1MCSA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcsA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcsA02
5GRWA 3BIKB 2AJUH 1RZIB 2EDKA 3WO4B 3WDJA 4XWOC 4YBLC 3NCJL 3TEUA 1GGUA 1KEMH 3RIFF 3T8XA 2AXFB 1IEBA 2ICWI 3MJGX 4XCCL 4XP4L 2DQHH 1YNLL 2DM4A 5ICXA 5TDPB 1P4IH 5F96L 1LWRA 1YQVL 4LMQI 4O9HH 1ZHKB 3B8YA 2XNAA 3VXUB 5EOQH 5DJCB 4BFIB 3SKNB 4HKBA 1PLGL 1YNTA 3VFSB 4QYOB 1X5ZA 1YY9C 4OUUA 1GL4B 4YFLI 1NGQH 4X5LA 1NCCL 4JFQB 4Q7DA 1F4WH 3WDHA 5JW4N 3ZYIA 5TDOB 5HVFB 4O00A 4NRXB 5FF6A 3SDXB 4GXUM 2Z91A 5HHVL 1J0ZA 1AY1H 2CIIB 2NLJB 3GUTA 5CEZL 2PTTA 1MWAB 3RWEA 4ZTPH 3HHRB 3CK0L 1NFIB 3T0EB 2JK5A 2YUZA 2XZQL 4I0CC 3KWWB 1NBVL 4W4NA 4Y2DB 4KHTH 1G7LB 4KXZI 1AKJB 5IB5B 4LCUA 1IQDA 4HK3N 3ZSTA 4LSRH 3CLFL 4CMMB 3GSOA 4U1IA 4BUGA 5EU6D 3BYTA 3L7EA 4LASL 5F9OL 3O4LB 5TQ0H 1MCDA 2Y07L 1PYWA 2QSTA 4AG4H 3AY4A 5CGYD 1PKOA 3T8XB 1IEBB 4NT6A 4KH2A 4MVBC 5ICXB 3HFMH 1RMFH 4PBVC 4BQ8A 4N0FB 2C3GA 2F5AL 2XNAB 4HD9A 4OF3A 4XRCA 3HE6C 1H5BA 4MD0A 1I3VA 1JRHL 3MV9D 3D9AL 1AD9A 4KRNA 4HKBB 1YNTB 1OAYH 4A6YH 2OK0L 4OUUB 4HH8A 4HWEL 3KPRE 3HLAA 4MA8H 3DETC 3TF7C 4NN5B 4YHZH 1IRAY 3C09B 1QSFD 3CFCH 4KVNH 5FF6B 4IRJD 1GOFA 1Z3GL 4N1HB 4NBYB 2Z91B 4WTWA 3TO4A 3QYCA 5SV4A 4ODXA 4FP8H 3GUTB 2PTTB 4YUEL 3WYRA 1JF5A 4P4KD 3NH7L 4Z18A 2ZKHL 1SJVA 2BSTA 1L7IL 2JK5B 1AGDB 4TSBH 4LCUB 5AYUH 2IQ9L 4L9LC 3RVTD 4XP6L 4OCMC 4GQ9L 3ZL4H 3GSOB 3PDDA 4U1IB 2JTDA 3S36X 2WUCH 5AZ2H 3L7EB 4CVXA 4YR6A 4PGCA 1Q9OA 2EDFA 3C60C 3HRZA 1PYWB 4LOUC 4N9OB 4DGVH 4S1QL 1WCBA 4OFDA 5EC1A 2BZDA 4HAFA 4NT6B 4RFOL 4GSDL 3T04D 3FZUD 3TPKA 1SQ2N 1GJIA 4P3CH 1H5BB 4MD0B 1AGEA 4D0DA 4EBQL 1AD9B 4L29A 4EOWH 2EZ0C 3BKML 2HT3D 4AJ0A 1X6LA 1XGPA 2H32H 4L4VA 1RURL 2P8LA 3HLAB 3VA2C 3NTCH 4GBXA 3LQAL 2X2YA 5KAQG 2OP4H 3MA9H 3SPVA 1N26A 1K8DA 4TPRL 5AZEL 3OB0H 3ZKXC 2X44D 2NW3A 3IRPX 3K2MC 3ZHLA 3LEYL 3QQ3A 3AGVA 3WNKA 3QXVA 2MJWA 4RMUA 2WV3A 4K3JH 4ODXB 2WWKT 1DQLL 15C8L 4XP9H 3RHWK 5GSVA 2DI7A 5T3XE 5D7IF 4JFPA 3IFPA 1FSKB 1YJDL 2PXYD 5D2LA 3OB8A 2BSTB 4X6FA 4P2QD 5JXEA 3Q5TA 2IBZX 4L3CA 4QHMA 5FO9A 4MA3A 1U2CA 4PJAF 4J23A 3S5LA 4UIMB 2DM2A 4FQQB 1RU9H 1X4ZA 3C5JA 1QSFE 3QAZB 1FHGA 3V0WH 3WIIL 4CVXB 4YR6B 4PGCB 1XFPA 1Q9OB 2CXGA 3HG1E 3HRZB 2JIXD 2C3HA 1DCLA 1WCBB 1TNMA 5EC1B 4G42A 3MJ8A 3NIFE 5CGTA 4F8QA 2FEEI 4ZXBC 1UM6H 3ZO0A 1ACZA 2VQUA 1HE7A 2APXA 5BRZA 4QXWA 4EVNA 1AGEB 3VG0H 5F1NA 2A9NH 4D0DB 2UZYB 4L29B 1HHKA 2RHEA 1NANI 2GKIA 2NXZB 5F7HA 4O5LH 4DWHA 1XGPB 4P5TA 3QUXA 2R1YA 3F7QA 3QDHA 2P8LB 4GBXB 5EO0A 2HYMA 3O8XC 2EC9U 3NPSC 1B4RA 2YD9A 2Y06L 1GC1L 3HPLA 3SPVB 5H2BA 5JZ7D 1K8DB 4HK3J 2NW3B 5JQ6L 4NM4H 1N6QH 1TETL 3QQ3B 1A7PH 2IFFL 1ZLWK 1WSST 5AWNH 1Y18A 3WKMH 2E8ZA 3CX5J 3MOAL 3QIWC 3S9DB 3IFPB 4V2BA 3ZKQD 4ZAKD 3KYOA 5D2LB 4X6FB 4NZUH 3ARWA 4L3CB 2A9ML 4QHMB 4MA3B 4Y4FD 5EBLA 5FO9B 1NCDL 4PRHE 2WP3T 3S5LB 3AREA 4YHPA 2C4FT 3K1KC 3NAAH 1OL0A 3CZJA 4PJ8C 4HLZG 1BAFL 3C5JB 5C9JA 1NC4D 1L6ZA 3EYVA 5D2NA 4PJ9C 1HDMA 1EHAA 1UG9A 2OR8A 1MFBH 1D6VL 4G42B 1RD6A 2IJ0C 3QJHA 3MJ8B 2QHRL 1J12A 3EDDA 2X40A 5BRZB 4EVNB 3ARBC 5F1NB 5I73B 1T5WA 2AEPH 2XICA 3VGDA 4N5UA 3VGBA 4HS3A 4P5TB 3QUXB 2R1YB 1A6ZA 4Q6YA 3MLVH 1N3NA 4WWKD 4HXBH 2X6MA 5EO0B 4IRSC 1F2QA 1HHJA 3HPLB 3QFJA 5IBTL 1EV2E 1NAKH 1XCQB 2AW2A 5C0AD 4MDIA 1FO0A 3LS5L 5F71A 4OIBA 4JDZA 4PJDE 3H9SD 2A6DA 4XPFH 1Y18B 4GLRI 1QLEH 4X7TA 4NJ9L 4OBRA 4WO4C 2XWTA 3QEGH 2IAMD 5AUMA 3RVUD 3KYOB 2DL9A 2XKUA 3P30L 2XZCH 2CRMA 3INUL 3L7FA 5EBLB 2A83A 3EDJA 1CF8L 2VLRD 3AREB 4YHPB 5FM5M 1ZGLA 1KUMA 4UDTA 1KB5L 1UACH 5C9JB 4X8XA 4E42A 3VXSA 2BHYA 3EYVB 4G9FE 5IFAH 4E41E 1HDMB 3B4NA 3FT2A 4ODTH 4PJIF 4NWTL 4BUHA 4CN6A 4P9HC 4U6YA 1PAMA 5T1DL 2ZUWA 2R4SH 3MROA 3CDFA 1S9KC 5ISZE 3QJHB 1KCRL 3WE6A 3UTTA 2OTUA 4F57H 4NQXA 3ARFC 1Q8MA 2ESVE 3CVHL 3TA3C 5D70L 4KROD 1T5WB 2E9JA 3C6SA 1NCWL 1P7HL 5GJTH 4JFHD 4HS3B 4R7DA 5I66A 1A6ZB 3BT2H 3FN9A 2PUQT 5HHMD 2XG4A 5TH2A 4F7EA 1S8DA 3LRGA 4KUCF 3DSNA 1F11A 4PB9L 1HHJB 3QFJB 1BD2D 5LBSH 1CR9L 4MDIB 4OT1L 2W92A 1FO0B 4JDZB 2A6DB 4B50A 2GW5A 4X7TB 2Y23A 4H20L 4A2LA 3AM8A 2J88H 4LSPH 1I7RA 4F37F 2XWTB 1KIRA 3LEXA 1KTRL 4M93C 5AUMB 5FYJD 3P0YH 2XA3A 5EC2A 4YFLF 3L7FB 3CU7A 2A83B 2D9QB 4DQOH 2FECI 4LEOA 2DBJA 1HI6A 1A7BA 1UCBH 2Q3ZA 1ZGLB 4QTIL 2CRZA 5HYJD 4UDTB 1MLCA 3R0NA 1BWMA 3QUZD 3VXSB 5I8KH 4MQSB 3THMH 4OGYL 5JLZA 3FT2B 3TT3H 1EGJL 5C0AE 3CVHA 2H9GB 2R0ZH 1QBML 3D39D 3O3BB 4LLQA 4WTZG 4U6YB 1KCSL 4YHOL 5DUML 3HNSH 3KXFD 3MROB 3QI9D 4FQCL 5CJOH 2AJSL 2LFGA 3WE6B 3UTTB 2OTUB 4KMLB 3TVMD 4MNGE 4FQXB 4NQXB 3WD5L 4M6OH 3G6JA 1NLBL 2W59A 4RISL 2R56H 3C6SB 4YZFF 5CZXC 2VLRE 5KVFH 4R7DB 5I66B 1X5IA 1J8HA 5TH2B 4F7EB 1S8DB 3C87A 4M3KB 3CNKA 2OJEA 1F11B 4Y5YC 4DKEL 1EJ6A 5KS9F 2V5SA 4G80A 1RUQH 3K46A 3MCG1 4PJ7A 1NAML 4NKQB 4Y1AA 2WBJC 1DUZA 1TIUA 4P9HH 4POUB 2AK4A 5EPMA 3RTQD 4G7YH 4KKAC 5HHOE 1I7RB 1D9KC 1KIRB 2N4IA 3OJDA 3LEXB 4K7PX 1X3DA 4YXKL 1S9WA 2OS7A 1A5FL 2YWZA 4HPOH 5EDXA 5EC2B 5DO2C 1ZEAH 5GGTL 1EGJA 3FO9B 5DHVA 1S5IL 2F53A 2J8UF 4LEOB 