1MCSA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
total genus 38
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcsA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcsA02
3ARGD 1NJ9B 4MSWA 4LP4A 4BQ6A 1IQWL 4MNQD 5DR5L 5E5MA 1BQHG 1TCMA 4F2MA 1WT5A 3QI9A 3TO4B 3QZWG 2A74A 2LE9A 2PN5A 1INEL 1ZT1B 5LAXB 1A6UL 4Y19A 4POUB 4U7MA 1EA9C 8FABA 2I60L 2OZ4H 5D7SL 3TYGL 3IAPA 2NY3B 4BUHA 1BWWA 1OQXA 3EDFA 3ZYJA 3BHBB 4HCRL 2FJFB 3GNMH 4L3CA 2YMXH 3DX9A 4P9MH 5E5MB 1CK0L 1D5XA 1OPGL 5EZJA 3Q1SH 4ZFOB 3TBVB 3L3IB 1AR1D 1S7XA 4J3XA 1OP5H 5EU6B 2L7JA 4Y2OA 3K74B 3RU8L 1F3JB 3DBXB 5D2LB 3WFZA 4WW1B 3PQYE 4Z7WF 5J12B 1U8MB 3HPLB 1AGBA 1A9BA 2ZSWB 1LEGA 5ILTL 2O26U 2R2EB 5T5NF 2P45B 2R8SH 1FYTE 1R3IL 1B0GB 2V2WB 4EI5C 1BD2B 1NBYA 5DD3H 3ETBF 4TUKL 3ZTJH 3ARPA 1MCWW 5AWNL 5J4MA 4N0UE 1HNGA 5L8KB 2R15A 5JW4M 5DD5H 5FOBA 3AAZA 1T04A 1Y0LA 3RGVA 1ZVSA 2YK1H 3OKOA 4CMHC 1A7PL 4YAQA 5LQBH 4X7FC 1UJ3A 3V4PL 5FA4A 3LOWA 3U6RA 3IXAA 4ODSH 4LAQH 1YZZA 1CLZH 3SDDD 2D4DA 2NXZB 4D9QD 1FN4A 4ZS7L 3MREB 1FRGL 3RDTB 5E5UB 1EGJA 2NY0D 1L7IH 1TVBB 4NZJA 2ZUTA 4LSDA 3BKCH 3RVWC 4YK4B 2ID5A 5FFLA 2FJHB 1YPZA 3TM6A 2YD3A 1YQ2A 3PDDA 5JZ7C 2IG2L 5JW3L 5KAQF 1J87A 3NFNA 4FFYL 3PWVB 3DYMA 4NO0D 2Z8WC 4NM8L 4NHCH 1OCWH 4ZUVB 4ACPA 4QNPE 4HJGA 4RFNC 4Y4HB 1FE8H 5IW6B 4I0PD 3MC0A 5F71A 1XCQB 3FHAA 3IFOB 1K8IB 3WL9B 4MDJB 2ARJB 5CD3B 2ZUVA 3MV11 1NCAL 4LDOB 4MJIE 3MPCA 2V6HA 4ONFH 4GKZB 2GKIA 3CU7A 3VXPA 2Q7YA 5DLMH 3VI4F 1T80A 3IDNA 3UPAA 3MR9B 1QSZA 1SBSH 3LKOA 4IBLT 5ICXA 5SWSA 4PP1D 5F6IB 1NJ9A 5F9JB 3MGOB 4HT1L 3GB7A 5HDOA 4LASL 4MB5A 2P5WA 1UKSA 3FQXA 3TCLA 4NJAH 2BY1A 4EN3B 4ERSH 3SDDA 5KSAD 5BVJA 3P77A 5GS0C 2DQJH 3D39E 1N6QH 2B7DT 1XF2B 1TZGL 3WHXA 3BHBA 4ETQB 5TE7L 3UBXB 4LSUL 1K5NA 2FX7H 4XP9H 3UZQA 2NY7H 3TJHC 1H15B 4ORZC 4ZUSA 1BFVH 2X40A 4HEPG 1N2RB 3LHPH 3R06A 4KAQH 3TBWB 5IBUB 1JF1B 1TZGH 2V7HB 4Q58C 1B9ZA 3QCVL 2ZSVA 4XNUL 2PTTB 5CJOL 1DQJA 3TIDA 3DSNA 2R2CA 2WIIB 1JMXA 1DBML 2ADFH 1U91A 3OKDA 2AQ1A 2BRQA 1YMMB 4NRYA 1AGFA 1T5WB 1QG3A 4EXPX 1ND0B 2WP3T 3AY4C 3VFVA 2X4SA 4G3YL 1Q0YH 1YDPB 4GMSH 4KJQD 1E4XH 3FRPA 2CKBB 1P4IL 5A2LH 2GAZA 4M4RA 1BHGA 5L2JB 3M8OL 3T04D 5EN2A 2ICWI 3HZKB 5C8JA 1YYML 5ERWB 5E4IA 1H3GA 4Q0XH 3TC9A 5ALBL 5E99L 4EN3D 5D1ZA 4DUWA 4HUUB 5KVGH 1FE8L 1LEIB 2YA2A 1T22B 4MWFA 4FG6D 4OKVA 4QHUB 4NHCL 4YPGB 5T3XH 2M2DA 4FFYH 3O3BA 5A3IC 1EAJA 2D0GA 1NUNB 4Y5YA 2JELH 4F7CA 4P99A 4Y5XA 5TQ0H 3UBXG 1QO3A 2EYSA 5EBGA 4XNYH 3MJ9A 1OAQH 3F5WA 4P9HH 2NZIA 1NC4D 2MCG1 1UWXK 4AEHL 4PJAB 5L2KA 3EHBD 1B0RA 3DGCR 4GLRI 4LHUD 4R97B 4MA1B 4QRPA 4FOMA 4GS7B 4R7NB 3BD5A 3N85L 2E6JA 5CCKH 2G75A 1OWRM 5SX4H 2X89A 3KNBB 3GO1H 4YPGA 3NPSC 3IDYB 4X0KB 1MRFL 4Y4FC 4WEUD 4PRPB 3WIHL 3G6JE 3L3OA 2A73A 2DMCA 3DRQB 3NTCL 4MQ7B 2P5WE 4EQ3A 4GKSB 4ZTPL 3UJJH 1ZOXA 4BSJA 5BW7A 4EBQL 5D5MF 4JKWA 3C60B 3O6FB 1YUHA 4HGWA 1CK0H 4Z7WE 3HI5H 5E6IC 3MRGB 4K94C 1JGUH 4ZOCA 4LCWD 3V5KA 2PKDA 1X4ZA 4OCWL 1QFWM 3LS4L 3L3KA 4XVSL 3BKMH 1QSEA 3ECBB 3GRWA 1AGCA 5HHOE 1CE1L 4UNVA 3O6KH 1K3IA 4U1JA 2ENYA 4RMRA 5HGBA 4PJDB 4L4JA 2MKLC 5DQ9B 3Q0HA 2J4WL 4ZXBD 5C0BD 5IB1A 4Q6IA 4GMTL 5GSVA 2GCYA 5EU5B 2HFFB 1RV6X 5DK2B 5MI0B 1UWEL 1M7IB 4UAOC 4H20H 4D0BA 5DK3A 1IGJB 1EFQA 4ALAL 5GGTH 1HEZB 2XWJA 2HKFH 4LSQL 3G6DH 1N3NA 2L4OA 1UM6L 5JIKA 3ZHLA 1T03L 3QHZL 2HRLA 3L5XH 1KV3A 3RTQC 2EIEA 5DJCA 4MZ3A 3DJ9A 4AEFA 2FECI 3J8F7 4HHAA 4LRIA 1FV1B 3SQOL 3U4BH 5C0EB 1GCFA 2J8HA 1MHPL 5C2UB 2EC8A 5LGJB 1JGDB 1KJ2L 1JIBA 5C0RL 1QA9A 2B0SH 4OLYL 4PJ7F 4Q9BA 5EBMB 3MRIA 3R0NA 4Z76B 1NGWB 3BXNB 4LFHD 5IESL 4J2XA 5J13B 2GJZB 5EUOE 5HGDA 5I18H 4Y4HD 3QEQD 5E9DA 3DGGA 4KVNH 4X5XA 5I73B 2XN9D 2FLRT 1CFTA 3LRSB 2X1WL 4WWKD 2EC9U 1QLFB 3T1FA 1LO3L 2F5AL 1RK0A 2YPLB 1KXVC 2HRPH 2ICES 3B5HA 3BZ4B 1QLEL 2APBA 4MQ7A 4U7KA 3PV6A 1NFIA 2IH1A 4LLDA 5FYJH 3NIFF 5GZOD 4GKNB 1FNEA 2R2BA 1CGVA 2C3HA 3VMOA 4KPHH 1SMAA 3BDXA 3DPBA 3MACH 3SDCB 4K3JH 5IVZA 2FR4B 1NEZA 1JUFA 3DUSA 3VWJD 4NRXA 1CE6B 3KPLA 3T4YB 3CFCL 5I16A 4M5YH 5FGCE 5E9DD 1ZSDA 2P5ED 4LPYA 1VPOL 2WINB 4HAFA 5GGRA 3U30C 1Q38A 5DJ2A 3LRSA 3T1FB 4F7EA 3SE3C 1ORQA 2NLJA 2BDNH 1QLEH 4HWZA 2RCSH 3WO3B 1CXLA 1E28A 3EJYC 4RGNE 3SKNA 3KJ6L 4GG6E 2CDEA 5SV4A 4M1DH 4ZXBA 5HBBA 3B3IA 1SEQH 3VD7A 5DHVH 2F54E 4XX1E 5F7YC 3IU4H 2AXFA 4PJEF 2WUBH 5IW3A 5FOBB 5HHQA 1W0VA 3HAEH 1KCUH 3B5TA 2YC1A 5JUEH 1RZGB 4PLJD 4NQCB 2DQHH 3AROA 3PJSB 3TZVB 1EHAA 5HHXL 1EDQA 4I2XE 3WUWA 4OF6A 4RMUA 3U4BL 3OKYA 4R96B 3V4UL 1L0YA 2FGZA 2A6DB 3TV3H 3I2CH 3LKNA 2EZ0D 1HEZA 3KYNB 3HZYA 3I3DA 1U41A 1XF4A 4JY5L 4KGJA 3G6DL 3DMMD 3DUHA 2BSSA 3WMSA 1JN6B 4L29A 1U3HB 3MRQB 3T3MF 3ALWA 3QXAB 5B4MC 4RZCB 5FYJE 1CXEA 5IVOA 3U4AA 1UFUA 3OSKA 1WSST 1FDLH 2CGRL 5ICYB 2NR6C 4KKLD 1LO2H 5GS2D 2PYED 3RVXC 1OSPH 4JANB 4Z0BH 4ZAKB 2EDTA 3O9WA 5I2IB 3TO4C 3CJJA 3FOMA 1KIPB 5E6IA 1V8HA 5DMKA 2NY3C 5AAWA 2I26N 3SKJL 1UB6B 1NUFA 4LLVB 1CLOH 4UB0H 4C83A 1P4BH 1FGVH 1YPZF 4PRPA 1K8DA 1V7MH 2BZDA 4B5EA 5EO0B 3GM8A 5TE4H 3QQ3B 1MUJB 3CMOH 2QV2A 4BQCA 