1MD0A

Crystal structure of an inhibited fragment of ets-1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
138
structure length
138
Chain Sequence
b'PKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-ets-1 protein
publication title Structural Analysis of the Autoinhibition of Ets-1 and Its Role in Protein Partnerships
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 42
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1md0A00
3GFLA 2DK8A 2DPUA 3RPQA 5TJJA 3WTZA 1W7PA 2FOKA 5F6FA 3J81Z 2QQ9A 4YIIA 2YU3A 4OIRF 2DTRA 4E70A 1BIBA 1BI2A 4ESBA 3LAJA 1P4XA 1G3YA 1PUEE 2AS5F 1MKMA 3I59A 3QU3A 5D6FA 1H9GA 3F6VA 3WGGA 1MJ9A 4BYYA 3WTVC 3VB2A 3R60A 3KP5A 3F8MA 3KE2A 4KUMA 2GA2A 3LA3A 1OR7A 2ESNA 2J5OA 1REPC 1QNTA 4M71A 1DPUA 4YFKF 2GXGA 4UVAA 2PLYA 4N9IA 2KJCA 4L18B 4KIFA 3FF5A 1FZPB 2V9VA 3PFIA 3O6BB 1ZRFA 1WKMA 5FLXK 1LEBA 1FP2A 4XSXF 1I1GA 4U0VA 4IF4A 4IRHA 2WWYA 1XMAA 1ZLJA 2P6SA 1MZBA 1ZRCA 1H9TA 1SD6A 3O3KA 1B9MA 5J6XA 4EMSA 4HW0A 2GXBA 4M9XA 2XGXA 3FMSA 2MLGA 3QAHA 4LLNA 4D0PA 4O5VA 3MAJA 1B9NA 1XDUA 3F6OA 2FEZA 3TO9A 1V4RA 1QO0D 1IZ1A 1QGPA 1UFMA 4UXNA 3E6BA 3FX3A 2P4WA 1E2XA 3R61A 1JHHA 1Z9CA 1HSJA 3E5QA 2HTJA 3T5XA 1TQIA 1TBXA 2WV0A 5BOXA 3P9IA 5H6RA 3QOPA 3CUOA 5HDKA 3U2RA 4MHGA 1TW2A 2EJRA 1SMTA 4LK1F 1XD7A 2KJBA 3E3VA 5JI6A 1K78A 3HTUA 1FNNA 1KQ8A 4U0WA 2ESHA 1U5TC 1F4KA 5FO5A 3HSRA 1P2FA 2JRTA 2HFHA 4LG0B 1OMIA 4WXDA 2MA3A 4UV9A 1FYMA 3KLOA 2EK5A 3EUHA 2F5CA 2OA4A 3KP6A 4L9TA 1GXQA 1XGSA 4KFCA 2DLLA 3C1DA 2Z9OA 2P7CB 4ZYEA 3TO7A 1ZG3A 1G4DA 5LHHA 2ZCWA 1QZZA 3RPUA 2HQRA 3R4KA 1KYWA 3IHUA 1O57A 1TQPA 2FA5A 3LA2A 2Q2EA 3FM5A 2D1VA 5D8KB 2MLKA 3BJ6A 1BI1A 5DCFA 3ML6A 3RYPA 4L5IA 2UWMA 2P8TA 2CO5A 1EH6A 3RKXA 4GXOA 4HX7A 4U7BA 4LFUA 5D4RA 5FB2A 3F8FA 5DD4A 1YS7A 3I71A 2Y48A 3LSTA 3TDZC 3T8RA 2F5FA 4KN7X 3B02A 2LF8A 5EEGA 2FNPA 1K7AA 5HLIA 2ZBKA 4S04A 5D5WB 4LMYA 2XAJA 1B1BA 5J8CA 3NQOA 4EM2A 3FXQA 1J59A 4I98B 3CLOA 3H92A 3T1BA 2HTSA 2V1XA 4HYEA 3W6JB 2HEOA 3WTTC 2NNNA 3LAPA 2O0YA 2ZXJA 5JFRA 2K7LA 1F9NA 1O3RA 2FE3A 1RUOA 2GAUA 2QQAA 1O3QA 2IJLA 1SFEA 2W25A 3WTSC 5K5QA 1FBQA 1XCBA 1YYVA 2CW0F 4M9ZA 2V1UA 3ZMTA 2VBWA 3CO7C 2LNBA 2IPQX 1ZG5A 4OIPF 3ECOA 1FLIA 1KQ0A 4P96A 2IA1A 2FU4A 3LQQA 3ZMVA 4RB2C 1JXSA 1CF7A 3B73A 3N97A 3FHZA 5E8GA 5CVVA 3H3ZA 3KP4A 4LG0A 2EFNA 5HOOA 3IKTA 3HSFA 5LEJA 5E1XA 3C3WA 3LFKA 4Z2YA 2PG4A 4R79A 3V8KA 1IN5A 2DK5A 1R22A 4A5MA 2PMHA 4L9NA 4ASNA 3FWEA 1HBXG 1R5HA 2PMUA 4XLNF 5CVRA 5DD8A 2A6EF 4OU0A 1UCRA 3GX4X 1DUXC 2ETHA 3E6DA 5ICCA 3OOPA 4O6JA 4HF2A 2HKXA 3HRSA 5FD5A 5D4SA 3P9KA 5E8IA 4BHCA 4IVNA 3ROUA 3E6CC 1A04A 3E6MA 1RZ4A 2ISYA 3BY6A 3VODA 2COMA 3TGNA 1XGOA 4RGSA 2NS0A 4BNCA 2QM3A 5ILVA 2FQ3A 1BIAA 1FBUA 4CICA 3QRFF 4HF0A 1Z91A 4IHSA 1XGNA 3WTUC 4A12A 5LGTA 4IHTA 3GFMA 4HOBA 5K5RA 1U3EM 4Q48A 4KMUX 1XDSA 1TLHB 2YR2A 1B4AA 1HXDA 2EV0A 4M6XA 5E1WA 2TDXA 5E1ZB 4CZZA 1ZN2A 3Q9SA 4MEYF 1Z6RA 2K86A 3HHGA 4N0BA 2V6CA 1KU2A 1J0RA 4LLGF 4ESFA 4G9YA 3R6SA 2YX4A 2F5EA 2Y0MA 1YW8A 1HKTA 1FX7A 2VXZA 5HS8A 4G7HF 2P5VA 5DEQA 1KA8A 2Q8KA 1OPCA 3ZQ7A 1KYZA 3K1PA 2FRHA 4RGRA 2P7VB 1BN5A 1SMYF 3KZZA 2EV6A 1G3SA 5L3DA 4YIFA 1XN7A 2G7UA 2XUBA 4R1HA 2P5KA 2D1HA 3DP7A 3L09A 5D8LB 2MH2A 1C0WA 1ON1A 1U8RA 2QYOA 2VE8A 3KP3A 3EQLF 2XKOA 4JQFA 5BS6A 2QZ8A 4L0ZB 2EFWA 3WTYC 4EJOA 4ENMA 3MZHA 2OU2A 4KN4X 4YFNF 4AIHA 3WTXC 1O7LA 4ETSA 4O3MA 2O03A 2LF7A 3I0TA 1Z7UA 5LHGA 2K4JA 2FMYA 1UHWA 2L01A 3O2PE 1ZG1A 1HKQA 5IT9Z 2A69F 4MEXF 2YX7A 3V7RA 2XASA 3KFWX 3DV8A 3G3ZA 5D5VB 4M74A 1R7JA 1SD4A 3GZ6A 5F1RA 2D2WA 4UUVA 3CUQB 3WU0A 5FD6A 1TW3A 2DQLA 3K2ZA 5HLHA 2PEXA 3BROA 4LB6B 1MDMB 4XBFA 1BOAA 2RV8A 4HX8A 4FX0A 2HQNA 4UVBA 4OOIA 2GWRA 2ZO4A 3GUDA 1IN4A 4U88A 3V4GA 3BDDA 3GW2A 3TKYA 4ZH4F 3BWGA 5CLSA 1WRJA 2VOOA 3TDUC 5KVRA 4HQEA 2XAGA 2XHKA 3LWFA 3V8LA 2O3FA 2CFXA 1KU7A 2HKOA 5CJ9A 1E17A 4ZZLA 4I09A 2L4AA 2ZKZA 3L2CA 1O7FA 3IL2A 2JT1A 3V7SA 4CYDA 2MD5A 4GCVA 1OYWA 4CDGA 5L3EA 1YO5C 3BPXA 2CQKA 3TO6A 4N9HA 1R1VA 1BC7C 1W5SA 1QQIA 1TTYA 1S3JA 3SHFA 2BGCA 5KK1A 1WSUA 2E7XA 3GZ5A 4EGYA 2E1NA 1XGMA 1O3SA 2STWA 1SAXA 1MJBA 3ZN0A 1NHAA 1B59A 3DQVC 4JK1X 2H27A 2ZJ2A 1RNLA 1LEAA 3RI4A 3KEQA 2KKOA 4AWXB 4GO1A 2O6GE 4ON0A 3ZN1A 1FSHA 1OYIA 4KIBA 1P6RA 1J9IA 4MQ9F 2Z33A 5E18F 5K5OA 4OMZA 1IXRC 4GYGA 5CVJA 1FP1D 2OAZA 4B09A 2JPCA 3GLXA 3J81K 4Q5SF 1W5TA 2JSCA 3HIFA 1W7PD 3N4MA 2Y75A 3VFZA 4I2OA 5A2QZ 1TNSA 3I64A 5IT9K 3T0YA 2VT3A 1J7KA 5EEHA 2PFBA 3EETA 3LA7A 2Z3YA 1QZYA 3KCCA 3QPHA 5JHUA 2BEOA 1K79A 2V79A 2DFIA 5DDGA 4MNUA 2DPDA 3NEUA 4WCGA 1RI7A 4I0BA 1D3YA 2G9WA 3ABTA 2IT0A 2W24A 5H20A 4L9VA 4HQMA 2R7FA 2NYXA 2HZTA 3ZMZA 4ENNA 2H94A 3E97A 1ZYRF 5DUKA 1I6XA 1U78A 5LHIA 2RDPA 2OZ6A 1LB2A 2EA2A 2GIVA 1ONVA 1HKSA 1FPQA 3F72A 2XRNA 3REOA 4KDPA 5AIPA 2ZMEB 2MC3A 3K1MA 1G3WA 3RJPA 3IC7A 4HA8A 2HS5A 2EFOA 1YIOA 1G3TA 1ZREA 1FY7A 3JAMZ 1LDKB 2MBFA 4JBAA 4FHTA 2PI0A 2QLZA 1LDJA 4I02A 4EJVA 2NRAC 1DPRA 3MCZA 6PAXA 1FC3A 1I1SA 3L00A 4EJWA 2PQ8A 2Q0OA 3KETA 2MH9A 3ZMUA 1U2WA 1XSDA 3WGHA 4CO8A 3BJAA 4HX4A 3M8FA 4A2UA 3D0SA 3KP2A 3ZMDA 1KU3A 3HOTA 2M8EA 4MTDA 1WWXA 3JW4A 4ENKA 3C7JA 3TOBA 2O8XA 4YFXF 2XAFA 4M9SA 4KICA 2DU9A 2DT5A 3MWMA 1V3FA 2VBYA 3ZPLA 4BHPA 1HSTA 3BP8A 3P7NA 3F8NA 1YG2A 4FT8A 3ELKA 3GO5A 4HZFA 2M45A 3I5UA 1P4AA 2B0LA 1H0MA 3K1NA 2XVCA 4QLCU 3DPLC 1ZLKA 5A2QK 4OMYA 2ISZA 2GQQA 2FSWA 4HDVA 2GZWA 4BHBA 1AOYA 1OYYA 1W7PB 4LB5A 1XB4A 2BBYA 4CXFA 5HVQC 1PP7U 3ZP5A 2RC4A 2R3SA 5J8FA 4ZZDA 2V1DA 2OZUA 4HV5A 4G94A 3I59B 1FT9A 4ESJA 3H3UA 2EWNA 2QENA 2HWVA 3GEZA 1TNTA 3ULQB 3HYIA 1R1TA 2JPBA 2CG4A 2BYVE 1R5GA 5L3BA 1R1UA 3KZYA 1B6AA 1SFXA 3KP7A 3GF2A 4HV6A 3IRRA 4HAMA 1WQ2A 1J75A 2AXLA 2RGVA 1PDNC 5BPIA 3GFIA 4B8XA 2FMLA 1XMKA 2VBXA 4M6YA 5K1YA 3WU1B 1HW1A 4K2EA 3F23A 4Q47A 3JSOA 4WXCA 4FX4A 2KIUA 4A6DA 1T98A 3JAMK 4NHJA 5CYVA 4YG2F 4F7ZA 1IXCA 1S7OA 4WX9A 5ERIA 1IRGA 1YW7A 2ZMEA 3HRUA 2A07F 1EH8A 3JSPA 2FNAA 1HW5A 1U6GA 3L7WA 5E17F 5ILUA 4G7ZF 5D5XB 1IN8A 3VOEA 4IJAA 4NQWA 1HQCA 4UVCA 4G7OF 2K02A 3HOSA 4EM1A 2PBIA 5E20A 1BJAA 4PGHA 3MFKA 4RB1A 1YS6A 2IA2A 3MZYA 3CJNA 5D6EA 5CVIA 3QP6A 3WE2A 4EVIA 1KU9A 2EFPA 3WG9A 4A0YA 1VTNC 5FGMA 4WK8F 3R0AA 2QQBA 3IRQA 4RS8A 2FBKA 3V8JA 3HRMA 5DYMA 4OINF 1D5VA 1K78B 4AIKA 3RTRA 2KIMA 3G73A 3WTWC 3DPTA 4DQ2A 2E1CA 4MGRA 2X0LA 2KIFA 3OV8A 4Y15A 5HLGA 1U5TB 5F64A 3J7AO 2H6BA 1K6OA 1L0OC 2NNYA 4U7DA 3F21A 4AVPA 3DEUA 3HUGA 1GVJA 3R0JA 4WXHA 3AAFA 1UHMA 4UV8A 1LJ9A 2L3DA 3MEXA 2NAZA 3WE3A 3FXUA 4RGXA 2L02A 2RVCA 2W85A 2RQPA 3V7CA 2H6CA 2LKPA 2LSOA 3M7GA 5JVTA 4M72A 2STTA 2X4HA 3F8CA 3SZTA 1DDNA 3PQJA 3DF8A 3M8EA 2FXAA 4KMFA 1YQAA 2DO7A 5TRDA 2UXXA 1IW7F 1IN7A 2PN6A 4XSZF 2W84A 4HBLA 3FZVA 5FFZA 2M30A 4G8XA 5LLQA 2H09A 4BQAA 5LGUA 3SQNA 4RB0A 3JTHA 1YW9A 3M1EA 1SD5A 3SFZA 1YTYA 2ZFWA 4HLYA 4IRGA 4LGWA 1JHFA 1ZH5A 2IA0A 2E7WA 5L3FA 1IF1A 1Q1HA 2A5YB 3RKYA 1PP8F 1T0FA 3I4PA 1J2XA 2M5WA 4H0EA 2OQRA 4XRFA 5LGNA 2C6YA 2A61A 5IT3A 3LQRA 4P55A 1USSA 5DV5A 2HGCA 2CWEA 4BXUA 3RIRA 3U1DA 1GXPA 2O61A 1FSEA 1Z6TA 1LNWA 3HRTA 1XSXA 4CGZA 1G6NA 1S6LA 5DCMB 4OIOF 2XROA 3HSEA 5BQTA 1BI3A 3DXJF 1STZA 1X3UA 3TQNA 3RKWA 2JTVA 2A3SA 3IKVA 1CGPA 4KIGA 3TOAA 1D8JA 1S29A 2VODA 4P5OA 1T38A 4LLLA 2CYYA 1R00A 3ABUA 3CTAA 1IRFA 3GWZA 2A6HF 3U9GA 2W57A 4EGZA 2HOEA 3C18A 3K69A 3Q9VA 4S05A 3EYIA 3BJOA 1BBYA 1JGSA 3ISPA 5LRRA 1CF7B 4L9JA 2QUFA 2DI3A 3WGIA 4CHUA 1LVAA 4L0YB 2R7DA 1I27A 2HR3A 1U5TA 1ZHFA 1BM9A 3FMRA 3T8TA 2Z5UA 4LJZF 4PZJA 1WI9A 1KQ9A 2QWWA 4PCQA 3VEPA 1FWZA 4P9UA 1MD0A 4MTEA 4BH9A 1MGTA 4XLPF 4TV7A 5ILSA 3CUQC 2Z99A 1T2KA 1LQ1A 3IWFA 1KGSA 4EJUA 2VBZA 2ELHA 3CUQA 1EV7A 2OQGA 4Y13A 5LEKA 2LDUA 5HDNA 2EFQA 2RNJA 2IRFG 2YSRA 3DKWA 4HDUA 1MDMA 1OKRA 3CDHA 1ZGJA 4ENJA 4EV0A 1Y0UA 2XV4S 3GXOA 4AIJA 4Y17A 5L3CA 5CVUA 3E5XA 3Q5FA 4BAYA 2ADUA 5LRSA 5AIQA 5ICFA 4IPAA 1ON2A 1J5YA 1YLFA 3J80Z 3PQKA 3ZMSA 1LDDA 4KNYA 3MQ0A 2EV5A 1ZRDA 5D5UB 3ERED 3ECHA 2WTEA 5LBQA 3SZPA 1D8KA 2FBHA 1MJAA 4G6DA 1USTA 3M9AA 1TQMA 2VONA 2UXNA 3HTSB 2QBYB 1I5ZA 4Q4ZF 1Z05A 2DW4A 2OBPA 1P4WA 3E5UA 4RGUA 4EJTA 1ULYA 3RDIA 5DCMA 4U0YA 2IVMA 1DP7P 1IXSB 2XAQA 3RYRA 2J5PA 4IXAA 2ZNYA 4UNOA 3IWZA 2L54A 3K9TA 2CGPA 1O3TA 5DUIA 3EDPA 3GYHX 4A6EA 3FM3A 4A5NA 3JTGA 2FF4A 2GA1A 4ZYGA 2M1BA 4HF1A 1XSVA 4G6QA 1QPMA 4I01A 4EQQA 4MQVA 3F3XA 5HDGA 1FBSA 1HW2A 4KT5C 1ZAOA 3EYYA 1F1ZA 2UZKA 3I53A 4AD9A 1R23A 1FOKA 1R58A 2QVOA 3QPTA 2D45A 2DQRA 5AONA 3COAC 5BMZA 1FYKA 2HDCA 4NB5A 2P5LC 1IN6A 4A0XA 5ICEA 4GYIA 2F5DA 5JR3A 4OIQF 2XIGA 3WODF 2M87A 1Z1DA 4L5JA 2FBIA 1EH7A 2K4BA 1T39A 2DAOA 1IUYA 1SD7A 2RKHA 1RIOH 4LK0F 1W4MA 4M73A 3FXRA 4GGGA 1RUNA 1P92A 4RAZA 5L3GA 1BC8C 1SFUA 2P6TA 3L9FA 4R8HA 2PJPA 3QP5A 2ACJA 3P9CA 3QU6A 1ZARA 2VC1A 3J80K 2EA4A 1IAWA 3I58A 2BE5F 5FLXZ 2YPRA 2VT2A 2A68F 3F8BA 1AWCA 2L4MA 3BOQA 3K0LA 4I0AA 3D5LA 2XAHA 4HLXA 4KA4A 3S2WA 4WWCA 5ED4A 3I54A 4QWQA 1JE8A 2OD5A 3GVAA 2VOPA 3KEOA 1F5TA 2JZYA 3W6KB 2VC0A 3SXYA 5HS7A 4IRIA 2VN2A 1YFHA 2RN7A 2CSOA 2VE9A 4RAYA 3HHHA 1ODDA 3BZ6A 4UHTA 2HYFA 4ZYDA 4ZYHA 5H6QA 1UB9A 1FYLA 1S7AA 2QBYA 3KLNA 3GFJA 2IP2A 3NRVA 1GHCA 4RB3C 2XKPA 1ZGAA 2DBBA 3DFGA 1BI0A 2ZNZA 2HYGD 2IW5A 2K27A 3CO6C 4LD5A 3BPVA 5ICGA 4KYWA 1R36A 2BV6A 4I7HA 2G7HA 1T6SA 2EB7A 4WF2A 1XCVA 1S8NA 4EM0B 4PDKA 3FMQA 4PGGA 4A0ZA 1L3LA 2WC2A 5HS9A 2F2EA 3F22A 4DNCA 2KRFA 5BPDA 5FFXA 4P9FA 1QBJA
chains in the Genus database with same CATH superfamily