3T2NL 1HI6B 2DWDA 4ORGA 5TPWL 5HHME 5IVXB 4I2XE 5JIKA 1U8JA 3MRPA 1FE8L 1MAMH 1SY6H 1MLCB 4PS4H 3UTPE 5JLZB 4NO0A 2ZUVA 4GS7C 4LVHB 2OR7A 1P53A 3CVHB 5J56B 2W9EH 2AQ1A 2GJZA 4LLQB 1N2RA 5GGQL 3QXTA 2AJVH 4Z6AT 3SGJC 1BIHA 3HC3H 4HBCL 5I15H 5C08D 2KQMA 3G5YA 4Z7NF 3BGFB 2N7AA 3EUUA 5FYJE 3G6JB 1GXEA 3MYZA 3O3DA 5BZDA 2DIBA 2DYPA 5E2WH 1XIWC 5SWZA 4YDLB 1CGTA 1J8HB 3BDXA 2OM5A 2OJEB 3TYFA 3FFCA 1IC5L 3GMLA 3WFCH 2NTFA 1NGXB 4G80B 2HWZL 4EI6A 2QSQA 4PJ7B 4WCYH 4D94A 5K9JL 5JW5A 4Y1AB 1DUZB 5GGTA 5D7IE 3KXFE 2WWKO 1PZUB 5DEZA 2JCCF 3G04A 3C08H 4Y5XC 3OJDB 1BP3B 5FECA 1KCUL 2O5YL 4WUKL 1S9WB 4PJAE 3KJ4B 2LU3A 5DHVB 4BFBD 3BRDA 2C3XA 2F53B 3PWPD 4G3YL 3VA6A 2DWDB 3HMXA 1C5CL 4GW4B 2VLLA 1U8JB 3MRPB 1IKFL 4Z8FH 1U3HC 4KK6D 3MBEA 4XNQA 4NO0B 2EYRA 1MJJA 4H1LH 4PGDA 2GJZB 2VB5A 1J11A 1N2RB 1R24A 4JDTH 4YJZL 1LD9A 1A7QH 1MHHA 1UJ3C 3RP1A 2Q1EA 3BGMA 1U95A 2DS4A 3UTQA 3G5YB 4TVSa 5D6DC 2DTSA 2V2XA 3TV3L 4AEEA 1U8MA 2DMKA 1XZ0A 3Q3GB 5C0EA 4BZ1L 3D48R 3WJJC 2D4FA 5B38A 3O3DB 5BZDB 3T3MF 2DYPB 2ADJA 1SEQH 1S9XA 1ZTXL 4WW2A 4TRPH 2NY7H 4Q0XL 5ITBH 4KAQH 1W72L 3MLYH 2VXQH 3TYFB 5F7LB 2YUVA 3FFCB 3MBXL 4M7JH 5IR1A 3GMLB 2W9DL 1BOYA 4Y89A 2NTFB 2APVA 2YOCA 4EI6B 3DO3A 4LQFH 1GRWA 1P9MC 4CGTA 2GSIA 2C3VA 4U1KA 5JW5B 5E8OA 3QT2A 3WO4C 2YXMA 1QFWM 5C08E 4JN1L 3MRCA 2FH6A 4CRPA 3UYRL 3ESVF 2ARJA 3O6MH 4JY5L 4NPYA 3G04B 1UFUA 2MHAA 2DQJL 3L3IA 3MQIA 2X41A 3VG9C 1NCBL 3CGTA 4WFFE 3MACL 4GG6F 3BFOA 4NNXA 4KUCD 4UOW1 2M26A 4M6NH 4G8EA 4WU5A 5F3HA 2VLLB 3BW9A 4X83A 4R6UA 3S37L 4TVPH 4XNQB 3MBEB 4IM8A 3QNZA 1MJJB 3SEPA 4MCZA 4DFIA 4PGDB 1R24B 5D1QA 1LD9B 1MHHB 3BGMB 2RIKA 1U95B 3QWOA 3UTQB 1PX3A 2V2XB 3WFEL 2D31A 1U8MB 1T2JA 2AXGA 1E6JL 3ISWA 5C0EB 4NKIH 4NOBA 1TJHH 4B5EA 4X4XB 5B38B 4ZUWA 4ZFGH 3T0EC 2ADJB 4NKOA 1S9XB 1JTOA 3LCYA 4WW2B 5CJXA 3KLHD 4APQC 2I27N 4PJ5A 1VGEH 2GT9A 1RULL 3NVQA 4OFIA 5IR1B 1CFVL 1L9NA 3IU4L 1P5UA 3PXJA 2N1KA 2GSIB 2C3VB 4YGVB 4U1KB 4KTDH 2FZ3A 4TSCL 4HKZA 5E8OB 3MLWL 4GW5A 2B4CL 5J3HD 2C1PA 2R29H 5F7DA 4W70A 2A77L 3MRCB 2YPLA 4PRPA 5FB8A 2ARJB 4HMEA 3QUML 5C6TL 5KJRL 2MHAB 3L3IB 3QUYA 5HI4C 3OAYK 2WMPA 1XR8A 5CD3A 3VD3A 1WZKA 3ULVC 5GGSY 3P0VH 4NNXB 4KV5F 1KENL 1PW3A 1MRDL 4G8EB 4WU5B 5F3HB 4PJIE 1Q72L 3BW9B 1IGCH 1NLDH 4NN5C 3QNZB 2CJUH 4MCZB 3C09C 4KK5D 3ILQC 2KKQA 5D1QB 4LPYA 5IMOA 4JE4B 4Q9RH 1YNKH 3FO0H 1J9CT 3QWOB 1MFEL 3EOAA 3CCHA 3VFGL 1YEFL 5ACZB 1MCQA 3V4VH 2D31B 4MXQD 2AXGB 1VKXA 2QSCL 4XPAH 1UH4A 1JBJA 3VWJA 3DX8A 2J4WL 2JLLA 2CMRL 4U7KA 4ZUWB 1J0YA 1AO7D 4L4TD 4GXUN 5BVJA 1YEGH 2QEJA 4NFCA 1MFCH 35C8H 4HWZA 2R0LH 4XMPH 2HMID 1MY5A 5JIHA 3V4UL 5EH1A 4PJ5B 1P7QD 2GT9B 5E00A 3QUMA 4L3EA 2NY4D 3HS0A 3EYUH 4KQ3H 3KJ6L 1AXIB 1ES0A 2X89A 2FZ3B 4HKZB 4GW5B 3N85H 2C1PB 3BI9X 5F7DB 4WY7H 4ZQKA 2YPLB 2DQEL 3CU1A 4PRPB 2HVJA 1U36A 3AY4C 5FB8B 4F9LC 1FNAA 2YK1L 1OW0A 3QUYB 3PGCA 1XR8B 5CD3B 3B83A 1MWAH 1H5BC 3OMZA 3U9PL 5DR5H 1T03L 3MNZA 3S98A 3NCBB 4U6VL 4U33A 1BQHA 1N64H 3UZVB 1FC2D 4P4RA 5FOBA 5D7JA 1IGTA 4TNWK 3DYPA 3UJIH 5IJKA 2JJVA 4JQXA 5IMOB 1S78C 2XN9E 2EE2A 4X99B 5DUPL 2D0FA 5J1TC 3SKMA 4IBLT 3EOAB 4OQTL 2PF6A 3CCHB 1OTUC 5DJ2A 3TO4C 2F58L 2BFVH 3LOWA 4PBWD 4G8GE 4YZFE 1IBGL 1CLCA 1EUUA 4YBQD 1VKXB 3VWJB 3X3FL 3DX8B 5K9KB 4UNUA 1CLYL 5DWUL 4MHHG 3RI5F 1FSKC 5GISL 3ULVH 1B90A 5BVJB 5E24E 1JFQL 1HK6A 2R23A 4R9HA 2AGJL 4HWZB 3IJYA 5KS9E 2AAVA 3LKRA 1ZANL 1C1EL 3RVVC 1I1RA 5D1ZA 4QHUA 3TT1H 5E00B 3QUMB 1BFOA 2WINA 4L3EB 3HS0B 3G6DH 3EJZD 1IVLA 3QAZC 4U2YA 1ES0B 3BEWA 4S1RL 3WNLA 1F13A 3OGCA 4NHCH 4ELMA 2GAZA 3QQ9D 4ZQKB 1NEUA 2HVJB 3SDCD 1QLRB 5SWSD 2HFTA 2QQKL 3EYQC 1NGZA 3PGCB 4HQQH 4LVEA 5IMKB 2J8UE 1YMHB 4PPTA 2Z8SA 3T2OA 5C7XH 4GXVL 1AO7E 2I60H 1NC2A 2E7BA 2NXZC 3MNZB 1CBVL 4RAVA 2Y5EA 1A1OA 1BQHB 3PWJA 1AXTH 5HDQH 3NCJH 1MHPH 4GBXC 4P4RB 5FOBB 5D7JB 1IGTB 2Z35A 5D8JL 4JKPL 4KK9D 1NFDF 5C07E 4XCCH 3MV8D 4XP4H 2Y72A 4Z7NE 3TIDA 5F96H 1YQVH 3RGVA 1DZBA 43CAA 3SKMB 3P4LA 5DJ2B 3MRGA 4WI7A 5DMGD 5TGBA 1PLGH 3ZHDA 3H42L 3O2VL 1JNNL 4NUGL 1NCCH 5I1EL 2HFFA 3ZT6A 4Y8AA 2EDNA 3B5GA 5DQJA 1OVZA 5JXEC 2R23B 5D7LD 3HRPA 3NFPA 3LKRB 4HXAL 5C0BD 1IC4H 5D1ZB 4QHUB 5HHVH 4QRRD 1BFOB 2WINB 2XZAL 4F9PC 2RAMA 5EU4A 5CCKL 4AH2A 1BIIA 1WZMA 4L8DA 2YRPA 3BEWB 5CEZH 1UM4L 4LRNL 5KSAD 3OGCB 3R8QA 2ZG3A 3U6RA 4ELMB 2GAZB 3CK0H 3RL2A 2XZQH 4OZFG 4TVPE 4K23L 2P24A 1KCVL 1NGZB 3H9YA 2XRAL 5DURB 1PKQE 3LQAC 1VPOH 3JV6A 3BPNB 3SDAD 3O3AA 4LASH 5F9OH 5DC4B 5I73C 3NN8A 1NC2B 3LVEA 3GSUA 3IETA 2MOVA 4J4PA 4RAVB 4G6AD 2RB8A 4P5TC 3QUXC 1A1OB 3PWJB 4LFHD 3ARDA 5DS8A 2Z35B 4F33A 4P0DA 4NCC2 3TIDB 1I8KA 3RGVB 1YJDC 43CAB 3RNKA 2F5AH 1EUTA 1JRHH 3MRGB 3D9AH 5SWSE 5TGBB 5FYKD 3T3ME 2OK0H 1HNGA 1A1NA 4QHNA 4HWEH 2M8XA 3EO0A 2DOCA 3PE9A 1QSEE 2HFFB 1FG2A 5DQJB 1T7VA 4AQ1B 1KJ3H 3P77A 1WFOA 3SQOL 3TH2T 3NFPB 5KZCB 5MHSD 5EZIL 3AREC 2CK0H 1RIHL 2HJKA 2VLKE 5EU4B 2COQA 1BIIB 4L8DB 5D2NC 1MCKA 3GHEL 3MV8E 4XVJH 2P43B 4YUEH 4G6FB 1NDGA 1H8OA 3U6RB 5F89A 3HA0A 3NH7H 2ZKHH 3RL2B 1WZLA 2P42B 3QEHA 1EH9A 4P2RE 