4NYLB 4BFEA 4G6JL 3RA7H 3TBYA 4EI5B 2X4PB 4NO5A 1FGNL 3PWJA 3KGRA 1ZWIA 5D72L 4YWGH 4PRID 2AJSH 3SO3B 1LDSA 1V3JA 5K9OB 1J7VR 2BC4A 1RUPL 1EEZB 4R90L 5C92A 1T3FB 1UEMA 4OGZA 2EEDA 3OV6A 1BMGA 3BDBA 3EJZD 3RDTC 2UZIL 5EFIB 4JY4A 4NCC2 5C6TL 4YK4C 4CVXB 4TUJB 4P48A 4Z7NF 4EOWH 1Q8MA 2QTEA 3ESUF 1S7QA 4PD4J 3RUGA 5FO7A 5IROA 4PLNC 1F90H 2R2EA 4NNXA 4LRNH 3MJ8A 3WFHB 1O5DT 1LNUB 3QEUB 4B53A 4IHOB 4PJEB 3HRZB 2BSRB 3KPOA 1J8HD 5EFIA 1A4JA 1A7BA 4L8BA 2VLRA 1IGIL 4CMMA 1SHMA 5E8EA 3V0WL 5GJTL 4PJGB 5J1AA 3O0RH 1NCUA 1YYMH 1MVUA 2WWMD 2UY6A 3VXTA 3JTSA 1WFTA 3M8OH 2YK1L 4XCEB 3BZFB 1QLFA 1M6OB 1F11B 4JHZA 2DDQL 4S1RH 1G6RB 1WIOA 2QSCL 4F37K 4GMSL 3B6SA 3MCG1 4O51B 5JNYB 1VACB 1Z9OA 5ITBL 1FQ9C 4LCCC 1OAXL 2GTWB 3K2MC 4I3RL 1I8MA 5DO2D 4OQ1A 3RWIB 1GZQA 1X7QB 1E6JL 4KKCD 1N64L 1J1XL 2CO7B 1SY6L 1MVFA 1ONQB 2JK5B 3VXNB 3ZKMD 2VUYA 4N8PA 3VMPA 3N1GC 3LD8B 4GRMA 1CL7L 3U0TB 1B3JA 3QP3A 3SJVB 4X5WB 1U6AL 4LF3A 4G80A 5DDHA 3GMNB 1CFSB 4HUWB 2I60H 3TYGH 3ZMRA 1FCCA 1G7QA 2VISB 1XF4B 1KBGL 3GZKA 3GJFA 5F3BB 5AYUH 4PJXE 4JO1L 3GI8L 4W6XB 4X98B 4XP9L 2FWOB 5MEPB 3SGKC 2JB6B 2YD9A 4L4VB 4TNVK 1VEPA 4OI8A 1KNOB 1FNSH 3KYKL 2J8OA 5CS7A 5FA3B 4ONGH 5EO1B 3U9UA 5F7DB 1X7QA 2W0PA 1P5VA 4U1NB 2Z91B 4Z7OE 1XF5A 2Z0BA 1J12A 3JV5A 4PY8J 2VDKH 4GQ9H 1OAKH 1T1WB 3EOAB 2A9ML 4RGND 4JO2L 1HILB 1UM5H 4GBXA 1DQML 3CAFA 3GSXA 5D7KE 1WUNT 3PF2A 4FP8H 3D18B 5B39G 2QSCH 1FAKT 4YDKH 3QA3A 5K9JL 5FYJU 1HIMH 1ZVYA 3KPQB 5TH2B 1NGYA 1BQLL 1WCBA 3C60A 3EDJA 3QFJD 1CDYA 3RI5F 3PNWA 2BSRA 2EIDA 5BXFA 1LNUA 3C5JB 2FNBA 3QEUA 4WI6A 5HI4C 4XMKL 1MSPA 4RAUB 4EEEA 1J10A 1INDH 3QZWB 1QR1B 2JJVA 3GSUA 2VXSH 2CJUH 1KB5H 2VC2H 4K3DL 4WCYL 5BMFH 4JKPH 1RI8A 1HOCB 3BP6B 1AD0A 1DUYB 4ONHA 3MV8E 5EUOF 4V1DD 5SV3A 1NMCB 1D9KA 5GRVK 5C0GB 3QUXB 3OB0H 5E94A 4F7TA 4H8WH 5KN5A 4NKMB 1EZVX 4WW2C 3RGVC 1H8NA 5DO2C 5KS9E 1I85C 1MCEA 5DJDA 3QXDA 5E6ZA 3WFEL 1FO0B 2FO4A 3K1KC 4MD0B 2NX5D 4WHTA 2CUMA 2YPLD 1T0NB 4GS7C 1HI6A 4Y5YB 4PV9A 3CNKA 1Z6JT 4Y0GA 1LMKA 4IOIA 5DJYB 4NOBA 3NPSB 4Y4FB 1AP2B 2DQCH 3HZVA 1I1AD 4PJ9B 3AU1B 4O2EA 3RA7L 2R8SL 3SGEH 3CDYA 4LBEB 4F7PA 4NC0B 4HD9A 3CMOL 4NQEE 1V05A 1F45A 4PIRF 4PRDA 5KBNC 2ICWA 3C60C 4MA3A 3S37X 5E6IB 2DD8L 3H9SE 1E6OL 4Y4KC 1OTUC 1R3JB 3KR3L 5D1ZD 3L3JA 2A6IB 2VZ1A 5CGYC 2HT3D 3MRIB 4HXAL 1CVRA 1LO4H 1FVDA 5DHVA 4HLZG 2XZQL 5D1QD 2NNAB 4KK9D 2DLEA 2XKUA 2NY4D 1JGVH 1I7RB 1M05B 1ZHLA 3TN0D 1CXIA 3K3QA 2F53A 2VJXA 4OAWA 2QL1A 5C0AD 4H0IA 3FFCB 3QIBC 1KCSL 4EXKA 4H1LB 1V3LA 3TWCH 3VI4E 3CFJA 4I0PC 1KN2H 2BRRL 5SWZB 2V17L 4U0RB 1GPOL 2YKLL 5JTWA 3HKFA 4X83A 1Z9LA 2E6PA 2AJVL 2J5LB 4A6YA 3CZFB 1GHFH 5C08D 2G5BB 1BD2D 1H15A 2AEIT 3SY0B 5EU4B 3BE1L 4HXBL 5K59E 3PWLB 1KN4H 5F3BA 5I17B 3IDJA 4MXVE 5IK3B 5T33L 3FQUA 2BVUA 3QG6A 3WUWB 2AJYL 5TDNA 2A2QT 2FX9L 4R4ND 4QNPF 5FKAB 4PLOB 1A3LL 1U92A 3QNZB 2OK0L 1NMBL 5JORA 5CBAB 3MOAH 3VDAA 5I66A 4WNQA 4UIKH 4APQB 4EI6B 1RZ7H 2FATL 2NY3D 5DD0H 1P1ZB 1R5VA 5C6WH 3QDMD 3M17B 4F33A 4MNHB 5ICZA 2JJWA 1P7HL 4YR6A 4GAGH 1YY9C 5J13C 5GIRB 2A6KA 2BVPB 4KI5E 4D0CA 5ISZD 1TETH 3CDFA 2HH0H 5ADPH 2A77H 2GTZB 3OJMB 2HWZH 5E94B 1EHNA 1D6VL 2XA3A 3MLTB 4JN1H 4M5ZH 1G7PA 4L1DA 1OAYL 1U8IA 2EDHA 1KTLB 3KLHC 2VABB 3M45A 4OQTH 2DICA 1NC2A 3FZUC 4CMMB 3QDGA 3ARED 2IALB 3TPUA 3T1WA 3OKNB 3ZT5A 3DWTA 5GGRY 1RJLA 4KRPD 4HMCA 3MNWB 4JZJB 2XT1B 3SDCC 2C7UB 4IS6A 1S3KL 2X4OB 5GSRA 1MQKH 1YEIH 1KTLA 5IHZB 3WXWH 2VXUL 1MFNA 2QKIB 3G5XB 2B2XH 3D0VB 4ZD3L 3RDTA 5JDJA 4HUXA 5D7IF 1I1FB 3SQBA 4ZD3H 4PJCA 3V8OA 4NO3B 4MCZA 3MV9A 3QA3B 1IAKB 1Y18A 5EOCH 4LNRB 1BEYL 3EZJB 1DUZB 4CN6A 1A1OA 4QHNB 5FO9A 5J06A 4UIMA 4Z5RA 2XA8H 5KANI 1TQCB 5DXWA 1RIHL 3B2UC 3MRFA 3TWCL 5L88L 4O2CA 2XIDA 2Z31C 4YHPB 4I18B 5DMGC 1F2QA 2N56A 3JSSA 3C5SA 3QDGE 1EUTA 3FMGH 1WISA 2NCMA 3QDHA 3DBXA 5D9SB 4GXVH 2C5DC 4YNYB 4OD2A 3ALXA 1ZGLA 3MNZA 2WNGA 1BZ7B 1D5BB 1HQRB 1MWAA 4MD5A 4ODUA 3B2VL 4DJMA 4NBYB 1FO0L 5J9PB 1ZV5A 3U82B 4JPKL 2XZAH 5FUOH 4FRWA 4OZGA 4QO1A 1NGZB 3ZE0F 1RPQA 2ICEA 5EZLB 3BJLA 4Y1AD 1GSMA 3QFDB 4UILH 5I6XB 1R0AH 3D85B 3HMXL 5KSBF 4TNWF 2NW3B 4PGZA 4Y8AA 3FQXB 4MAYC 1QSFE 1TDQA 1I7RA 1M05A 1N5AB 3HMXA 3IGAA 1KCLA 1KTRL 4U1JB 2WSKA 4Y1AE 2WK2A 3T3PF 1G7IB 4TPRH 1MLBA 3U0PB 5DD1L 4JZOA 1CBVH 2ADGB 5CIPA 1RUAL 2FEEL 2FYYB 2DQDL 5C0AB 1W2KT 1BFOA 3PP3K 5HYSG 5EU3A 1KEMH 4AZ8A 2WQ8A 2VITA 5FO8A 4OCWH 2AJVH 1XH3B 7CGTA 4K2UL 4X5WA 3H7LA 3RGHA 4P4RA 1BQHB 2CIKB 2X4UB 3IU3B 2QHRL 3N9GH 2Y1VA 1U0QA 3HZVB 1A4JB 2OX5A 5CJQL 3FAWA 2E7CA 4ZUVA 3FONA 1F3DJ 4N0CD 5D93B 5C09D 1CQYA 5DTFA 5ID1B 1RZKC 4P3WA 4K8RC 2WWMC 1JPSL 5BV7H 1J0HA 3DROB 2Q7YB 2ZJSH 3MXVL 1XR8A 1U3YA 3MA9H 3QNXA 4BUGA 4ZFZA 3O4LE 1OLLA 4WTWA 3C6LA 4GKZA 2O5YH 5A43C 5IW1B 4JGUA 4G6AC 2DWEA 4JFYB 4MCZB 4XI5D 1MCBA 2C3VA 4QGTA 1TFHA 2Z92A 4YDKL 1D3CA 4P5TD 4QHMA 4KHXL 1Y0LB 1GGCL 1CICC 5TQ0L 5EU6E 1FBIL 5KVMC 4PBVC 3S7GA 3D3VB 2D2OA 1FFOA 4JDTH 1WLHA 3KXFA 4KQ4H 5DMJB 1IKFH 4WO4D 4JRYD 5ID1A 1WTGT 3PABA 4P59L 2CLZA 4BFIB 5J89A 2G60H 1MFEL 2VLLB 1U8JB 1LHZA 