3GFLA 3GLLA 1V5EA 2DK8A 3OL4A 3RPQA 2DPUA 5TJJA 1UMQA 4F55A 3WTZA 1W7PA 1JTYA 2FOKA 5F6FA 2BY2A 3K4NA 2CH0A 3J81Z 1WGXA 2QQ9A 2HU9A 2DFFA 4YIIA 3BR2A 2YU3A 5FKKA 3E7LA 1MNMC 4OIRF 2DTRA 4E70A 3HBLA 2CW7A 3PL8A 1NH3A 1BIBA 1BI2A 4W97A 4ESBA 3H1CA 3LAJA 1P4XA 1G3YA 1PUEE 2AS5F 4J01A 1MKMA 2R0QC 5LFAA 3I59A 4J00A 3QU3A 5D6FA 3VPRA 3MKZA 1RETA 1H9GA 4PK4A 3OYBA 3F6VA 3WGGA 1MJ9A 1D1BA 4BYYA 3WTVC 2Q2EB 3VB2A 3R60A 3KP5A 3F8MA 4E7HA 3TEDA 3B6CA 3KE2A 3BT9A 4KUMA 3RZDJ 2A05A 2GA2A 3A0BC 3LA3A 1OR7A 2ESNA 2J5OA 2MG4A 1REPC 1QNTA 4M71A 3TBIA 1DPUA 2WAQN 4YFKF 2GXGA 4H4KC 2HVQA 1H8AC 2QSFX 4UVAA 2KQRA 4IQ4A 4FISA 2PLYA 4N9IA 2KJCA 3H9JA 4JX4A 2K3FA 2HQ5A 1H89C 4L18B 4KIFA 1LFUP 3FF5A 1TP4A 1FZPB 2V9VA 3PFIA 1R5ID 3SYTA 2R5ZB 2DODA 3O6BB 4ZTFA 1ZRFA 1WKMA 5FLXK 1LEBA 3MN2A 2K9SA 1FP2A 4XSXF 4UUSA 1I1GA 1QRYA 4U0VA 4IF4A 3X2QH 4IRHA 2AQFA 2E2HJ 1F36A 2WWYA 3V42A 1XMAA 1FTTA 1ZLJA 2P6SA 1MZBA 2Y31A 2ZJQF 1AHDP 1ZRCA 1H9TA 1SD6A 1WJDA 5FKOA 3OSFA 1ETKA 3O3KA 3Q0WA 3WHCA 4HEA2 1B9MA 5J6XA 5GAEJ 4EMSA 1WJEA 3L2UA 4HW0A 2GXBA 3I4MJ 4M9XA 3AL0C 2XGXA 3P5JA 3FMSA 2MLGA 3QAHA 4BEHB 1ZQ3P 4LLNA 4A3MJ 3G1OA 4D0PA 4O5VA 2DOFA 2NVQJ 4B3AA 3MAJA 4FE4A 1B9NA 1XDUA 4G6TB 3F6OA 5C4XJ 2FEZA 3TO9A 2LG4A 1V4RA 1QO0D 1OQYA 3H5NA 1B72B 1IZ1A 4JX6A 3CCJI 1QGPA 1UFMA 2L9RA 1JKOC 4UXNA 3E6BA 3FX3A 2P4WA 1E2XA 1UG2A 5E3LA 3R61A 1JHHA 1OFCX 2XF5A 1Z9CA 5EG0B 1HSJA 3E5QA 2HTJA 2HVSA 5CPRB 3T5XA 2VXDA 1WFXA 3M07A 1TQIA 3IUOA 1TBXA 4XKWA 2WV0A 5BOXA 3DTEA 3P9IA 5H6RA 2KHMA 3O8GA 3QOPA 1MMDA 3CUOA 3I3LA 3Q3SA 5HDKA 2WADA 3U2RA 4MHGA 1TW2A 2EJRA 3BG6A 1SMTA 4LK1F 1LE8B 1OCZH 1XD7A 4CSWA 2KJBA 2XC7A 3DEWA 3E3VA 1EJ9A 5JI6A 3A01B 1K78A 4XN0A 3HTUA 1FNNA 1KQ8A 3BR0A 3HKZA 1U9OA 4U0WA 4ANJA 2ESHA 1U5TC 3FXLA 1F4KA 2HVRA 3TW6A 5FO5A 4U87A 3VWBA 3HSRA 1P2FA 2AHQA 1H88C 3PJRA 3ASOH 2JRTA 1X2NA 4DYCA 2HFHA 4LG0B 1KZHA 3EUHC 4RM2A 1IDYA 3S15J 1OMIA 4WXDA 2MA3A 2VQHA 1OCTC 1MW7A 2JA5J 4UV9A 1YRNB 1FYMA 2QGUA 3KLOA 2EK5A 3EUHA 1VQNI 1A6QA 2F5CA 3JRHA 2Y0SN 1SANA 2LP0A 1NG7A 2OA4A 3KP6A 1JJ6C 2VJJA 2R7ZJ 2DDAA 4L9TA 1GXQA 4E7LA 1XGSA 4KFCA 4M3DA 2DLLA 2X85A 3C1DA 4AC0A 2Z9OA 2P7CB 1FMVA 1MH4A 4ZYEA 3BR5A 3HGYA 2CUZA 3TO7A 4XICA 1RR8C 1ZG3A 1PUFB 2Z2SB 3OYFA 1G4DA 1N75A 4B44A 5LHHA 2ZCWA 3ABMH 1QZZA 1FJLA 3RPUA 2HQRA 2DMUA 3R4KA 1KYWA 3IHUA 4IHYA 1O57A 1TQPA 2FA5A 3LA2A 2Q2EA 4RM3A 1BA5A 3FM5A 2D1VA 2CQ7A 3DCFA 3GMEA 5D8KB 1X58A 2MLKA 3BJ6A 3MKYB 1BI1A 2KLOA 5DCFA 4BL0B 3ZXSA 2I8DA 3OIPA 5IP9J 4BDYA 2TRTA 3ML6A 1HOMA 3RYPA 4L5IA 2UWMA 1TWFJ 3HJEA 3DLLF 2OCCH 2P8TA 2XF6A 2CO5A 2E19A 1ZGWA 1EH6A 3RKXA 4GXOA 4HX7A 4U7BA 1SEUA 1VQPI 4LFUA 4I76A 5D4RA 5FB2A 3F8FA 3VSLA 1FOWA 5DD4A 2RNGA 1YS7A 4OAYA 4KITB 3I71A 2R5ZA 3LSKA 5M5WJ 2Y48A 3LSTA 3H3VK 1DGRM 4XLFA 1WJBA 3TDZC 3T8RA 2F5FA 2N8GA 4KN7X 2ZXWH 3B02A 4NQWB 1APLC 2LF8A 4QPOA 1Y1WJ 3JR9A 5EEGA 1WHUA 4M3BA 4A3CJ 2FNPA 1K7AA 5HLIA 3S3NA 2ZBKA 5D5WB 4S04A 4LMYA 2XAJA 3OL3A 2MD0A 2GLOA 1B1BA 5J8CA 2KP6A 3NQOA 2VPLA 2OCEA 4EM2A 3FXQA 1J59A 5J1YA 4DGWB 4I98B 3CLOA 1T08B 2CRGA 2XGEA 5FJ8J 2V6EA 2R4GA 3OYAA 1W36D 3H92A 3T1BA 3HGGA 4KJZA 2HTSA 2RAEA 3OIQA 2HOTA 2V1XA 4BEHA 4HYEA 2VASA 3HC7A 3W6JB 3S17J 2DCEA 2F4IA 2HEOA 2QCOA 2XB5A 3BZKA 2DA6A 3FHNA 3WTTC 4PUSA 2DT7B 2NNNA 3LAPA 1TT5B 1JUMA 2O0YA 2R7VA 2ZXJA 1SVOA 2KMUA 4V2GA 4IHWA 5JFRA 1ORKA 2VLAA 2ZXIA 2K7LA 1F9NA 1O3RA 2FE3A 2K3PA 2WA0A 3QQAA 1RUOA 1V5FA 2GAUA 2QQAA 3OYIA 1I6HJ 1WCMJ 3LFUA 1O3QA 3CCMI 3JRCA 2IJLA 1SFEA 4I6ZA 1A5JA 2W25A 3WTSC 5K5QA 1FBQA 1XCBA 5K7FA 1YYVA 1VQMI 2CW0F 1YOVB 4M9ZA 2V1UA 2R7XA 1RESA 2HOAA 3ZMTA 2BHYA 1S5LC 2HQAA 1X1BA 1UJ8A 2VBWA 4YRVA 3CO7C 4V19K 1MMGA 2LNBA 4KISA 2IPQX 1ZG5A 2BXZA 3MMYB 2WAEA 4OIPF 2ELKA 3ECOA 4LITA 1FLIA 1KQ0A 2HDWA 5FKNA 4P96A 3IH2A 2L7FP 3BCBA 3HUGB 2IA1A 2FU4A 3AG1H 3LQQA 3CD6I 3ZMVA 4DW6A 4RB2C 4D7MA 1JXSA 1JT0A 1CF7A 4ABZA 3B73A 3CJRB 3N97A 4FE7A 2B7EA 3FHZA 5E8GA 5CVVA 3H3ZA 3KP4A 4LG0A 2EFNA 5HOOA 3IKTA 3HSFA 5LEJA 2H1LA 4XM3A 5E1XA 3C3WA 2DMQA 3LFKA 4Z2YA 1Z0XA 2PG4A 4R79A 3V8KA 5F0HA 1MIJA 1IN5A 1MH3A 1MBFA 2DK5A 5FLVA 1XTAA 3OIOA 1R22A 4A5MA 5FKLA 2PMHA 4L9NA 3QWLA 4ASNA 3MKWB 1TWGJ 3FWEA 5GTHC 1HBXG 1R5HA 2PMUA 2ZFUA 4BJ6C 2K9NA 4XLNF 1K83J 1YIJI 3Q0VA 5CVRA 3OYJA 3K7AJ 5DD8A 2A6EF 4OU0A 1UCRA 3GX4X 1DUXC 2ETHA 3E6DA 3K4KA 5ICCA 2CQQA 3OOPA 4O6JA 4HF2A 5IOYA 3C2GA 2ECBA 2HKXA 3HRSA 5FD5A 5D4SA 3P9KA 2ZC2A 2NXNB 5E8IA 4BHCA 2CUEA 2IS6A 4IVNA 1WZ2A 3ROUA 3E6CC 2KFDA 1A04A 3E6MA 4V2FA 1RZ4A 2JWTA 3RQIA 2ISYA 4E7ZA 2FX0A 3BY6A 3VODA 1POGA 2COMA 2DJNA 3TGNA 1XGOA 4RGSA 2XRLA 2NS0A 4BNCA 2QM3A 2L7KA 5ILVA 2DOEA 2FQ3A 1BIAA 1FBUA 4LG3A 1RR7A 4CICA 3QRFF 2V26A 2LR8A 4HF0A 4XL9A 1Z91A 3ZQGA 4NC7A 4OWRB 4C2UA 4B47A 4IHSA 1XGNA 2W48A 3WTUC 4A12A 5LGTA 4IHTA 3GFMA 4HOBA 5K5RA 2LKXA 3K4MA 1U3EM 2Y69H 3ZOBA 2BZTA 2JJ7A 4Q48A 1YITI 4AYBA 2BY1A 4KMUX 1Z77A 1XDSA 1WI3A 4DIQA 3BQYA 3A1YA 3NWSA 3LSGA 1TLHB 2YR2A 3I55I 1B4AA 1HXDA 2EV0A 4M6XA 5E1WA 2TDXA 2DJIA 5E1ZB 4CZZA 1ZN2A 3Q9SA 4XLHA 3MKLA 2VI6A 4MEYF 5FRNA 1VQ7I 1Z6RA 2FJ1A 2R7UA 3IV5A 1ZELA 2K86A 3HHGA 1MBKA 4N0BA 2V6CA 1KU2A 1J0RA 4LLGF 1YJWI 4ESFA 1QU3A 1B8IA 4ZC3A 3M1CA 4G9YA 3OSGA 3R6SA 2YX4A 2JQ7A 2F5EA 2Y0MA 1YW8A 4UB8C 1HKTA 2CFOA 1FX7A 2VXZA 5HS8A 3O8HA 4E7IA 4G7HF 2P5VA 2OPTA 5DEQA 1KA8A 2Q8KA 1W0UA 2K9LA 2VJ5A 1OPCA 3A03A 2V9PA 2W00A 3GCMA 4CYCB 3ZQ7A 2X1EA 1KYZA 2BY0A 3K1PA 4JOMA 2IGKA 1WVRA 2FRHA 3QODA 4RGRA 2P7VB 1G2HA 3IP4B 5F04A 1BN5A 4IKFA 1SMYF 3KZZA 2EV6A 1G3SA 4NDLA 1Y1VJ 5L3DA 1BR2A 4YIFA 1XN7A 1BW5A 3DTIA 4GFBA 2G7UA 2XUBA 4R1HA 4NUBA 2P5KA 2D1HA 2L7ZA 3DP7A 3L09A 2LYCA 5D8LB 2M0MA 2EZLA 2MH2A 1C0WA 1ON1A 3C2HA 1X3WB 1U8RA 2QYOA 2VE8A 3KP3A 3EQLF 4RMNA 2XKOA 3PUBA 1OISA 1TWCJ 4JQFA 1T8IA 5BS6A 2QZ8A 3ZRGA 4L0ZB 2EFWA 1BR1A 4KT6A 3WTYC 1FMWA 4EJOA 4ENMA 3I9V2 3MZHA 2OU2A 2K9MA 4BACA 1IGNA 4KN4X 4YFNF 2LKSA 3OR2C 2Y30A 3SDGA 3S93A 3PFYA 3CDIA 4AIHA 2PMZN 5E79C 3WTXC 3D1NI 1O7LA 2DYRH 2LTPA 2GXAA 4ETSA 3OYHA 4O3MA 2O03A 1VQ8I 1VFCA 2LF7A 3W2VA 3I0TA 1Z7UA 2CS3A 3CCSI 1TL8A 2DA3A 5IP7J 5LHGA 2NVTJ 2JA2A 2K4JA 2F5VA 2FMYA 3FK7A 3OOUA 1UHWA 2L01A 3O2PE 1W1WE 3AKZA 1ZG1A 1HKQA 1ZKGA 2HI3A 5B1BH 5IT9Z 1XS9A 3ZQFA 2A69F 1TC3C 4MEXF 1OR7C 1ETYA 4MFEA 5KHDA 1QVTA 5JHFA 2HOSA 2QKMB 2BW3B 2YX7A 1JKPC 1JJ8C 3V7RA 3KYLA 2XASA 3KFWX 5KCMA 4GDFA 3DV8A 3G3ZA 2VQCA 5D5VB 1N77A 4M74A 2AQEA 1R7JA 1SD4A 2K85A 3GZ6A 2FD5A 5F1RA 2D2WA 5J47A 3CUQB 4JX5A 3WHBA 2DA5A 4UUVA 3D5RC 5F27A 3WU0A 5FD6A 2KZVA 2R7WA 2M7BA 1TW3A 1HC8A 3FXMA 2DQLA 3K2ZA 5HLHA 2PEXA 1MSFC 3BROA 4LB6B 1MDMB 1BOAA 1X1DA 2RV8A 4HX8A 4FX0A 1N25A 4PJJA 4XBFA 2HQNA 4UVBA 5IY5H 4RLFA 1XMXA 4OOIA 1X1AA 2WB1A 2GWRA 2ZO4A 2JSPA 2M0CA 3GUDA 1KONA 4A3LJ 1IN4A 4U88A 1MBGA 3V4GA 3BDDA 3H0GJ 3GW2A 3I4NJ 3TKYA 3LSHA 4BDZA 1MMSA 3FXKA 4ZH4F 4BQNA 4BBSJ 1E3PA 3BWGA 5CLSA 1WRJA 2VOOA 3TDUC 2HPIA 2XAUA 2E35A 5KVRA 4HQEA 1YI2I 2E1MB 2Q1ZB 2XAGA 3L2VA 2E36A 3K4LA 3W3CA 2XHKA 3OYLA 3LWFA 3UR3C 4BJ5C 5DTDA 1GDTA 3V8LA 4A3JJ 2O3FA 2CFXA 2LOOA 4BY7J 2BOLA 4AUXA 2XSDC 1KU7A 2HKOA 5CJ9A 1IC8A 1E17A 4ZZLA 4I09A 2L4AA 3F9KA 2ZKZA 1I39A 3L2CA 1O7FA 3IL2A 1MBJA 1D5YA 2JT1A 4RLQA 3V7SA 2P0WA 2E60A 4CYDA 1MMAA 2JRMA 1OCCH 2MD5A 3HOXJ 4GCVA 1OCRH 3IAM2 1OYWA 2TCTA 3ZQCA 4CDGA 3N05A 4MLOA 5L3EA 1YO5C 4XLAA 4YEJA 1HDPA 3BPXA 2CQKA 3TO6A 4N9HA 1R1VA 4Z6YA 1BC7C 1W5SA 1QQIA 2CW8A 2X1CA 4XK4A 2VKEA 1TTYA 1S3JA 3SHFA 2BGCA 5KK1A 1WSUA 2E7XA 3GZ5A 3BZCA 4EGYA 2E1NA 2DMNA 1XGMA 1O3SA 2STWA 1SAXA 2CQNA 2V1NA 1AKHB 1MJBA 3ZN0A 1NHAA 3UKGA 4HG2A 1PYVA 1B59A 4PJNA 4S0HB 3DQVC 3S8PA 1Z3XA 3MD2A 4JK1X 1IRZA 2H27A 2ZJ2A 3CF5F 1RNLA 1LEAA 2ZJPF 1PJRA 4A3EJ 2XGDA 3RI4A 9ANTA 3KEQA 3JRAA 2KKOA 1M1EB 4AWXB 2ICWG 4GO1A 4LIUA 2O6GE 4ON0A 2HXIA 3ZN1A 1FSHA 4XN3A 4PJMA 3QPSA 4M6VA 2M4GA 5IPAA 2M34A 1OYIA 4KIBA 2X51A 4E7SA 1P6RA 1J9IA 4MQ9F 2Z33A 1HA8A 4BGDA 2L2OA 2VJIA 3FIWA 5E18F 1WPKA 5K5OA 4ITVA 1GVDA 4OMZA 3S16J 4B4CA 3K4JA 1IXRC 1JKRC 4GYGA 2DN0A 5CVJA 3CC2I 1FP1D 2OAZA 2KRHA 2LLKA 3CP8A 4B09A 1S72I 2JPCA 2PJRA 3GLXA 3J81K 2V9KA 2H8RA 4Q5SF 4XR6A 1W5TA 2JSCA 1IO2A 3PSFA 3HIFA 1W7PD 3N4MA 2Y75A 3CCYA 3VFZA 2WAFA 4XRSG 4I2OA 3S2DJ 3JRDA 1NG6A 1GT0C 4XLCA 5LD2C 5A2QZ 3M4OJ 1TNSA 1K4SA 3NAUA 3I64A 5IT9K 3T0YA 1LKXA 3RQ4A 3G1LA 2VT3A 3CZ6A 1J7KA 5EEHA 2L0KA 2PFBA 1T95A 3GTGJ 3OYMA 3H0DA 3EETA 3LA7A 2XF7A 2Z3YA 1QZYA 3KCCA 4DYRA 3QPHA 3S1NJ 4A3FJ 5JHUA 2O8KA 2BEOA 3HKZN 2LBFB 2QSGX 5C3EJ 1K79A 4C2TA 2V79A 2DFIA 5EJCA 5DDGA 4MNUA 4XRMA 1BL0A 2DPDA 3GTQJ 4CH7A 3NEUA 4WCGA 1RI7A 4I0BA 1D3YA 2G9WA 2M9HA 1VQ9I 3ABTA 4Y3OA 4G12A 2IT0A 3MVPA 3GTKJ 2W24A 5H20A 2W82A 4L9VA 2K40A 4BE0A 4HQMA 2R7FA 5E3OA 4HRIA 2NYXA 1A36A 2DXIA 3J7ZI 1VF9A 2HZTA 2NS8A 5B3SH 4NNJA 3ZMZA 4ENNA 4A3IJ 1X4PA 4II3A 2H94A 4IX7A 3E97A 1ZYRF 5K7ZA 3IAS2 3B6AA 2Y9ZA 1ITYA 3CQZJ 5DUKA 1I6XA 1U78A 5LHIA 2RDPA 2OZ6A 1LB2A 4HNUA 3CCVI 2E2IJ 1U9NA 2EA2A 2GIVA 4F93B 4QPQA 2OF7A 1IRXA 1ONVA 1HKSA 1FPQA 3F72A 1TWHJ 2XRNA 3REOA 1NTCA 4KDPA 5AIPA 2ZMEB 1U0JA 1IV8A 3A02A 2MC3A 3K1MA 4X0GA 1G3WA 2JMWA 5E3NA 1UZCA 1QPIA 3RJPA 3IC7A 1IJWC 4HA8A 2HS5A 2EFOA 2HZDA 1YIOA 1TT0A 1G3TA 5GTIC 2X48A 4CZCA 4PFOA 1ZREA 3JCUC 1MSEC 3AG4H 3DBLB 1K61A 2M7AA 4C3JJ 4II2A 1FY7A 3JAMZ 3KX2A 1LDKB 2MBFA 5CQGA 2K9QA 2Z1DA 4JBAA 4X6AJ 1JT6A 4FHTA 2PI0A 2QLZA 1RKTA 3H5AA 1QA6A 3HEFA 3BR3A 1LDJA 4I02A 4EJVA 2NRAC 1DPRA 1ETOA 3MCZA 2EPFA 2LRDA 3OMYA 6PAXA 3EUAA 1QHGA 3CMAI 1FC3A 4B43A 1I1SA 3L00A 2M2EA 4EJWA 2PQ8A 2Q0OA 4C9YA 1R49A 3RCOA 3KETA 2MH9A 3ZMUA 1U2WA 1Q1VA 2KT0A 2KZGA 5M3MJ 3LL7A 3HB9A 1OLTA 2OV7A 1XSDA 3WGHA 2ZSHB 2VB6A 3CMYA 4CO8A 2ME6A 1RKWA 3BJAA 3TP3A 4HX4A 3M8FA 4A2UA 3D0SA 4ZJZA 3KP2A 5BNGA 2E2JJ 1JI8A 4X1EA 1B72A 3VYTB 3ZMDA 1KU3A 3HOTA 4HNVA 1MNEA 5CKTA 2M8EA 2FOWA 4MTDA 1WWXA 3JW4A 1XX5A 4ENKA 3C7JA 3TOBA 2O8XA 4YFXF 2XAFA 5EGOB 4M9SA 3LMMA 3DEEA 3QYFA 5EG0A 3CCLI 4KICA 1FOXA 2DU9A 2DT5A 3BC8A 3MWMA 4DYQA 1V3FA 3CMMA 2VBYA 3QYEA 4UUTA 2KPMA 1IG7A 1MBEA 3ZPLA 3LSMA 1EA3A 3H9QA 2OC6A 4BHPA 5HNFA 4HPQA 1HSTA 3BP8A 4CA0A 1WJFA 1LE8A 5F1JA 2I10A 3P7NA 3A01A 2CQXA 1YG2A 2ZSIB 3F8NA 4FT8A 4BE1A 3ELKA 3GO5A 3HPGA 3VSKA 4HZFA 2M45A 3I5UA 1P4AA 2ECCA 2B0LA 2D5VA 4BQQA 1GV5A 1D0ZA 1WH7A 3BG7A 1H0MA 3K1NA 2XVCA 4FCYA 4QLCU 3DPLC 1VQ5I 5FKMA 1ZLKA 1YJ9I 4XONA 5A2QK 4OMYA 2ISZA 5HODA 3HOZJ 2GQQA 2FSWA 4HDVA 5J3LA 2R7RA 3OYCA 2GZWA 1R71A 4BHBA 1AOYA 1OYYA 1W7PB 4LB5A 5M5YJ 1XB4A 2GBYA 2BBYA 4CXFA 4RBOA 5HVQC 2W1OA 1PP7U 3FISA 3ZP5A 2RC4A 2R3SA 5J8FA 4ZZDA 1YRNA 2V1DA 1ETXA 2OZUA 3JRIA 4HV5A 4G94A 5J40A 2OTLI 2VL8A 3OWTA 3I59B 1FT9A 4ESJA 3H3UA 3UNGC 3FXOA 2EWNA 3JREA 2QENA 2B63J 1K6YA 2R7OA 3OYKA 2ZB9A 3CCUI 2X6YA 3J7YJ 2HWVA 3GEZA 1TNTA 2MABA 5IP6A 3M3YJ 3ULQB 3S14J 3HYIA 4IOCF 1IDZA 1R1TA 3H5RA 2JPBA 4DZJA 3F0CA 2CG4A 2BYVE 1BJZA 3BLYA 5C4JJ 1R5GA 2QKLB 5L3BA 2HDDA 1R1UA 1PUFA 3KZYA 1B6AA 1OJLA 1SFXA 1PVEA 