5IB1A 4GG6E 3VMOA 3W11D 4XP6H 3MO1A 4GQ9H 3V0VA 1GOHA 3JV6B 3ETBF 1GC1C 1FRGL 4JO2L 3O3AB 3QDGD 3RVWD 5D7LE 3BIBX 3GSUB 3IETB 4LLMA 4NGHL 4Y4KD 1A1MA 1MQKH 5C0CD 3ZKND 1PBYA 4X4ZA 4S1QH 1MRFL 5GHWL 3ARDB 2FH8A 1V3MA 5HYSA 5DS8B 3ARYA 3UZQA 4GSDH 3ARXA 1I8KB 1LO5A 3MUHL 4KDWA 2OLDA 3RNKB 1EHNA 4LEXH 5M95B 4P5MA 1ZLVK 3RAJH 4EBQH 2ID5A 1EAJA 2AKRA 3BKMH 3HI5L 4XI5C 1RZKL 1A1NB 3EO0B 1FG2B 3LQAH 1J10A 1BF2A 1VGKB 3P77B 1A6PA 4TPRH 1HOCA 3ALPA 5DFWH 3U0WL 3S35X 3LEYH 3KYAA 3GRWL 3L3HA 4LSDA 2DWEA 1MRCL 2FBJL 2HJKB 4OLUL 1R3IL 1QVOA 4MDJB 1DQLH 3PGFL 15C8H 3T0EE 4YWGH 2CUHA 2WNGA 1XGQA 1NDGB 1WCQA 4MLSA 5F89B 2CPCA 1YJDH 2WWMC 3E3QC 2QKIA 3QEHB 5IB1B 1OCWH 4KV5E 3O4LE 3MO1B 3V0VB 4OB5L 3EW3B 3RWJA 1KPRA 2VZVA 1FH5H 3WLWC 1YYML 2M1KA 2NY3D 1A1MB 2VUYA 4U05A 4UB0L 4QF1B 1MIML 5D5MA 1IAIM 4JY6A 2O5XL 4KWUA 1NEZB 3QDAA 2DDQH 5HYSB 3MRMB 1F4HA 2VRAA 1LO5B 1X5GA 4GKOA 3EJYD 4TULL 4P5MB 5ADOL 3U7YL 1BQUA 2AKRB 3AM8C 3WNPA 1G7IA 2WW8A 1A0QL 2DBLL 1PDKA 3QCTL 4HIEA 2MWCA 4LCCA 5FA3A 1TZIA 5IHUL 5EOCH 1GC1H 1RUML 4OZGA 3GSRA 2YSSB 2FHFA 1HOCB 4LDLB 1F02I 4H5SA 5C0CE 2IMMA 3UO1L 4XCEA 3L3HB 2HRPL 4JAMA 5BW7A 2DWEB 3BOVA 5GS3A 5JUEL 1BGXL 1OF2A 1QVOB 1T04A 3BDYL 1JPSL 1XGQB 3MOAH 1HINL 4LVHC 4NO2A 4CUCA 5C09D 1FO0H 3OAZK 4NUJA 2QKIB 5GS0D 2AS5M 2A9MH 2HT2C 1HQRA 1NCDH 1IL1A 3VXRA 3BGFC 2WIIA 4HDIA 2QLVB 1KFAH 1KPRB 2HFEA 3FAXA 4X6CA 1BAFH 3TNMA 5GXBB 1E6OL 1FNSL 1I3GH 1UH3A 2F74A 5L8JB 3DO7A 2PETA 4JHAL 4MSWA 4XPTL 3ZYZA 4YDLC 4MLIA 3V5HA 5D5MB 3SGEI 4JY6B 5EOCJ 3JWOC 4Q6IB 4G6KL 1PSKH 2NXYD 3OL2A 4G6ML 2VR9A 3V5DA 3G6JF 3BEVA 2HTKC 5T1LD 4UOW0 4ODUA 3BPLB 4BK4A 1G7IB 1BEYL 5E5UB 5KVDH 2R8SL 4HIEB 3SQBA 3GSXA 4LCCB 5GGVL 3PDOA 4W4OA 1FYHB 1TZIB 5FA3B 4TTGA 3KJ4C 3O9WC 3GSRB 4OZGB 5EULV 4BK5A 5C2BL 5IBTH 1TTUA 3VGGA 3S3SA 4H5SB 4ODVL 3ABZA 4XCEB 3LS5H 4JAMB 1AGFA 1N5YL 1OF2B 3BMVA 4ETQA 1T04B 2Q7NA 5DVNA 1WBYA 4WUUA 5F1OB 4ZUUA 4NO2B 1AIFA 5IFJA 2J12B 3DGGA 2H2PC 3P30H 4ZO6A 4NUJB 1KEGH 1CD9B 3INUH 1HQRB 1CF8H 1M71A 3VXRB 5DC0A 2CDEA 2WIIB 4HDIB 3D3VD 1Q9KA 1BQLL 5IVZA 1FPTL 4X6CB 1RFDL 2HFEB 3QDMA 3TNMB 4D0CA 2F74B 3DO7B 3N9GH 4MSWB 1A14L 4JM4L 4NWTH 5E03A 3U46A 2UZXB 3QZWG 5BS0D 3V5HB 1I1AA 2GJ6A 1NFDE 2HJLA 5T1DH 2ZCHL 3OV6A 5ID0A 1P4LA 3TLRA 1IMHC 3QO1A 4OLZL 5TQ2L 1KCRH 2BY0A 1KTKE 5DFVD 3V5DB 4LP5A 4NZDA 3BEVB 3CVHH 3ARGC 5DLMH 5GGVY 5GJSL 4L4VE 4XCFL 5D70H 1FNHA 3NMEA 4ODUB 4N0RA 1NCWH 3JUZA 2E27L 3BPOB 2EYSA 5MERB 1NGYA 3GSXB 1TVBA 1NUDA 3PDOB 1K4CA 4M00A 4U3XA 1MHEB 2M2DA 4PB9H 2J3SA 1IILE 1YC7A 2C5DC 1IQWL 5DJXA 5FO8A 1CR9H 1NJ9A 1MI5D 4O2FA 2BNQA 4FTVA 1AGFB 2GYSA 4ETQB 4X4YA 4JFXA 4HUMB 4WHTA 3JWOH 4H20H 1WBYB 4WUUB 3W0WE 5A1AA 2Y25A 4ZUUB 3W5NA 4UT6L 1AIFB 5IFJB 1KELL 4RMSA 3DGGB 3ZTJG 4Y88A 4YFDB 4MJ6A 4J7RA 4FABL 5HPOA 5SX5H 1M71B 5A2JH 2CDEB 3M8OL 5E70A 4DK3A 5DUBA 1Q9KB 5IVZB 1K85A 4QTIH 3QDMB 4D0CB 3PDGA 1EGJH 4TTDC 3U46B 5DHVH 4MA1B 3VD7A 1NGPL 4WW2C 5D7KD 2GJ6B 2H26A 2HJLB 1KCSH 1CE1L 4YHOH 5DUMH 4X7EC 4Z7VA 4GAGL 1P4LB 5ID0B 4DUWA 3QO1B 4FQCH 5HI3D 5BRZE 1AFVL 2AJSH 5AAMA 1OT1A 1CGXA 4I9WD 3ALWA 5E8PA 5JOPD 1A3RL 3ARQA 3WD5H 4ERSL 2DRUA 4RA3A 3QWRD 3Q5YA 4RISH 1X4XA 3K8LA 2FRGP 5K59F 3ZMRA 2VN4A 3AAZA 1ZHNA 3VFNA 4CDGC 2EYSB 4R4NC 5AEAA 4YHIA 1NGYB 1UKSA 3D3VE 1K4CB 1EFXA 5GS2D 4ODSL 2XXMB 3P11L 2BXZA 4DKEH 3VGHA 4HC1L 3TZVD 4XCYA 1G6RL 4OZHA 4X6EA 2H6PA 4FQIL 5DJXB 3IB4A 5FO8B 1NJ9B 1XT5A 4O2FB 5BS0E 1X5YA 1U3JA 4MVBD 2BNQB 4FTVB 5MEND 3BXNB 2R0KL 4X4YB 4JFXB 2D7TL 4EXPX 3NGBB 1QHOA 5JHDD 3RJDA 2CLRB 1GYAA 2WANA 5CWSA 4MQ7A 5D1QC 4MJ6B 2HAZA 4YXKH 3VFMA 3N50A 3CX2A 1R0AL 1RJLA 5HVHB 4RRPA 5GGTH 2E5EA 4X0KA 1ORSA 5LG1A 2VZSA 5K93A 3T2NH 5D2NE 4I48A 5TPWH 1IE5A 25C8L 1JI1A 5HGHA 1FE8H 1SVZA 3IVKA 4LSTH 3FT3A 1CFTA 4NQDA 1I8LA 4KPHL 4ESKA 1OP5K 3EFFB 1DFBL 4F2MA 4HMCA 1MI5E 5IIEA 4PB0L 5CJXC 2H26B 1KF9B 2JJTA 1QRNA 1CD0A 3V0AC 1J18A 3RBSA 1E4KA 2W0KA 4Z7VB 2AEIT 1QHPA 4Z78A 1GGIH 3GBLA 4AL8L 2NCMA 4HC1A 3I3BA 5HHXL 3AAZB 1ZHNB 2HVKA 3VFNB 3TN0D 4YHIB 3QFJE 4DKDC 3QUYC 1EFXB 4A2MA 4HWNA 3BH8A 1IC5H 4OBSA 4RIRA 4XCYB 1LEGA 4OZHB 4X6EB 2H6PB 5E9DA 1WJ3A 1DTUA 2HWZH 3SKJL 3KPLA 3EDKA 1TQBB 5I30H 1B0RA 5K9JH 1TXKA 3MFFA 2LU4A 4MJIA 2ZP0T 1EO7A 4LCWE 2EEAA 5HYIA 1HXYB 4WI9A 4I3RL 5CWSB 3IDXL 3IDIA 4LPUA 5DD5L 4MQ7B 4IMKA 1KCUH 3VFMB 4WUKH 5FHBL 3RIAF 1RJLB 1RSFA 1ORSB 1V5JA 4G3YH 1ERNA 3VXMA 1GGCL 2EDYA 2PKDA 4I48B 2LTQB 1C5CH 2KPNA 3VWJC 5HGHB 2DD8L 1IKFH 4P2OA 3IVKB 4KTEL 2NX5E 3FT3B 5DD1L 1CFTB 4KJWD 2EH7L 4NQDB 2NQCA 1FN4A 1D5MA 3W82A 3DI2B 4F2MB 5IIEB 3DV6A 1DVFC 2B4CC 1QRNB 4QRUA 1ZWIA 1JE6A 3UTTE 4CL7A 4N90D 3WBDA 4Z78B 2EXWD 3TV3H 1YECL 4V1DA 4EQ2A 3MRBA 3LKPA 4ZOCA 1ZLSL 2XQYK 4BZ1H 2VLMD 2X4NA 2HVKB 4XZUA 3MLRL 3L5IA 1VEMA 2FGWL 1OW0C 1VFBA 3BD5A 4CADA 2BRRL 3HN3A 3BH8B 4HUKB 3VCLA 3EO9L 4RIRB 2W9DH 1LEGB 1QFWH 3FB5A 5E9DB 5IV2A 2NY5L 3KPLB 2FO1A 1HYRC 4OD1H 3VDCA 4NQED 4JFDD 3MFFB 4MJIB 4JRXE 3UYRH 4NN7B 5D7JC 4JY5H 1LO2L 3IDIB 4R2GB 2DQJH 5IWLA 3C8KA 5IJKC 1NCBH 