2PXYB 3BOVA 5ID0A 3B9KD 3K80A 3KYKH 2IPKB 4YPJA 1T3FA 3EYFB 1VKXB 4I0KA 4YHMH 5LJYH 1G7LB 1QSEE 2H8PA 5F1OB 4Y2DD 5D5MB 3IS1X 1NPUA 3UJTL 3GSWB 1XIWC 3FT3B 4R4BA 4KTEH 1JNNH 1ETZB 1ZT1A 1F6AA 3BPOC 2FEEI 1H3WM 2A6JA 4HPOL 3QI9C 3G9AB 2CKBL 4LIQH 2VXSL 2EZ0C 3BMVA 1Q9LA 1YEDA 3HLAA 1INDL 2CH8A 4JANA 2NY1B 4ODBD 5EO9A 4KWUA 2ED7A 1BWMA 1P4LA 1UWGH 3OHXA 4GAJH 1IKNA 5SX5H 4H0GA 1IQDB 5BS0A 1I3VA 1QZ1A 4HKZB 2VQ1B 5T1LA 4RGNB 3MROB 3ROOB 3Q48A 3OL2A 3U4EA 1K6QL 1KIRB 1BQHA 4K3GA 3LD8C 1A64A 1S7SA 2R9HC 4X4YB 5M94B 2VDOL 3EYOB 1Q9LB 1KCVL 1FZKA 4E41E 4WI5A 5TGBB 5TFSH 3LN4A 3OJDA 2ESVB 4RQQA 4WI3A 3SKOB 2DQFA 5BO1L 4G43A 2W65B 3SE8H 2R1XB 1UZ8B 3O9WD 3QO0A 4EN3A 4PV8B 3MROA 3FO1A 3GHEH 4RMTA 4GRLD 1AGDA 4OBRA 3V0WH 5JDSA 5FM4A 1MFCH 5MEND 4L5FH 3MGTA 4ZODA 1AHWC 5IVNA 3FOLB 3MLZL 1YJDL 3AMKA 4GW5B 1YJDH 3TH2T 4ONGL 3LV3A 4UDTB 3QAZC 5F1KC 3ZKXC 3T08A 5ICYA 5CKGA 4O2CB 4A2LA 3ARYA 2NX5B 3VFSA 5C0NC 1IKFL 1AXTL 4J4PD 3RWFA 4X9GA 1HYSD 4KQ4L 4P5TA 2OL3B 3SE8L 1LD9A 5AYUL 3HFMH 5C0ND 1OW0C 3MUGB 1NH6A 2XTJC 4JFOB 3MV01 2QQNL 3CH8A 1DEEA 5C70A 4LQFL 3FB8A 3RVXD 3O8XA 3C5ZD 3C09B 1J1OL 1XIWD 2VLLA 2YSSA 2R0KL 1IAOA 4M7JL 4XPAH 3O3DA 1H3PL 2J88H 3RZCC 4JPVL 4U3HA 4NQDB 4MGXA 1YECL 3L3OB 5T5FL 3RZCD 1HZHH 1Z2KA 1A6TA 4G7VL 5IFHL 2AK1H 2AXJA 2X4QB 4QXTA 3WIFA 1DUZA 3GMQA 3UJTH 2UVEA 2P46B 2O5XL 4BFGA 3ZO0A 3BKCL 1KACB 4OCYL 5IW1A 3IXAB 1QQDB 3T65A 5BJTA 3VW3L 3QUXC 4QRPD 1QRNA 5FIEA 3VXRD 4WW2B 5INDB 1CGTA 3AAZB 4HAGA 1T1ZA 1AC6A 5I1DA 1KYOK 3U0WH 1R6VA 3GMQB 3VG0L 4OZIF 1SYVA 5T1DL 4Y5YC 4BSVB 4U1SA 4NZRL 1PDKA 2VN4A 5E8NB 1KJVB 3WNNA 2VWEE 3MRPA 5TDOA 4M1CC 4HKBA 4QWWC 4Q9RL 4JVPA 1CDHA 3D2UB 3IGAB 4OLXH 1EX0A 3EJYD 1Q94B 1QPPA 1QR4A 4QYOB 3TIEA 2JIXB 1SEBA 2Z35A 4K94H 4UTAL 3AS3A 3TESA 1Y6NR 1Z9SA 2HKHL 5EU3B 4O2FB 4BM7A 4KUZL 1RIVH 3FB6B 4ODTH 2F58L 4WO4C 1IGFL 3SJVD 2AV1A 4ORGA 5I8KH 4HCRH 3L95A 3I6KA 3OB8A 4OFIA 1QFWL 4NNPH 2NY5C 2OZ4A 3UYRL 1ZXQA 3K8KA 1BF2A 3W2DL 1PKQB 3QG7H 4GBXC 3ZKNC 1QFUL 4WFGE 4FABL 4GG8B 3QIBB 1I1AB 1Q94A 1KCUL 2EEAA 3DIFB 4YHPA 4I0PB 4WHYG 1J0IA 1MI5B 2Q3AA 4OBSA 4WI9A 5CSZB 4JFFE 4TQEH 4P59H 4Z5RB 3SGKA 1HHHA 1DLHB 1UC6A 3G5ZB 4AENB 3GI9H 4KK5D 1MLCA 1PYWA 1YNKH 4WFGD 3PDOA 4U2YA 3O3EA 4GJTB 5L0QB 1LP9E 35C8L 4H1LG 1CFSA 3T8XB 3GBMH 4HWEL 5JQ6L 1XF2A 1UA6H 4OZ4A 5IBLD 2EDYA 3G5XA 4J3UA 3RL2A 1FZMB 3ILPA 3QPQC 1IGTA 4W81A 1LK2A 3H6JA 4G9FB 5FM8A 5KSBA 2IBZX 3EAKA 4D9RD 5JMOC 1HK6A 2FD6L 1QSFA 2ZOKA 3EZ8A 5CP3H 4YJZL 5FGRA 1WCQA 2A0LD 3WO4B 4JKLA 1IT9H 4N0UA 3MR9A 4O9HL 5L7XH 3F12A 1I9RL 3ZDYF 3BZEB 4D2NA 1DANT 5HVGB 1S5IH 2IFGA 1KJMB 5JOPD 1D5ZA 2H9GB 4KTEL 3CFBB 3FQRA 1FPTL 3PG2A 5K59F 2HH0L 2Q76A 5ADPL 1G7LA 2GSGB 1AFVH 4X6DF 3ES6A 5D71L 1OB1A 3MZTA 1I9RH 1UQSB 5B21A 5CHNB 1X5LA 3E0GA 4Y4FA 4MNHA 4DAGH 5FGBC 1JHLH 3EYVA 3GBLA 4OLYH 4XBEL 3TNMB 4JZJC 1VENA 2WUBL 1LEIA 3IDIA 5J6GB 4D9LH 2ATPB 2F54A 3H3KA 1W0YT 4XRCA 4IIQB 4JQVA 4JLRB 3VCLA 5T1MB 1CFNA 4J3SA 3IJHA 1I3UA 4POZD 4QRSA 3HC0A 5GRWA 5BOPA 1OP3K 3N1QC 4U1GB 2Q8AH 1NCBH 1KEGL 3P0YH 3OR7B 5BJTB 2SEBB 3QQ9D 1BJMA 2E9IA 3MREA 3MUJA 4IMLB 3ARQA 5JW4R 3EOTH 2JJSA 32C2B 4RA3A 4I77H 4MQSB 4XP5L 5HHNA 1RD6A 4EJ1C 4G7YL 4HWBL 4PRAB 3UXFA 4M03A 2CUIA 2GHWB 3F7YA 3ULUD 4YXKH 1F6LL 5I76B 4M48L 4HIJB 5E7FA 5DJCB 4JREB 4YDVA 5JOFA 3U9UB 3BVNA 1RHHB 5FA3A 2VERN 1KPRB 4TSBH 5I74B 1MF2H 3W2DH 3QT2A 2FWOA 5MEPA 2Q7NA 2Z93A 4HKXB 2B1HL 5JHDE 3WCYA 3ULUF 3LQMA 4HWBH 4JFOA 1WIUA 3RZWA 3PWNB 4UQ3B 3UBXA 1SBBA 4YEEA 1VB9A 5D2NE 1NL0H 2GK2A 4QRUB 3TEUA 3CCHB 2PR4L 3V7AE 1MCCA 1KEML 4JFHD 3V6OE 1CDJA 3P77B 1DDHA 5HYQB 1ZTXL 3HG1E 5EOCL 4EUPG 4U1KA 5EOCJ 1HHJB 3VXNA 4MAYB 3EYFA 2Y6SC 1CFVH 4JG1H 2ZSVB 2EE3A 3WFCH 1EAPA 4FS0A 4E41D 4HH8A 3RAJH 2J1KA 4NPYB 1LK3L 5LWYH 1MCOL 1N2RA 3MRBA 1GOHA 35C8H 2CLZB 4WFHE 1BIIB 5IQ9B 1ZTXH 2NY6D 3S4SG 2P8PB 3L7FB 3VDCA 5CEXA 2PXYD 4KK9C 1GAFL 5MEOB 4M61A 1FZKB 5DK0A 4TVPD 1MWAB 4TRPH 4XNYL 4O02H 4OLZL 4OQTL 3VWJA 4XWGL 2R0WH 4LOUD 1D9KB 4CW1B 5DJ8B 3BKJH 4B41A 1J1PH 1VFBB 1TXKA 5E24E 4WW2F 1HHGA 3QNYB 1EJOH 5J12C 3HRZA 2LU4A 4IDLA 4W68A 5D93C 3GMRB 1V3MA 3OXRB 4DWHA 5ECJE 4WHTB 2DQIL 1YEDB 1VESA 1YMME 5HI5D 3A6BH 4WWID 3UYRH 3DO7B 4HKJA 3OXSB 4JCLA 5BZWA 4NWTL 3ULVL 3ALPA 2PYEE 1F6AB 1GYAA 3VU2A 3QHFH 4ODTL 3BZFA 5DUBB 3OGCA 1NBVH 1JGEA 2VKXA 3PNWB 1BQLH 4PJXF 2O5ZH 5K9KB 4IMLA 4LLQA 3IVKB 2XZCH 1MHHA 3MUY1 4QOKD 5EC2A 2W60A 4RNRB 2YD1A 3KS0H 1CICB 2BNUB 5CGYD 4ZO8A 2RHEA 5DA0B 4PP1C 3NH7H 3RPIA 3DROA 1HHIA 1SY6A 5FXCH 3SDXF 2H3NA 1OAKL 4UUJA 1ZS8B 3WXWL 4D3CL 1IC5H 2Q3ZA 3AXLA 2JTDA 1U8KB 2FR4A 1JWMB 4LSTH 5T1DH 2P1YA 3VRJA 5FB8B 1PY9A 5F7DA 1MFCL 1SMOA 3ARBD 5I1KL 1ZANH 4ZPVB 5FCUL 1T4KB 3LMJH 4U3CA 2BC4B 2GITA 4ESKA 2VYRE 4PRNA 3S5LB 4X6BA 1JFQH 1FL3A 2O5XH 3L3DA 1OLZA 1J8HB 1UJ3C 4J23A 4J8RA 1KUMA 2AK4A 5F21B 1DL7L 1FYTB 3BPOB 4HEME 5IB2A 1ZWIB 3TF7C 3RP1A 3QI9B 1VGEL 5LBSH 2VDRH 4MVBC 1OGAB 1BBDL 3T4AB 2I24N 3MJ7A 1C16B 2Z8VC 1KB9K 4EI5A 1MIMH 3D25B 4OTXH 5KVEL 3G6JB 5C0IB 1YC8A 4HT1H 3FT4A 