4F52A 3KP7A 2UUZA 3GF2A 4HV6A 1SVMA 3IRRA 4HAMA 1WQ2A 1J75A 4ZYAA 1D0YA 2VKDA 2AXLA 3MZ8A 2RGVA 3PIPF 1PDNC 5BPIA 3GFIA 2DFHA 1W0TA 4B8XA 3EPZA 1WH5A 3PM1A 2FMLA 3K4CA 3OYGA 2AXTC 3DTKA 1XMKA 2VBXA 1X1PA 4M6YA 4PJ0C 5EYRA 5K1YA 2LD5A 2NVXJ 5JVGF 3LOCA 3WU1B 1HW1A 4K2EA 2XPWA 2LY9A 1WJCA 4XNFA 1BR4A 4XIDA 1QVUA 3H35A 2GM4A 3F23A 4Q47A 3JSOA 4UUSB 4WXCA 4AIDA 3S1MJ 4FX4A 2DTZA 2KIUA 5B66C 3JRGA 4A6DA 2QQ8A 5EF6A 4LOCA 4DZPA 2EBIA 1T98A 3JAMK 3GTJJ 4NHJA 2YUSA 5CYVA 1XG1A 4YG2F 4F7ZA 1Y8RB 1IXCA 3OS0A 1AU7A 1S7OA 4WX9A 3CMEI 5ERIA 3LSIA 1IRGA 1YW7A 2ZMEA 3HRUA 2A07F 1EH8A 3JSPA 4D7NA 3DPUA 4EEFG 3HOWJ 2JK3A 4XQFA 2FNAA 1HW5A 1U6GA 2E71A 2M8GX 3L7WA 4M3FA 5E17F 5ILUA 4G7ZF 5D5XB 1IN8A 3VOEA 4IJAA 1X3ZB 4NQWA 1HQCA 4D5CA 4UVCA 4G7OF 2K02A 2LREA 4L5EA 4ZTJA 3HOSA 1VQOI 1VNDA 4EM1A 3K6GA 2PBIA 5E20A 1LPQA 1BJAA 3BG5A 4PGHA 3IH4A 3AG2H 4F3QA 4XORA 3OY9A 3MFKA 3AL0B 3CC7I 4DBRA 4RB1A 1YS6A 2IA2A 2ZJRF 4C3IJ 3MZYA 4AYBN 4BUPA 5DS9A 2KIQA 3CJNA 5D6EA 5CVIA 3QP6A 3SFIA 3WE2A 3BCAA 4EVIA 5KAIC 4F92B 1KU9A 2EFPA 5F0FA 2MSYA 1UELB 3WG9A 2CMPA 3ABLH 1ETWA 5GP9A 3L1PA 3U21A 4A0YA 2DOAA 3DWLE 1VTNC 5FGMA 1S9HA 4WK8F 2NVUB 3R0AA 3GZNB 2QQBA 1WJAA 3IRQA 2FQ4A 4RS8A 1LVKA 2MC4A 2FBKA 1SFKA 3V8JA 1ZR2A 3HRMA 3NARA 1JGGA 2VKHA 5DYMA 2X1DA 4OINF 1R6RA 3CCEI 1D5VA 1K78B 4AIKA 3RTRA 2KIMA 2ZXHA 3G73A 2JUGA 3K70D 4PSWA 1Y0NA 3WTWC 3W2WA 3GBGA 3DPTA 3RSNA 4DOZA 5GPCA 1BW6A 2A5WA 4DQ2A 4MO7A 2E1CA 3D5SC 3CCQI 3S1RJ 1V55H 4FETA 1UHSA 2X0LA 2KIFA 4MGRA 2ID3A 3OV8A 4Y15A 5HLGA 1U5TB 2EZHA 5F64A 4M3GA 3J7AO 2R5YB 4BQOA 2H6BA 1LFBA 3BG9A 1K6OA 1NK3P 1L0OC 4HNTA 5DM7F 2DA1A 2P81A 2GOXB 2NNYA 4U7DA 3F21A 3ABKH 1R4MB 2WAQA 3K10A 4AVPA 3DEUA 2BY3A 4A3DJ 3HUGA 1GVJA 2ID6A 3R0JA 4WXHA 3AAFA 1UHMA 4UV8A 1LJ9A 2OTJI 2L3DA 2LMDA 3MEXA 1NK2P 2NAZA 1ETQA 5H2FC 4XKVA 3FXUA 3WE3A 5IYDJ 4PJLA 1SVLA 2NOJB 3CJQB 4RGXA 4BXFA 2L02A 2Y9YA 2X6XA 1E3OC 2RVCA 3OS2A 2W85A 1X2MA 4AM3A 2RQPA 3PNYA 4CCLA 1X4OA 2R93J 2EZKA 3V7CA 1G59A 2H6CA 4XLEA 2LKPA 2LSOA 3M7GA 5JVTA 3H9GA 4M72A 4IHVA 2STTA 1UG0A 2X4HA 3FK6A 3F8CA 1SC7A 3SZTA 1DDNA 3PQJA 1XC5A 4M3EA 3DF8A 3K2AA 3M8EA 5CQEA 2FXAA 1ACIA 5B1AH 2M3AA 4KMFA 2DT6A 1YQAA 2DO7A 2IEKA 4PFPA 5TRDA 2UXXA 2V7FA 1IW7F 5GADJ 1IN7A 3OR1C 1JKQC 4BXXJ 3HOUJ 2PN6A 1V5GA 4XKBA 5EZGA 4XSZF 2W84A 3OS1A 4E7JA 2CUJA 4HBLA 3AFHA 3FZVA 5FFZA 2M30A 4G8XA 5LLQA 3BTCA 2HXOA 4XMYA 2H09A 3ZQLA 2F4OB 3K4BA 4BQAA 4D9JA 5LGUA 2OUMA 3SQNA 2JA6J 2KISA 4RB0A 4E7KA 3JTHA 3DBRB 4XKCA 5F08A 1YW9A 3M1EA 1SD5A 2L7MP 3OYEA 1SFOJ 1VZ0A 3SFZA 1T33A 3G1MA 1YTYA 2ZFWA 4HLYA 2MYSA 2MGQA 4MFDA 1LFPA 4IQJA 4IRGA 2LC2A 4LGWA 1JHFA 4EATA 3WG7H 1T0FC 3G2BA 1FIPA 4FTHA 2Z16A 1ZH5A 3Q0UA 1JTXA 2IA0A 3BR1A 2E7WA 3ZQHA 5L3FA 5E3MA 1Q1HA 1IF1A 2A5YB 3RKYA 2IGOA 1PP8F 2WY7Q 3KPHA 1HCRA 1T0FA 3I4PA 1J2XA 2EZIA 2M5WA 4H0EA 1A6IA 2OQRA 2VPRA 4XRFA 5LGNA 3L2WA 3ZR8X 3VYUB 2C6YA 2CUFA 2JA8J 1VQLI 2A61A 5IT3A 3LQRA 4P55A 1VQ4I 1DU6A 4A3GJ 2ME0A 4RA2A 2DYSH 2WB1N 1USSA 4I99C 5DV5A 4AU7A 2HGCA 4A3KJ 1W36C 4BU2A 2CWEA 4BXUA 3RIRA 1GLNA 2LK2A 2NVYJ 3U1DA 3HPHA 1GXPA 1EF4A 2O61A 1FSEA 1Z6TA 4HSRA 4HSTA 1LNWA 3ZGKA 2F4MB 1Z7LA 1D1AA 2LH9A 3FBNB 3HRTA 1XSXA 4CGZA 1G6NA 4D1QA 1EKEA 4UY8I 1S6LA 2R7TA 5DCMB 4OIOF 1W5CC 4CYCA 2XROA 2DFEA 3HSEA 3W6VA 1P7JA 1MNDA 5BQTA 1BI3A 3DXJF 1STZA 1X3UA 3TQNA 2Y0SA 3RKWA 2JTVA 2A3SA 3GTMJ 5HNHA 3IKVA 1CGPA 4KIGA 3TOAA 2F48A 1D8JA 1S29A 2VODA 4C30A 4P5OA 4IL6C 3TW7A 5KNLA 1T38A 4UB6C 4LLLA 2CYYA 2ELJA 1IV6A 1R00A 1R4NB 3ABUA 1ERDA 1X1CA 2LY2A 1S7EA 3CTAA 5F0CA 2NS7A 3FDYA 1IRFA 2EIKH 4Y4RA 3GWZA 2CV2A 4A69C 2A6HF 2UV1A 3U9GA 4D5FA 4Y33A 3KEYA 2W57A 3CJTB 5EEAA 2HOEA 4EGZA 2F6CA 4GRIA 3C18A 3K69A 2AO9A 2E34A 3Q9VA 4S05A 3DBHB 2DA2A 3SJMA 1V54H 3BJOA 3EYIA 1BBYA 1JGSA 4CUGA 5M3FJ 3ISPA 4FQGA 2BVLA 5LRRA 2DDBA 5EDNA 4L9JA 1CF7B 2QUFA 1YX3A 2DI3A 1P7IA 3WGIA 1LVAA 4CHUA 4L0YB 4MIMA 2R7DA 1I27A 2X9DA 2HR3A 1U5TA 1ZHFA 2QSHX 4NC8A 1BM9A 3DU6A 1GUUA 4YELA 3FMRA 2R5YA 3QYBA 2XPVA 3KYCB 3T8TA 3AG3H 4XOTA 2HNHA 2Z5UA 4LJZF 2IGNA 4PZJA 1O4XA 3BG3A 3ASNH 1WI9A 3PO2J 1KQ9A 2QWWA 3FKJA 4BY1J 1Z67A 1DGWY 2O5RA 5DM6F 4PCQA 3VEPA 2MFZA 3S3OA 2GIZA 3PNTA 1FWZA 1TWAJ 2EINH 5EZHA 4P9UA 1MD0A 4MTEA 1IUFA 5FLMJ 2XSJC 4BH9A 1LUJB 1MGTA 2HPMA 3KIOA 4XLPF 2LFBA 2OJED 4TV7A 2VUMJ 5ILSA 3CUQC 3OYNA 2Z99A 3VDXA 5J1RA 1T2KA 3S1QJ 1TZLA 3ZCOA 4NBQA 2BW3A 1LQ1A 1T56A 2IS1A 2RREA 5JLXA 3IWFA 3HG9A 1KGSA 4EJUA 2VBZA 2VQGA 4E4HA 2ELHA 3CUQA 1EV7A 2OQGA 4A3BJ 3G6EI 3IH3A 1Y39A 4Y13A 5LEKA 2LDUA 3BQZA 5HDNA 2EFQA 1FEXA 2RNJA 2IRFG 2LY1A 2YSRA 3E0JB 3DKWA 4N4NB 4HDUA 1FTZA 1MDMA 1OKRA 1P9QC 1XPXA 3CDHA 3I56I 4Y52J 1WJ5A 1ZGJA 3SDBA 4ENJA 2M4KA 3PIOF 2E1MC 2COBA 4EV0A 1Y0UA 2DA7A 2QEXI 3FKIJ 5TGTA 2XV4S 3GXOA 4AIJA 2EIJH 4Y17A 5L3CA 2CV1A 1N78A 5CVUA 3E5XA 3Q5FA 5TISC 4BAYA 2ADUA 2CV0A 5LRSA 1YE9A 5AIQA 5ICFA 1CQTA 3CCRI 4RAFA 4IPAA 1I3QJ 1ON2A 2CJJA 1RC9A 1J5YA 1G8XA 1YLFA 3PQKA 3VYSB 3ZMSA 3J80Z 3JRBA 1B8IB 1LDDA 1Z21A 2L5QA 3MQ0A 3CC4I 4KNYA 1FIAA 2EV5A 4CCOA 1ZRDA 5D5UB 3ERED 3ECHA 2WTEA 1FOYA 5LBQA 3GTPJ 3KYDB 2L9VA 4QIWN 3FBIB 3SZPA 3EUKL 1YJNI 3LSJA 3U1KA 1F43A 1D8KA 2FBHA 2DMPA 2RQQA 4FASD 1MJAA 4G6DA 3G4SI 1USTA 3M9AA 1TQMA 2VONA 2IAIA 2UXNA 3HTSB 2QBYB 2CU7A 3BTIA 1ETVA 1I5ZA 4B48A 3ZQIA 4Q4ZF 5K7HA 1Z05A 2DW4A 2OBPA 2EILH 3S32A 1P4WA 3H36A 4YIRX 3SZGA 2JUCA 3E5UA 1MMNA 4RGUA 4DBQA 4EJTA 3ONQA 1AKHA 1Y56A 1ULYA 4IZZA 2O9LA 3RDIA 4PSXA 3PNVA 3CF2A 5DCMA 2IVMA 4U0YA 3SEZA 1DP7P 1HDDC 5IYCJ 1IXSB 2XAQA 4C2MJ 3RYRA 2J5PA 5FRMA 4IXAA 2ZNYA 4XRSA 3TMOA 4UNOA 2EQRA 1I3AA 1E0EA 3IWZA 3K70C 2L54A 2WY8Q 3K9TA 4AVZA 4BKXA 2CGPA 3CLQA 1O3TA 3L2QA 1AA7A 5DUIA 2XPUA 3EDPA 5GPAA 3GYHX 4A6EA 4B1RA 4QTRA 3FM3A 2R7QA 4RAGA 4A5NA 2IGMA 2Y2ZA 3JTGA 1OCOH 5J1UA 1QZEA 4XOPA 2FF4A 2GA1A 4ZYGA 2PX9A 2M1BA 4HF1A 2XB0X 2XDVA 1XSVA 3J7AY 1ZK8A 4G6QA 2HYJA 4ZDOA 1QPMA 4DJAA 2IXSA 2EH3A 1OCPA 1Y8QB 4I01A 3M8JA 4EQQA 3CDLA 3C2BA 4MQVA 4C3HJ 2LVSA 3F3XA 2E5ZA 5HDGA 3TP0A 1FBSA 1DP3A 1HW2A 1R9TJ 4KT5C 3S2HJ 3PUFA 3GTOJ 1BC8C 1ZAOA 1I50J 3EYYA 3A4CA 4CCMA 1F1ZA 2R92J 2UZKA 3I53A 3RPUD 4AD9A 3LSPA 1YHQI 4B3XA 1R23A 1FOKA 1R58A 2QVOA 3QPTA 2D45A 2DQRA 3PSIA 5AONA 3COAC 2LBFA 5BMZA 1FYKA 3CESA 2QA4I 2HDCA 2KDOA 3ZQQA 4IOAF 2QF7A 2H1KA 4NB5A 2P5LC 2DMTA 1IN6A 4A0XA 3HM5A 5ICEA 1DU0A 3A2KA 4GYIA 2F5DA 1Y6IA 3S3MA 1ENHA 4BE2A 2IS2A 2VJ4A 5JR3A 3QOEA 2DA4A 2XIGA 1HLVA 4OIQF 4ZDPA 3WODF 4JP0A 2M87A 2K5CA 1Z1DA 2JVHA 2X6OA 4L5JA 2IS4A 2E5NA 2FBIA 1EH7A 1YX5A 2K4BA 4CCKA 2DAOA 1T39A 1SD7A 3BTLA 1K4TA 1IUYA 2NOGA 2RKHA 3CP2A 1UAAA 1VQ6I 1RIOH 3E1SA 2ZMEC 4LK0F 1W4MA 2IBDA 4M73A 3FXRA 4GGGA 3DU5A 2GOMA 4F91B 5M5XJ 1RUNA 1P92A 2X6WA 4OAZA 4RAZA 5IYBJ 5L3GA 3RKQA 1SFUA 2P6TA 2JVGA 2A6TA 2MW8A 3BTJA 3L9FA 3QP5A 4R8HA 4BBRJ 2PJPA 2ACJA 3P9CA 3QU6A 4BJTA 2VIXA 1ZARA 5GAGJ 1VQKI 4RDUA 1D0XA 2VC1A 2WV1A 3J80K 2EA4A 3A0HC 1IAWA 4LIVA 1DQUA 3L2RA 1A31A 3I58A 2BE5F 4NC6A 5FLXZ 2O7OA 1X19A 2YPRA 2VT2A 1BOBA 1RRJA 2R7SA 2A68F 2H8WA 4IEJA 1RPWA 3JRFA 2WBMA 3F8BA 4P1WA 3HXLA 5J4YA 4IHXA 1AWCA 2KRCA 4W1UA 2L4MA 3BOQA 3K0LA 4I0AA 3GTLJ 3D5LA 4J19A 2XAHA 1Z3YA 4HLXA 1GV2A 3WU2C 4KA4A 2XGCA 3S2WA 4WWCA 5ED4A 1ZTRA 3I54A 4QWQA 3TL4X 1JE8A 2OD5A 3GVAA 1E3HA 1A35A 1D1CA 3FXJA 3NWTA 3KEOA 2VOPA 1F5TA 2JZYA 4JYKA 3W6KB 5FROA 3HL2A 2VC0A 3SXYA 5HS7A 3G71I 4IRIA 5C44J 2BXYA 3LNQA 5B5EC 2VN2A 3DKYA 1YFHA 2FUG2 2EIMH 2RN7A 2CSOA 4QSHA 2VE9A 4RAYA 3RZOJ 4Y7NJ 3HHHA 1JUPA 1ODDA 3BZ6A 2I5UA 4UHTA 2W7NA 2HYFA 4ZYDA 3KZIC 4ZYHA 2PMZA 3HOYJ 3QPLA 5H6QA 1UB9A 3W2AA 1FYLA 1S7AA 2V4JC 3VYRB 2QBYA 5J4VA 4ZDLA 3DLAA 3KLNA 1SAUA 3GFJA 2IP2A 3NRVA 1GHCA 4RB3C 2XKPA 2E1OA 2YS9A 1ZGAA 2DBBA 3DFGA 1JUSA 2L9SA 3BR6A 3LSRA 5EGOA 2KDZA 3DKXA 1QHHD 1BI0A 2ZNZA 2HYGD 2IW5A 2K27A 4CCNA 3CO6C 4LD5A 3BPVA 5ICGA 4KYWA 1R36A 2BV6A 2VQLA 4I7HA 3HZJA 2YU9J 5JLWA 2G7HA 4A93J 1J09A 5IOZA 2JN6A 1HF0A 5KAFC 3OYDA 2PJRB 1ZR4A 3SEQA 1U8BA 1T6SA 4N4OB 4E6KG 5HLTA 2JA7J 2EB7A 2W4SA 4WF2A 1XCVA 3PO3J 1MBHA 1S8NA 3HDDA 4EM0B 4PDKA 1VI0A 3FMQA 2BHZA 4PGGA 4A0ZA 1L3LA 4IO9F 2WC2A 5HS9A 3HOVJ 2F2EA 2KL4A 4DNCA 2KRFA 4BS9A 3F22A 5BPDA 4CCJA 5FFXA 2B9SA 3ERMA 2BVMA 3ESWB 2VKVA 2G0EA 4P9FA 2L9NA 1QBJA 5GAHJ
chains in the Genus database with same CATH topology
3GFLA 2DK8A 2DPUA 3RPQA 5TJJA 3WTZA 1W7PA 2FOKA 5F6FA 3J81Z 2QQ9A 4YIIA 2YU3A 4OIRF 2DTRA 4E70A 1BIBA 1BI2A 4ESBA 3LAJA 1P4XA 1G3YA 1PUEE 2AS5F 1MKMA 3I59A 3QU3A 5D6FA 1H9GA 3F6VA 3WGGA 1MJ9A 4BYYA 3WTVC 3VB2A 3R60A 3KP5A 3F8MA 3KE2A 4KUMA 2GA2A 3LA3A 1OR7A 2ESNA 2J5OA 1REPC 1QNTA 4M71A 1DPUA 4YFKF 2GXGA 4UVAA 2PLYA 4N9IA 2KJCA 4L18B 4KIFA 3FF5A 1FZPB 2V9VA 3PFIA 3O6BB 1ZRFA 1WKMA 5FLXK 1LEBA 1FP2A 4XSXF 1I1GA 4U0VA 4IF4A 4IRHA 2WWYA 1XMAA 1ZLJA 2P6SA 1MZBA 1ZRCA 1H9TA 1SD6A 3O3KA 1B9MA 5J6XA 4EMSA 4HW0A 2GXBA 4M9XA 2XGXA 3FMSA 2MLGA 3QAHA 4LLNA 4D0PA 4O5VA 3MAJA 1B9NA 1XDUA 3F6OA 2FEZA 3TO9A 1V4RA 1QO0D 1IZ1A 1QGPA 1UFMA 4UXNA 3E6BA 3FX3A 2P4WA 1E2XA 3R61A 1JHHA 1Z9CA 1HSJA 3E5QA 2HTJA 3T5XA 1TQIA 1TBXA 2WV0A 5BOXA 3P9IA 5H6RA 3QOPA 3CUOA 5HDKA 3U2RA 4MHGA 1TW2A 2EJRA 1SMTA 4LK1F 1XD7A 2KJBA 3E3VA 5JI6A 1K78A 3HTUA 1FNNA 1KQ8A 4U0WA 2ESHA 1U5TC 1F4KA 5FO5A 3HSRA 1P2FA 2JRTA 2HFHA 4LG0B 1OMIA 4WXDA 2MA3A 4UV9A 1FYMA 3KLOA 2EK5A 3EUHA 2F5CA 2OA4A 3KP6A 4L9TA 1GXQA 1XGSA 4KFCA 2DLLA 3C1DA 2Z9OA 2P7CB 4ZYEA 3TO7A 1ZG3A 1G4DA 5LHHA 2ZCWA 1QZZA 3RPUA 2HQRA 3R4KA 1KYWA 3IHUA 1O57A 1TQPA 2FA5A 3LA2A 2Q2EA 3FM5A 2D1VA 5D8KB 2MLKA 3BJ6A 1BI1A 5DCFA 3ML6A 3RYPA 4L5IA 2UWMA 2P8TA 2CO5A 1EH6A 3RKXA 4GXOA 4HX7A 4U7BA 4LFUA 5D4RA 5FB2A 3F8FA 5DD4A 1YS7A 3I71A 2Y48A 3LSTA 3TDZC 3T8RA 2F5FA 4KN7X 3B02A 2LF8A 5EEGA 2FNPA 1K7AA 5HLIA 2ZBKA 4S04A 5D5WB 4LMYA 2XAJA 1B1BA 5J8CA 3NQOA 4EM2A 3FXQA 1J59A 4I98B 3CLOA 3H92A 3T1BA 2HTSA 2V1XA 4HYEA 3W6JB 2HEOA 3WTTC 2NNNA 3LAPA 2O0YA 2ZXJA 5JFRA 2K7LA 1F9NA 1O3RA 2FE3A 1RUOA 2GAUA 2QQAA 1O3QA 2IJLA 1SFEA 2W25A 3WTSC 5K5QA 1FBQA 1XCBA 1YYVA 2CW0F 4M9ZA 2V1UA 3ZMTA 2VBWA 3CO7C 2LNBA 2IPQX 1ZG5A 4OIPF 3ECOA 1FLIA 1KQ0A 4P96A 2IA1A 2FU4A 3LQQA 3ZMVA 4RB2C 1JXSA 1CF7A 3B73A 3N97A 3FHZA 5E8GA 5CVVA 3H3ZA 3KP4A 4LG0A 