4JQXC 3MACH 1QBLL 4I0PD 3RWHA 1N5AA 1FP5A 5T1MA 7FABL 1I1FA 3VXMB 4KQ4L 3HE7D 4ZPTA 4P2OB 1M7XA 3S37H 4UAOB 1KOAA 2BVOA 3QCVH 5E2VL 1FN4B 1D5MB 1JPTL 4ZD3L 3DV6B 2XY2A 1ZWIB 4QRUB 3UBXA 5DJ8A 2FGZA 5D1ZC 3G6JE 5EA0L 3VU2A 4ZUVA 1E4JA 4AENA 4GRLA 1T6WA 2P5ED 2PO6A 4E5XA 3WFEH 4V1DB 1FBIH 1MCJA 4KKLD 3MRBB 3LKPB 5D7SL 5E6YA 1XAUA 2HKFH 4S0SD 3G5VA 2X4NB 1FVDA 4MD5B 1Q0YL 4U6TA 4XZUB 2NY0D 4F3FA 4RWYL 5HI5D 2VDKL 1VFBB 4CADB 5A3ID 5CBEA 3VCLB 4BELD 3RPIA 4L8CA 3BPNC 1EO5A 1CFVH 2AK4E 3FB5B 3PABA 5IV2B 4OLXH 1J0IA 5H94A 1J1XL 1TDQA 4TSCH 3LEVL 3MLWH 2B4CH 1FV1A 4ELMF 2A77H 3CFBA 1U42A 1DE4A 2Y36L 3QUMH 5C6TH 5KJRH 4U7SA 2VDRL 3HZMA 5CAYB 1KJ2L 3RGVC 2VLME 3RWHB 3VFWA 1N5AB 1CD1A 3EDEA 2UWEA 4MB5A 5T1MB 2ZUXA 1I1FB 1MRDH 3GEWB 3BE1L 1CGUA 2EE6A 4ZPTB 1GCFA 3L5XH 2BVOB 5HD8D 5C6WH 5J6HA 5JA9A 2ZSVA 1Q0XL 4DJMA 3BKJL 1WLHA 3LPGA 3UBXB 2NY6B 1DDHA 1YMMD 5DJ8B 4IIQA 1CTOA 4ZUVB 1MFEH 1K2DA 4AENB 4GRLB 2PO6B 3VFGH 4E5XB 5B4MC 3VH8G 1YEFH 2ZCLL 3FQUA 3HR6A 2VNCA 4XMKL 4G6JL 4WI2A 2QSCH 5EU6A 3GKWL 1UC6A 5SWZE 2J4WH 2CMRH 4GAYA 3VD5A 2HTLD 1DN0A 2R2CA 1BJMA 3G5VB 3DUUA 3DYMA 1FVDB 2VZUA 3FFCE 4F3FB 1A22B 3V4UH 3BESR 3MGOA 3ZT7A 3F7VA 5CBEB 3RPIB 4L8CB 5FGCB 4MGXA 5TE7L 5JMOC 4JGJA 3PABB 4X98A 5J4MA 5EB9A 3KJ6H 5H94B 3MV9A 5CGMA 3GB7B 4J4PC 5EZJA 3NCMA 1FV1B 3EHBC 5L6YL 2JE8A 4FFYL 4Y0GA 1DE4B 1R5VA 8CGTA 1EERB 4ZDHA 5FM4A 3SJVD 4FQ1L 1QSFA 1GPOL 3HZMB 1AE6H 2AI0H 3MRLA 2N56A 4IRJA 1IGFL 4Y19D 4XB8A 3HG1A 1CD1B 4P59H 4X9IA 2UWEB 3U9PH 1T03H 3NFNA 3GIZL 1T1ZA 3KPTA 4U6VH 4K3DL 2XQBL 4Y8DC 5J6HB 2IBBA 5I8CA 3MLUH 2ZSVB 4P4KA 5J06A 4N9GA 3JV4A 3OR7A 5J13B 4QT5A 1X6NA 2IANE 2FHCA 3MPCA 1DDHB 1FYTD 5DUPH 2Q8BL 3HKFA 4IIQB 4W68A 1K2DB 3O2DL 4FG6D 4JEGB 2F58H 3FQUB 3QISA 2OQJA 2YWYA 4JQVA 5F6HI 4QOKD 3ROLA 3WN5A 4WEBL 1IBGH 1YDPA 1OQOA 5TF0A 5K59E 3X3FH 1YUHA 2J8OA 4GAYB 1DN0B 5DWUH 1SEBA 2E6PA 3DUUB 5GISH 1J88A 3MRDA 3BZEA 1JFQH 2AGJH 3VGAB 1OTTD 1BQSA 5E08H 2Z31D 5EBGA 1K3ZA 1FNLA 1KN4L 3F7VB 4HUXA 4ZO9A 3ARTA 3RU8H 2J8HA 4X98B 3R1GH 4CN4A 1HYSD 3MV9B 5K9QI 3UAJC 4KZEL 5HDBF 5EZJB 5LGKA 3EYSL 3UJTL 4K94C 4PRHA 3NZHL 3CJJA 5ILTH 2BSED 1R5VB 4ZDHB 2X1WL 2QQKH 5E0QA 4XP5L 5IVNA 1QSFB 4R4FL 3MRLB 3PXHA 4IRJB 1CDIA 4GXVH 1NUFA 1WK0A 3HG1B 4JDVA 3S5LG 4J12A 1V7ML 9CGTA 3LIZL 3NFNB 1H3XA 5IBLD 1T1ZB 1CBVH 5FYJU 3TJHC 5DMKA 4M6ML 4XHJD 3O2DA 1G1CA 5I8CB 1NPUA 4P4KB 3S88H 2PXYA 2BNRD 3B2VL 1R3KA 3OR7B 3JV4B 4N9GB 4P2QA 4KKAD 5CSGA 1H3PH 3EAKA 4QT5B 1EPFA 1NSNH 1HQ4A 4RWHA 2L7JA 1YEJL 4Q9BA 5TFSL 1C7TA 4X7DC 2OQJB 1KYOJ 3BN9D 3ROLB 3ZLQC 1YDPB 1OAQL 3H42H 1YUHB 3O2VH 2V5YA 1SEBB 4NUGH 1UZ8A 1OD7A 4PJ5E 3MRDB 4RMRA 4P57A 1P84J 3RWCA 2JIXA 3BZEB 2EDHA 4ZO7A 5IVOA 3VMPA 3UX9B 3PGDA 5FKPA 4NZTL 4HUXB 2A1WL 4HS8L 4NNPH 5CCKH 4M4PA 2YPLE 3RVXC 1KN2H 1OT2A 3MLZH 1UM4H 4ZOAA 1FYTE 3BSZL 1HH9A 5CJ8A 1DQDL 3GKZA 1BM3H 1ZT7A 4PRHB 4FQ2L 2BOCA 1MCOH 5I0ZA 2ADFL 4K23H 5EBWA 4M5YL 1KCVH 4QOKE 3QFDA 4KJQD 1RZKC 2XRAH 4G9DA 4HGWA 1J86A 4JVUA 2ZNXA 3D2UD 4JDVB 3OF6D 1PJ9A 3BPLC 5ESVA 3KLAA 3WIHL 5DMKB 4LCCC 4NKMA 5D1XD 3T65A 4ZAKA 2PXYB 1R3KB 4P2QB 4Y4FA 2HFGL 4UQ3A 4YX2L 5DYOA 2B0SL 1HQ4B 4UU9A 5BW7C 4K94H 4C55A 1AGBB 1ZT1A 4POZC 5JW4M 5F9WB 2E9BA 1RUPL 1UZ8B 3LB6D 1UYWH 4PGEA 4OZGF 4KHXH 3RWCB 2JIXB 4PJDB 3DV4A 3SQOH 3PGDB 3TNNA 4FFZH 5EZIH 5L2KD 3JV0A 5DQ9A 1RIHH 2Q6WA 4QCIA 4HCRL 4JLRA 5DEGA 1ACYL 2B39A 3GHEH 1D3CA 1E28A 3A0OA 4OIIL 1JZ5A 4PRIE 1HH9B 4PY8J 4WHYH 5DVOA 1ZT7B 2BOCB 2GSGA 4EIGB 2CGRH 4WWKA 3WXWL 2AK1L 1X5JA 2ZCKL 5EBWB 2XTJE 3KPPA 3CUPA 3H9HA 3QFDB 4G9FB 4EEEA 4HGWB 2DLHA 5C0AA 4X6CF 4N5EC 1FRGH 4XC3L 5ESVB 5GZNC 3KLAB 2ERJB 2IC2A 3BPOC 4NGHH 5FUOL 4PGJA 5HY9A 4DFHA 3O3UN 1MRFH 4NKMB 2D3VA 2IAMA 4W4OC 3T65B 1HIMH 1RZGA 4ZAKB 4KRLB 2Q20A 3GI9L 5FUZL 4Y4FB 4UQ3B 1I8IA 5DYOB 3E6FB 2VLRA 4IEFB 4UU9B 3CC5A 3KPOA 4XP1L 3AU1A 3BN3B 1TZHA 1TQCC 3VXUD 5FYJL 5I1HH 1ZT1B 3X14A 1AD0A 4C83A 3HI5H 3WFZA 2BDNH 1RZKH 4LAQL 3QG7H 3NFSH 4PGEB 4O4YL 1H8NA 1UZ6E 1LO0H 3LKSA 4LGRB 3BMWA 1WIPA 3ELAT 3U0WH 3TNNB 2NR6C 3GRWH 5A2FA 5DQ9B 3QEQD 2Q6WB 2FBJH 4QCIB 3SDYH 3K8MA 1DBKH 4JZJA 2EDRA 4OLUH 1M7DA 1R3IH 4JLRB 1D5XA 4ELME 1BFVL 1JGLL 1MOEA 3PGFH 4JQIL 5DEGB 3ZYJA 5IGXL 1E28B 4ZNEA 1I1AC 2GSGB 4FFWC 4WWKB 1B2WL 1WAAF 3RIFK 3KPPB 3CUPB 3H9HB 4Y2DD 1EO8L 4QO1A 4TUJA 3E6HA 4WEMB 1JYWA 4OB5H 3Q2CA 5C0AB 2FWOA 2DAVA 2P8MA 1I7TA 4BYHA 1N4XL 1IAIH 1WEJL 3T2PA 1MCWM 3C5SA 4V2CB 2EEDA 5L2KE 4UB0H 1XGTA 5HY9B 3UTOA 4MJ4A 2O5XH 2IAMB 3EOBA 5IK3A 1RZGB 2CQVA 3IF1A 2W1NA 4XVUC 5CLTA 5I1CL 5CKGA 5JQHC 1KGCD 5HI4D 1I8IB 4UT7H 2VLRB 3KPOB 3AU1B 5GRJL 3DHJA 4TULH 1TZHB 4RFNB 5ADOH 3U7YH 3KNBA 5K33A 4L5FL 5E4IA 3X14B 5HYJA 3NGBC 1AD0B 3HE6B 4C83B 1NMBL 3NCEB 2DBLH 4ORZC 3KYKL 3QCTH 5BO1H 1QACA 2NZ9C 4S11A 5IHUH 1SVCP 1IT9H 1RUMH 1TZGL 1QD0A 1EMTL 1MCEA 5HVHC 1JNLL 4YDKL 5D7IA 3KXFA 3LKSB 3QI9A 5GRVL 3GK8H 3ILQD 5KG9A 5CZKA 2VXTL 3TVMA 2E8YA 5JUEH 3LQMA 2CSPA 4QKXB 4JZJB 4BFGA 1JUFA 1D5XB 3CIQA 3K7UA 4PJAA 4KROB 32C2A 1MSPA 4XCNA 5B3JF 