4G9FA 1K8DB 4U6TA 1RHHA 1DR9A 4MLIA 4RGNC 4WGVB 3MX0A 1MHCB 1BBDH 4I18A 4LCUA 2DQCL 3MJ7B 1P69B 2VZTA 4M8QB 5K93A 4FXGB 4V1DE 3FQUB 3QUKB 4ETQA 4P2RA 4QRTA 3SO5A 1N26A 3T3PE 4NKOA 4YDLB 4ONFL 2OXHA 1AO7B 1MJJA 2VWEC 1BZ7A 1JV5A 1ZGLB 1LE9A 3CZFA 4R96A 4OZIE 3QISA 3AM8C 5HY9B 2AABL 1JNHB 2IADA 5CIPH 1EBPA 4DQOL 3KVQA 2X4TB 4IJ3C 1S5HA 1BM3L 4XNUH 2V5RA 3MUZ1 4NDMA 3WFDL 3CH1A 4L5FL 1VSCA 1CR9L 3PHOB 5KTEH 4FQQB 3IDMB 5JW3H 4JGMA 1XT5A 1XGUA 3HMWL 4LDLB 4JM2F 1W0WA 3U7YL 1KB5L 2C7UA 2I5YL 1IZKA 1IM3B 3FN0H 1JJUA 1FRGH 1JTOA 3WL9A 3GM0A 4ODWA 4ZO6A 1MHHB 2QBWA 5IBTH 3FQTA 4LLQB 3O2VL 4ZAKD 4OCXL 3ZE2F 4WFED 4Z9KB 4PRIA 1IMHC 5KOMC 3C09C 1J86A 1J05A 2KZWA 1FNHA 4NWTH 1CLYL 5E8DL 4MJ5A 4OCSL 4I3RH 1XGYH 5F8RC 4RWYL 4NO5B 5JXAH 2I9LA 1U8NA 2VKWA 3CSYB 4NZUL 2VB5A 4X80H 1S7TB 4DZ8A 3MV7D 2DI8A 3QQ3A 2AGJL 5B38B 1JFQL 2D7TL 4P2QD 1MWAL 1A5FL 1P7KB 4XBPA 1EIBA 4OV5B 1CI5A 1FFPA 3DARA 1J0YA 1KC5H 2AABH 5C0CE 4KRNA 1S7RA 2DQTL 2NY0B 3DRTB 5MEOA 1SJEA 3MBEA 4LPVA 1UM4H 5FHAH 4LRNL 1Z0NA 3DV6B 2XY1A 3GI8H 3GSQB 3VFMA 5EU4A 2J6EH 5BO1H 4QXTB 4DZBB 4Z7VB 3C9NB 4Z0BL 1PJ9A 1B0WA 1G7IA 2GT9A 3GGWA 2UWEB 3VFGH 4PRHB 4HJ0D 3DVNB 5IGXL 1T20A 4Q6YA 1I7TB 4PGEA 3CXHJ 1AI1H 1JVKA 4JFEB 3QNZA 1KCRH 1YECH 3GSRA 3G6JF 1ZT4B 3B5GA 2R0KH 2XFXB 5AUMA 2YD5A 2FH6A 1X5JA 4XNXH 3VFRA 4UV7H 2X4TA 5IB3B 5JPMA 2I27N 2BY3A 1T0PB 3L6FA 2BJML 4U6HA 4P46D 5ICZB 3P0VL 3I2CL 5B38G 5K9JH 3PIQB 1CS6A 1PY4A 2NPLX 3UPRA 3UZEA 5ETUB 4G6JH 2ICWB 5F3HA 3VFSB 3GMPA 3ARFA 2D3VA 3DI3B 4UV4H 1BQUA 5KTEL 1U8HA 4JFEA 4P2QA 5L88H 1OQOA 4PGJA 4OLZH 4WFHD 3DVGA 5I8EA 4N5UA 3HZYB 2OS7A 3DX7A 4Z7UA 5K9QG 3CVHA 4G8IA 4YIQB 4DKAA 5B39A 3H3PH 3QIBD 1MAKA 1HWHB 3BD3A 2ESVA 5B4MD 4OT1L 5SWZA 5LWYL 5DVKA 3RTQB 5TFSL 1O7VA 4UINH 3ZYZA 3U46A 1CTOA 1I1AA 3CLFL 3PL6A 4XMPL 4M5YL 3LEXB 3JUYA 1AP2A 5D4QA 4P2CG 2O5YL 3V7MA 4LIQE 3KPRD 2ESVE 2Q1EA 3L1OL 2I25N 5A40E 3EJZC 4OTXL 3RDTD 2EXYC 3W82A 4HDIA 4LHQB 5IB4B 1NL0L 4FMFA 1VA9A 4PR5A 4P46A 3QRFM 5CZVL 1FYTA 1ORQB 1RUQH 2NLJB 1ZS8A 2QLVB 4AT6B 4YE4H 4I48A 4R4BB 2BVEA 1D6VH 1LO3H 2F5AH 1FL3B 4TSBL 1I9EA 4J7RA 4JE4B 4CADA 2H2SC 4UB0L 4RSVA 1UADC 1IEBA 3NVQA 2ITCA 3JVGA 4TRPL 3KPNB 4R26H 5ESVB 1PQZA 5ISZE 1RIHH 4LLAA 15C8H 1QR1A 4JFQA 4RDQF 5DD0L 1EGJL 5CAYB 5KW9H 4PJIA 4JGJA 4JFDE 4XP5H 4IIQC 4HS8L 5DD1H 1P6AB 2XI9A 2ZKHH 5F9DC 1RZFL 1F13A 2V9TA 1TTUA 3UTZB 4L3AA 2HT2D 1L9MA 3P73B 5HYJE 3X11B 4WHYH 5C0GA 2GJ6E 1HQ4B 2EICA 2Y36H 4JHWL 3WJLC 2HT4D 5FECA 2KUTA 1WFOA 1EJ6A 4JJHA 3BE1H 25C8L 1JGEB 1HKFA 1JV5B 3NACH 1WBXB 3DHMA 1HCVA 3H9SD 1ED3A 5E70A 3S4SA 2DM7A 2G5BA 2VSDA 4ZSOE 2KZ1B 3SDXE 2DQFB 4NRYB 3WS6C 2P5EA 1CGUA 3QUKA 3BP7A 4KPHL 1FFNA 3OX8B 5I1IH 3DIFA 2J4WH 1ZHNB 3RWFB 3BZDA 4JREC 2YN5A 3PHOA 4OZFA 1QSED 4U4BA 5DYOB 2E9BA 3CH1B 2JK5A 3ARBB 2W1NA 4HCRA 2HMID 1JTTA 3WFBL 1Z3GH 5I74C 3V52H 2CRIA 2P5EE 3LZFH 2IFFH 4WUUD 4B0MM 4LLYB 5E9DE 5I8KL 1P4BL 5JDSB 1P9MC 5FYKL 3ABZA 3RTQD 3WHXB 4PTUB 5E7BA 1U3HC 1AD9A 1JF5A 4IOFD 5KVFL 5E8PB 1I8KB 3HA0A 3SKMB 4PP2B 2CDFA 4NC1E 5D7LD 3MYZA 3TCLB 5IBUG 5FGCB 4UQ2B 5EC1A 3I6LD 4NP4L 3WHE1 1T4KA 4FZEL 2M1KA 2Z91A 3WNMA 1DVFA 1HXYB 1Q9KA 3QUMB 5BRZE 4MJIB 3VD9A 4IRJA 1T03H 4U1LA 5EIIA 2JB6A 3SDAD 5KS9F 1A6PA 4PV9B 1K85A 4UBDC 1YEFH 1S3KH 4LQ1A 4QHKJ 2R1XA 3MRJB 1EGJH 1H3VA 3MACL 5DEGA 4AEHH 1AO7D 4L8SA 5J9PA 1DBBL 4JFXA 1X5ZA 1UH3A 4JPKH 2Y72A 4IMKC 1M7DA 4MCYB 2BRRH 3WJJA 5HJ3A 5SWQA 3MA7B 1QQDA 3T65B 1IGYB 3FO2B 4YHLH 2HVJA 3AVEA 4EUPH 4AH2B 2F15A 4BZ1L 3GHBL 4FABH 5HD8C 4RGOH 3D39B 1W72A 4ZPVA 3H9HA 1WZ1H 4P3CL 4U1MA 4HK0B 5A2KH 4JFFB 1I1YB 3TYFB 2DBJA 1FVCB 4FZ8L 5CZVH 3N50A 3TA3A 3LKOB 3LSOA 4GAGL 4K23L 5GZOC 2GUOA 3K0WA 2ZCLL 4WY7H 2H26B 2WUCH 2DQHL 3D69B 3H0TA 2J88L 3PWJB 2A6JB 1I9IL 4NQDA 4AK1A 5AG8A 4URTB 1IC4H 3VG9B 3GSWA 2E9JA 5D5MA 3FONB 3SO3C 5BV7C 3NABL 2HKHH 4UIKL 3O8XB 1KLGA 1AKJD 1CD1B 1HHGB 3QNYA 4KDVA 1U8PB 1F3DH 4OB5L 2V9QA 1P4IH 2X4UA 4I9WD 1U42A 3NTCH 5T33H 1MFBL 3A6CL 5D7JB 2ITDB 2A0LC 1A6AB 3GUTA 1GOGA 3ZDZE 1UM5L 4HS3B 4KZDL 4G9DB 1OD9A 1XR9A 3FJTA 1DN2A 1AXTH 3WDJA 2E6QA 5DZLA 3I02B 3HE6C 3VXUE 1U8LB 3EYSH 3TIDB 1KB5A 3OKNA 1YYLL 2AJZB 4DAGL 4KAQL 4V2CB 1IL1B 2LV4A 4LLVA 1MCQA 1L0QA 4LNVA 5IJKC 2EE9A 4PV8A 3WS3B 1OARH 4P4RB 5DMKB 4JN1L 3NOIA 4EQ2A 2YBRA 5LAXA 2W91A 4QWWD 4AIZA 3VD3A 4A6YH 1PLGL 4Z7QE 4JKPL 4XC3H 5GIRA 5I2IA 4QCIB 5E03A 3QJFB 5DMYA 2P8LA 3CVHB 2ZOKB 4XWOD 3W81A 3ZKND 4QGYA 3DX6B 5LCVH 4LP5A 4JHBA 4ELKA 3ILQC 1F3JA 5D2LA 5EBLB 3C5SB 1NUDA 1FG2B 4J4PC 1L0XA 3VE0A 3JWOC 3D25A 1PZ5A 4HIJA 4LQFH 4XMPH 1LE5A 4Q9RH 3EO9L 4S1RL 2FJFA 3LN5B 1BD2E 3S34L 4GFTB 4NT6B 1UM6H 2OJZL 5ESAB 3BWAB 4YDLC 4AG4H 2P44B 4M3KB 1UM4L 4NQVB 4NQUA 2QEJA 3PWNA 4UQ3A 3IETB 3VXQA 2K1MA 2ZCHH 5IVXA 1HQRA 4RRPA 1KJ3H 4I5BB 4BQBA 5DRXB 3U1SL 3MYJB 1NMAH 5DJ2B 3QCVH 4LLUA 4LPWA 3RJQB 3Q5TA 3CD4A 3QFJB 2J6EA 4UV4L 4DOHB 5FO7B 2X4NA 1LO5B 5IFHH 4WEBL 3MOBH 4PRHA 5EORH 4Y16D 5ANME 1KT2A 1LO4L 1A6AA 4K55A 3GUTB 3BKML 1BJ1H 2VLME 3MRPB 1W8OA 2X70B 5IOPB 1JP5A 4RNRA 