2EFNA 5HOOA 3IKTA 3HSFA 5LEJA 5E1XA 3C3WA 3LFKA 4Z2YA 2PG4A 4R79A 3V8KA 1IN5A 2DK5A 1R22A 4A5MA 2PMHA 4L9NA 4ASNA 3FWEA 1HBXG 1R5HA 2PMUA 4XLNF 5CVRA 5DD8A 2A6EF 4OU0A 1UCRA 3GX4X 1DUXC 2ETHA 3E6DA 5ICCA 3OOPA 4O6JA 4HF2A 2HKXA 3HRSA 5FD5A 5D4SA 3P9KA 5E8IA 4BHCA 4IVNA 3ROUA 3E6CC 1A04A 3E6MA 1RZ4A 2ISYA 3BY6A 3VODA 2COMA 3TGNA 1XGOA 4RGSA 2NS0A 4BNCA 2QM3A 5ILVA 2FQ3A 1BIAA 1FBUA 4CICA 3QRFF 4HF0A 1Z91A 4IHSA 1XGNA 3WTUC 4A12A 5LGTA 4IHTA 3GFMA 4HOBA 5K5RA 1U3EM 4Q48A 4KMUX 1XDSA 1TLHB 2YR2A 1B4AA 1HXDA 2EV0A 4M6XA 5E1WA 2TDXA 5E1ZB 4CZZA 1ZN2A 3Q9SA 4MEYF 1Z6RA 2K86A 3HHGA 4N0BA 2V6CA 1KU2A 1J0RA 4LLGF 4ESFA 4G9YA 3R6SA 2YX4A 2F5EA 2Y0MA 1YW8A 1HKTA 1FX7A 2VXZA 5HS8A 4G7HF 2P5VA 5DEQA 1KA8A 2Q8KA 1OPCA 3ZQ7A 1KYZA 3K1PA 2FRHA 4RGRA 2P7VB 1BN5A 1SMYF 3KZZA 2EV6A 1G3SA 5L3DA 4YIFA 1XN7A 2G7UA 2XUBA 4R1HA 2P5KA 2D1HA 3DP7A 3L09A 5D8LB 2MH2A 1C0WA 1ON1A 1U8RA 2QYOA 2VE8A 3KP3A 3EQLF 2XKOA 4JQFA 5BS6A 2QZ8A 4L0ZB 2EFWA 3WTYC 4EJOA 4ENMA 3MZHA 2OU2A 4KN4X 4YFNF 4AIHA 3WTXC 1O7LA 4ETSA 4O3MA 2O03A 2LF7A 3I0TA 1Z7UA 5LHGA 2K4JA 2FMYA 1UHWA 2L01A 3O2PE 1ZG1A 1HKQA 5IT9Z 2A69F 4MEXF 2YX7A 3V7RA 2XASA 3KFWX 3DV8A 3G3ZA 5D5VB 4M74A 1R7JA 1SD4A 3GZ6A 5F1RA 2D2WA 4UUVA 3CUQB 3WU0A 5FD6A 1TW3A 2DQLA 3K2ZA 5HLHA 2PEXA 3BROA 4LB6B 1MDMB 4XBFA 1BOAA 2RV8A 4HX8A 4FX0A 2HQNA 4UVBA 4OOIA 2GWRA 2ZO4A 3GUDA 1IN4A 4U88A 3V4GA 3BDDA 3GW2A 3TKYA 4ZH4F 3BWGA 5CLSA 1WRJA 2VOOA 3TDUC 5KVRA 4HQEA 2XAGA 2XHKA 3LWFA 3V8LA 2O3FA 2CFXA 1KU7A 2HKOA 5CJ9A 1E17A 4ZZLA 4I09A 2L4AA 2ZKZA 3L2CA 1O7FA 3IL2A 2JT1A 3V7SA 4CYDA 2MD5A 4GCVA 1OYWA 4CDGA 5L3EA 1YO5C 3BPXA 2CQKA 3TO6A 4N9HA 1R1VA 1BC7C 1W5SA 1QQIA 1TTYA 1S3JA 3SHFA 2BGCA 5KK1A 1WSUA 2E7XA 3GZ5A 4EGYA 2E1NA 1XGMA 1O3SA 2STWA 1SAXA 1MJBA 3ZN0A 1NHAA 1B59A 3DQVC 4JK1X 2H27A 2ZJ2A 1RNLA 1LEAA 3RI4A 3KEQA 2KKOA 4AWXB 4GO1A 2O6GE 4ON0A 3ZN1A 1FSHA 1OYIA 4KIBA 1P6RA 1J9IA 4MQ9F 2Z33A 5E18F 5K5OA 4OMZA 1IXRC 4GYGA 5CVJA 1FP1D 2OAZA 4B09A 2JPCA 3GLXA 3J81K 4Q5SF 1W5TA 2JSCA 3HIFA 1W7PD 3N4MA 2Y75A 3VFZA 4I2OA 5A2QZ 1TNSA 3I64A 5IT9K 3T0YA 2VT3A 1J7KA 5EEHA 2PFBA 3EETA 3LA7A 2Z3YA 1QZYA 3KCCA 3QPHA 5JHUA 2BEOA 1K79A 2V79A 2DFIA 5DDGA 4MNUA 2DPDA 3NEUA 4WCGA 1RI7A 4I0BA 1D3YA 2G9WA 3ABTA 2IT0A 2W24A 5H20A 4L9VA 4HQMA 2R7FA 2NYXA 2HZTA 3ZMZA 4ENNA 2H94A 3E97A 1ZYRF 5DUKA 1I6XA 1U78A 5LHIA 2RDPA 2OZ6A 1LB2A 2EA2A 2GIVA 1ONVA 1HKSA 1FPQA 3F72A 2XRNA 3REOA 4KDPA 5AIPA 2ZMEB 2MC3A 3K1MA 1G3WA 3RJPA 3IC7A 4HA8A 2HS5A 2EFOA 1YIOA 1G3TA 1ZREA 1FY7A 3JAMZ 1LDKB 2MBFA 4JBAA 4FHTA 2PI0A 2QLZA 1LDJA 4I02A 4EJVA 2NRAC 1DPRA 3MCZA 6PAXA 1FC3A 1I1SA 3L00A 4EJWA 2PQ8A 2Q0OA 3KETA 2MH9A 3ZMUA 1U2WA 1XSDA 3WGHA 4CO8A 3BJAA 4HX4A 3M8FA 4A2UA 3D0SA 3KP2A 3ZMDA 1KU3A 3HOTA 2M8EA 4MTDA 1WWXA 3JW4A 4ENKA 3C7JA 3TOBA 2O8XA 4YFXF 2XAFA 4M9SA 4KICA 2DU9A 2DT5A 3MWMA 1V3FA 2VBYA 3ZPLA 4BHPA 1HSTA 3BP8A 3P7NA 3F8NA 1YG2A 4FT8A 3ELKA 3GO5A 4HZFA 2M45A 3I5UA 1P4AA 2B0LA 1H0MA 3K1NA 2XVCA 4QLCU 3DPLC 1ZLKA 5A2QK 4OMYA 2ISZA 2GQQA 2FSWA 4HDVA 2GZWA 4BHBA 1AOYA 1OYYA 1W7PB 4LB5A 1XB4A 2BBYA 4CXFA 5HVQC 1PP7U 3ZP5A 2RC4A 2R3SA 5J8FA 4ZZDA 2V1DA 2OZUA 4HV5A 4G94A 3I59B 1FT9A 4ESJA 3H3UA 2EWNA 2QENA 2HWVA 3GEZA 1TNTA 3ULQB 3HYIA 1R1TA 2JPBA 2CG4A 2BYVE 1R5GA 5L3BA 1R1UA 3KZYA 1B6AA 1SFXA 3KP7A 3GF2A 4HV6A 3IRRA 4HAMA 1WQ2A 1J75A 2AXLA 2RGVA 1PDNC 5BPIA 3GFIA 4B8XA 2FMLA 1XMKA 2VBXA 4M6YA 5K1YA 3WU1B 1HW1A 4K2EA 3F23A 4Q47A 3JSOA 4WXCA 4FX4A 2KIUA 4A6DA 1T98A 3JAMK 4NHJA 5CYVA 4YG2F 4F7ZA 1IXCA 1S7OA 4WX9A 5ERIA 1IRGA 1YW7A 2ZMEA 3HRUA 2A07F 1EH8A 3JSPA 2FNAA 1HW5A 1U6GA 3L7WA 5E17F 5ILUA 4G7ZF 5D5XB 1IN8A 3VOEA 4IJAA 4NQWA 1HQCA 4UVCA 4G7OF 2K02A 3HOSA 4EM1A 2PBIA 5E20A 1BJAA 4PGHA 3MFKA 4RB1A 1YS6A 2IA2A 3MZYA 3CJNA 5D6EA 5CVIA 3QP6A 3WE2A 4EVIA 1KU9A 2EFPA 3WG9A 4A0YA 1VTNC 5FGMA 4WK8F 3R0AA 2QQBA 3IRQA 4RS8A 2FBKA 3V8JA 3HRMA 5DYMA 4OINF 1D5VA 1K78B 4AIKA 3RTRA 2KIMA 3G73A 3WTWC 3DPTA 4DQ2A 2E1CA 4MGRA 2X0LA 2KIFA 3OV8A 4Y15A 5HLGA 1U5TB 5F64A 3J7AO 2H6BA 1K6OA 1L0OC 2NNYA 4U7DA 3F21A 4AVPA 3DEUA 3HUGA 1GVJA 3R0JA 4WXHA 3AAFA 1UHMA 4UV8A 1LJ9A 2L3DA 3MEXA 2NAZA 3WE3A 3FXUA 4RGXA 2L02A 2RVCA 2W85A 2RQPA 3V7CA 2H6CA 2LKPA 2LSOA 3M7GA 5JVTA 4M72A 2STTA 2X4HA 3F8CA 3SZTA 1DDNA 3PQJA 3DF8A 3M8EA 2FXAA 4KMFA 1YQAA 2DO7A 5TRDA 2UXXA 1IW7F 1IN7A 2PN6A 4XSZF 2W84A 4HBLA 3FZVA 5FFZA 2M30A 4G8XA 5LLQA 2H09A 4BQAA 5LGUA 3SQNA 4RB0A 3JTHA 1YW9A 3M1EA 1SD5A 3SFZA 1YTYA 2ZFWA 4HLYA 4IRGA 4LGWA 1JHFA 1ZH5A 2IA0A 2E7WA 5L3FA 1IF1A 1Q1HA 2A5YB 3RKYA 1PP8F 1T0FA 3I4PA 1J2XA 2M5WA 4H0EA 2OQRA 4XRFA 5LGNA 2C6YA 2A61A 5IT3A 3LQRA 4P55A 1USSA 5DV5A 2HGCA 2CWEA 4BXUA 3RIRA 3U1DA 1GXPA 2O61A 1FSEA 1Z6TA 1LNWA 3HRTA 1XSXA 4CGZA 1G6NA 1S6LA 5DCMB 4OIOF 2XROA 3HSEA 5BQTA 1BI3A 3DXJF 1STZA 1X3UA 3TQNA 3RKWA 2JTVA 2A3SA 3IKVA 1CGPA 4KIGA 3TOAA 1D8JA 1S29A 2VODA 4P5OA 1T38A 4LLLA 2CYYA 1R00A 3ABUA 3CTAA 1IRFA 3GWZA 2A6HF 3U9GA 2W57A 4EGZA 2HOEA 3C18A 3K69A 3Q9VA 4S05A 3EYIA 3BJOA 1BBYA 1JGSA 3ISPA 5LRRA 1CF7B 4L9JA 2QUFA 2DI3A 3WGIA 4CHUA 1LVAA 4L0YB 2R7DA 1I27A 2HR3A 1U5TA 1ZHFA 1BM9A 3FMRA 3T8TA 2Z5UA 4LJZF 4PZJA 1WI9A 1KQ9A 2QWWA 4PCQA 3VEPA 1FWZA 4P9UA 1MD0A 4MTEA 4BH9A 1MGTA 4XLPF 4TV7A 5ILSA 3CUQC 2Z99A 1T2KA 1LQ1A 3IWFA 1KGSA 4EJUA 2VBZA 2ELHA 3CUQA 1EV7A 2OQGA 4Y13A 5LEKA 2LDUA 5HDNA 2EFQA 2RNJA 2IRFG 2YSRA 3DKWA 4HDUA 1MDMA 1OKRA 3CDHA 1ZGJA 4ENJA 4EV0A 1Y0UA 2XV4S 3GXOA 4AIJA 4Y17A 5L3CA 5CVUA 3E5XA 3Q5FA 4BAYA 2ADUA 5LRSA 5AIQA 5ICFA 4IPAA 1ON2A 1J5YA 1YLFA 3J80Z 3PQKA 3ZMSA 1LDDA 4KNYA 3MQ0A 2EV5A 1ZRDA 5D5UB 3ERED 3ECHA 2WTEA 5LBQA 3SZPA 1D8KA 2FBHA 1MJAA 4G6DA 1USTA 3M9AA 1TQMA 2VONA 2UXNA 3HTSB 2QBYB 1I5ZA 4Q4ZF 1Z05A 2DW4A 2OBPA 1P4WA 3E5UA 4RGUA 4EJTA 1ULYA 3RDIA 5DCMA 4U0YA 2IVMA 1DP7P 1IXSB 2XAQA 3RYRA 2J5PA 4IXAA 2ZNYA 4UNOA 3IWZA 2L54A 3K9TA 2CGPA 1O3TA 5DUIA 3EDPA 3GYHX 4A6EA 3FM3A 4A5NA 3JTGA 2FF4A 2GA1A 4ZYGA 2M1BA 4HF1A 1XSVA 4G6QA 1QPMA 4I01A 4EQQA 4MQVA 3F3XA 5HDGA 1FBSA 1HW2A 4KT5C 1ZAOA 3EYYA 1F1ZA 2UZKA 3I53A 4AD9A 1R23A 1FOKA 1R58A 2QVOA 3QPTA 2D45A 2DQRA 5AONA 3COAC 5BMZA 1FYKA 2HDCA 4NB5A 2P5LC 1IN6A 4A0XA 5ICEA 4GYIA 2F5DA 5JR3A 4OIQF 2XIGA 3WODF 2M87A 1Z1DA 4L5JA 2FBIA 1EH7A 2K4BA 1T39A 2DAOA 1IUYA 1SD7A 2RKHA 1RIOH 4LK0F 1W4MA 4M73A 3FXRA 4GGGA 1RUNA 1P92A 4RAZA 5L3GA 1BC8C 1SFUA 2P6TA 3L9FA 4R8HA 2PJPA 3QP5A 2ACJA 3P9CA 3QU6A 1ZARA 2VC1A 3J80K 2EA4A 1IAWA 3I58A 2BE5F 5FLXZ 2YPRA 2VT2A 2A68F 3F8BA 1AWCA 2L4MA 3BOQA 3K0LA 4I0AA 3D5LA 2XAHA 4HLXA 4KA4A 3S2WA 4WWCA 5ED4A 3I54A 4QWQA 1JE8A 2OD5A 3GVAA 2VOPA 3KEOA 1F5TA 2JZYA 3W6KB 2VC0A 3SXYA 5HS7A 4IRIA 2VN2A 1YFHA 2RN7A 2CSOA 2VE9A 4RAYA 3HHHA 1ODDA 3BZ6A 4UHTA 2HYFA 4ZYDA 4ZYHA 5H6QA 1UB9A 1FYLA 1S7AA 2QBYA 3KLNA 3GFJA 2IP2A 3NRVA 1GHCA 4RB3C 2XKPA 1ZGAA 2DBBA 3DFGA 1BI0A 2ZNZA 2HYGD 2IW5A 2K27A 3CO6C 4LD5A 3BPVA 5ICGA 4KYWA 1R36A 2BV6A 4I7HA 2G7HA 1T6SA 2EB7A 4WF2A 1XCVA 1S8NA 4EM0B 4PDKA 3FMQA 4PGGA 4A0ZA 1L3LA 2WC2A 5HS9A 2F2EA 3F22A 4DNCA 2KRFA 5BPDA 5FFXA 4P9FA 1QBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GFL A;  2DK8 A;  2DPU A;  3RPQ A;  5TJJ A;  3WTZ A;  1W7P A;  2FOK A;  5F6F A;  3J81 Z;  2QQ9 A;  4YII A;  2YU3 A;  4OIR F;  2DTR A;  4E70 A;  1BIB A;  1BI2 A;  4ESB A;  3LAJ A;  1P4X A;  1G3Y A;  1PUE E;  2AS5 F;  1MKM A;  3I59 A;  3QU3 A;  5D6F A;  1H9G A;  3F6V A;  3WGG A;  1MJ9 A;  4BYY A;  3WTV C;  3VB2 A;  3R60 A;  3KP5 A;  3F8M A;  3KE2 A;  4KUM A;  2GA2 A;  3LA3 A;  1OR7 A;  2ESN A;  2J5O A;  1REP C;  1QNT A;  4M71 A;  1DPU A;  4YFK F;  2GXG A;  4UVA A;  2PLY A;  4N9I A;  2KJC A;  4L18 B;  4KIF A;  3FF5 A;  1FZP B;  2V9V A;  3PFI A;  3O6B B;  1ZRF A;  1WKM A;  5FLX K;  1LEB A;  1FP2 A;  4XSX F;  1I1G A;  4U0V A;  4IF4 A;  4IRH A;  2WWY A;  1XMA A;  1ZLJ A;  2P6S A;  1MZB A;  1ZRC A;  1H9T A;  1SD6 A;  3O3K A;  1B9M A;  5J6X A;  4EMS A;  4HW0 A;  2GXB A;  4M9X A;  2XGX A;  3FMS A;  2MLG A;  3QAH A;  4LLN A;  4D0P A;  4O5V A;  3MAJ A;  1B9N A;  1XDU A;  3F6O A;  2FEZ A;  3TO9 A;  1V4R A;  1QO0 D;  1IZ1 A;  1QGP A;  1UFM A;  4UXN A;  3E6B A;  3FX3 A;  2P4W A;  1E2X A;  3R61 A;  1JHH A;  1Z9C A;  1HSJ A;  3E5Q A;  2HTJ A;  3T5X A;  1TQI A;  1TBX A;  2WV0 A;  5BOX A;  3P9I A;  5H6R A;  3QOP A;  3CUO A;  5HDK A;  3U2R A;  4MHG A;  1TW2 A;  2EJR A;  1SMT A;  4LK1 F;  1XD7 A;  2KJB A;  3E3V A;  5JI6 A;  1K78 A;  3HTU A;  1FNN A;  1KQ8 A;  4U0W A;  2ESH A;  1U5T C;  1F4K A;  5FO5 A;  3HSR A;  1P2F A;  2JRT A;  2HFH A;  4LG0 B;  1OMI A;  4WXD A;  2MA3 A;  4UV9 A;  1FYM A;  3KLO A;  2EK5 A;  3EUH A;  2F5C A;  2OA4 A;  3KP6 A;  4L9T A;  1GXQ A;  1XGS A;  4KFC A;  2DLL A;  3C1D A;  2Z9O A;  2P7C B;  4ZYE A;  3TO7 A;  1ZG3 A;  1G4D A;  5LHH A;  2ZCW A;  1QZZ A;  3RPU A;  2HQR A;  3R4K A;  1KYW A;  3IHU A;  1O57 A;  1TQP A;  2FA5 A;  3LA2 A;  2Q2E A;  3FM5 A;  2D1V A;  5D8K B;  2MLK A;  3BJ6 A;  1BI1 A;  5DCF A;  3ML6 A;  3RYP A;  4L5I A;  2UWM A;  2P8T A;  2CO5 A;  1EH6 A;  3RKX A;  4GXO A;  4HX7 A;  4U7B A;  4LFU A;  5D4R A;  5FB2 A;  3F8F A;  5DD4 A;  1YS7 A;  3I71 A;  2Y48 A;  3LST A;  3TDZ C;  3T8R A;  2F5F A;  4KN7 X;  3B02 A;  2LF8 A;  5EEG A;  2FNP A;  1K7A A;  5HLI A;  2ZBK A;  4S04 A;  5D5W B;  4LMY A;  2XAJ A;  1B1B A;  5J8C A;  3NQO A;  4EM2 A;  3FXQ A;  1J59 A;  4I98 B;  3CLO A;  3H92 A;  3T1B A;  2HTS A;  2V1X A;  4HYE A;  3W6J B;  2HEO A;  3WTT C;  2NNN A;  3LAP A;  2O0Y A;  2ZXJ A;  5JFR A;  2K7L A;  1F9N A;  1O3R A;  2FE3 A;  1RUO A;  2GAU A;  2QQA A;  1O3Q A;  2IJL A;  1SFE A;  2W25 A;  3WTS C;  5K5Q A;  1FBQ A;  1XCB A;  1YYV A;  2CW0 F;  4M9Z A;  2V1U A;  3ZMT A;  2VBW A;  3CO7 C;  2LNB A;  2IPQ X;  1ZG5 A;  4OIP F;  3ECO A;  1FLI A;  1KQ0 A;  4P96 A;  2IA1 A;  2FU4 A;  3LQQ A;  3ZMV A;  4RB2 C;  1JXS A;  1CF7 A;  3B73 A;  3N97 A;  3FHZ A;  5E8G A;  5CVV A;  3H3Z A;  3KP4 A;  4LG0 A;  2EFN A;  5HOO A;  3IKT A;  3HSF A;  5LEJ A;  5E1X A;  3C3W A;  3LFK A;  4Z2Y A;  2PG4 A;  4R79 A;  3V8K A;  1IN5 A;  2DK5 A;  1R22 A;  4A5M A;  2PMH A;  4L9N A;  4ASN A;  3FWE A;  1HBX G;  1R5H A;  2PMU A;  4XLN F;  5CVR A;  5DD8 A;  2A6E F;  4OU0 A;  1UCR A;  3GX4 