2A38A 4QWWC 1FVEA 1HINH 5E2JA 4HWUA 2FO4A 6FABL 5HHMB 3RKDC 3RZCD 2D7OA 1RUAL 4OJFL 2EKJA 5M7QA 2P8MB 2VITA 1I7TB 5E8DL 1E6OH 1FNSH 4RDQG 1JZ8A 4OCXL 4JHAH 5EU7C 3C5SB 3TP4A 4XPTH 5DA0B 5DVKA 1JV5A 1XGTB 3VI3F 3QEQE 4KK8C 3EOBB 5IK3B 4CJ1A 4OM1L 3IF1B 1VSCA 3AC0A 2O26U 4G6KH 4G6MH 1QZ1A 4TNVF 1PG7H 1TQBC 1AQKH 1ZKAA 4ODWA 1QSZA 1O5DT 3KNBB 5HYJB 1BEYH 2E6QA 2R8SH 1RK1A 1YY8A 3J8F7 5E5RB 4OF7A 4DK6A 3T77A 4K55A 2R39A 4B41A 5C2BH 5D7IB 4JRYD 3WFBL 3KXFB 2NY1D 5C08A 1MREL 3CX5K 3S36L 4ODVH 5KG9B 4M7KL 3TVMB 2LTQC 3V7AE 5HDBE 1JUFB 4PJAB 4NWUH 1UQSA 2QADB 1I8LC 32C2B 2MKLC 3RJQB 1FVEB 1DBBH 3CDYA 2JJTC 2FO4B 1E4KC 3B9VA 5F9AC 2CD0A 5ICYA 2B2XL 4Z76A 1EJOL 3U4EA 1OLLA 1FPTH 2VITB 3SY0A 1RFDH 3P9WB 4YHKL 4DOHE 5ELIA 5LAXA 4JM4H 1JHTA 2UUDH 1JV5B 2VDPL 4OI7A 1BHGA 2ZCHH 3FOMA 1UT9A 1IFHL 4ZYKA 3SOBL 4TOYL 3C8HA 4K2UH 1CIDA 2RCSL 1OARL 2YA0A 4XGZA 3PWPA 1S7XA 5GJSH 2O61A 4XCFH 4XPBH 4JB9L 5IT2L 2E27H 4NN7C 3WSQH 2VDQL 2IG2L 5B38G 5ALCL 4R2GC 1RK1B 4CVZA 1YY8B 4IMKC 4M8QA 4AK1A 3T77B 1JYXA 2EC9T 3UYPA 1IQWH 5C08B 3CH1A 4ODHL 2ADGB 1H15A 2G5RA 3F7PC 3QNXA 4P2OC 3SBWA 4WEUD 1UQSB 4UAOC 4UT6H 4N0CC 5L7XL 2A74A 4FABH 4PJIA 3CH8A 5ICYB 2D4DA 5JXED 1U8PA 5GRXG 3MOBH 4Z76B 1MPAH 3E0GA 5ID1A 3RBGA 3U4EB 2AEWA 3BKCL 3SY0B 1N6VA 5I1JL 3MGAA 3ZYOA 3E8UH 4XNZB 3K4AA 5D72L 5LAXB 3V52L 1KLFA 4YEEA 1JHTB 2G60L 4C4KT 1CFNA 1CE1H 4LARL 2PW1A 4GAGH 3V95A 5L8KB 3DVGA 1LVEA 4ZYKB 1AFVH 3FO2A 2WQ8A 4HWBL 2MQ0A 4HGMA 3MXWL 3T1WA 3GSNL 1A3RH 1QLFA 5EU5B 4ERSH 3EOYG 4XGZB 3PWPB 1S7XB 1TVDA 1K8IA 2O61B 2EDWA 1RJYA 1II4E 1J1PL 2UYLA 3HC0A 4OZGE 2NYYC 4IS6A 2ICWA 3JWNC 4OLWL 3OHXB 5T3ZD 4CVZB 2H41A 5IWLC 2VABA 1S7SA 4XAKD 3QUXD 4M8QB 1LO4L 4ODSH 1JYVA 1NBQA 4FMKA 2LE9A 4HC1H 4L1DA 4UI2A 5BCAA 1G6RH 3CH1B 2BSSA 1H15B 2AJZA 2Y9RT 2R0KH 3QNXB 4KGLA 1ZSDA 4C56D 5CZVL 1EFQA 2D7TH 4F15B 4HUWA 4S0TD 1C7SA 4OCRL 4OCWL 1G7PA 1GIGH 1F45A 5DT1L 3O6FD 3S34L 2A74B 2C4XA 1R0AH 12E8L 5E8NA 4PJIB 5JMRA 4X6CE 5L2JA 1U8PB 4GRLC 2PO6C 4G5ZH 3BQUD 5F7MC 5ID1B 5E4EC 3AS0A 1I9RL 25C8H 2P46B 4LPVA 1DBJL 3U1SL 4RGMB 2NY5C 3GSNA 3MRRA 3CXDL 5E6ID 5EIIA 4M02A 4PB0H 1PG7W 1CFNB 3L1OL 2DLGA 5C92A 2OZ4L 2PW1B 5FK9A 4B7IA 3DVGB 1C08A 2AV7A 1KBGL 3KHQA 1SYSB 3FO2B 2HN7A 3PJSA 4PP2A 3SCMD 2DQTL 3V8OA 4AL8H 5H37G 1K8IB 1RJYB 3T0VA 4DN4H 2FEDD 2UYLB 2VXVL 3HC0B 4J3WA 5ANME 5HHXH 4PG9A 3BZDA 4IS6B 4XPGL 2ICWB 2VL5A 1YEIH 5I1GL 4OV5A 2VABB 3IJSA 4DGYH 1XF1A 3NCYP 3LKQA 4U1LA 5FYKU 3SKJH 2BSSB 3MCKA 4Q2ZA 4ZUSA 2AJZB 5LJYH 1MFDL 1ZSDB 4H0HB 4JGMA 1J0HA 3MJ7A 4HUWB 3N1MC 4U0QB 4I3RH 5EUKA 1AO7A 3IDXH 1N59A 1R5IA 1G7PB 1WAAE 4L4TA 1OAXL 5DD5H 4FXKA 5J13C 3O4OB 5IKCA 1FNGA 2FLRT 1RZFL 3F6IA 1S7UA 5HHPA 5E8NB 1P7QA 4IIQC 4JFED 3QDME 5L2JB 2UWEF 2P8PA 1GGCH 2OZ4A 4GKSA 4PLJC 3W81A 2DD8H 2GJ6E 4KTEH 4J8RA 5DK0A 4P23D 5IF0A 1AXSA 5DD1H 5EO1A 3RDTA 5CJQH 3GSNB 4I1NB 3MRRB 5CGYC 4ZS6D 5EIIB 2OCFD 3B9AA 2DM7A 3JWDL 3K2UL 4IHOA 2FX7L 2GK0A 1UA6H 3WXVL 4EQ3A 1J0JA 4C56E 2PNDA 1C08B 2AV7B 2H8PA 2ICEA 4OCSL 1I9EA 1YECH 2HN7B 1IC7L 3PJSB 4OF0A 5BOZG 5IW6A 4R26L 4PP2B 1ZLSH 4FQXD 3T08A 4NP4H 4LL9A 5J8OA 3MJ6A 5EORH 1DBML 1BOGA 1KULA 4PG9B 1OGAD 1Z2KA 4LSUH 2FGWH 2DICA 4I77L 4F37K 4OV5B 3IJSB 3LKQB 3GDBA 2BRRH 3QG6A 1XIWA 2BNQE 4FTVE 4IRJC 4AEIH 2JCCA 3OXSA 4JFFD 4HFUL 3VGEA 2NY5H 4DEPB 5CJ5A 3SE4A 4S1SL 3B43A 4Q2ZB 4ZUSB 4B0MM 4O58L 5B3JE 2FEEL 4H1LB 4QLRA 3KR3L 1F4YL 4JPKL 1PKQA 1F6AA 3MJ7B 3P9LB 4P4KC 3BISA 5EUKB 1AO7B 1N59B 1R5IB 1X7QB 4L4TB 2EIZA 4C59B 5IKCB 1FNGB 4FA8A 4LHQB 3D87B 1EEQA 4DGIL 2V6HA 5C2UB 5HHPB 4EIZC 1D9KB 1AGCA 1EVUA 1P7QB 1QBLH 1ZLUH 3KPSE 5LXGL 1IGML 3RVTC 3EDFA 2GTZA 3I9GL 4PYHA 4JQVC 5ITFA 7FABH 2NY4B 2P8PB 3WN5C 4KQ4H 4AY0A 1W8NA 4GKSB 4IDLA 4J8RB 4K3EL 5DK0B 1AXSB 5EO1B 5C0IA 1F58H 3VI3E 1Q1JL 3RDTB 4G43A 1IGYA 1JPTH 3SDCA 1GH7A 5SWSA 1UM5L 1RIUH 4IHOB 2GK0B 1KCKA 3BP5A 1QNZH 5EA0H 1ZVHA 3LV3A 2H8PB 4YO0A 2ICEB 4DTGH 4YHML 3UPCA 5T5NF 3FZUC 5GGUA 2QQNL 5EU7E 4YEFA 5IW6B 5E56A 5D7SH 3NPZB 3RUGF 3X3GL 3P73B 4MAUL 2HT3C 4K7PL 4CNIA 3CFEA 4FN0A 4JFEE 2Z0BA 1BOGB 2FYYA 4PY7A 1Q0YH 4RWYH 5MEQB 2X9YA 2VLKA 2DLFH 4KTYA 2VDKH 4WTZA 1YA5A 3MV8A 4YHLL 2H1PH 3QG6B 1XIWB 3U0PB 4J6RL 4HW6A 2JCCB 1RVFL 3OXSB 2CLVA 1DEDA 3I84A 5JR1L 5FM5O 1J1XH 1EHXA 3L9RA 4GG6A 4KY1L 2VYRE 3LEVH 4UZGA 4FNLL 1LGVA 4RZCA 2YKLH 3CSBA 1PKQB 1F6AB 5T3XH 2Y36H 3TESA 1IKNA 3NIDF 1JL8A 2PXYC 2W0FA 2BVQA 2EIZB 2VDRH 3QCUH 5D7LA 1CLOL 2F15A 2MTPA 3VFRA 1AGCB 4E9LA 5FYKL 1I1CA 3LDBB 3STLA 2GTZB 3OQ3B 4HV8A 4Z77A 1OGAE 1OLZA 5ITFB 4QRRA 2BY1A 5IMMA 4NQDE 1QPXA 1UB6A 3BE1H 2DQDL 5F9WC 5C0IB 5KSAA 2JJSA 5F3BA 1Q0XH 4G43B 1K6QL 4JFFE 4X9FA 1UWGL 2JJUA 1IGYB 1AI1L 4HPYL 3SDCB 3ZDZF 3BKJH 5SWSB 3BP5B 3MNWA 3DJ9A 2EIEA 3LV3B 5JXAL 4YO0B 4K7PY 1QSEB 2ZCLH 5GGUB 3SDAA 4EUPA 5DD6A 1C16A 4JG1L 3GKWH 1MEXL 4HKXA 4P3DB 4P9ML 4G8IA 2V5MA 2IEPA 4CNIB 3CFEB 4PY7B 1KPUA 4U1SA 5SX4H 3IFLL 2R9HC 2VLKB 2PW2B 5E9DE 5JZ7C 3MV8B 3D6GA 5JORA 1C5BH 2OJZL 4NBZB 1CCZA 4APQA 4MJIE 1Z0NA 3VW3L 2GHWB 2ERJC 