2P42B 1UQSA 1QEWB 4LAQL 2J8UE 2RIKA 5F1NB 3V6OC 1JZ2A 2YA0A 1OF2A 1C7TA 4PJDF 3X12A 2BVPA 2E7MA 4GW4B 3D2UA 3OXSA 1E4XL 4Z76A 4K8RH 5T1KB 4C59B 5DLML 1UZ6E 1UH2A 1LILA 3GMRA 1B2WH 3ZT6A 5AZEH 4JO2H 1QA9B 3GKZA 2Q86B 1FN4B 4M02A 4MHHG 5DD6B 3BZ4A 1FO0A 1LK2B 1X9QA 1CLOL 4HG4J 4X5LA 3PWPD 5DS8A 1OB1B 3B9DA 4K2UH 3N0PB 2R1YA 2CLVB 4F7TB 3CUPA 5KN5B 5D70L 2EECA 4JFXB 5F1NA 1T7YA 1R3LB 2G2RB 1U58A 2VL5A 3KPLB 1CGXA 4M62H 5EBMA 4PJ5B 2B5IC 2BVQA 2EKJA 5C2BH 2VDOH 3SBWC 4PJ9C 4KHXH 5EZJB 3TBVA 4H1LA 2VQTA 1EFXB 3U1SH 5C3LD 5E8DH 3WIHA 1FH5H 1IGTB 4M7JH 4Z7VF 1DP0A 2H2SD 1UACH 4L4TA 5JORB 1NEUA 4L8DB 1U95A 1NDGA 4YHKH 2JCCB 4I8DA 1AGCB 4HX1A 3BQUA 1G7MA 2VDRL 1J18A 2YPVH 3HG1D 5IBTL 2YD2A 3MCLL 4JFHE 3V5KB 1YY8A 5EZOH 3QULA 3MRGA 3NFPA 3P9MB 3IDGA 1QSFD 3HR5B 3EO1A 5DQDL 2X1PA 2XOTA 4I9WE 3HG1B 3D0LA 3C87A 4TTGA 1CR9H 3MFFA 2WAHA 3D3VE 4P2YA 3MLRH 3WKMH 3U4EB 3DVNA 1QRND 3O11A 3IF1B 2DTSA 2HG5A 1QYGL 2COQA 5IK3A 3FT4B 2Y5EA 3OBAA 2J5LC 1T7ZA 4EDWH 4U1SB 3SKUD 4JO3H 2Y23A 2ADIA 2PYFB 1S7WB 5C3TA 1JNLL 4EOWL 1T6WA 3FB5B 4G43B 1JZ4A 3LAFA 2LABA 1FBIH 5I1DB 2C3XA 5C6TH 3BQUC 3L6FB 4H26A 2YBRB 3ARXA 2GFBB 3LQAL 1B4JL 1KJ2A 1CL7H 5HD8D 2QADD 1VEOA 4D8PA 1I8IA 5FV1L 2WBJC 3QFJE 5HGBB 3MA9L 4JCMA 4LGPB 4GAJL 5HHPB 1IGCH 1CICD 3MRNA 4R7NA 1DLFL 1AO7E 1MI5E 1U8LA 4L9DA 2ICCA 4TUKH 2OR9L 4O51A 1JWMA 3BAEL 43CAB 5HDBF 3JUZA 3QUMH 3SDAC 1G9EA 1GL4B 5IR1A 1NGQL 1ES0B 1J1PL 4C56E 3FB8B 3RJDA 5E08L 1CFTB 2NMSA 2APXA 5CJXC 1CT8A 2VXVH 5FEBA 3ZDXF 3BZEA 1ADQA 4F9LA 5K9KA 2MMXA 3L5HA 2I07B 2DLFH 2J2ZA 4HS6B 2FATH 3KWWB 6FABL 2DS4A 2X9YA 4NZDA 4PJBB 2BSTB 2ZPKL 1MOEA 1KFAH 2HFGL 1DQQB 2RB8A 1TJHL 2FX9H 3DETD 4R2GD 1BZQK 1C8PA 4P57B 4KK8C 4OQTA 2Y06H 5EO1A 3TZVD 3ORJA 4D94A 3SGDI 3V7AG 1W72B 2PF6A 3M1BA 4JPIA 2MQCA 2OCFD 5DUMH 4PRIE 1N59B 3VFVB 2WZPD 4HG4K 2E7HA 5F1IB 3B9EA 3QIUD 4RMVA 1YEFL 2JCCF 4P4KD 5H8DA 4OCRL 1FO0H 4P23A 4PJHE 4TSCH 1JPFA 2IJ0C 2B39A 4KMLB 2MFNA 2H45A 3MLWL 4KZEH 3SGJA 4BQ8A 2Z31B 5AWNH 4I18C 4NFCA 3QDJE 1I7ZB 3T0EA 3RVTD 1OAYH 3ARBC 3FO0L 3KPTA 4GRWB 5T3ZE 5FUCC 4M48H 3OKEB 3LS4H 1V7ML 3IDUA 1FGVL 1ORSA 1RK1B 3HLAB 1NKRA 3CX5J 5I8OL 5DGQA 5IESH 1XH3A 3IU4L 3O6LH 1F3RB 1X5GA 2EH7L 4MXWH 4JKMA 1G7QB 2OZ4L 2VISA 5D7SH 5GGTA 2V5TA 5I6XC 4K7FA 2BNQA 4PG9B 4W6YB 3EW3B 1D6EA 3OKKA 2C3GA 5IKCB 1CZ8L 2PW1A 2YWZA 3I50L 5D7IA 2VH5L 4G8FA 4XPTL 1XF3B 2KL6A 3C6LD 3WDHA 3D48R 4N0YL 4X8JB 4BSVA 4HGKC 1VFAA 2CR3A 3KPMA 3F7PC 3ZE2E 4G9DA 1MQ8A 1S78C 5JNYA 3GMNA 4HUWA 3E8UL 5C7XH 2FEDC 3L9RA 1WFNA 5GRXG 1KN2L 2DMKA 3BUTA 1RURL 1YNTA 3AS1A 3WS3A 1AFVL 3V79C 1WZKA 2GITB 3QEQA 4W4NA 2MCPL 5IJKA 5A2IH 4PYHA 1J0KA 3NBNA 1HWGB 1FG9C 4HUXB 4KVNL 3VXMD 4WCYH 3UTTD 3STLA 5I18L 2FBJL 3KJ4B 4I4WB 1TVHB 2DLFL 2D7QA 4BSWA 4XVSH 4O9HH 3DTXA 3PWUB 4X99A 5CSBA 2HTLD 3RWEA 3AREA 4KV5E 2IBGA 3NZHH 4OM0L 2YSSB 3VG9C 3UROR 5GGVY 3C5JA 4HBCL 3O8XC 4AQ1B 4DN3L 3L5JA 4M1DL 4AH2A 2MCPH 2DI9A 4KK6C 2D4FA 4HWEH 1RUQL 1P84K 4OLVL 4FP8L 3X17A 5JQ6H 4N90E 1EEZA 1NLDL 3ES6B 5D7JC 4R7DB 5JPNA 1FL5B 1CD1A 1OW0A 2IAMB 4AEIH 5DI8A 3ZDZF 12E8L 3RVWD 1I3RB 4MA8H 2AJUL 4G9FD 2XKSA 4GQ9L 3REWA 2GI7A 1WIPA 1AE6H 3FFDB 3OKDB 3D39D 5E6YA 1QBML 3DOSA 1X5YA 2PXYC 3TBYB 5I1JH 3MRNB 4ELME 4LLMA 4XBGA 4WU5B 3MRKA 1JZ5A 5DSCB 3AM8A 3ARRA 1R3HA 1C7SA 1P84J 2OP4H 2XQYG 3H3PL 1XIWB 3QXAA 2J8UF 1MI5D 2DWDA 2YEZA 4X7TA 2NR6D 2GJZA 2GK0B 2EH7H 2CJUL 2VC2L 4K3DH 5BMFL 4RX4A 2YN3A 3RX7A 4PJ5D 2HTLC 5HDBE 5IIEB 1IAII 5CUSH 3TVMC 1VFAB 1IILE 1MCHA 4ZMAT 2APWA 3NCJL 2OL3H 1WF5A 1Y6KR 1NC4B 3L5WB 5T3XD 4PUBH 4QRRA 1T2QH 3NN8B 1ROWA 3AS2A 3UAJC 3PWPB 1NMBH 3MV8D 3ARDC 4KZEL 4Q74A 2BSED 2OSLB 1U36A 2DTML 3EFFA 1MPAH 2R4SL 1NBZB 3ARGC 5I19H 1E27B 1T1YA 5FAAA 2HKFL 3RKDC 1PKQE 1IAKA 1Y18B 1PAMA 1B6DA 2SEBA 5F9OH 4H20L 4X7CC 3VGAC 4XAKD 1UWXH 1YMHA 4NKIH 5ID0B 1AI1L 3RHWF 1TZHB 4KJWC 3MLVL 5IGXH 3ULUL 3KPOB 3GIVA 3QAZB 3ZKXB 1BZ9A 1WICA 5H94A 1KG0A 4LHUG 3UTSB 1TENA 4BZYA 3GFUA 5CEZL 3H9SB 5EUOA 5CD5C 3EGSA 4KROC 4WENB 3O81A 3D85D 4PJ9A 3SGJC 4JO1H 4LCWE 4PRAA 5FHAL 2VDML 5LGHH 1IBGH 4NJ9H 2ADJA 4ZUUB 1FL5A 5A16A 4HXAH 2XTJB 2AAVA 3INUL 5F72S 4ZS7H 5CILH 3VXSA 3GSQA 4AL8L 1J1OH 1H8SA 2IANE 4KUCD 3MLXH 3K4AA 2VLKA 4OZIB 1BGXH 1PVHA 1XGPA 2V2TA 4K94L 4MNGA 2VIRB 3RZCB 5J1SC 2DM3A 5DFWH 5DC9B 3VI3F 1XGYL 4RWYH 3PV7A 2HFEA 2WLYA 3WIHH 5AZ2L 4DVBA 4BJLA 3S36L 1CLYH 1D7FA 4JFFA 3NIDE 5JLZB 1DLFH 4JY6B 3MNWA 5CCKL 4NZRH 2BY2A 1IGCL 1OY3B 3WDIA 2AXGA 1I9JL 4FQLL 3FL7A 4MJ5B 1NC2B 5D7LE 3IXTB 1J9CT 1KJ2B 1IEBB 4NHUA 1U92B 2DIBA 4BZ2L 3OAZK 2CRYA 3D3VD 2FGWL 3O2DA 4KI5F 3VDBA 1C12B 1XGQA 4KK8D 1WZMA 3MLTA 2VITB 5FO8B 3T09A 1Q1JL 3HUJF 3UX9B 3EUUA 4JRWA 1KBGH 2FYYA 5HGDB 3OG6B 4LKXA 2JELL 4U1IA 4U6YA 5SWSD 4ENEC 1HXMB 3DX8A 4XCYA 5DZOA 3QJHA 5CEYA 5J57B 1WAAE 4XGZA 3MRHB 1CGYA 2XWTB 4K71C 5DQJA 3ZTJG 2AERT 1K6QH 5FKPB 3TP4A 4NJAL 1A6VH 2IPUG 4Q9QL 5H2BA 4MNGE 3RFZC 1Z9MA 4PG9A 2OJEB 5JA9A 1RK0B 2YPLA 4J6RH 3DXAE 3JBG7 4IRSB 4UT7L 3UTTE 3UDWA 4XP6H 2CK0H 1OT2A 1AY1L 4MQTB 