X;  1DUX C;  2ETH A;  3E6D A;  5ICC A;  3OOP A;  4O6J A;  4HF2 A;  2HKX A;  3HRS A;  5FD5 A;  5D4S A;  3P9K A;  5E8I A;  4BHC A;  4IVN A;  3ROU A;  3E6C C;  1A04 A;  3E6M A;  1RZ4 A;  2ISY A;  3BY6 A;  3VOD A;  2COM A;  3TGN A;  1XGO A;  4RGS A;  2NS0 A;  4BNC A;  2QM3 A;  5ILV A;  2FQ3 A;  1BIA A;  1FBU A;  4CIC A;  3QRF F;  4HF0 A;  1Z91 A;  4IHS A;  1XGN A;  3WTU C;  4A12 A;  5LGT A;  4IHT A;  3GFM A;  4HOB A;  5K5R A;  1U3E M;  4Q48 A;  4KMU X;  1XDS A;  1TLH B;  2YR2 A;  1B4A A;  1HXD A;  2EV0 A;  4M6X A;  5E1W A;  2TDX A;  5E1Z B;  4CZZ A;  1ZN2 A;  3Q9S A;  4MEY F;  1Z6R A;  2K86 A;  3HHG A;  4N0B A;  2V6C A;  1KU2 A;  1J0R A;  4LLG F;  4ESF A;  4G9Y A;  3R6S A;  2YX4 A;  2F5E A;  2Y0M A;  1YW8 A;  1HKT A;  1FX7 A;  2VXZ A;  5HS8 A;  4G7H F;  2P5V A;  5DEQ A;  1KA8 A;  2Q8K A;  1OPC A;  3ZQ7 A;  1KYZ A;  3K1P A;  2FRH A;  4RGR A;  2P7V B;  1BN5 A;  1SMY F;  3KZZ A;  2EV6 A;  1G3S A;  5L3D A;  4YIF A;  1XN7 A;  2G7U A;  2XUB A;  4R1H A;  2P5K A;  2D1H A;  3DP7 A;  3L09 A;  5D8L B;  2MH2 A;  1C0W A;  1ON1 A;  1U8R A;  2QYO A;  2VE8 A;  3KP3 A;  3EQL F;  2XKO A;  4JQF A;  5BS6 A;  2QZ8 A;  4L0Z B;  2EFW A;  3WTY C;  4EJO A;  4ENM A;  3MZH A;  2OU2 A;  4KN4 X;  4YFN F;  4AIH A;  3WTX C;  1O7L A;  4ETS A;  4O3M A;  2O03 A;  2LF7 A;  3I0T A;  1Z7U A;  5LHG A;  2K4J A;  2FMY A;  1UHW A;  2L01 A;  3O2P E;  1ZG1 A;  1HKQ A;  5IT9 Z;  2A69 F;  4MEX F;  2YX7 A;  3V7R A;  2XAS A;  3KFW X;  3DV8 A;  3G3Z A;  5D5V B;  4M74 A;  1R7J A;  1SD4 A;  3GZ6 A;  5F1R A;  2D2W A;  4UUV A;  3CUQ B;  3WU0 A;  5FD6 A;  1TW3 A;  2DQL A;  3K2Z A;  5HLH A;  2PEX A;  3BRO A;  4LB6 B;  1MDM B;  4XBF A;  1BOA A;  2RV8 A;  4HX8 A;  4FX0 A;  2HQN A;  4UVB A;  4OOI A;  2GWR A;  2ZO4 A;  3GUD A;  1IN4 A;  4U88 A;  3V4G A;  3BDD A;  3GW2 A;  3TKY A;  4ZH4 F;  3BWG A;  5CLS A;  1WRJ A;  2VOO A;  3TDU C;  5KVR A;  4HQE A;  2XAG A;  2XHK A;  3LWF A;  3V8L A;  2O3F A;  2CFX A;  1KU7 A;  2HKO A;  5CJ9 A;  1E17 A;  4ZZL A;  4I09 A;  2L4A A;  2ZKZ A;  3L2C A;  1O7F A;  3IL2 A;  2JT1 A;  3V7S A;  4CYD A;  2MD5 A;  4GCV A;  1OYW A;  4CDG A;  5L3E A;  1YO5 C;  3BPX A;  2CQK A;  3TO6 A;  4N9H A;  1R1V A;  1BC7 C;  1W5S A;  1QQI A;  1TTY A;  1S3J A;  3SHF A;  2BGC A;  5KK1 A;  1WSU A;  2E7X A;  3GZ5 A;  4EGY A;  2E1N A;  1XGM A;  1O3S A;  2STW A;  1SAX A;  1MJB A;  3ZN0 A;  1NHA A;  1B59 A;  3DQV C;  4JK1 X;  2H27 A;  2ZJ2 A;  1RNL A;  1LEA A;  3RI4 A;  3KEQ A;  2KKO A;  4AWX B;  4GO1 A;  2O6G E;  4ON0 A;  3ZN1 A;  1FSH A;  1OYI A;  4KIB A;  1P6R A;  1J9I A;  4MQ9 F;  2Z33 A;  5E18 F;  5K5O A;  4OMZ A;  1IXR C;  4GYG A;  5CVJ A;  1FP1 D;  2OAZ A;  4B09 A;  2JPC A;  3GLX A;  3J81 K;  4Q5S F;  1W5T A;  2JSC A;  3HIF A;  1W7P D;  3N4M A;  2Y75 A;  3VFZ A;  4I2O A;  5A2Q Z;  1TNS A;  3I64 A;  5IT9 K;  3T0Y A;  2VT3 A;  1J7K A;  5EEH A;  2PFB A;  3EET A;  3LA7 A;  2Z3Y A;  1QZY A;  3KCC A;  3QPH A;  5JHU A;  2BEO A;  1K79 A;  2V79 A;  2DFI A;  5DDG A;  4MNU A;  2DPD A;  3NEU A;  4WCG A;  1RI7 A;  4I0B A;  1D3Y A;  2G9W A;  3ABT A;  2IT0 A;  2W24 A;  5H20 A;  4L9V A;  4HQM A;  2R7F A;  2NYX A;  2HZT A;  3ZMZ A;  4ENN A;  2H94 A;  3E97 A;  1ZYR F;  5DUK A;  1I6X A;  1U78 A;  5LHI A;  2RDP A;  2OZ6 A;  1LB2 A;  2EA2 A;  2GIV A;  1ONV A;  1HKS A;  1FPQ A;  3F72 A;  2XRN A;  3REO A;  4KDP A;  5AIP A;  2ZME B;  2MC3 A;  3K1M A;  1G3W A;  3RJP A;  3IC7 A;  4HA8 A;  2HS5 A;  2EFO A;  1YIO A;  1G3T A;  1ZRE A;  1FY7 A;  3JAM Z;  1LDK B;  2MBF A;  4JBA A;  4FHT A;  2PI0 A;  2QLZ A;  1LDJ A;  4I02 A;  4EJV A;  2NRA C;  1DPR A;  3MCZ A;  6PAX A;  1FC3 A;  1I1S A;  3L00 A;  4EJW A;  2PQ8 A;  2Q0O A;  3KET A;  2MH9 A;  3ZMU A;  1U2W A;  1XSD A;  3WGH A;  4CO8 A;  3BJA A;  4HX4 A;  3M8F A;  4A2U A;  3D0S A;  3KP2 A;  3ZMD A;  1KU3 A;  3HOT A;  2M8E A;  4MTD A;  1WWX A;  3JW4 A;  4ENK A;  3C7J A;  3TOB A;  2O8X A;  4YFX F;  2XAF A;  4M9S A;  4KIC A;  2DU9 A;  2DT5 A;  3MWM A;  1V3F A;  2VBY A;  3ZPL A;  4BHP A;  1HST A;  3BP8 A;  3P7N A;  3F8N A;  1YG2 A;  4FT8 A;  3ELK A;  3GO5 A;  4HZF A;  2M45 A;  3I5U A;  1P4A A;  2B0L A;  1H0M A;  3K1N A;  2XVC A;  4QLC U;  3DPL C;  1ZLK A;  5A2Q K;  4OMY A;  2ISZ A;  2GQQ A;  2FSW A;  4HDV A;  2GZW A;  4BHB A;  1AOY A;  1OYY A;  1W7P B;  4LB5 A;  1XB4 A;  2BBY A;  4CXF A;  5HVQ C;  1PP7 U;  3ZP5 A;  2RC4 A;  2R3S A;  5J8F A;  4ZZD A;  2V1D A;  2OZU A;  4HV5 A;  4G94 A;  3I59 B;  1FT9 A;  4ESJ A;  3H3U A;  2EWN A;  2QEN A;  2HWV A;  3GEZ A;  1TNT A;  3ULQ B;  3HYI A;  1R1T A;  2JPB A;  2CG4 A;  2BYV E;  1R5G A;  5L3B A;  1R1U A;  3KZY A;  1B6A A;  1SFX A;  3KP7 A;  3GF2 A;  4HV6 A;  3IRR A;  4HAM A;  1WQ2 A;  1J75 A;  2AXL A;  2RGV A;  1PDN C;  5BPI A;  3GFI A;  4B8X A;  2FML A;  1XMK A;  2VBX A;  4M6Y A;  5K1Y A;  3WU1 B;  1HW1 A;  4K2E A;  3F23 A;  4Q47 A;  3JSO A;  4WXC A;  4FX4 A;  2KIU A;  4A6D A;  1T98 A;  3JAM K;  4NHJ A;  5CYV A;  4YG2 F;  4F7Z A;  1IXC A;  1S7O A;  4WX9 A;  5ERI A;  1IRG A;  1YW7 A;  2ZME A;  3HRU A;  2A07 F;  1EH8 A;  3JSP A;  2FNA A;  1HW5 A;  1U6G A;  3L7W A;  5E17 F;  5ILU A;  4G7Z F;  5D5X B;  1IN8 A;  3VOE A;  4IJA A;  4NQW A;  1HQC A;  4UVC A;  4G7O F;  2K02 A;  3HOS A;  4EM1 A;  2PBI A;  5E20 A;  1BJA A;  4PGH A;  3MFK A;  4RB1 A;  1YS6 A;  2IA2 A;  3MZY A;  3CJN A;  5D6E A;  5CVI A;  3QP6 A;  3WE2 A;  4EVI A;  1KU9 A;  2EFP A;  3WG9 A;  4A0Y A;  1VTN C;  5FGM A;  4WK8 F;  3R0A A;  2QQB A;  3IRQ A;  4RS8 A;  2FBK A;  3V8J A;  3HRM A;  5DYM A;  4OIN F;  1D5V A;  1K78 B;  4AIK A;  3RTR A;  2KIM A;  3G73 A;  3WTW C;  3DPT A;  4DQ2 A;  2E1C A;  4MGR A;  2X0L A;  2KIF A;  3OV8 A;  4Y15 A;  5HLG A;  1U5T B;  5F64 A;  3J7A O;  2H6B A;  1K6O A;  1L0O C;  2NNY A;  4U7D A;  3F21 A;  4AVP A;  3DEU A;  3HUG A;  1GVJ A;  3R0J A;  4WXH A;  3AAF A;  1UHM A;  4UV8 A;  1LJ9 A;  2L3D A;  3MEX A;  2NAZ A;  3WE3 A;  3FXU A;  4RGX A;  2L02 A;  2RVC A;  2W85 A;  2RQP A;  3V7C A;  2H6C A;  2LKP A;  2LSO A;  3M7G A;  5JVT A;  4M72 A;  2STT A;  2X4H A;  3F8C A;  3SZT A;  1DDN A;  3PQJ A;  3DF8 A;  3M8E A;  2FXA A;  4KMF A;  1YQA A;  2DO7 A;  5TRD A;  2UXX A;  1IW7 F;  1IN7 A;  2PN6 A;  4XSZ F;  2W84 A;  4HBL A;  3FZV A;  5FFZ A;  2M30 A;  4G8X A;  5LLQ A;  2H09 A;  4BQA A;  5LGU A;  3SQN A;  4RB0 A;  3JTH A;  1YW9 A;  3M1E A;  1SD5 A;  3SFZ A;  1YTY A;  2ZFW A;  4HLY A;  4IRG A;  4LGW A;  1JHF A;  1ZH5 A;  2IA0 A;  2E7W A;  5L3F A;  1IF1 A;  1Q1H A;  2A5Y B;  3RKY A;  1PP8 F;  1T0F A;  3I4P A;  1J2X A;  2M5W A;  4H0E A;  2OQR A;  4XRF A;  5LGN A;  2C6Y A;  2A61 A;  5IT3 A;  3LQR A;  4P55 A;  1USS A;  5DV5 A;  2HGC A;  2CWE A;  4BXU A;  3RIR A;  3U1D A;  1GXP A;  2O61 A;  1FSE A;  1Z6T A;  1LNW A;  3HRT A;  1XSX A;  4CGZ A;  1G6N A;  1S6L A;  5DCM B;  4OIO F;  2XRO A;  3HSE A;  5BQT A;  1BI3 A;  3DXJ F;  1STZ A;  1X3U A;  3TQN A;  3RKW A;  2JTV A;  2A3S A;  3IKV A;  1CGP A;  4KIG A;  3TOA A;  1D8J A;  1S29 A;  2VOD A;  4P5O A;  1T38 A;  4LLL A;  2CYY A;  1R00 A;  3ABU A;  3CTA A;  1IRF A;  3GWZ A;  2A6H F;  3U9G A;  2W57 A;  4EGZ A;  2HOE A;  3C18 A;  3K69 A;  3Q9V A;  4S05 A;  3EYI A;  3BJO A;  1BBY A;  1JGS A;  3ISP A;  5LRR A;  1CF7 B;  4L9J A;  2QUF A;  2DI3 A;  3WGI A;  4CHU A;  1LVA A;  4L0Y B;  2R7D A;  1I27 A;  2HR3 A;  1U5T A;  1ZHF A;  1BM9 A;  3FMR A;  3T8T A;  2Z5U A;  4LJZ F;  4PZJ A;  1WI9 A;  1KQ9 A;  2QWW A;  4PCQ A;  3VEP A;  1FWZ A;  4P9U A;  1MD0 A;  4MTE A;  4BH9 A;  1MGT A;  4XLP F;  4TV7 A;  5ILS A;  3CUQ C;  2Z99 A;  1T2K A;  1LQ1 A;  3IWF A;  1KGS A;  4EJU A;  2VBZ A;  2ELH A;  3CUQ A;  1EV7 A;  2OQG A;  4Y13 A;  5LEK A;  2LDU A;  5HDN A;  2EFQ A;  2RNJ A;  2IRF G;  2YSR A;  3DKW A;  4HDU A;  1MDM A;  1OKR A;  3CDH A;  1ZGJ A;  4ENJ A;  4EV0 A;  1Y0U A;  2XV4 S;  3GXO A;  4AIJ A;  4Y17 A;  5L3C A;  5CVU A;  3E5X A;  3Q5F A;  4BAY A;  2ADU A;  5LRS A;  5AIQ A;  5ICF A;  4IPA A;  1ON2 A;  1J5Y A;  1YLF A;  3J80 Z;  3PQK A;  3ZMS A;  1LDD A;  4KNY A;  3MQ0 A;  2EV5 A;  1ZRD A;  5D5U B;  3ERE D;  3ECH A;  2WTE A;  5LBQ A;  3SZP A;  1D8K A;  2FBH A;  1MJA A;  4G6D A;  1UST A;  3M9A A;  1TQM A;  2VON A;  2UXN A;  3HTS B;  2QBY B;  1I5Z A;  4Q4Z F;  1Z05 A;  2DW4 A;  2OBP A;  1P4W A;  3E5U A;  4RGU A;  4EJT A;  1ULY A;  3RDI A;  5DCM A;  4U0Y A;  2IVM A;  1DP7 P;  1IXS B;  2XAQ A;  3RYR A;  2J5P A;  4IXA A;  2ZNY A;  4UNO A;  3IWZ A;  2L54 A;  3K9T A;  2CGP A;  1O3T A;  5DUI A;  3EDP A;  3GYH X;  4A6E A;  3FM3 A;  4A5N A;  3JTG A;  2FF4 A;  2GA1 A;  4ZYG A;  2M1B A;  4HF1 A;  1XSV A;  4G6Q A;  1QPM A;  4I01 A;  4EQQ A;  4MQV A;  3F3X A;  5HDG A;  1FBS A;  1HW2 A;  4KT5 C;  1ZAO A;  3EYY A;  1F1Z A;  2UZK A;  3I53 A;  4AD9 A;  1R23 A;  1FOK A;  1R58 A;  2QVO A;  3QPT A;  2D45 A;  2DQR A;  5AON A;  3COA C;  5BMZ A;  1FYK A;  2HDC A;  4NB5 A;  2P5L C;  1IN6 A;  4A0X A;  5ICE A;  4GYI A;  2F5D A;  5JR3 A;  4OIQ F;  2XIG A;  3WOD F;  2M87 A;  1Z1D A;  4L5J A;  2FBI A;  1EH7 A;  2K4B A;  1T39 A;  2DAO A;  1IUY A;  1SD7 A;  2RKH A;  1RIO H;  4LK0 F;  1W4M A;  4M73 A;  3FXR A;  4GGG A;  1RUN A;  1P92 A;  4RAZ A;  5L3G A;  1BC8 C;  1SFU A;  2P6T A;  3L9F A;  4R8H A;  2PJP A;  3QP5 A;  2ACJ A;  3P9C A;  3QU6 A;  1ZAR A;  2VC1 A;  3J80 K;  2EA4 A;  1IAW A;  3I58 A;  2BE5 F;  5FLX Z;  2YPR A;  2VT2 A;  2A68 F;  3F8B A;  1AWC A;  2L4M A;  3BOQ A;  3K0L A;  4I0A A;  3D5L A;  2XAH A;  4HLX A;  4KA4 A;  3S2W A;  4WWC A;  5ED4 A;  3I54 A;  4QWQ A;  1JE8 A;  2OD5 A;  3GVA A;  2VOP A;  3KEO A;  1F5T A;  2JZY A;  3W6K B;  2VC0 A;  3SXY A;  5HS7 A;  4IRI A;  2VN2 A;  1YFH A;  2RN7 A;  2CSO A;  2VE9 A;  4RAY A;  3HHH A;  1ODD A;  3BZ6 A;  4UHT A;  2HYF A;  4ZYD A;  4ZYH A;  5H6Q A;  1UB9 A;  1FYL A;  1S7A A;  2QBY A;  3KLN A;  3GFJ A;  2IP2 A;  3NRV A;  1GHC A;  4RB3 C;  2XKP A;  1ZGA A;  2DBB A;  3DFG A;  1BI0 A;  2ZNZ A;  2HYG D;  2IW5 A;  2K27 A;  3CO6 C;  4LD5 A;  3BPV A;  5ICG A;  4KYW A;  1R36 A;  2BV6 A;  4I7H A;  2G7H A;  1T6S A;  2EB7 A;  4WF2 A;  1XCV A;  1S8N A;  4EM0 B;  4PDK A;  3FMQ A;  4PGG A;  4A0Z A;  1L3L A;  2WC2 A;  5HS9 A;  2F2E A;  3F22 A;  4DNC A;  2KRF A;  5BPD A;  5FFX A;  4P9F A;  1QBJ A; 