3L9RB 3LQZA 4GG6B 3B8SA 2VQ1A 3U82B 4RZCB 5L6YH 2YD2A 4FFYH 1CK0L 3GSVA 5EIQA 4JKMA 4ZAKC 2W0FB 1OHQA 2BVQB 1E4XL 3QDJD 5D7LB 1GPOH 4Y4FC 2AERT 3VFRB 3VXME 1MF2L 1IGFH 3HNVL 3VG9B 3J7HA 2WZPD 4HV8B 3STLB 4Z77B 3TC9A 4QRRB 2PR4L 5IMMB 3GIZH 1UB6B 5J12B 4K3DH 2XQBH 3C2AH 4U3HA 3U0TA 3B2UD 1G1YA 3GMRA 4FZ8H 5KSAB 4PGBA 4DZBA 5F3BB 4QXGL 3FKUS 4Z7QF 1DSFL 3MBED 2YZ8A 4C4KO 1KC5L 4MAYD 2CKBL 3ROOA 4Y4HD 4HX1A 4V1DE 1MCIA 1NEZG 5HYSG 3MNWB 4KC3B 1JPGA 2Q8BH 1JIBA 3O2DH 1DQML 3SDAB 4EUPB 4WEBH 4N8PA 2IBGA 3QDGA 1C16B 5DD6B 4W81A 2FECL 4HKXB 3HMWL 4G8IB 4UTAL 1Z5LA 4Y4KA 5HHQA 5C0CA 4PJEF 4YDIL 5IQ7L 3DARA 4U1SB 4WWKC 4MNQD 4BSVA 2X10A 1MCPL 5JORB 1W0WA 5AG9A 3P2TA 4WDIA 4TN9A 4APQB 4UV7L 5BMFL 4NQVA 3LQZB 2VQ1B 4BJLA 3QHTC 5ABDE 3UJTH 3NZHH 3GSVB 3FJTA 3I6LD 2IAMC 2BVYA 4QXTA 3RVUC 1IEAA 3RY4A 1ZMYA 4XP5H 2YD4A 3VD4A 4R4FH 3V6BR 1WITA 4EDWL 1S7TA 4F9LA 4WFHE 1U2HA 1A6WH 2Z8VC 4RFNC 3ORJA 3LIZH 2CKBA 3VXOA 1I1YA 2AV1A 3BUTA 2XTLA 4M6MH 3U0TB 3GMRB 4PGBB 2V9QA 4DZBB 2ATPA 4RSVA 3B2VH 2PYED 4HT1L 2ZZUT 3MLTA 4MQXD 3PG2A 4JO3L 3ROOB 4HX1B 3U30B 1JPGB 4O02L 4X4ME 7CGTA 1D5BA 5TFSH 4DN3L 3VRIA 1LDPL 4JZJC 1FZMA 4K9EL 2UV3A 3MXVL 4KROC 3QDGB 3QDJE 1OAQH 4L8SA 5GS0L 1JK8A 1CVRA 5HHQB 1Z5LB 4Y4KB 5C0CB 1HNFA 4BSVB 3RWEB 3HAEA 2AJUL 4EN3D 5FGCE 3G6AA 1CQYA 2CO6B 1FZKA 3NABL 4NZTH 3WNNA 3MLXL 4LLVA 1QYGL 1KEML 1W0WB 2YXFA 4OLVL 4WDIB 4OM0L 5BVPH 1NCAL 2A1WH 1IQDB 3HNTL 2MCG1 3SGDI 4NQVB 4O9HL 5EOQL 5FV2A 2BVPA 3BSZH 1LNUA 3S8WA 3IU3A 3QIBD 4FQ2H 4ENED 4QXTB 1IEAB 2A6JA 3AROA 4UTBL 5D6CA 4M5YH 1NGQL 2QL1A 3RX7A 2UWEE 2NTSP 4LHJB 1S7TB 2BHZA 3BO8A 5C3TA 1A6TA 4GMTL 1NFDA 1SHMA 2AVGA 1G9ML 2I5YL 1GGBL 4D9QD 2CKBB 3VXOB 1AR1D 1I1YB 3WIHH 1I7UA 5E94A 4XRCB 4YDVA 2AV1B 3V6FA 3QUZC 4X6BA 1MQ8A 1T80A 5KSBA 2X4OA 3MZTA 2ATPB 3QJFA 1M4KA 2KZWA 3MLTB 1U8QA 2WLZA 3QI9C 4D9RD 3QH3A 1MIEL 1EXUA 4YX2H 5EU6E 5A40E 1CN4A 4NQTA 3TVMC 1INQA 3ULSA 1D5BB 5JO5A 3MOQA 3VRIB 1FZMB 1VENA 3JV5A 2QADC 4NC2B 4J2XA 4L8SB 3TO4B 1JK8B 1RUPH 2VDML 2NY3B 5F1IA 5DMJB 2RR3A 2QQQA 3HAEB 4MB4A 3G6AB 1FZKB 2D0GA 2XKSA 5MI0B 3W0WA 4LLVB 3MV9E 5EWIL 4NC1E 1JGEA 2DQCL 3HFML 1DANU 1RMFL 5T1LA 1KACB 1R3JA 3OSKA 4QHKI 4L3ED 1FAIL 2DJSA 4F9PA 4WNQA 1JTTA 1FJ1A 3BJ91 3RTQC 2BVPB 1ED3A 1LNUB 3W9EA 2DTML 5J11B 3IU3B 1U0QA 4LLWA 5E8EA 4M1CD 3IDGA 1HEZA 2EYTA 2AK1H 3WXWH 2XT1B 2A6JB 2ZCKH 2VLJD 4AIOA 4BZ2H 5D6CB 5I8EA 4QY8A 2V9TA 5ALBL 1UXWA 1L0XA 4YHZL 3BO8B 1A6TB 3L3JA 1NFDB 3CFCL 4XC3H 3F65A 5LGJA 1RJCA 1ETZA 4NYLA 1I7UB 3Q48A 3OR6A 5E94B 4YDVB 3DRTA 3V6FB 1WISA 1Y6MR 5FUOH 1WTLA 4X6BB 1CDGA 5KSBB 2R1XA 2X4OB 3K8KA 2B1HL 1QQDA 3JSSA 4LRIA 2BMKA 3QJFB 3RI5K 3BDBA 4M1GL 4TSAL 4L4VB 3GI9H 3I50L 1U8QB 2YPKA 5FUZH 3QH3B 3HC4L 1EXUB 1NBZA 3N1FC 1Z9MA 4M8VA 4XP1H 1INQB 3ULSB 1PFCA 2A0LD 5JO5B 3D3VA 4OF6A 5FYJH 1WTGT 1CXIA 3BP7A 4LAQH 1X5KA 2B1AH 5AZ2L 5BS0A 1ZE3C 5F1IB 4O4YH 5MP6L 5GSVB 4JFPB 1FORL 4D9QE 5FOJA 5BQ7A 4DGVL 1JGVL 3W0WB 2NXYB 5DSCA 1TJIL 4YQXL 5DVLA 1JGEB 4LGPB 1CICD 1J05A 5D1ZD 5HPMA 2EXYC 5T1LB 1CXEA 3EFDL 1BFVH 1R3JB 1DP0A 4JQIH 4XNZC 4D9RE 1DLHA 1FJ1B 4WIQA 3W9EB 3NIDE 1R6VA 1CD8A 4LLWB 1QOKA 5E8EB 4Z9KB 4BKLA 3IDGB 1HEZB 2EYTB 1B2WH 4AYFA 2WSKA 5ADPL 5I8EB 4QY8B 3T0WA 1EO8H 5DQDL 1UXWB 3AXLA 3E2HB 2OTPA 1MI5A 3L3JB 5DURD 3ULUF 4LLDA 2J6EL 1N4XH 5LGJB 3IAPA 2HKHL 1ETZB 5DMIH 4NYLB 1ZGLM 3OR6B 3DRTB 3DVFA 4P2QE 4KK6C 2V7NA 1HHKB 3ZDZE 2R1XB 4YXHH 1V3JA 4PLKD 1QQDB 3VFVA 2BMKB 3IDNA 5I1CH 1V3KA 2YPKB 5CP7A 1VFOA 1NBZB 1OTSC 3QA3A 4GG8A 1JNJA 5H2BB 5H35A 2G9HA 3CXHJ 5GRJH 2PTVA 3D3VB 1KXTB 1HHIA 4YGAB 3SBWC 1ZA6A 5BXFA 5GQBA 2F8VA 3BPCA 4F15C 1NMBH 4B7LA 3BP7B 5MEPA 2K7QA 5BS0B 4R8WL 2XQYG 1JPST 1TZGH 3BUYA 1EMTH 5C0RL 4YDKH 3FCTA 3QBTB 5BQ7B 4LCWA 4QRQA 3MLSL 5DSCB 1F6FB 3UC0H 3DIFA 1J05B 2P4AB 1A4KA 3QWRA 3EZJB 3H8NA 1OB1A 4RGMC 2HLFC 1DLHB 4J3OC 4LSVL 1WT5A 1FNFA 2J6EA 5D2NB 4BKLB 1A7RL 3IT8D 4QEGA 6FABH 5I1AA 5KAQF 4F7MA 2NX5A 4OJFH 1XF4A 1DLFH 3TZVA 5F8QC 3AXLB 4RRPG 5LGHH 4PJXA 1MI5B 4LLDB 1P69B 1B0WA 4OCXH 4NM4L 5CEXA 5L88L 2V7NB 4Z7QE 4YPGA 5DXWA 1E4XI 3WKML 1VHPA 2VDOL 3T4YA 4GT7A 4OM1H 3B5TA 4OZFA 4P3WA 3IDNB 1N3NB 2D03H 3ARDD 5CP7B 3U2SA 4UV4H 3QA3B 5KOMC 4GG8B 4XBEL 4PGZA 5H35B 2G9HB 1EEYA 1W2KT 1EA9C 2RFXA 3U7AA 1HHIB 1ZA6B 5BXFB 3BPCB 3CSGA 4S2SA 4PJEE 4D2NA 2AJYH 3VFPA 5MEPB 3TIEA 3O4OC 2CR6A 2VE6A 1LK2A 3KLHC 1TFHA 5JTWA 4OKDA 3BUYB 5CFHA 5B21A 3VRJA 3WFBH 3FCTB 4LCWB 1KB5A 1MREH 1U6AL 4QRQB 3S36H 1MFBL 4JRXA 3KVQA 5B39G 5DJZA 4JFOA 4M7KH 5I74B 3F7RA 3DIFB 1Z0MA 1CFBA 1A4KB 5KW9L 4JREB 1KB9J 1OB1B 3H6JA 1F4AA 2OXHA 1FAKT 5FO7A 2QSVA 4E42B 5I1AB 1BZ7A 5KBNC 1SMAA 4S1DD 5FKAA 3O2WL 3PWUA 4F7MB 4ISVA 2NX5B 5HXMA 1XF4B 3TZVB 1WICA 2B2XH 4YDJA 4C57C 3H9SE 1EJOH 4PJXB 4OI8A 1G0YR 5T1KD 1BZ9A 1U9KA 1NAKL 4JG0H 4YHKH 1UXSA 3R06A 5CEXB 3GMQA 2XFXA 2PN5A 5GPRA 1KTDA 5FYLD 4KK5C 3T4YB 3BRGC 3S35L 2FJFA 4OZFB 4D9LH 4X7SH 5SV3A 3SOBH 4U0RC 3U2SB 2RCSH 1FFOA 5CHNA 4U6HA 1OARH 4DEPC 3OG6B 1EEYB 3PV6A 4MXQC 4YH6A 2RFXB 4BFEA 