4ZUWA 1D5BA 4LLYA 3CC5A 2W9LA 3QO1A 5ADOL 5M7QA 4NO0A 4YHNA 4HC1H 3V6ZA 4Y7MA 4X4XA 4RMSA 3QBTB 4OLWL 2Y5TA 1FP5A 3O45A 1J0JA 3OZ9L 1NANH 1D9KD 1HKLL 1QBLL 5JUEL 5IB1B 3DRQA 3PWPE 5TPWL 3QSKB 4P0DA 4P9ML 5EULV 5I1AA 1C08A 3ZHDA 3TBWA 2AXFB 1CLCA 3OKLA 1S7UA 3V6ZB 2NY6B 1A1OB 3LHPL 4X6EA 5HPMB 2XWJB 1JNJA 1O7SA 4WUKH 2MJWA 5L0QC 4X7SH 4NQTA 4XC1H 4JZNA 3NCCB 3GMLA 5DK2A 3BQUB 4E41B 1T7XA 2ARWA 3FT3A 2R4RL 4NSKA 4TUOA 1REIA 4X9BA 2XFXA 1IARB 4X6BB 2DLGA 3KHQA 3GKWH 4GG6B 1A9EA 3N1PC 4ODSL 4DGYH 2JB5H 4JRXD 1BOYA 4K9EH 1VKXA 2CRMA 1JZ8A 5DSCA 1YNLH 4OV6F 5DUPL 3NFSH 5KSUA 2ATPA 2F54B 3C2AH 4J1UA 3TN0B 4WI4A 3TH4T 3WO4C 4LCIL 4DVBB 2HJKA 2IBZY 4HKBB 4MA8L 1WC7B 5GS1B 2BP3A 1VACA 5DJYA 4Z7VA 4N0FB 1SBSL 3NCYS 2ED9A 5DD3L 4R2GB 2F8OA 1FJ1B 1NLDH 3UTSD 2UV3A 5D1ZB 5D2NA 4RGMC 4N9OB 1F11A 3IFPB 4HF5H 3LDBC 3C08H 3SDAB 2G2RA 1P6FA 4R0LB 4HS3A 4KTYA 5DJDB 5MP6H 1XGQB 1LEKB 3QUZC 2VLKB 3E3QC 5D6DA 3NABH 4PJAE 1YJDC 4PB0L 2W60B 5I1EH 2V5YA 4BELD 1QEWA 5CP3A 4HV8B 2I9TA 2RBLA 1ACYH 1BVKA 5C0FB 4K3EH 2DYPD 2FIRT 4QF1B 1ZLUH 2EXWC 2GSIB 1J8KA 1N7ML 1XZ0A 2QHLA 1IAIM 4AMKH 3VGGA 3C6LB 4JG0H 2DQIH 3STBA 3LEVH 2I9LB 2N4IA 1EUUA 4DGVH 2MHAB 3UTSA 4OIIL 3SQOH 4BSWB 4AM0A 5C0DA 1T83A 3CVIL 4U1GC 5I1HH 1LGVA 1A7OH 2NXYD 4PJFF 4KY1H 1A1NB 5ESQB 4MA7H 3V6OA 1JZ6A 1A21A 4XWOC 3RX5A 4X4XB 1KNOA 3LKRB 3O3EB 2J8UA 1G9MC 1N6UA 5JHLL 1E27A 4Y88A 1AIFB 2WANA 3B4NA 1MAML 3BWAA 5HHMB 4K3JL 3WYRA 2QQQA 1RZ8B 2OR8A 5I1AB 2DTMH 5DT1H 4X6CE 4NC2B 3UTPD 4QTHA 3FCTB 3RAJL 5C08E 2X4NB 3T0EE 3RL1A 4I2XA 3HUJE 3MMEA 1EMTL 1KG0B 5ACMA 1BZ9B 1M7XA 1MH5B 1ZHLB 5H2BB 4ODXA 3GSNB 4YXLL 1L7TH 1MFDH 4EDXB 4K7PL 4ZO9A 5HHXH 3QIUA 3V95A 5AYQA 1SVZA 4PLKD 3SPVA 2XQBL 3X14A 3SCMA 3VXOA 1DE4A 5J3HC 4XCFL 3BEWB 1A7QL 3TBTB 2BNRE 1A6WH 2XTJD 4LFHG 3SOBH 5IB2B 5FHBH 2EDWA 2JCCA 4O2FA 4L8DA 1U3HA 3MRQA 5IMKB 4RQQB 1UYWH 1JYWA 5KG9A 2DQDH 3DURB 5IEHB 2CR6A 3AB0B 4PJCE 3VXOB 1FYTD 4OJFL 1XCQA 3THMH 4DKEL 3QPXL 2BFVH 1KSRA 3X3GH 3CLEH 1OTSD 5SWZD 4PBWD 4ODXB 1FORH 3WN5A 2NYYC 4CU7A 4TSCL 3FO9A 1HI6B 4I77L 1I8MB 2CRZA 3HMXH 2VR5A 2ORBL 4NZTL 1G1YA 4F3FB 3K8MA 3ARUA 1QD0A 5J6HB 1ZMYA 2Q8AL 3WUZA 1D9KC 1ZVHA 5JZ7D 4PRPE 3TV3L 3QYCA 4LKCB 4XP4H 3WJLA 4S2SA 4WU5A 1UKTA 5FA4B 5LXGL 3FMGL 6CGTA 3OR7A 2AJZA 3KLDA 1KB5B 2E8ZA 1PX3A 5HGHB 1CDBA 1KLUA 3ROLB 3DO7A 2R69L 4U6VL 3U36A 4DVRH 4PB0H 1QBAA 2FJHA 5J7CC 1M4KA 4RIRA 3NZ8A 4EBQH 4N90D 2B8OT 3QDGB 4F9LC 3MA7A 3RQ3A 4ZUTA 4JFYA 4OLUL 2VDQH 4Y4HA 5IR1B 3QIWD 1VFUA 5HYEA 1HHKB 4K3HA 1NAML 4AJ0A 3D69A 1MLBB 3K4ZA 3DMMA 4CN1A 2XYCA 1T6VN 3CZJA 3GKWL 1Q9WB 4Z8FH 3MBXL 3MODL 4FFWC 1ITCA 1ZHKA 3CFIC 3MYJA 1QSFB 3PV6B 2APVA 4RRPG 5HY9A 3QPXH 4UT9L 4YEFA 3I85A 5CGMA 3HCVB 4XC1L 4Z77A 1TLKA 2CIKA 5JW5B 1JWUA 4NUJB 4ELMF 3F65A 1UJ3B 4JN2A 1XAUA 1RJYB 5TE7H 2EYTB 4OSUL 5DK0B 2BSSB 4P3DB 3RY5A 2VLJB 4NRZA 3OAZH 3IFNH 5ITFA 3MJ6A 1JGUL 4JM4L 5C0BA 3HI5L 3TVMB 4AEEA 5C07D 1U3ZA 3S36X 2AJ3A 2QJDA 2R2HB 1ZLWK 4MMXC 3V4VH 1IGJA 5D1XD 1R3HB 2EIBA 2RGSA 1ONQA 4N0CC 4F9PA 4OZFB 2HJLA 5DYOA 1IFHH 1KPUB 1EVTC 4MNQA 1ZHKB 4HWUA 1F00I 1I1RA 4KQ3L 1EMTH 2CQVA 4LCCA 3D0LB 1CDIA 2P24B 3GMPB 3ARDB 5BCAA 2DBLH 4DUVA 2Y25A 3HI6H 4LAJH 1JN6A 4L29B 3ARGB 4Z78B 2L7UA 4RBPK 3WFEH 4HXBH 1P9MA 2V2XA 3PGDB 5JHLH 5DUML 2WIMA 2EE6A 2G5RA 4PJCB 4PREA 1NDGB 4IJ3B 2QR0B 4OLXL 2WINA 2VO5A 4P49A 1F4XL 4M7KH 2QQLH 4WWKB 2B1AH 1CFBA 1S8DA 3PP4H 1F4AA 5EU7C 5L9DL 1E4WH 2IC2A 5FM5M 5I76A 5KZCB 3QHTC 5I30L 1T7WA 1J8HE 1HSBB 4ZFFB 4DGIL 1KIUA 5HHOA 4LSUH 1NGXB 1N7MH 4PPTA 4YDIH 3D87B 1KGCD 1S9XB 1ACYL 1FVEA 4K3EL 1CLZL 4NQEB 5CGTA 1BX2B 2UYLB 4J3TA 3LKRA 3S3PA 1MWAH 2XWBB 5C0JB 5DJ0B 3QWRA 4ZS6C 4U0QB 1BAFL 1JPTL 1UT9A 3BFOA 3E3QE 3HS0B 2C26A 1N4XH 2OQJB 4LGSB 1XGRB 3BIKA 3MLSL 5IHUH 5DRZB 4G7VH 2EDRA 4NQCD 5L6YH 1WITA 4CU8A 2UZXB 3KNBA 3X13B 1Q9OA 3IRPX 3S96B 3STLB 5F7WC 3LCYA 1LEGB 4LCIH 1RIUH 4TOYL 1UCBH 2ZCKH 5KJRH 3HE7D 3QXVA 2GY5A 2HFEB 5DHYA 5C0CD 4D8PB 4JRYA 3L3IA 4ZOAA 1XGRA 3BIKB 1OP5K 4ZFOA 3UYPA 3RIAK 3MQIA 3B9KB 4PJIF 4CADB 4ZDHA 3QG6B 5ALCH 2NY0C 4MQXC 3FQRB 5IVXF 1B4RA 2VE6B 3JTTB 3QEQE 4OZHB 3PWLA 2A6KB 4LK4A 4WUKL 2FX8H 2IG2H 1F58H 1FNLA 5I8EB 3QI9D 4GOSA 1YDPA 4XVJH 1IM3A 3A67H 3LY6A 2R1WA 2XPGA 4K71B 1NFDE 4NCDA 3V5HB 4P5TB 1ZLUK 2YZ8A 3BKYH 3IJYB 4RAVA 5TPWH 3OKKB 5JXEC 4PGDA 4KHTH 3GJEB 3CVHH 3QH3B 4EI5D 4NSKB 5ETUA 2F9BT 3MTRA 4YDJA 4PREB 1AGEA 4KGLA 1WVZA 5FDYA 1AGDB 1PZUB 5E2WL 4YH6A 4Y4KA 2CXGA 5E2WH 4G6KH 1DCLA 1JTPA 1N0XL 3OJ2C 4HUVA 3P4NB 4F57H 1T5WA 4MA3B 4M3JA 1PX4A 1EZVY 1AGEB 2AP2A 4U33A 2IBBA 2VDKL 2Y7QB 3LVEA 3PWPA 4NFBA 2APTA 4WU7B 5C71A 4Z7UF 2XWTA 2VXTH 2FEDD 4X0KA 4WUUB 3A6OA 3DX6A 2JIXD 4KXZI 1P7QB 4XHJC 5B8CA 1BVZA 4G6MH 3STZB 2H6PA 3DUUA 4HJJH 1INEH 2Z4QA 3D6GA 3ZSTA 2E8YA 3I6LE 5DJXB 4C55A 5LKNA 3HE7C 1A2YB 1E28B 4HIXH 5CMAB 3S98A 2V7NB 4Z6AT 5F70A 3FB6A 3SE3A 2DQTH 1AJ7L 1QRNB 5ALCL 2HTKC 4O58L 1CDCA 2H8PB 5GHWH 4GKSA 1BJ1J 2EKSB 4LARH 1GXEA 1MFEH 4WFEE 3BN9C 5HGAA 3V4PH 1KENL 3VGHA 3TN0C 3FRUA 1ZLVK 1UCBL 