#chains in the Genus database with same CATH topology
 3GFL A;  3GLL A;  1V5E A;  2DK8 A;  3OL4 A;  3RPQ A;  2DPU A;  5TJJ A;  1UMQ A;  4F55 A;  3WTZ A;  1W7P A;  1JTY A;  2FOK A;  5F6F A;  2BY2 A;  3K4N A;  2CH0 A;  3J81 Z;  1WGX A;  2QQ9 A;  2HU9 A;  2DFF A;  4YII A;  3BR2 A;  2YU3 A;  5FKK A;  3E7L A;  1MNM C;  4OIR F;  2DTR A;  4E70 A;  3HBL A;  2CW7 A;  3PL8 A;  1NH3 A;  1BIB A;  1BI2 A;  4W97 A;  4ESB A;  3H1C A;  3LAJ A;  1P4X A;  1G3Y A;  1PUE E;  2AS5 F;  4J01 A;  1MKM A;  2R0Q C;  5LFA A;  3I59 A;  4J00 A;  3QU3 A;  5D6F A;  3VPR A;  3MKZ A;  1RET A;  1H9G A;  4PK4 A;  3OYB A;  3F6V A;  3WGG A;  1MJ9 A;  1D1B A;  4BYY A;  3WTV C;  2Q2E B;  3VB2 A;  3R60 A;  3KP5 A;  3F8M A;  4E7H A;  3TED A;  3B6C A;  3KE2 A;  3BT9 A;  4KUM A;  3RZD J;  2A05 A;  2GA2 A;  3A0B C;  3LA3 A;  1OR7 A;  2ESN A;  2J5O A;  2MG4 A;  1REP C;  1QNT A;  4M71 A;  3TBI A;  1DPU A;  2WAQ N;  4YFK F;  2GXG A;  4H4K C;  2HVQ A;  1H8A C;  2QSF X;  4UVA A;  2KQR A;  4IQ4 A;  4FIS A;  2PLY A;  4N9I A;  2KJC A;  3H9J A;  4JX4 A;  2K3F A;  2HQ5 A;  1H89 C;  4L18 B;  4KIF A;  1LFU P;  3FF5 A;  1TP4 A;  1FZP B;  2V9V A;  3PFI A;  1R5I D;  3SYT A;  2R5Z B;  2DOD A;  3O6B B;  4ZTF A;  1ZRF A;  1WKM A;  5FLX K;  1LEB A;  3MN2 A;  2K9S A;  1FP2 A;  4XSX F;  4UUS A;  1I1G A;  1QRY A;  4U0V A;  4IF4 A;  3X2Q H;  4IRH A;  2AQF A;  2E2H J;  1F36 A;  2WWY A;  3V42 A;  1XMA A;  1FTT A;  1ZLJ A;  2P6S A;  1MZB A;  2Y31 A;  2ZJQ F;  1AHD P;  1ZRC A;  1H9T A;  1SD6 A;  1WJD A;  5FKO A;  3OSF A;  1ETK A;  3O3K A;  3Q0W A;  3WHC A;  4HEA 2;  1B9M A;  5J6X A;  5GAE J;  4EMS A;  1WJE A;  3L2U A;  4HW0 A;  2GXB A;  3I4M J;  4M9X A;  3AL0 C;  2XGX A;  3P5J A;  3FMS A;  2MLG A;  3QAH A;  4BEH B;  1ZQ3 P;  4LLN A;  4A3M J;  3G1O A;  4D0P A;  4O5V A;  2DOF A;  2NVQ J;  4B3A A;  3MAJ A;  4FE4 A;  1B9N A;  1XDU A;  4G6T B;  3F6O A;  5C4X J;  2FEZ A;  3TO9 A;  2LG4 A;  1V4R A;  1QO0 D;  1OQY A;  3H5N A;  1B72 B;  1IZ1 A;  4JX6 A;  3CCJ I;  1QGP A;  1UFM A;  2L9R A;  1JKO C;  4UXN A;  3E6B A;  3FX3 A;  2P4W A;  1E2X A;  1UG2 A;  5E3L A;  3R61 A;  1JHH A;  1OFC X;  2XF5 A;  1Z9C A;  5EG0 B;  1HSJ A;  3E5Q A;  2HTJ A;  2HVS A;  5CPR B;  3T5X A;  2VXD A;  1WFX A;  3M07 A;  1TQI A;  3IUO A;  1TBX A;  4XKW A;  2WV0 A;  5BOX A;  3DTE A;  3P9I A;  5H6R A;  2KHM A;  3O8G A;  3QOP A;  1MMD A;  3CUO A;  3I3L A;  3Q3S A;  5HDK A;  2WAD A;  3U2R A;  4MHG A;  1TW2 A;  2EJR A;  3BG6 A;  1SMT A;  4LK1 F;  1LE8 B;  1OCZ H;  1XD7 A;  4CSW A;  2KJB A;  2XC7 A;  3DEW A;  3E3V A;  1EJ9 A;  5JI6 A;  3A01 B;  1K78 A;  4XN0 A;  3HTU A;  1FNN A;  1KQ8 A;  3BR0 A;  3HKZ A;  1U9O A;  4U0W A;  4ANJ A;  2ESH A;  1U5T C;  3FXL A;  1F4K A;  2HVR A;  3TW6 A;  5FO5 A;  4U87 A;  3VWB A;  3HSR A;  1P2F A;  2AHQ A;  1H88 C;  3PJR A;  3ASO H;  2JRT A;  1X2N A;  4DYC A;  2HFH A;  4LG0 B;  1KZH A;  3EUH C;  4RM2 A;  1IDY A;  3S15 J;  1OMI A;  4WXD A;  2MA3 A;  2VQH A;  1OCT C;  1MW7 A;  2JA5 J;  4UV9 A;  1YRN B;  1FYM A;  2QGU A;  3KLO A;  2EK5 A;  3EUH A;  1VQN I;  1A6Q A;  2F5C A;  3JRH A;  2Y0S N;  1SAN A;  2LP0 A;  1NG7 A;  2OA4 A;  3KP6 A;  1JJ6 C;  2VJJ A;  2R7Z J;  2DDA A;  4L9T A;  1GXQ A;  4E7L A;  1XGS A;  4KFC A;  4M3D A;  2DLL A;  2X85 A;  3C1D A;  4AC0 A;  2Z9O A;  2P7C B;  1FMV A;  1MH4 A;  4ZYE A;  3BR5 A;  3HGY A;  2CUZ A;  3TO7 A;  4XIC A;  1RR8 C;  1ZG3 A;  1PUF B;  2Z2S B;  3OYF A;  1G4D A;  1N75 A;  4B44 A;  5LHH A;  2ZCW A;  3ABM H;  1QZZ A;  1FJL A;  3RPU A;  2HQR A;  2DMU A;  3R4K A;  1KYW A;  3IHU A;  4IHY A;  1O57 A;  1TQP A;  2FA5 A;  3LA2 A;  2Q2E A;  4RM3 A;  1BA5 A;  3FM5 A;  2D1V A;  2CQ7 A;  3DCF A;  3GME A;  5D8K B;  1X58 A;  2MLK A;  3BJ6 A;  3MKY B;  1BI1 A;  2KLO A;  5DCF A;  4BL0 B;  3ZXS A;  2I8D A;  3OIP A;  5IP9 J;  4BDY A;  2TRT A;  3ML6 A;  1HOM A;  3RYP A;  4L5I A;  2UWM A;  1TWF J;  3HJE A;  3DLL F;  2OCC H;  2P8T A;  2XF6 A;  2CO5 A;  2E19 A;  1ZGW A;  1EH6 A;  3RKX A;  4GXO A;  4HX7 A;  4U7B A;  1SEU A;  1VQP I;  4LFU A;  4I76 A;  5D4R A;  5FB2 A;  3F8F A;  3VSL A;  1FOW A;  5DD4 A;  2RNG A;  1YS7 A;  4OAY A;  4KIT B;  3I71 A;  2R5Z A;  3LSK A;  5M5W J;  2Y48 A;  3LST A;  3H3V K;  1DGR M;  4XLF A;  1WJB A;  3TDZ C;  3T8R A;  2F5F A;  2N8G A;  4KN7 X;  2ZXW H;  3B02 A;  4NQW B;  1APL C;  2LF8 A;  4QPO A;  1Y1W J;  3JR9 A;  5EEG A;  1WHU A;  4M3B A;  4A3C J;  2FNP A;  1K7A A;  5HLI A;  3S3N A;  2ZBK A;  5D5W B;  4S04 A;  4LMY A;  2XAJ A;  3OL3 A;  2MD0 A;  2GLO A;  1B1B A;  5J8C A;  2KP6 A;  3NQO A;  2VPL A;  2OCE A;  4EM2 A;  3FXQ A;  1J59 A;  5J1Y A;  4DGW B;  4I98 B;  3CLO A;  1T08 B;  2CRG A;  2XGE A;  5FJ8 J;  2V6E A;  2R4G A;  3OYA A;  1W36 D;  3H92 A;  3T1B A;  3HGG A;  4KJZ A;  2HTS A;  2RAE A;  3OIQ A;  2HOT A;  2V1X A;  4BEH A;  4HYE A;  2VAS A;  3HC7 A;  3W6J B;  3S17 J;  2DCE A;  2F4I A;  2HEO A;  2QCO A;  2XB5 A;  3BZK A;  2DA6 A;  3FHN A;  3WTT C;  4PUS A;  2DT7 B;  2NNN A;  3LAP A;  1TT5 B;  1JUM A;  2O0Y A;  2R7V A;  2ZXJ A;  1SVO A;  2KMU A;  4V2G A;  4IHW A;  5JFR A;  1ORK A;  2VLA A;  2ZXI A;  2K7L A;  1F9N A;  1O3R A;  2FE3 A;  2K3P A;  2WA0 A;  3QQA A;  1RUO A;  1V5F A;  2GAU A;  2QQA A;  3OYI A;  1I6H J;  1WCM J;  3LFU A;  1O3Q A;  3CCM I;  3JRC A;  2IJL A;  1SFE A;  4I6Z A;  1A5J A;  2W25 A;  3WTS C;  5K5Q A;  1FBQ A;  1XCB A;  5K7F A;  1YYV A;  1VQM I;  2CW0 F;  1YOV B;  4M9Z A;  2V1U A;  2R7X A;  1RES A;  2HOA A;  3ZMT A;  2BHY A;  1S5L C;  2HQA A;  1X1B A;  1UJ8 A;  2VBW A;  4YRV A;  3CO7 C;  4V19 K;  1MMG A;  2LNB A;  4KIS A;  2IPQ X;  1ZG5 A;  2BXZ A;  3MMY B;  2WAE A;  4OIP F;  2ELK A;  3ECO A;  4LIT A;  1FLI A;  1KQ0 A;  2HDW A;  5FKN A;  4P96 A;  3IH2 A;  2L7F P;  3BCB A;  3HUG B;  2IA1 A;  2FU4 A;  3AG1 H;  3LQQ A;  3CD6 I;  3ZMV A;  4DW6 A;  4RB2 C;  4D7M A;  1JXS A;  1JT0 A;  1CF7 A;  4ABZ A;  3B73 A;  3CJR B;  3N97 A;  4FE7 A;  2B7E A;  3FHZ A;  5E8G A;  5CVV A;  3H3Z A;  3KP4 A;  4LG0 A;  2EFN A;  5HOO A;  3IKT A;  3HSF A;  5LEJ A;  2H1L A;  4XM3 A;  5E1X A;  3C3W A;  2DMQ A;  3LFK A;  4Z2Y A;  1Z0X A;  2PG4 A;  4R79 A;  3V8K A;  5F0H A;  1MIJ A;  1IN5 A;  1MH3 A;  1MBF A;  2DK5 A;  5FLV A;  1XTA A;  3OIO A;  1R22 A;  4A5M A;  5FKL A;  2PMH A;  4L9N A;  3QWL A;  4ASN A;  3MKW B;  1TWG J;  3FWE A;  5GTH C;  1HBX G;  1R5H A;  2PMU A;  2ZFU A;  4BJ6 C;  2K9N A;  4XLN F;  1K83 J;  1YIJ I;  3Q0V A;  5CVR A;  3OYJ A;  3K7A J;  5DD8 A;  2A6E F;  4OU0 A;  1UCR A;  3GX4 X;  1DUX C;  2ETH A;  3E6D A;  3K4K A;  5ICC A;  2CQQ A;  3OOP A;  4O6J A;  4HF2 A;  5IOY A;  3C2G A;  2ECB A;  2HKX A;  3HRS A;  5FD5 A;  5D4S A;  3P9K A;  2ZC2 A;  2NXN B;  5E8I A;  4BHC A;  2CUE A;  2IS6 A;  4IVN A;  1WZ2 A;  3ROU A;  3E6C C;  2KFD A;  1A04 A;  3E6M A;  4V2F A;  1RZ4 A;  2JWT A;  3RQI A;  2ISY A;  4E7Z A;  2FX0 A;  3BY6 A;  3VOD A;  1POG A;  2COM A;  2DJN A;  3TGN A;  1XGO A;  4RGS A;  2XRL A;  2NS0 A;  4BNC A;  2QM3 A;  2L7K A;  5ILV A;  2DOE A;  2FQ3 A;  1BIA A;  1FBU A;  4LG3 A;  1RR7 A;  4CIC A;  3QRF F;  2V26 A;  2LR8 A;  4HF0 A;  4XL9 A;  1Z91 A;  3ZQG A;  4NC7 A;  4OWR B;  4C2U A;  4B47 A;  4IHS A;  1XGN A;  2W48 A;  3WTU C;  4A12 A;  5LGT A;  4IHT A;  3GFM A;  4HOB A;  5K5R A;  2LKX A;  3K4M A;  1U3E M;  2Y69 H;  3ZOB A;  2BZT A;  2JJ7 A;  4Q48 A;  1YIT I;  4AYB A;  2BY1 A;  4KMU X;  1Z77 A;  1XDS A;  1WI3 A;  4DIQ A;  3BQY A;  3A1Y A;  3NWS A;  3LSG A;  1TLH B;  2YR2 A;  3I55 I;  1B4A A;  1HXD A;  2EV0 A;  4M6X A;  5E1W A;  2TDX A;  2DJI A;  5E1Z B;  4CZZ A;  1ZN2 A;  3Q9S A;  4XLH A;  3MKL A;  2VI6 A;  4MEY F;  5FRN A;  1VQ7 I;  1Z6R A;  2FJ1 A;  2R7U A;  3IV5 A;  1ZEL A;  2K86 A;  3HHG A;  1MBK A;  4N0B A;  2V6C A;  1KU2 A;  1J0R A;  4LLG F;  1YJW I;  4ESF A;  1QU3 A;  1B8I A;  4ZC3 A;  3M1C A;  4G9Y A;  3OSG A;  3R6S A;  2YX4 A;  2JQ7 A;  2F5E A;  2Y0M A;  1YW8 A;  4UB8 C;  1HKT A;  2CFO A;  1FX7 A;  2VXZ A;  5HS8 A;  3O8H A;  4E7I A;  4G7H F;  2P5V A;  2OPT A;  5DEQ A;  1KA8 A;  2Q8K A;  1W0U A;  2K9L A;  2VJ5 A;  1OPC A;  3A03 A;  2V9P A;  2W00 A;  3GCM A;  4CYC B;  3ZQ7 A;  2X1E A;  1KYZ A;  2BY0 A;  3K1P A;  4JOM A;  2IGK A;  1WVR A;  2FRH A;  3QOD A;  4RGR A;  2P7V B;  1G2H A;  3IP4 B;  5F04 A;  1BN5 A;  4IKF A;  1SMY F;  3KZZ A;  2EV6 A;  1G3S A;  4NDL A;  1Y1V J;  5L3D A;  1BR2 A;  4YIF A;  1XN7 A;  1BW5 A;  3DTI A;  4GFB A;  2G7U A;  2XUB A;  4R1H A;  4NUB A;  2P5K A;  2D1H A;  2L7Z A;  3DP7 A;  3L09 A;  2LYC A;  5D8L B;  2M0M A;  2EZL A;  2MH2 A;  1C0W A;  1ON1 A;  3C2H A;  1X3W B;  1U8R A;  2QYO A;  2VE8 A;  3KP3 A;  3EQL F;  4RMN A;  2XKO A;  3PUB A;  1OIS A;  1TWC J;  4JQF A;  1T8I A;  5BS6 A;  2QZ8 A;  3ZRG A;  4L0Z B;  2EFW A;  1BR1 A;  4KT6 A;  3WTY C;  1FMW A;  4EJO A;  4ENM A;  3I9V 2;  3MZH A;  2OU2 A;  2K9M A;  4BAC A;  1IGN A;  4KN4 X;  4YFN F;  2LKS A;  3OR2 C;  2Y30 A;  3SDG A;  3S93 A;  3PFY A;  3CDI A;  4AIH A;  2PMZ N;  5E79 C;  3WTX C;  3D1N I;  1O7L A;  2DYR H;  2LTP A;  2GXA A;  4ETS A;  3OYH A;  4O3M A;  2O03 A;  1VQ8 I;  1VFC A;  2LF7 A;  3W2V A;  3I0T A;  1Z7U A;  2CS3 A;  3CCS I;  1TL8 A;  2DA3 A;  5IP7 J;  5LHG A;  2NVT J;  2JA2 A;  2K4J A;  2F5V A;  2FMY A;  3FK7 A;  3OOU A;  1UHW A;  2L01 A;  3O2P E;  1W1W E;  3AKZ A;  1ZG1 A;  1HKQ A;  1ZKG A;  2HI3 A;  5B1B H;  5IT9 Z;  1XS9 A;  3ZQF A;  2A69 F;  1TC3 C;  4MEX F;  1OR7 C;  1ETY A;  4MFE A;  5KHD A;  1QVT A;  5JHF A;  2HOS A;  2QKM B;  2BW3 B;  2YX7 A;  1JKP C;  1JJ8 C;  3V7R A;  3KYL A;  2XAS A;  3KFW X;  5KCM A;  4GDF A;  3DV8 A;  3G3Z A;  2VQC A;  5D5V B;  1N77 A;  4M74 A;  2AQE A;  1R7J A;  1SD4 A;  2K85 A;  3GZ6 A;  2FD5 A;  5F1R A;  2D2W A;  5J47 A;  3CUQ B;  4JX5 A;  3WHB A;  2DA5 A;  4UUV A;  3D5R C;  5F27 A;  3WU0 A;  5FD6 A;  2KZV A;  2R7W A;  2M7B A;  1TW3 A;  1HC8 A;  3FXM A;  2DQL A;  3K2Z A;  5HLH A;  2PEX A;  1MSF C;  3BRO A;  4LB6 B;  1MDM B;  1BOA A;  1X1D A;  2RV8 A;  4HX8 A;  4FX0 A;  1N25 A;  4PJJ A;  4XBF A;  2HQN A;  4UVB A;  5IY5 H;  4RLF