4JB9H 5IT2H 4S2SB 5HSFA 2FL5A 2VDQH 1VACA 5ALCH 5IB3A 3VFPB 4I5BA 1HWHB 4N8VA 2BCKA 2HMIC 1LK2B 1QRKA 5I1KH 3VRJB 4LIQL 1KB5B 2W9LA 3MYJA 4JRXB 3O9WA 4ODHH 1IEHA 2NY4C 5DJZB 4JFOB 4LKXA 3LZFL 1IAOA 2V17L 3DECA 1TPXB 3HCVA 4ZNEE 1X44A 4F57L 2IH3A 4JFHE 3JXAA 4H26A 4XX1E 1F8TH 4Z0BL 3RDTC 4H8WC 1L9MA 1MCWW 2P1YA 2YUXA 5FO7B 5I18H 1BZ7B 4K8RD 3AMLA 1BD2E 1ZVSA 5FKAB 3PWUB 1G6VK 1RIVL 4ISVB 1BF8A 5JDJA 4YDJB 4OFYD 1MFNA 3BKCH 1F3DH 4NQEA 4JFDA 1WBZA 2CRYA 1UXSB 3LMJH 3R06B 3V52H 3BD3A 2XFXB 1KTDB 1ZXQA 3G9AB 5IP4A 2J88L 2PTUA 4LARH 4LSPL 1NAMA 2UY6A 1NKRA 3SDDD 1UEYA 2FJFB 5J9PA 2E9WA 3UBXG 4N8CH 3GNML 4I0PA 4XNXH 3IFOA 3EKCA 4MJ2A 4KI5D 3MXWH 2YD1A 5HYJE 1FFOB 5CHNB 4U6HB 2ICWJ 3GSNH 4KXZH 3SE4C 3FRPG 3PV6B 4YBQC 1J1PH 3HE7A 4ZTOL 5DVMA 3D39E 1UCBL 2Q76A 3ULUD 3ARGA 4UILL 2FL5B 1VACB 4DUVA 5IB3B 2AK4B 4I5BB 5EPMB 4N8VB 4P46D 1LO4H 3THML 1HKFA 3QO0A 3MODL 1NMCB 3V79C 4HLZH 4ONFL 3LDBC 3MYJB 4FS0A 4U3CA 3O9WB 1OAZL 3JWDC 4LKXB 1IAOB 1Q94A 3EJZC 5HGDA 1F3DJ 1H3VA 3HCVB 2IH3B 5CZVH 3WUWG 1YEKH 3PIQA 4ORGB 4H26B 1J8KA 1ZV5A 5EUOF 3QQ9C 4KVCH 4OCRH 4OCWH 2NPLX 5DT1H 1GHFH 4KRPD 5E1HB 3SDCC 4HIJA 1FL6A 3S34H 5L9DL 12E8H 1FFRA 1ZVSB 2L4OA 1BVKA 3OTTA 4LGSB 2W65A 4JM2D 1JZ6A 2JELH 5IQ9A 4NQEB 4FFVD 2IANA 3D18A 3EOTL 4JFDB 1WBZB 1DBJH 2Z8WC 4YE4L 3U1SH 1DJSA 3CXDH 4PJGF 3JTSA 3L1OH 5GZOC 2OZ4H 4KK9C 4NC0B 4G7YL 1NAMB 5SWZB 5J9PB 1KBGH 2P49B 1P7KA 4I0PB 5DRXA 3IFOB 3PQYD 4MHHI 4JFZH 4H8WH 1N7ML 1SJHA 2DQTH 5DMGC 3GJFA 3MGTA 1ADQL 4N5ED 3RNQA 2VXVH 4KDVA 3HE7B 5SX5K 2MSPA 3D25A 2Q76B 3ARGB 5GZND 2GY5A 4XPGH 1IKNC 4HEME 2IFGA 1MAML 1SY6L 3EGSA 4M48L 3MRKA 5I1GH 5KN5A 1ODAA 1T7WA 3OPZL 3GSWA 3S3JA 3AUVA 1CGYA 3FQWA 2H3NA 3QO0B 5CBAA 2W9EL 5FECB 1A7OH 2NY2D 4LF3A 4JKLA 3U36A 3HC3L 3H0TA 5HVGB 1Q94B 4OSUL 5J12C 1LK3L 4NNYA 3GO1L 3L5HA 3ZDXF 4RFEA 1XGYL 3PIQB 2WP3O 5C0ND 1OP3H 5KSAC 1H3TA 2JJSC 5T5FL 4CVWA 1OAXH 4WUUD 1T66D 4NIKB 1S9YA 2YEZA 2NY0B 1KJMA 1FL6B 4HIJB 1RZFH 2EYRB 1BVKB 4WTXA 3ULUE 3MCLL 2W65B 5DA4A 3U9UA 4BQ6A 3SDAC 5HGGS 4OD3H 5IQ9B 2IANB 4WCYL 3D18B 1MCSA 4G6AC 1B3JA 4CMHC 1W72A 2DMBA 1CXFA 1XZ0B 1Q9WA 3OJVC 3JWDH 3K2UH 1EX0A 1ADQA 2FX7H 3WXVH 3SJVA 1MUJA 3PWPE 3C08L 1R3LA 5IHBA 4OCSH 1P7KB 4Y19A 4U1NA 4K71B 5DRXB 1IC7H 1YN6A 4R26H 3SHSA 1SJHB 3GJFB 3MGTB 3GJEA 2D0HA 5F6IB 3RNQB 2CH8A 3D25B 1OOAA 4XXCA 3OZ9L 4LP4A 5D71L 4UBDC 5KN5B 3EGSB 3QZWA 3MRKB 3GSWB 3VD9A 2H3NB 3MV7D 5TE6H 1PY9A 1O0VA 4NPYB 5CBAB 1FYTA 4KKBC 3PP3H 3GZKA 4LF3B 3U36B 5GGSA 3VWKD 3BP4A 3PL6D 3H0TB 4S1SH 1RZ7L 4QOKA 4NNYB 5HYQA 3KR3H 4HZAA 1F4YH 4JPKH 4RFEB 3FN3A 4OI9A 1P4BH 1NANH 1S9YB 2YEZB 1KJMB 3MC0A 3W11C 3U30C 2Z31A 3U4BH 1GZPA 1IGMH 5FDWA 3I9GH 2YN5A 3ALXA 3U9UB 2VXQL 1B88A 3RVWC 2WUBH 4KZDH 5TDNA 1BECA 4K3EH 4U1GC 3LS4H 3OXRA 4Y4KC 5I0DA 1Q1JH 1W72B 3IKCA 1B4JH 4CU7A 1Q9WB 2F5BL 2ZUTA 4WRLA 2C7UA 1I75A 4NKOB 1MUJB 2NNAA 3OWEA 1R3LB 4LQ1A 1DVFA 4YHMH 3NIGF 2GIYA 4U1NB 2QQNH 1YN6B 3CVIL 5EOTA 3MRNA 4LLYA 3GJEB 4K7PH 4M6NL 3N1PC 3QIUD 4LMQE 1RZJL 3QZWB 3U7WL 4F8TA 2BNRA 3OJ2C 4AMKL 4EUPH 4PLNC 4NQSA 4YHLH 1MCRA 1FYTB 4PRIA 5GGSB 3BP4B 5JR1H 3AS1A 4KY1H 4QOKB 4OD2A 4HIXL 1ZVYA 2CRIA 5HYQB 4FNLH 3RA7L 4QHLA 3BHBA 4ZFFA 3U79A 1FL3A 2YMXL 3TM6A 3CMOH 3BAEL 4PJBF 1CLOH 3FO1A 1FGVL 3LD8B 5JIIA 2Z31B 1GZPB 5FYKH 5FDWB 4CU8A 1WQVT 2CLZA 1MJUL 3QSKB 5L0QB 2DI9A 2DB8A 3PF2A 4GAJL 2DQDH 2Y6SD 3GMNA 4L8SC 5TDNB 2SEBA 3MV7E 3DLQR 2NY3C 3OXRB 5DRNA 5DK3A 3CDCA 3IKCB 4TUKL 1K6QH 1MCLA 4M3JA 1UWGH 3ZKMD 3MLPA 1AI1H 4GLRH 4HPYH 4ETYA 4XPHL 4OV6F 5MI0C 2C7UB 1CU4H 1QRND 2NNAB 5JXAH 2EO1A 3TWCL 1DVFB 2KL6A 3D2UA 3BVNA 1KCLA 3D85D 5EOTB 4BQBA 3OF6A 4JG1H 1MEXH 3P0VL 3MRNB 3EO1A 4GAFB 4P9MH 1QEWA 5FCSH 5J11C 2YD3A 3TPUA 3IAQA 3VXQA 4HGKC 4IOFD 4JJHA 5D1XA 5CSBA 2BNRB 5DZOA 4JVWA 4NQSB 1DN2A 2VR5A 3C2SA 1JZ3A 1GZQA 3RIAK 2OJZH 1S7VA 3IGAA 4PRIB 1GGTA 3L3DA 4JO4L 2EIDA 3VDAA 1I7ZA 3VW3H 4Q9RL 3FO0L 2XTJB 4OD2B 4L4TE 1H8SA 4XTRD 2QHLA 3V4VL 4QHLB 1CK0H 3P40A 3BHBB 2EE9A 4GMSL 5LQBL 4K9EC 1FL3B 1UKQA 2HJFA 4OQTA 3FO1B 5GS0C 2MNUA 1BVZA 1N8ZA 1MF2H 1MFCL 5L2KA 1HXMA 3HNVH 2R0LL 2HH0L 1K5NA 2V2WA 4KKCC 4X9BA 1L7TL 1YNLH 4EI5D 2CLZB 4QNPF 5F7KC 1INDL 5BOPA 5I6XC 2IF7A 4UIKL 3BKYL 1CZ8L 3HI6L 4NQCD 3GMNB 2SEBB 4R96A 5KSBF 3UXFA 5DRNB 3D5OF 1WWAX 3BZ4A 1DSFH 1I85A 2DQUL 1KC5H 3QPXL 2CKBH 4PUBL 3TBVA 1VERA 3BWUC 3L95A 2NXYC 1ZGLP 5I76A 3IJYB 4NDMA 5H8DA 3D2UB 5DHXB 1OSPL 3BVNB 1K9TA 5M94B 2DIAA 3EO1B 3HMWH 4ONGL 1QEWB 3IDMA 4UTAH 3TPUB 1G9MC 1F3RB 5DR5L 3VXQB 4YDIH 3RRQA 4OIAA 3VI4F 5D1XB 3BIKA 1RZIA 2JCCE 1EK3A 1X5XA 2ITCA 2B5IC 3RGHA 3ZE1F 1MLBA 1NBVH 1GZQB 1I4FA 3E2HC 3IGAB 1S7VB 4UV7H 4X5XA 3L3DB 1EBAA 5AG8A 5BMFH 1I7ZB 3CLFH 4PP1D 1LHZA 3HAEH 4HJJL 5EUOE 3R0MA 3IYLW 2BFVL 5ETUA 1BBJA 5JPMA 4LRIC 5KTEL 2FATL 2Y07H 3DYOA 4PBXA 1T89A 2HJFB 1AC0A 4EDWH 1P1ZA 1N8ZB 1KSRA 2ZPKL 4NHUA 5L2KB 1HXMB 2V2WB 1K5NB 3QEQA 3JVGA 5JOEA 3O6LL 4U31A 2ZSWA 4R96B 5K9OA 4PJGE 3T09A 2XKNA 3BZ4B 1G0DA 4HT1H 4Y16A 2ZOLA 3T4AA 1GGYA 4PD4J 4JO3H 2R0WL 