2BVOA 2ZCKL 5KJRL 5IFJA 1N64H 2ZUUA 3GGWB 3S36H 4FQXA 43C9A 2J3SA 1I4FB 3ELAT 1QFPA 4JDTL 2YD4A 1K3ZA 3H7BA 3DETC 4R2GC 1NFIB 4HGMA 1G6VK 3CXDH 4LLDB 3ZT7A 1MCDA 3FQWB 4OGXH 4M7ZC 4QRPB 4KUCF 4OCSH 4RGMB 4OZHA 2EDXA 4RWHA 3MV7E 5F6HJ 3C60D 4D0DA 3QUZB 3WEXB 2H9GA 4NKMA 1OPGH 4HBCH 5KS9B 4U6XB 4OGAD 5E8OB 1LQSR 1GC1H 3ULUC 5GJTH 2X9XA 4JQIL 4LVEA 3S97C 1HH6A 1IGIH 4NO2A 5CWSA 4X6CA 4HJGB 1KLGB 2VAJA 1S9VB 2PYFA 2W92A 4N8CL 5JLZA 1T0MB 4K23H 2XTJE 4PGBA 2IMMA 1VEMA 4FZ8H 3OKOB 3X13A 4N68A 5AG9A 2IGFH 2BHZA 5KSBB 1VHPA 3SGDH 1A8JH 2NY2B 3VRLE 2NY5H 1E4WL 4GW4A 3CK0L 3GBNL 3PP4L 1RULH 4J3OC 5HDQL 5J56B 4L4VE 3RTQA 1NC4A 5E2UL 5GS0H 5DHXB 4YO0A 1MREH 3FN9A 3KHOA 3W11C 3QO1B 3BN9D 3VWKC 2WBJD 1CD9B 2ATKA 4PJ8C 2QADC 1DLHA 3G5ZA 3EOBB 4OM1L 2DKMA 2PYEB 3O3AA 2BOBA 3BPCB 3ZE1F 2DWDB 5GS2H 4G8EA 3SJVA 2AW2A 4Q6IC 3VXUB 1V7NL 4W4OA 4TVSa 3EO9H 2XXMB 3I50H 2HLFD 3UBXI 1CZ8H 1X5KA 4TNWK 4TTDC 4ELKB 1LVEA 4U1HA 1DSFH 3HC3L 2NNAA 4JM2C 1FFRA 5DQJB 5LCVL 4X6FA 3VGDA 2NTSP 3NCJH 3L3KB 3MRLA 2P7TA 4NGHL 2BNQD 4DFIA 1DBAL 3R06B 4S1SH 5CINH 3HNVL 4X98A 4HX1B 5CZKA 4WTXA 4XH2A 3O4LB 4EVNA 4L3EE 2ICEB 3PUCA 1PLGH 1LP9F 2NY1D 4J8RB 1WBYB 4OSUH 1UZ6F 2D31B 1X5HA 4PJHB 2YUXA 3TBTA 1UG9A 2AI0H 4MD5B 3AB0C 3HRPA 5CBEB 3MRLB 1EV2E 3NA9L 3TVMD 3SDDB 1E4KA 1IC7H 3UC0L 4U1HB 1IKNC 1YYLH 3GB7B 3SE4A 4GLRH 4I13B 3VRJB 1IVLA 3O6MH 2UUDK 3MMEB 5GRJH 4LVNB 2Y07L 3BT2L 1YY9D 4N5EC 1XR9B 5DRZA 1WQVT 3E2HB 3UTPE 4P4KA 3WS6A 2JJUA 5DI8B 2XNAA 5FYJL 5JPNB 2N7BA 3Q6GL 2X89D 4PGBB 1F8TL 1GIGH 2AKRB 2WW8A 3P0YL 4FQ2H 3TGXA 5L6YL 4OLVH 2IAND 3LRHA 1RVFH 1YEJH 3ULUE 3O6FD 3AGVA 2W0LA 4YAQB 4F15C 4H25A 2ADJB 1X3DA 4QOKE 3O41A 3H0TB 3MJ8B 3WFHA 1H3UA 2H26A 3W9DA 3GIZL 1CGSH 3TO4D 3GIZH 4CJ0A 4NNYA 3MRDB 5J6GA 4DK6A 5D71H 1A4KA 1J05B 5BV7B 1DBKL 2VL4A 1U2HA 1HE7A 4KJYA 1G84A 4RGOL 1EJOL 3W39B 4QXUH 4ODWB 4S2SB 3BMWA 4PJ9D 3V8CA 1OAZH 4H0HB 1UB5A 5GGSB 2B1AL 3NIDF 2OTWB 2BX5A 1CF8H 4L3EA 3FT2A 4LEOA 1F4YH 1PEWA 4NN5C 3QUYD 3HE6B 4XPGL 3TO4A 3BXNA 3PWUA 3L3GB 2HN7B 3W5NA 1OTUD 4OFDA 3STZA 3SPVB 4MJIA 1P2CB 2NZ9C 2BXZA 1ITBB 1QSVA 1FYHB 4WUUA 5EO0A 4UQ2A 1GJIA 3MLYL 4WNQB 4KC3B 2NY2D 1CE1H 2FHBA 5DVLA 1M7DB 3DURA 1L4IA 3H42H 5EPMA 5IEHA 2ZUQC 4MXWL 1X5IA 3L7FA 4OFYA 4P23B 5GGVH 4MAUH 3TO2A 5I1GH 3S88L 4DFHA 3U0TA 1A7NH 5EZIH 3WKML 5BVJB 1F97A 1N59A 4YHZH 4P2OD 3UPCA 1RZKH 3OHXB 3EIFA 3FHQA 3G6JA 5C0IA 4N9GB 3VXRB 5IMLA 3DYOA 1RUML 5GRUH 5DJ6B 3O3UN 3KYAA 4NQCA 3P2TA 5A2JH 2Z31A 1NCWH 1RFDL 5I1IL 5GGQH 1E4JA 3ULVF 3N85H 5CFHA 2M26A 4FMKA 5DEFB 2J7LA 1NGZA 1R5WA 4XNZB 4OZFG 2W07A 2VLRD 3QQNA 4LSQH 3S37L 3S5LA 2OR7A 4XPGH 2Q8BL 1BVKB 1JRHH 4TVPL 3D1MC 4L8CA 1J11A 4B7IA 1URLA 2GEEA 4PS4H 3QWOA 2EIZB 4WWKC 3PQYB 4C54A 3RI5K 4YQXH 4ETYA 1MCIA 2KKQA 3G5VB 3VXSD 4NBXB 3PGFL 4XPBH 3AU1A 4XCCH 3FQNB 2R1WB 2XPGB 3R0MA 1L6ZA 4BH8A 5AD0B 1HXMA 4GT7A 4U6YB 3TPUB 4PJ5A 4M7LH 1U8OA 1DANU 2E7BA 5EC2B 4CVWA 1CG9A 1DFBL 3TCXA 4H5SA 3VFUB 3LKQA 4NQXB 1R3LA 2AXHA 1YNTB 2FBOJ 1NGQH 4XP1L 4FTVE 4MNQE 1RJZB 3C08L 2OMBA 43CAA 3NAAH 5BZWB 4PR5B 5T1MA 4G3YH 2V9RA 4BKLA 1I7UB 1EHLH 3WNLA 1I1YA 3TYFA 2X44D 3SDCA 5IFAL 4XTRD 1F02I 2VLKD 2Q20A 1OSZA 4WW1A 3ULSA 2R29L 2BVOB 4RX4D 5IFJB 2H41A 3SHSA 4OCXH 5KSUB 4LRIC 3U46B 3B9KC 3DX9B 1RHFA 2D7NA 4DEPB 4GBXD 4YX2H 5C1MB 3EFDH 4LSSL 2E5EA 2VAAB 3ARFD 3NA9H 1NCNA 4WEBH 2NXZD 4XNQB 2PCPA 2PUQT 1DEEB 1YNKL 2ADGA 3G6AA 5EA0L 1JNLH 5IB4A 4G6ML 2B5IB 1U3JA 1DN0B 2P48B 4YGVB 5BRZB 2D03H 3O2DL 5T3ZD 1F4HA 4P5TC 1AQKL 1BM3H 4OZHF 3HNVH 4DW2L 3PE9A 1S7UB 1NMAL 4YBQC 5C08B 5IQ7H 3T0EB 5MEQA 1QBLH 2X1XR 1EPFA 5I66B 3RL1B 2C1PB 2EDBA 4FQHA 1WFUA 1VGKB 1YA5A 3HC3H 1L7TL 2D0HA 2MWCA 5D96B 5BRZA 1JF1A 1LP9A 3TNNB 3MCLH 3P4OA 2AJ3B 2OLDA 1EFXD 4PJ8A 4JR9L 2A1WL 5DJZB 3VXMB 3IKKA 4RFOH 5ACZB 3LN4B 2HFFA 1MAMH 4NCC1 1G0DA 1BBJA 1SY6H 1WBZB 1DBMH 3CX5K 3ARWA 1CXKA 3HC4H 5TDPA 4MS8D 4GRWE 4JHAH 3S35X 3RWGA 1OCWL 4KY1L 3QRGL 4JVWA 2BHYA 4E9LA 1ZA3A 3GSOA 4CNIA 3SDXB 4QHNA 5FO9B 3UTQB 2YHGA 2EYRA 5H35B 4XMLL 1SVCP 2GTWA 2J6EL 4QRRD 3TT3L 5KZCD 4NO3A 5FECB 1I85A 1NGPL 3HS0A 1ADQH 3LMJL 4TVPE 1DBJH 1OGAE 3C5ZC 3P9WB 1FFPB 4IEFB 4FA8A 3D0VA 4ZFGH 4PGCA 3A0OA 5T3ZH 5D70H 4KI5D 1NUGA 2DQJL 4Y5XC 1QPXA 2WBJB 3P11L 4TULH 1CE6A 4U3XA 4AIXA 2DJUA 5CKAA 5F7KC 2JCCE 4TOYH 1SYSA 5IFAH 5E1HB 3UTOA 1JMZA 4GRWF 2E9WA 1GGCH 4V1DB 3NFNB 2HA1A 1R3IH 4B50A 1T0NA 5F96H 4ZNEA 3KXFB 3H9ZA 1RZJL 2Q76B 1JPTH 4JFEE 3IRZA 1BGXL 5FYKE 1G0XA 4WW2A 2NW2B 4PLKC 1M1SA 1NCCL 1SJHB 3QUXA 4OV5A 5DFTA 5C0CA 4OZIA 2AJSL 1IGMH 4WV1A 3MUGA 5FUZL 1A6UH 3AY4A 1NGPH 3L5IA 4GRWH 4ODVL 4CGTA 2XNAB 3RUGE 1C08B 2XQYK 2IEPA 3RKDD 1DQDH 1T21A 2HT4C 3JWDL 4NFDA 1WV7T 2VIRA 3RZCA 2Z8SA 5DJ6A 5AAMA 1B0GA 1KXTB 1F5WA 4M9PA 5H94B 2HJLB 1CQKA 2NZ9D 3F7VA 1VFBA 5DJ8A 3UAJD 1JRHL 3KPQA 4TVPH 4PJ8B 4CDGC 2RAMA 5C07E 1AC0A 2EDFA 1QFHA 3Q3GB 4DCQB 1CFQB 1TITA 3ARTA 3K81A 4RFOL 5FK9B 1KT2B 1NLBH 3EBAA 1LD9B 5ADOH 4L4VD 5TQ2H 4Y2DC 3S34H 2LVCA 3KPMB 1K4CA 3OAUH 4GRMB 4HZAA 1RFDH 5AUMB 5I0ZA 3WBDA 