A;  1XMX A;  4OOI A;  1X1A A;  2WB1 A;  2GWR A;  2ZO4 A;  2JSP A;  2M0C A;  3GUD A;  1KON A;  4A3L J;  1IN4 A;  4U88 A;  1MBG A;  3V4G A;  3BDD A;  3H0G J;  3GW2 A;  3I4N J;  3TKY A;  3LSH A;  4BDZ A;  1MMS A;  3FXK A;  4ZH4 F;  4BQN A;  4BBS J;  1E3P A;  3BWG A;  5CLS A;  1WRJ A;  2VOO A;  3TDU C;  2HPI A;  2XAU A;  2E35 A;  5KVR A;  4HQE A;  1YI2 I;  2E1M B;  2Q1Z B;  2XAG A;  3L2V A;  2E36 A;  3K4L A;  3W3C A;  2XHK A;  3OYL A;  3LWF A;  3UR3 C;  4BJ5 C;  5DTD A;  1GDT A;  3V8L A;  4A3J J;  2O3F A;  2CFX A;  2LOO A;  4BY7 J;  2BOL A;  4AUX A;  2XSD C;  1KU7 A;  2HKO A;  5CJ9 A;  1IC8 A;  1E17 A;  4ZZL A;  4I09 A;  2L4A A;  3F9K A;  2ZKZ A;  1I39 A;  3L2C A;  1O7F A;  3IL2 A;  1MBJ A;  1D5Y A;  2JT1 A;  4RLQ A;  3V7S A;  2P0W A;  2E60 A;  4CYD A;  1MMA A;  2JRM A;  1OCC H;  2MD5 A;  3HOX J;  4GCV A;  1OCR H;  3IAM 2;  1OYW A;  2TCT A;  3ZQC A;  4CDG A;  3N05 A;  4MLO A;  5L3E A;  1YO5 C;  4XLA A;  4YEJ A;  1HDP A;  3BPX A;  2CQK A;  3TO6 A;  4N9H A;  1R1V A;  4Z6Y A;  1BC7 C;  1W5S A;  1QQI A;  2CW8 A;  2X1C A;  4XK4 A;  2VKE A;  1TTY A;  1S3J A;  3SHF A;  2BGC A;  5KK1 A;  1WSU A;  2E7X A;  3GZ5 A;  3BZC A;  4EGY A;  2E1N A;  2DMN A;  1XGM A;  1O3S A;  2STW A;  1SAX A;  2CQN A;  2V1N A;  1AKH B;  1MJB A;  3ZN0 A;  1NHA A;  3UKG A;  4HG2 A;  1PYV A;  1B59 A;  4PJN A;  4S0H B;  3DQV C;  3S8P A;  1Z3X A;  3MD2 A;  4JK1 X;  1IRZ A;  2H27 A;  2ZJ2 A;  3CF5 F;  1RNL A;  1LEA A;  2ZJP F;  1PJR A;  4A3E J;  2XGD A;  3RI4 A;  9ANT A;  3KEQ A;  3JRA A;  2KKO A;  1M1E B;  4AWX B;  2ICW G;  4GO1 A;  4LIU A;  2O6G E;  4ON0 A;  2HXI A;  3ZN1 A;  1FSH A;  4XN3 A;  4PJM A;  3QPS A;  4M6V A;  2M4G A;  5IPA A;  2M34 A;  1OYI A;  4KIB A;  2X51 A;  4E7S A;  1P6R A;  1J9I A;  4MQ9 F;  2Z33 A;  1HA8 A;  4BGD A;  2L2O A;  2VJI A;  3FIW A;  5E18 F;  1WPK A;  5K5O A;  4ITV A;  1GVD A;  4OMZ A;  3S16 J;  4B4C A;  3K4J A;  1IXR C;  1JKR C;  4GYG A;  2DN0 A;  5CVJ A;  3CC2 I;  1FP1 D;  2OAZ A;  2KRH A;  2LLK A;  3CP8 A;  4B09 A;  1S72 I;  2JPC A;  2PJR A;  3GLX A;  3J81 K;  2V9K A;  2H8R A;  4Q5S F;  4XR6 A;  1W5T A;  2JSC A;  1IO2 A;  3PSF A;  3HIF A;  1W7P D;  3N4M A;  2Y75 A;  3CCY A;  3VFZ A;  2WAF A;  4XRS G;  4I2O A;  3S2D J;  3JRD A;  1NG6 A;  1GT0 C;  4XLC A;  5LD2 C;  5A2Q Z;  3M4O J;  1TNS A;  1K4S A;  3NAU A;  3I64 A;  5IT9 K;  3T0Y A;  1LKX A;  3RQ4 A;  3G1L A;  2VT3 A;  3CZ6 A;  1J7K A;  5EEH A;  2L0K A;  2PFB A;  1T95 A;  3GTG J;  3OYM A;  3H0D A;  3EET A;  3LA7 A;  2XF7 A;  2Z3Y A;  1QZY A;  3KCC A;  4DYR A;  3QPH A;  3S1N J;  4A3F J;  5JHU A;  2O8K A;  2BEO A;  3HKZ N;  2LBF B;  2QSG X;  5C3E J;  1K79 A;  4C2T A;  2V79 A;  2DFI A;  5EJC A;  5DDG A;  4MNU A;  4XRM A;  1BL0 A;  2DPD A;  3GTQ J;  4CH7 A;  3NEU A;  4WCG A;  1RI7 A;  4I0B A;  1D3Y A;  2G9W A;  2M9H A;  1VQ9 I;  3ABT A;  4Y3O A;  4G12 A;  2IT0 A;  3MVP A;  3GTK J;  2W24 A;  5H20 A;  2W82 A;  4L9V A;  2K40 A;  4BE0 A;  4HQM A;  2R7F A;  5E3O A;  4HRI A;  2NYX A;  1A36 A;  2DXI A;  3J7Z I;  1VF9 A;  2HZT A;  2NS8 A;  5B3S H;  4NNJ A;  3ZMZ A;  4ENN A;  4A3I J;  1X4P A;  4II3 A;  2H94 A;  4IX7 A;  3E97 A;  1ZYR F;  5K7Z A;  3IAS 2;  3B6A A;  2Y9Z A;  1ITY A;  3CQZ J;  5DUK A;  1I6X A;  1U78 A;  5LHI A;  2RDP A;  2OZ6 A;  1LB2 A;  4HNU A;  3CCV I;  2E2I J;  1U9N A;  2EA2 A;  2GIV A;  4F93 B;  4QPQ A;  2OF7 A;  1IRX A;  1ONV A;  1HKS A;  1FPQ A;  3F72 A;  1TWH J;  2XRN A;  3REO A;  1NTC A;  4KDP A;  5AIP A;  2ZME B;  1U0J A;  1IV8 A;  3A02 A;  2MC3 A;  3K1M A;  4X0G A;  1G3W A;  2JMW A;  5E3N A;  1UZC A;  1QPI A;  3RJP A;  3IC7 A;  1IJW C;  4HA8 A;  2HS5 A;  2EFO A;  2HZD A;  1YIO A;  1TT0 A;  1G3T A;  5GTI C;  2X48 A;  4CZC A;  4PFO A;  1ZRE A;  3JCU C;  1MSE C;  3AG4 H;  3DBL B;  1K61 A;  2M7A A;  4C3J J;  4II2 A;  1FY7 A;  3JAM Z;  3KX2 A;  1LDK B;  2MBF A;  5CQG A;  2K9Q A;  2Z1D A;  4JBA A;  4X6A J;  1JT6 A;  4FHT A;  2PI0 A;  2QLZ A;  1RKT A;  3H5A A;  1QA6 A;  3HEF A;  3BR3 A;  1LDJ A;  4I02 A;  4EJV A;  2NRA C;  1DPR A;  1ETO A;  3MCZ A;  2EPF A;  2LRD A;  3OMY A;  6PAX A;  3EUA A;  1QHG A;  3CMA I;  1FC3 A;  4B43 A;  1I1S A;  3L00 A;  2M2E A;  4EJW A;  2PQ8 A;  2Q0O A;  4C9Y A;  1R49 A;  3RCO A;  3KET A;  2MH9 A;  3ZMU A;  1U2W A;  1Q1V A;  2KT0 A;  2KZG A;  5M3M J;  3LL7 A;  3HB9 A;  1OLT A;  2OV7 A;  1XSD A;  3WGH A;  2ZSH B;  2VB6 A;  3CMY A;  4CO8 A;  2ME6 A;  1RKW A;  3BJA A;  3TP3 A;  4HX4 A;  3M8F A;  4A2U A;  3D0S A;  4ZJZ A;  3KP2 A;  5BNG A;  2E2J J;  1JI8 A;  4X1E A;  1B72 A;  3VYT B;  3ZMD A;  1KU3 A;  3HOT A;  4HNV A;  1MNE A;  5CKT A;  2M8E A;  2FOW A;  4MTD A;  1WWX A;  3JW4 A;  1XX5 A;  4ENK A;  3C7J A;  3TOB A;  2O8X A;  4YFX F;  2XAF A;  5EGO B;  4M9S A;  3LMM A;  3DEE A;  3QYF A;  5EG0 A;  3CCL I;  4KIC A;  1FOX A;  2DU9 A;  2DT5 A;  3BC8 A;  3MWM A;  4DYQ A;  1V3F A;  3CMM A;  2VBY A;  3QYE A;  4UUT A;  2KPM A;  1IG7 A;  1MBE A;  3ZPL A;  3LSM A;  1EA3 A;  3H9Q A;  2OC6 A;  4BHP A;  5HNF A;  4HPQ A;  1HST A;  3BP8 A;  4CA0 A;  1WJF A;  1LE8 A;  5F1J A;  2I10 A;  3P7N A;  3A01 A;  2CQX A;  1YG2 A;  2ZSI B;  3F8N A;  4FT8 A;  4BE1 A;  3ELK A;  3GO5 A;  3HPG A;  3VSK A;  4HZF A;  2M45 A;  3I5U A;  1P4A A;  2ECC A;  2B0L A;  2D5V A;  4BQQ A;  1GV5 A;  1D0Z A;  1WH7 A;  3BG7 A;  1H0M A;  3K1N A;  2XVC A;  4FCY A;  4QLC U;  3DPL C;  1VQ5 I;  5FKM A;  1ZLK A;  1YJ9 I;  4XON A;  5A2Q K;  4OMY A;  2ISZ A;  5HOD A;  3HOZ J;  2GQQ A;  2FSW A;  4HDV A;  5J3L A;  2R7R A;  3OYC A;  2GZW A;  1R71 A;  4BHB A;  1AOY A;  1OYY A;  1W7P B;  4LB5 A;  5M5Y J;  1XB4 A;  2GBY A;  2BBY A;  4CXF A;  4RBO A;  5HVQ C;  2W1O A;  1PP7 U;  3FIS A;  3ZP5 A;  2RC4 A;  2R3S A;  5J8F A;  4ZZD A;  1YRN A;  2V1D A;  1ETX A;  2OZU A;  3JRI A;  4HV5 A;  4G94 A;  5J40 A;  2OTL I;  2VL8 A;  3OWT A;  3I59 B;  1FT9 A;  4ESJ A;  3H3U A;  3UNG C;  3FXO A;  2EWN A;  3JRE A;  2QEN A;  2B63 J;  1K6Y A;  2R7O A;  3OYK A;  2ZB9 A;  3CCU I;  2X6Y A;  3J7Y J;  2HWV A;  3GEZ A;  1TNT A;  2MAB A;  5IP6 A;  3M3Y J;  3ULQ B;  3S14 J;  3HYI A;  4IOC F;  1IDZ A;  1R1T A;  3H5R A;  2JPB A;  4DZJ A;  3F0C A;  2CG4 A;  2BYV E;  1BJZ A;  3BLY A;  5C4J J;  1R5G A;  2QKL B;  5L3B A;  2HDD A;  1R1U A;  1PUF A;  3KZY A;  1B6A A;  1OJL A;  1SFX A;  1PVE A;  4F52 A;  3KP7 A;  2UUZ A;  3GF2 A;  4HV6 A;  1SVM A;  3IRR A;  4HAM A;  1WQ2 A;  1J75 A;  4ZYA A;  1D0Y A;  2VKD A;  2AXL A;  3MZ8 A;  2RGV A;  3PIP F;  1PDN C;  5BPI A;  3GFI A;  2DFH A;  1W0T A;  4B8X A;  3EPZ A;  1WH5 A;  3PM1 A;  2FML A;  3K4C A;  3OYG A;  2AXT C;  3DTK A;  1XMK A;  2VBX A;  1X1P A;  4M6Y A;  4PJ0 C;  5EYR A;  5K1Y A;  2LD5 A;  2NVX J;  5JVG F;  3LOC A;  3WU1 B;  1HW1 A;  4K2E A;  2XPW A;  2LY9 A;  1WJC A;  4XNF A;  1BR4 A;  4XID A;  1QVU A;  3H35 A;  2GM4 A;  3F23 A;  4Q47 A;  3JSO A;  4UUS B;  4WXC A;  4AID A;  3S1M J;  4FX4 A;  2DTZ A;  2KIU A;  5B66 C;  3JRG A;  4A6D A;  2QQ8 A;  5EF6 A;  4LOC A;  4DZP A;  2EBI A;  1T98 A;  3JAM K;  3GTJ J;  4NHJ A;  2YUS A;  5CYV A;  1XG1 A;  4YG2 F;  4F7Z A;  1Y8R B;  1IXC A;  3OS0 A;  1AU7 A;  1S7O A;  4WX9 A;  3CME I;  5ERI A;  3LSI A;  1IRG A;  1YW7 A;  2ZME A;  3HRU A;  2A07 F;  1EH8 A;  3JSP A;  4D7N A;  3DPU A;  4EEF G;  3HOW J;  2JK3 A;  4XQF A;  2FNA A;  1HW5 A;  1U6G A;  2E71 A;  2M8G X;  3L7W A;  4M3F A;  5E17 F;  5ILU A;  4G7Z F;  5D5X B;  1IN8 A;  3VOE A;  4IJA A;  1X3Z B;  4NQW A;  1HQC A;  4D5C A;  4UVC A;  4G7O F;  2K02 A;  2LRE A;  4L5E A;  4ZTJ A;  3HOS A;  1VQO I;  1VND A;  4EM1 A;  3K6G A;  2PBI A;  5E20 A;  1LPQ A;  1BJA A;  3BG5 A;  4PGH A;  3IH4 A;  3AG2 H;  4F3Q A;  4XOR A;  3OY9 A;  3MFK A;  3AL0 B;  3CC7 I;  4DBR A;  4RB1 A;  1YS6 A;  2IA2 A;  2ZJR F;  4C3I J;  3MZY A;  4AYB N;  4BUP A;  5DS9 A;  2KIQ A;  3CJN A;  5D6E A;  5CVI A;  3QP6 A;  3SFI A;  3WE2 A;  3BCA A;  4EVI A;  5KAI C;  4F92 B;  1KU9 A;  2EFP A;  5F0F A;  2MSY A;  1UEL B;  3WG9 A;  2CMP A;  3ABL H;  1ETW A;  5GP9 A;  3L1P A;  3U21 A;  4A0Y A;  2DOA A;  3DWL E;  1VTN C;  5FGM A;  1S9H A;  4WK8 F;  2NVU B;  3R0A A;  3GZN B;  2QQB A;  1WJA A;  3IRQ A;  2FQ4 A;  4RS8 A;  1LVK A;  2MC4 A;  2FBK A;  1SFK A;  3V8J A;  1ZR2 A;  3HRM A;  3NAR A;  1JGG A;  2VKH A;  5DYM A;  2X1D A;  4OIN F;  1R6R A;  3CCE I;  1D5V A;  1K78 B;  4AIK A;  3RTR A;  2KIM A;  2ZXH A;  3G73 A;  2JUG A;  3K70 D;  4PSW A;  1Y0N A;  3WTW C;  3W2W A;  3GBG A;  3DPT A;  3RSN A;  4DOZ A;  5GPC A;  1BW6 A;  2A5W A;  4DQ2 A;  4MO7 A;  2E1C A;  3D5S C;  3CCQ I;  3S1R J;  1V55 H;  4FET A;  1UHS A;  2X0L A;  2KIF A;  4MGR A;  2ID3 A;  3OV8 A;  4Y15 A;  5HLG A;  1U5T B;  2EZH A;  5F64 A;  4M3G A;  3J7A O;  2R5Y B;  4BQO A;  2H6B A;  1LFB A;  3BG9 A;  1K6O A;  1NK3 P;  1L0O C;  4HNT A;  5DM7 F;  2DA1 A;  2P81 A;  2GOX B;  2NNY A;  4U7D A;  3F21 A;  3ABK H;  1R4M B;  2WAQ A;  3K10 A;  4AVP A;  3DEU A;  2BY3 A;  4A3D J;  3HUG A;  1GVJ A;  2ID6 A;  3R0J A;  4WXH A;  3AAF A;  1UHM A;  4UV8 A;  1LJ9 A;  2OTJ I;  2L3D A;  2LMD A;  3MEX A;  1NK2 P;  2NAZ A;  1ETQ A;  5H2F C;  4XKV A;  3FXU A;  3WE3 A;  5IYD J;  4PJL A;  1SVL A;  2NOJ B;  3CJQ B;  4RGX A;  4BXF A;  2L02 A;  2Y9Y A;  2X6X A;  1E3O C;  2RVC A;  3OS2 A;  2W85 A;  1X2M A;  4AM3 A;  2RQP A;  3PNY A;  4CCL A;  1X4O A;  2R93 J;  2EZK A;  3V7C A;  1G59 A;  2H6C A;  4XLE A;  2LKP A;  2LSO A;  3M7G A;  5JVT A;  3H9G A;  4M72 A;  4IHV A;  2STT A;  1UG0 A;  2X4H A;  3FK6 A;  3F8C A;  1SC7 A;  3SZT A;  1DDN A;  3PQJ A;  1XC5 A;  4M3E A;  3DF8 A;  3K2A A;  3M8E A;  5CQE A;  2FXA A;  1ACI A;  5B1A H;  2M3A A;  4KMF A;  2DT6 A;  1YQA A;  2DO7 A;  2IEK A;  4PFP A;  5TRD A;  2UXX A;  2V7F A;  1IW7 F;  5GAD J;  1IN7 A;  3OR1 C;  1JKQ C;  4BXX J;  3HOU J;  2PN6 A;  1V5G A;  4XKB A;  5EZG A;  4XSZ F;  2W84 A;  3OS1 A;  4E7J A;  2CUJ A;  4HBL A;  3AFH A;  3FZV A;  5FFZ A;  2M30 A;  4G8X A;  5LLQ A;  3BTC A;  2HXO A;  4XMY A;  2H09 A;  3ZQL A;  2F4O B;  3K4B A;  4BQA A;  4D9J A;  5LGU A;  2OUM A;  3SQN A;  2JA6 J;  2KIS A;  4RB0 A;  4E7K A;  3JTH A;  3DBR B;  4XKC A;  5F08 A;  1YW9 A;  3M1E A;  1SD5 A;  