3TBVB 5GRZA 3L95B 3NBNA 3MNVA 4O02H 3ET9F 3MRQA 3WIFA 5I76B 2NY6D 5DFVC 3HB3D 4NDMB 4HQQL 1LDPH 1Z3GH 1CL7L 1VB9A 4K9EH 3MXVH 3HTLX 3NCYS 2PO6D 1DBAL 3KPRD 5C7XL 5GS0H 3EYFA 4LNVA 5KOVC 3IDMB 4AH2B 4WFED 1U3YA 3FB6A 3DWTA 1AXTL 3NABH 2ITCB 5HDQL 4YHYB 1MHPL 1MLBB 3MLXH 1L7IH 4NQCE 5DC9B 1QYGH 4OLVH 5B22A 5C0GA 3STBA 1IZKA 1I4FB 4D8PA 2P24B 4OM0H 4F7PA 1NCAH 4HJ0D 4X5XB 5F88A 1CLZL 1U8NA 2IQ9H 3HNTH 3ZDXE 4LVNB 4N0FA 4JR9L 2B20A 2MKWA 4MJ5A 3QPQD 4DKFL 4OFVA 2C9AA 3NN8B 1BBJB 5ETUB 2Q87A 5JPMB 3CZFA 4N0UA 5C0BE 4UTBH 2P7TA 1X5LA 4JVPA 4L9DA 3BH9A 4QRRE 1P1ZB 1TCMA 4PTTA 4NHUB 5F9DC 5INDA 3OKEA 4RFOH 5ESAA 4GMTH 3LHPL 2WQRA 1G9MH 4F33B 4WW1A 3QEQB 43C9A 2I5YH 4MQTB 1GGBH 1IC4L 4FRWA 4X6DF 2VAAA 4R90L 2ZSWB 1GSMA 1J1OL 5K9OB 2XKNB 1KYOK 1YEEL 4Y16B 1RURH 4ZSOE 2ZOLB 4QHNB 1F6LL 3T4AB 3RZCA 5CMAA 3S6CA 1MIEH 5HI3C 1AGDA 1IM9A 3MNVB 3WIFB 3MRQB 5I74C 5AZEH 3UP1A 1OM3L 1P84K 4JPVL 1BLNA 4Q9CA 4JREC 4NN6B 1VPOL 1U41A 3EYFB 1WT5C 2VDMH 5J0BA 1H3WM 4PLJD 2FJGA 3WO3B 3U48A 5IW1A 1OWWA 2RGSA 3FB6B 3G08A 3WFHA 1RJZA 3RX8A 5GRYA 1QR1A 3TZVC 5C0GB 2D7MA 1U92A 3LSOA 4HHAA 5EWIH 4D8PB 2KZ1B 4F7PB 5F88B 2DQCH 5FYKE 1U8NB 5T3XD 3VH8A 2HT4D 1S9VA 1FAIH 2JJWA 3FB7A 4MJ5B 2YD8A 3MREA 5C3LD 3B5HA 2DTMH 1VFAA 5INCA 3WDIA 2X4PA 5E1AA 3WIIH 4LLMB 3CZFB 4N0UB 3UDWC 5MHSE 1IARB 1I9IL 4RGND 5IB4A 2V5RA 1F90L 2P7TB 4MB3A 5ALBH 3BH9B 1ROWA 4M7ZB 4JRYA 4DOHB 4PJXF 4PTTB 3X17A 5INDB 3OKEB 5ESAB 1KJ3L 2Q7YA 3DMMD 4WFEE 5AYQA 4WW1B 43C9B 2GITA 3HG1D 1RK0A 2CK0L 2VAAB 2E9IA 1KPVA 4M7LL 4X80L 3M17A 5CILL 3DGCR 2B1HH 4M1GH 4XVJL 2UVFA 3GRWA 3GBNL 1WFTA 4TSAH 3QQ4A 3UJJL 3I50H 3RZCB 1JGUL 5CMAB 3NIGE 1ZHLA 3HC4H 3CMGA 2Y06H 1IM9B 1G0XA 3QDGE 4JKWA 5IHZA 1M7IA 1TPXC 3TGXA 1BLNB 5FGBA 5JQ6H 1ZA3A 1TETH 3WFDL 4UIMA 1A6UL 4FQQA 3DI3B 2IFFH 2FJGB 3TN0C 5MP6H 2VWEC 5IW1B 3DX9A 5IESL 3WFHB 2ED8A 1MQKL 3G08B 1RJZB 3RWFA 1FORH 2B8OT 2VH5L 1JGVH 3FQRA 3H9ZA 1QR1B 3WNOA 3LSOB 1U92B 1TJIH 4HHAB 2MQCA 4YQXH 3HUJF 3IFNL 3ARUA 3ZHKA 3EFDH 4AEFA 3VH8B 2W60A 2ORBL 1S9VB 1FFQA 3FB7B 4M5ZL 4LEXL 3RWJB 3MREB 4DUXA 3RAJL 1VFAB 5INCB 2X4PB 4PJBE 5E1AB 3C5ZA 4PRHD 5ADPH 3DVIA 5IB4B 1NGWA 4JO1L 3LPWA 1RZ8A 3H3PL 1TMCB 1T83A 3SE8L 5DQDH 2RBLA 1D6VH 3CLEL 4JRYB 4C58B 2NY1B 1JZ7A 4Z95L 2Q7YB 5I9QB 1FC1A 3WL9A 2IQAA 2J6EH 5T3ZL 2GITB 4MMZC 2QHRH 3UTSD 2HKHH 4W6YB 1RK0B 4UNTA 5GS2H 4HULB 5C9KA 1KPVB 2I9TA 1N6UA 1UEMA 3M17B 4KJWC 5I71B 4M6AA 1MELA 1Q38A 2FNBA 5E7FA 4YWGL 1DEEA 2XYCA 3QQ4B 1C8PA 1UWEL 1NMCC 1E4WL 3CSPA 1ZHLB 1B9ZA 4HG4J 2VMFA 5ANMA 2EXWC 2OMNA 1OCWL 3DBXA 5IHZB 1CIUA 1M7IB 4RGNE 1PEZA 1ZA3B 1A3QA 3PHOA 4OZFH 2IMNA 1ZT4A 1FH5L 1CTNA 4NJ9H 3H7LA 4R8WH 1FDLL 3DX9B 3IAGC 3B3IA 3RWFB 5C0RH 2FX9L 3FQRB 3MLSH 3M07A 3C6LD 2DDQL 1WAAA 1IL1B 2FR4A 1MJ7L 2BK8A 2W60B 2VUOA 4LSVH 1KB5H 5IG7A 1F97A 3TBYA 1A7RH 2GCYA 3C5ZB 5FUCE 2VOTA 3VJ6A 1NGWB 3V6OE 1RZ8B 3L3OA 4MX7A 3ZDYF 4CVUA 4I0PC 1NMAL 2R9HD 3DXAD 5EOCL 2RJMA 5E7BA 4QNPE 2FJHA 4G9FD 4E41D 2E7LC 3WL9B 2IQAB 4E0RA 4FQJL 1XCQA 1BFSA 5KSBE 3HE7C 4UUJA 4C56A 5L88H 2CIKA 5C09E 2I9TB 5ISZD 1UB5A 2VDOH 1HSBA 1DEEB 3O6FA 4P2CG 2ESVD 3IXTA 1FO0L 1OAKL 5ANMB 4R4BA 4XWOD 2WAHA 4HUNB 4XBEH 1JHLL 3DBXB 3BQUA 5F7UA 4KKLC 3PUCA 2FIKA 4OT1H 5DGRA 4WENB 4KKNA 1KJVA 2V9RA 2BRQA 3PHOB 5JW3L 5C0FA 5DEFA 1KFAL 3VI4E 1JWUA 1TQCB 1ZT4B 4ODBD 1I3GL 3O11A 1SMOA 2NY0C 5E6IA 3ZE1E 5HI5C 1PGRB 2J1KA 3UTSE 3B3IB 3L3KA 1YY9D 5A3IC 1U6AH 5KVEL 4KMTL 4XVTL 2WLYA 4KGJA 3GI8L 1PSKL 3F7YA 4LSSL 3SCMA 2FR4B 3KG5A 1T3FA 5KW9H 4PRDA 4CKVX 1F3JA 3QXAA 1BWWA 3KPSA 1CQKA 4H1LG 3K4DA 4QRTA 4Q58C 5IG7B 2X9XA 3G5XA 3TBYB 3T2QA 3DUHA 3FL7A 4OGYH 2GCYB 3TO2A 3WHXA 4U2ZA 5KVDL 3VJ6B 3O2WH 1I1AB 1QBMH 1BVLA 1WC7A 2MQ3A 3L3OB 4MX7B 3F8UB 4K71C 3QHFL 4YNYA 2Z9TA 2FJHB 3BJLA 4E0RB 4ZG1A 5F6IC 3F5WA 4MXWL 2FDBP 4UUJB 3TCXA 4C56B 4FZEL 2CIKB 2D7QA 1NLBH 5HD8C 1A47A 4FMFA 3MJ9L 3SE3A 1UB5B 1HSBB 3S35H 3O6FB 3MA7A 1TVBB 3IXTB 4OKVA 4JFEA 1KEGL 4R4BB 1QR4A 3BQUB 1IC1A 4LVOB 3RY5A 2FIKB 1NAMH 1KJVB 1P2CA 1T1XA 2HTLC 2ENYA 4RX4D 5C0FB 4P23A 5DEFB 3DXAE 4CU6A 1JWUB 1T5XA 4WHTB 3HE6D 3O11B 1E0OB 5E6IB 3N9GL 3OKOA 2YRZA 2H9GA 4LIQH 3L3KB 3O3BA 1U3ZA 2VKWA 3OX8A 2C1OA 3WV0A 2Y7QA 5IBUB 2HG5A 1CL7I 3OJMB 1A5FH 3ARPA 1KLUA 3I3DA 3DETD 3LZFH 2V17H 4Q74A 1S5IH 3F7YB 2QTEA 3DRQA 5HHOD 3SCMB 1U93A 1NH6A 1T3FB 4FQXA 3O6KL 4PRDB 4OQ1A 1F3JB 1RHHA 4Z0BH 1CVSC 2EO9A 3QXAB 3KPSB 5DUBB 5F9JA 1UADC 5DLML 4QRTB 1N0XL 4DVBA 4Z7WF 1OGAA 3G5XB 2GQHA 1JP5A 3TO2B 6CGTA 1LEIA 3WHXB 5D93C 4Q9QL 5A2IH 1BVLB 1WC7B 1RIVH 5GGQH 1H3GA 3MJ9A 1DR9A 4HBCH 4YNYB 4JFFA 3UTPD 3HPJA 2UY7A 4X6DE 4Z7UF 5I75B 3QRGL 2DJUA 2OR9L 3F5WB 5E8PB 4JHWL 4XXCC 5J7CC 1G6RA 5TF1L 3JWOL 1T2XA 3MA7B 1BZQK 2DN7A 2P44B 1MY7A 3GNMH 4OKVB 3C60D 4JFEB 1UCTA 4LOUD 4N0YL 4FG6C 4YLQT 5A2KH 3ARSA 5IFHL 3FO9A 2VO5A 1BBDL 1HH6A 1P2CB 4ZTOH 5D7KE 1T1XB 4UILH 4P23B 5IVXA 2V2TA 1T5XB 2LAAA 2ZUSA 2XG5A 1A7NL 3LD8C 1OTTC 5F21B 3OKOB 3S4SA 1JJUA 3GJFH 3X13A 2Z31C 2EZ0D 3V2AR 3MODH 4I9WE 1L0YA 3C9NA 4ONFH 3OX8B