5GGSY 3TBSA 2DM2A 2CGRH 5C08A 5ILTH 3BDYL 4R4FL 5IG7B 1JK8A 4JM2B 1UWGL 3PHSA 1JI1A 1JE6A 1AHWA 1P2CA 2KBGA 2PO6C 3EKCA 3PIQA 4XCYB 1MIML 3GMMA 2XXCB 1TJIL 1A7RH 4X7EC 4HZLA 5FYKH 4DW2H 3U7WL 1UZ8A 2EDOA 4HPOH 1NANI 1MCPL 4G8EB 1PGRB 4PJXA 2FSEB 1NAKL 4FQJH 3G5YB 1XCTB 5BW7C 5FK9A 4ISVB 4M6OL 4LBEA 4F7PB 2C4FU 5JW5A 3EFDL 3RNKB 5FGSA 1IQWH 2UWEE 3WD5H 3WHE0 4OFPA 4OF3A 3QDMA 3I6GB 2G75B 2RFXA 2BY0A 2XN9A 4P2OC 5ISZB 4LVNC 1SEQL 4CBPA 4JRXA 2YOCA 2MOVA 1QLRA 3RWDA 3TJHD 1IC5L 2H2PC 1AE6L 4QCIA 5GGUB 2F74B 1A6ZB 4D9RE 4OUUA 3VMNA 3CSPA 3SGEI 5IT2H 4OLUH 2IAMA 4PRNB 3T0AA 1PFCA 4WV1B 3T0ED 5F9WB 4BFBD 2O5ZL 1II4E 3HB3D 3U6RB 4XBGB 4OB5H 1DUYA 2EXYD 4HS8H 3KJ4C 4ELMA 5IP4A 3KG5A 3QEGH 3SCMD 3BGFC 3MLXL 4MB3A 4J3VA 5KSVA 4BH7A 1QKZH 5IF0B 1I9IH 4W70A 5CJ5A 3B8YA 3MLPA 2FZ3B 3T0BA 3I84A 1TJGL 4LGRB 4P2OA 5GJSH 4YDIL 2FDBP 5F97E 1AGBB 3SE4C 3O41B 2VDMH 1I4FA 3TNMA 4ODHH 4WWKA 4FHBD 4IDJH 1WZ1L 2CDGA 2A83A 2HJKB 2QQKH 3E6FB 4P3CH 4WJ5B 3ULVD 4KXZH 4ZO7A 4UU9A 4HULB 1INQA 4YE4L 3N9GL 2AEPH 3HAEG 1TPXB 2GJ6A 1GRWA 4IRZH 5HHVH 4M7KL 2IAMC 3QDGD 3TFKD 4PS4L 3M07A 1DBBH 2IMNA 5E2JA 1ZEAH 4M7LT 1T1XA 4PTUA 5F7MC 4NN5B 5BQ7B 5F7EL 5BVPL 2XRAH 4UNUA 3L7EB 4LEXL 3GMMB 4LCWA 1OD7A 3KYOB 5H35A 5DTFB 3HI6L 3CLFH 5CZXC 5HHPA 3ZKQD 1JK8B 1IC1A 4KVCH 4JB9L 3CLEL 4F9PC 4XPTH 1CFVL 5D7LA 5EU7E 2VDLL 1EXUA 2G9HA 2VH5H 4PG2A 5HDLA 3V0VA 4OFYD 3FFCE 4XI5C 2HVKB 3ZTNH 1FZMA 3ILPB 4G6AD 1QUNA 1W8NA 2W65A 2FCBA 2HP4A 3JV4A 4KRMB 2BOBB 4R8WH 5IUSA 3FRPG 1VDGA 3IKCB 1YPZE 4YFEA 3EYOA 3VRIB 2BVYA 1JPST 2A74B 1TZIB 3VWKA 2HVKA 3O9WB 1FNAA 4U1LB 5EIIB 3W0WB 4M00A 2IH3A 2LTQC 1QFWI 4K7PH 5GISH 4Y5VC 2CXKA 4ENED 4X6CF 4MAYA 2W9DH 2IANA 1HHJA 3QDJB 3QFDA 5E8PA 3MLWH 3SKMA 3WE6A 1UEYA 4XXCA 3MBXH 5E1AB 2KDGA 1I3RA 1J8HA 1CVSC 2UVFA 3LKPA 1U8QB 3WIIH 2YRZA 2VLJE 4Y16B 1MJ7H 2B20A 3S8WA 5HXMA 5HGGS 1R3JA 3EOTL 1JBJA 1HH9A 1UGNA 3GSVA 1HQ4A 5ENWB 5C0CB 3VGAB 4HKXA 3IT8D 3T3ME 1A3QA 4OCMC 3WEXA 2BCKB 3OPZH 1CU4L 3VFGL 1OAUL 4HFUH 3MZGB 1BQSA 3MRDA 1RZFH 4PJBE 1TJHH 3QQ4A 4KROB 1MNUL 2FZ3A 4OD1L 1FFNB 3I75B 3U0WL 2P5EB 2GT9B 1OM3H 3FB7A 1HNFA 1JPFB 1KJVA 4XBEH 5CHNA 5I8CA 3BO8A 4YUEL 5DRWA 4WI2A 3MJ9L 5KSAB 3OG4B 2FO4B 4PTTA 2FB4L 3BP5A 2GSGA 3VWKD 4DKFH 4PB9H 2FL5B 3DVIA 4KKCC 5JMRA 4NUGH 1YEKL 3NCYP 4I0CC 3QUML 3SDCD 2B4CL 4QRSB 1NCDL 2D0FA 3IJHB 3O4OC 4KI1A 5CEXB 1N0LA 4R0LA 5DJXA 5E00B 3W5MA 1A0QL 2HTKD 4NRXB 3FQWA 2ADIB 3FN3A 4DZ8B 1H3PH 5F7NC 3CSYA 3E8UH 2MTPA 4EIZC 5DMIH 3VA6A 2MPAL 3L1OH 2P47B 4NIKB 3LEXA 3S6CA 1E4KC 4HPYH 1H3XA 5IKCA 4LPXA 5HI5C 3LQAH 3P4MB 1B4JH 4UINL 4DEPC 3SE9H 3GBML 3T0WA 3ARDD 3U7YH 4KKBD 4H26B 4WGWB 3MV8A 4NWUL 5IMOB 4JO3L 3SCMC 1YC7A 3N1MC 4EDWL 4AIOA 3WFDH 1HINH 4X6EB 2V5MA 3K2UH 4R4NC 3CDGA 3MLUH 3U7WH 1H8OA 1A7QH 3B9VA 4L4TB 4HQQH 3U79A 3VRLF 5EOQH 1HDMA 2IANB 3UMTA 4OAWB 1RU9H 3RL2B 5F7UA 2XICA 5DQDH 4YFDB 3VI3E 4N1EA 3OAYH 4IRSC 4FFZH 4JFPA 2EC9T 5DC4B 5DHVB 2V7HA 5D96C 4YXLH 4QRUA 4R9HA 1AKJB 4LU5H 2FX7L 1OGTA 2PYEA 3LEYH 3BSZH 3RVUD 4NNPL 3IDGB 5EZOL 1C5CL 1GH7A 3RWJA 5SX4I 3CC5B 2PW2B 1CTNA 3P0VH 3EDDA 3DV6A 3VFMB 5C0BB 4JFFD 3VRIA 2F58H 2DKSA 2HJFA 4PRBA 3RGVD 1Q72H 2GK0A 4OCRH 3DRTA 2DM4A 1S7RB 2VDNL 4HUKB 3QXWA 4JDVA 4QHLB 5JO5A 2FHCA 4KHTL 1A14L 1FH5L 2D7PA 4Q9QH 4JRYB 5ITBH 4KFZC 2BSTA 3C9NA 1P4LB 1A7OL 2A9NH 4JY6A 3UO1H 5IM7A 4NKDB 2NY6C 1GZQB 4R6UA 4XVJL 1QFOA 2FJGA 5IHBA 2P4AB 4MD0A 4PFEA 1K4DA 4PRPD 2XN9E 3OR6B 4DN4L 5E00A 4XZUB 3B6SB 2E27H 4ODVH 4I1NB 1G6RA 3F8UB 1GGYA 1PG7H 5AEAA 3RIFK 5IJVA 4Z95H 4JG0L 1Q1JH 3VXPB 1ZANL 1XIWA 3C5ZB 3T0DA 5IV2A 1FZOB 4LHUB 3MSPA 1KC5L 3DV4B 5GGSA 4Y5XB 4PJFA 1KJMA 3FQTB 2FH8A 5JXED 3O3BB 3ULSB 4HDIB 1RJLB 4FQXC 4NZUH 4X80L 5GS1C 4HF5L 3FTGB 3J7HA 4Z7UE 1MHEB 1ZA6B 1HCFX 1B90A 3OF6A 4OGXL 3RNQB 3CXDL 5D1ZC 2VABA 4Y4KD 1QVOB 4Y89A 3PGCB 1ZLSH 5L8LB 4OUOA 3LDBB 3VFOA 3ZLQC 1N4XL 4R0LC 4POYA 3LS5L 3D3VA 4ZTOL 5I1CL 1CN4A 2O61B 1YNLL 4I3SL 1S78D 4K9EL 2C3VB 3QCTL 3HUJA 4H5SB 4UT6L 4HK3N 3G04B 4QT5A 2QQNH 4XNMA 3C6LC 4LHJB 1HHHB 4AENA 3WLBB 5I71B 1XR8B 5HI4D 5E2VH 3ARZA 2BOCB 1A6ZA 1OVZA 2RR3A 2VDPH 2IPTL 3Q6FB 1OTTC 3HMWH 4P5KB 4OZ4B 3ZKMC 4WIQA 5HYJA 3QFJA 1EEQA 2Y5TB 2WWKT 4M8VA 2YMXL 1S9KC 4NKIL 1NFDA 4ZQKB 1SJXA 4L4VA 5IEKB 5DJZA 4I5BA 2PW2A 3KLAB 3E6HA 3R4DA 4MX7B 2W0KA 4OLWH 1CBVL 2RQ8A 2E27L 5KG9B 1UXWA 5EOTB 3K7UA 5EU5A 4XVTH 5SX5K 2OJZH 2YEZB 4PJIE 3CFJB 2OBGA 4Y2DB 3BQUD 1Z5LA 1TIUA 3IS0X 4EZMA 1S7SB 1JWUB 2IAMD 3CIQA 4JG1L 1FNFA 2CK0L 3U0PA 3KPRE 4QY8B 1EVUA 1F2XK 4NPYA 4S1QH 5F7LB 1RK1A 1XF5B 3LQZB 3KS0J 1T89C 2CO6B 4P23D 2DIAA 3VXRE 3U2SB 3TBSB 1MFAL 2R56L 3IETA 4NOFA 1M71B 1A6VL 4WFFE 5F9AC 4K7FB 3KPRA 5BQ7A 5B22A 1CDUA 3REWB 3WLWC 5LBSL 1UJTA 1CGWA 2B1HH 4GAYB 4RFEB 3NCFB 4H88L 4YBHA 1N5YH 3BP4A 3VXTB 2FX8L 4PY7A 1BIHA 1KELL 4LVOC 4R7DA 5K9QI 1KOAA 2R1YB 1K8IA 1ZT7A 4FFZL 1OP3H 3P4LA 2PTVA 3IXTA 1FLTX 3HAEA 4XBPB 4YHYB 1UXSB 2CDGB 4WJ5A 4PG2C 5DWUL 2R0LL 3MNVB 3DXAA 1KPVB 3UJIL 1IL1A 2IF7A 4EIGB 5F9JA 5MENB 1C5DA 4GSDL 4YDVB 5JOFB