2L7M P;  3OYE A;  1SFO J;  1VZ0 A;  3SFZ A;  1T33 A;  3G1M A;  1YTY A;  2ZFW A;  4HLY A;  2MYS A;  2MGQ A;  4MFD A;  1LFP A;  4IQJ A;  4IRG A;  2LC2 A;  4LGW A;  1JHF A;  4EAT A;  3WG7 H;  1T0F C;  3G2B A;  1FIP A;  4FTH A;  2Z16 A;  1ZH5 A;  3Q0U A;  1JTX A;  2IA0 A;  3BR1 A;  2E7W A;  3ZQH A;  5L3F A;  5E3M A;  1Q1H A;  1IF1 A;  2A5Y B;  3RKY A;  2IGO A;  1PP8 F;  2WY7 Q;  3KPH A;  1HCR A;  1T0F A;  3I4P A;  1J2X A;  2EZI A;  2M5W A;  4H0E A;  1A6I A;  2OQR A;  2VPR A;  4XRF A;  5LGN A;  3L2W A;  3ZR8 X;  3VYU B;  2C6Y A;  2CUF A;  2JA8 J;  1VQL I;  2A61 A;  5IT3 A;  3LQR A;  4P55 A;  1VQ4 I;  1DU6 A;  4A3G J;  2ME0 A;  4RA2 A;  2DYS H;  2WB1 N;  1USS A;  4I99 C;  5DV5 A;  4AU7 A;  2HGC A;  4A3K J;  1W36 C;  4BU2 A;  2CWE A;  4BXU A;  3RIR A;  1GLN A;  2LK2 A;  2NVY J;  3U1D A;  3HPH A;  1GXP A;  1EF4 A;  2O61 A;  1FSE A;  1Z6T A;  4HSR A;  4HST A;  1LNW A;  3ZGK A;  2F4M B;  1Z7L A;  1D1A A;  2LH9 A;  3FBN B;  3HRT A;  1XSX A;  4CGZ A;  1G6N A;  4D1Q A;  1EKE A;  4UY8 I;  1S6L A;  2R7T A;  5DCM B;  4OIO F;  1W5C C;  4CYC A;  2XRO A;  2DFE A;  3HSE A;  3W6V A;  1P7J A;  1MND A;  5BQT A;  1BI3 A;  3DXJ F;  1STZ A;  1X3U A;  3TQN A;  2Y0S A;  3RKW A;  2JTV A;  2A3S A;  3GTM J;  5HNH A;  3IKV A;  1CGP A;  4KIG A;  3TOA A;  2F48 A;  1D8J A;  1S29 A;  2VOD A;  4C30 A;  4P5O A;  4IL6 C;  3TW7 A;  5KNL A;  1T38 A;  4UB6 C;  4LLL A;  2CYY A;  2ELJ A;  1IV6 A;  1R00 A;  1R4N B;  3ABU A;  1ERD A;  1X1C A;  2LY2 A;  1S7E A;  3CTA A;  5F0C A;  2NS7 A;  3FDY A;  1IRF A;  2EIK H;  4Y4R A;  3GWZ A;  2CV2 A;  4A69 C;  2A6H F;  2UV1 A;  3U9G A;  4D5F A;  4Y33 A;  3KEY A;  2W57 A;  3CJT B;  5EEA A;  2HOE A;  4EGZ A;  2F6C A;  4GRI A;  3C18 A;  3K69 A;  2AO9 A;  2E34 A;  3Q9V A;  4S05 A;  3DBH B;  2DA2 A;  3SJM A;  1V54 H;  3BJO A;  3EYI A;  1BBY A;  1JGS A;  4CUG A;  5M3F J;  3ISP A;  4FQG A;  2BVL A;  5LRR A;  2DDB A;  5EDN A;  4L9J A;  1CF7 B;  2QUF A;  1YX3 A;  2DI3 A;  1P7I A;  3WGI A;  1LVA A;  4CHU A;  4L0Y B;  4MIM A;  2R7D A;  1I27 A;  2X9D A;  2HR3 A;  1U5T A;  1ZHF A;  2QSH X;  4NC8 A;  1BM9 A;  3DU6 A;  1GUU A;  4YEL A;  3FMR A;  2R5Y A;  3QYB A;  2XPV A;  3KYC B;  3T8T A;  3AG3 H;  4XOT A;  2HNH A;  2Z5U A;  4LJZ F;  2IGN A;  4PZJ A;  1O4X A;  3BG3 A;  3ASN H;  1WI9 A;  3PO2 J;  1KQ9 A;  2QWW A;  3FKJ A;  4BY1 J;  1Z67 A;  1DGW Y;  2O5R A;  5DM6 F;  4PCQ A;  3VEP A;  2MFZ A;  3S3O A;  2GIZ A;  3PNT A;  1FWZ A;  1TWA J;  2EIN H;  5EZH A;  4P9U A;  1MD0 A;  4MTE A;  1IUF A;  5FLM J;  2XSJ C;  4BH9 A;  1LUJ B;  1MGT A;  2HPM A;  3KIO A;  4XLP F;  2LFB A;  2OJE D;  4TV7 A;  2VUM J;  5ILS A;  3CUQ C;  3OYN A;  2Z99 A;  3VDX A;  5J1R A;  1T2K A;  3S1Q J;  1TZL A;  3ZCO A;  4NBQ A;  2BW3 A;  1LQ1 A;  1T56 A;  2IS1 A;  2RRE A;  5JLX A;  3IWF A;  3HG9 A;  1KGS A;  4EJU A;  2VBZ A;  2VQG A;  4E4H A;  2ELH A;  3CUQ A;  1EV7 A;  2OQG A;  4A3B J;  3G6E I;  3IH3 A;  1Y39 A;  4Y13 A;  5LEK A;  2LDU A;  3BQZ A;  5HDN A;  2EFQ A;  1FEX A;  2RNJ A;  2IRF G;  2LY1 A;  2YSR A;  3E0J B;  3DKW A;  4N4N B;  4HDU A;  1FTZ A;  1MDM A;  1OKR A;  1P9Q C;  1XPX A;  3CDH A;  3I56 I;  4Y52 J;  1WJ5 A;  1ZGJ A;  3SDB A;  4ENJ A;  2M4K A;  3PIO F;  2E1M C;  2COB A;  4EV0 A;  1Y0U A;  2DA7 A;  2QEX I;  3FKI J;  5TGT A;  2XV4 S;  3GXO A;  4AIJ A;  2EIJ H;  4Y17 A;  5L3C A;  2CV1 A;  1N78 A;  5CVU A;  3E5X A;  3Q5F A;  5TIS C;  4BAY A;  2ADU A;  2CV0 A;  5LRS A;  1YE9 A;  5AIQ A;  5ICF A;  1CQT A;  3CCR I;  4RAF A;  4IPA A;  1I3Q J;  1ON2 A;  2CJJ A;  1RC9 A;  1J5Y A;  1G8X A;  1YLF A;  3PQK A;  3VYS B;  3ZMS A;  3J80 Z;  3JRB A;  1B8I B;  1LDD A;  1Z21 A;  2L5Q A;  3MQ0 A;  3CC4 I;  4KNY A;  1FIA A;  2EV5 A;  4CCO A;  1ZRD A;  5D5U B;  3ERE D;  3ECH A;  2WTE A;  1FOY A;  5LBQ A;  3GTP J;  3KYD B;  2L9V A;  4QIW N;  3FBI B;  3SZP A;  3EUK L;  1YJN I;  3LSJ A;  3U1K A;  1F43 A;  1D8K A;  2FBH A;  2DMP A;  2RQQ A;  4FAS D;  1MJA A;  4G6D A;  3G4S I;  1UST A;  3M9A A;  1TQM A;  2VON A;  2IAI A;  2UXN A;  3HTS B;  2QBY B;  2CU7 A;  3BTI A;  1ETV A;  1I5Z A;  4B48 A;  3ZQI A;  4Q4Z F;  5K7H A;  1Z05 A;  2DW4 A;  2OBP A;  2EIL H;  3S32 A;  1P4W A;  3H36 A;  4YIR X;  3SZG A;  2JUC A;  3E5U A;  1MMN A;  4RGU A;  4DBQ A;  4EJT A;  3ONQ A;  1AKH A;  1Y56 A;  1ULY A;  4IZZ A;  2O9L A;  3RDI A;  4PSX A;  3PNV A;  3CF2 A;  5DCM A;  2IVM A;  4U0Y A;  3SEZ A;  1DP7 P;  1HDD C;  5IYC J;  1IXS B;  2XAQ A;  4C2M J;  3RYR A;  2J5P A;  5FRM A;  4IXA A;  2ZNY A;  4XRS A;  3TMO A;  4UNO A;  2EQR A;  1I3A A;  1E0E A;  3IWZ A;  3K70 C;  2L54 A;  2WY8 Q;  3K9T A;  4AVZ A;  4BKX A;  2CGP A;  3CLQ A;  1O3T A;  3L2Q A;  1AA7 A;  5DUI A;  2XPU A;  3EDP A;  5GPA A;  3GYH X;  4A6E A;  4B1R A;  4QTR A;  3FM3 A;  2R7Q A;  4RAG A;  4A5N A;  2IGM A;  2Y2Z A;  3JTG A;  1OCO H;  5J1U A;  1QZE A;  4XOP A;  2FF4 A;  2GA1 A;  4ZYG A;  2PX9 A;  2M1B A;  4HF1 A;  2XB0 X;  2XDV A;  1XSV A;  3J7A Y;  1ZK8 A;  4G6Q A;  2HYJ A;  4ZDO A;  1QPM A;  4DJA A;  2IXS A;  2EH3 A;  1OCP A;  1Y8Q B;  4I01 A;  3M8J A;  4EQQ A;  3CDL A;  3C2B A;  4MQV A;  4C3H J;  2LVS A;  3F3X A;  2E5Z A;  5HDG A;  3TP0 A;  1FBS A;  1DP3 A;  1HW2 A;  1R9T J;  4KT5 C;  3S2H J;  3PUF A;  3GTO J;  1BC8 C;  1ZAO A;  1I50 J;  3EYY A;  3A4C A;  4CCM A;  1F1Z A;  2R92 J;  2UZK A;  3I53 A;  3RPU D;  4AD9 A;  3LSP A;  1YHQ I;  4B3X A;  1R23 A;  1FOK A;  1R58 A;  2QVO A;  3QPT A;  2D45 A;  2DQR A;  3PSI A;  5AON A;  3COA C;  2LBF A;  5BMZ A;  1FYK A;  3CES A;  2QA4 I;  2HDC A;  2KDO A;  3ZQQ A;  4IOA F;  2QF7 A;  2H1K A;  4NB5 A;  2P5L C;  2DMT A;  1IN6 A;  4A0X A;  3HM5 A;  5ICE A;  1DU0 A;  3A2K A;  4GYI A;  2F5D A;  1Y6I A;  3S3M A;  1ENH A;  4BE2 A;  2IS2 A;  2VJ4 A;  5JR3 A;  3QOE A;  2DA4 A;  2XIG A;  1HLV A;  4OIQ F;  4ZDP A;  3WOD F;  4JP0 A;  2M87 A;  2K5C A;  1Z1D A;  2JVH A;  2X6O A;  4L5J A;  2IS4 A;  2E5N A;  2FBI A;  1EH7 A;  1YX5 A;  2K4B A;  4CCK A;  2DAO A;  1T39 A;  1SD7 A;  3BTL A;  1K4T A;  1IUY A;  2NOG A;  2RKH A;  3CP2 A;  1UAA A;  1VQ6 I;  1RIO H;  3E1S A;  2ZME C;  4LK0 F;  1W4M A;  2IBD A;  4M73 A;  3FXR A;  4GGG A;  3DU5 A;  2GOM A;  4F91 B;  5M5X J;  1RUN A;  1P92 A;  2X6W A;  4OAZ A;  4RAZ A;  5IYB J;  5L3G A;  3RKQ A;  1SFU A;  2P6T A;  2JVG A;  2A6T A;  2MW8 A;  3BTJ A;  3L9F A;  3QP5 A;  4R8H A;  4BBR J;  2PJP A;  2ACJ A;  3P9C A;  3QU6 A;  4BJT A;  2VIX A;  1ZAR A;  5GAG J;  1VQK I;  4RDU A;  1D0X A;  2VC1 A;  2WV1 A;  3J80 K;  2EA4 A;  3A0H C;  1IAW A;  4LIV A;  1DQU A;  3L2R A;  1A31 A;  3I58 A;  2BE5 F;  4NC6 A;  5FLX Z;  2O7O A;  1X19 A;  2YPR A;  2VT2 A;  1BOB A;  1RRJ A;  2R7S A;  2A68 F;  2H8W A;  4IEJ A;  1RPW A;  3JRF A;  2WBM A;  3F8B A;  4P1W A;  3HXL A;  5J4Y A;  4IHX A;  1AWC A;  2KRC A;  4W1U A;  2L4M A;  3BOQ A;  3K0L A;  4I0A A;  3GTL J;  3D5L A;  4J19 A;  2XAH A;  1Z3Y A;  4HLX A;  1GV2 A;  3WU2 C;  4KA4 A;  2XGC A;  3S2W A;  4WWC A;  5ED4 A;  1ZTR A;  3I54 A;  4QWQ A;  3TL4 X;  1JE8 A;  2OD5 A;  3GVA A;  1E3H A;  1A35 A;  1D1C A;  3FXJ A;  3NWT A;  3KEO A;  2VOP A;  1F5T A;  2JZY A;  4JYK A;  3W6K B;  5FRO A;  3HL2 A;  2VC0 A;  3SXY A;  5HS7 A;  3G71 I;  4IRI A;  5C44 J;  2BXY A;  3LNQ A;  5B5E C;  2VN2 A;  3DKY A;  1YFH A;  2FUG 2;  2EIM H;  2RN7 A;  2CSO A;  4QSH A;  2VE9 A;  4RAY A;  3RZO J;  4Y7N J;  3HHH A;  1JUP A;  1ODD A;  3BZ6 A;  2I5U A;  4UHT A;  2W7N A;  2HYF A;  4ZYD A;  3KZI C;  4ZYH A;  2PMZ A;  3HOY J;  3QPL A;  5H6Q A;  1UB9 A;  3W2A A;  1FYL A;  1S7A A;  2V4J C;  3VYR B;  2QBY A;  5J4V A;  4ZDL A;  3DLA A;  3KLN A;  1SAU A;  3GFJ A;  2IP2 A;  3NRV A;  1GHC A;  4RB3 C;  2XKP A;  2E1O A;  2YS9 A;  1ZGA A;  2DBB A;  3DFG A;  1JUS A;  2L9S A;  3BR6 A;  3LSR A;  5EGO A;  2KDZ A;  3DKX A;  1QHH D;  1BI0 A;  2ZNZ A;  2HYG D;  2IW5 A;  2K27 A;  4CCN A;  3CO6 C;  4LD5 A;  3BPV A;  5ICG A;  4KYW A;  1R36 A;  2BV6 A;  2VQL A;  4I7H A;  3HZJ A;  2YU9 J;  5JLW A;  2G7H A;  4A93 J;  1J09 A;  5IOZ A;  2JN6 A;  1HF0 A;  5KAF C;  3OYD A;  2PJR B;  1ZR4 A;  3SEQ A;  1U8B A;  1T6S A;  4N4O B;  4E6K G;  5HLT A;  2JA7 J;  2EB7 A;  2W4S A;  4WF2 A;  1XCV A;  3PO3 J;  1MBH A;  1S8N A;  3HDD A;  4EM0 B;  4PDK A;  1VI0 A;  3FMQ A;  2BHZ A;  4PGG A;  4A0Z A;  1L3L A;  4IO9 F;  2WC2 A;  5HS9 A;  3HOV J;  2F2E A;  2KL4 A;  4DNC A;  2KRF A;  4BS9 A;  3F22 A;  5BPD A;  4CCJ A;  5FFX A;  2B9S A;  3ERM A;  2BVM A;  3ESW B;  2VKV A;  2G0E A;  4P9F A;  2L9N A;  1QBJ A;  5GAH J; 
#chains in the Genus database with same CATH homology
 3GFL A;  2DK8 A;  2DPU A;  3RPQ A;  5TJJ A;  3WTZ A;  1W7P A;  2FOK A;  5F6F A;  3J81 Z;  2QQ9 A;  4YII A;  2YU3 A;  4OIR F;  2DTR A;  4E70 A;  1BIB A;  1BI2 A;  4ESB A;  3LAJ A;  1P4X A;  1G3Y A;  1PUE E;  2AS5 F;  1MKM A;  3I59 A;  3QU3 A;  5D6F A;  1H9G A;  3F6V A;  3WGG A;  1MJ9 A;  4BYY A;  3WTV C;  3VB2 A;  3R60 A;  3KP5 A;  3F8M A;  3KE2 A;  4KUM A;  2GA2 A;  3LA3 A;  1OR7 A;  2ESN A;  2J5O A;  1REP C;  1QNT A;  4M71 A;  1DPU A;  4YFK F;  2GXG A;  4UVA A;  2PLY A;  4N9I A;  2KJC A;  4L18 B;  4KIF A;  3FF5 A;  1FZP B;  2V9V A;  3PFI A;  3O6B B;  1ZRF A;  1WKM A;  5FLX K;  1LEB A;  1FP2 A;  4XSX F;  1I1G A;  4U0V A;  4IF4 A;  4IRH A;  2WWY A;  1XMA A;  1ZLJ A;  2P6S A;  1MZB A;  1ZRC A;  1H9T A;  1SD6 A;  3O3K A;  1B9M A;  5J6X A;  4EMS A;  4HW0 A;  2GXB A;  4M9X A;  2XGX A;  3FMS A;  2MLG A;  3QAH A;  4LLN A;  4D0P A;  4O5V A;  3MAJ A;  1B9N A;  1XDU A;  3F6O A;  2FEZ A;  3TO9 A;  1V4R A;  1QO0 D;  1IZ1 A;  1QGP A;  1UFM A;  4UXN A;  3E6B A;  3FX3 A;  2P4W A;  1E2X A;  3R61 A;  1JHH A;  1Z9C A;  1HSJ A;  3E5Q A;  2HTJ A;  3T5X A;  1TQI A;  1TBX A;  2WV0 A;  5BOX A;  3P9I A;  5H6R A;  3QOP A;  3CUO A;  5HDK A;  3U2R A;  4MHG A;  1TW2 A;  2EJR A;  1SMT A;  4LK1 F;  1XD7 A;  2KJB A;  3E3V A;  5JI6 A;  1K78 A;  3HTU A;  1FNN A;  1KQ8 A;  4U0W A;  2ESH A;  1U5T C;  1F4K A;  5FO5 A;  3HSR A;  1P2F A;  2JRT A;  2HFH A;  4LG0 B;  1OMI A;  4WXD A;  2MA3 A;  4UV9 A;  1FYM A;  3KLO A;  2EK5 A;  3EUH A;  2F5C A;  2OA4 A;  3KP6 A;  4L9T A;  1GXQ A;  1XGS A;  4KFC A;  2DLL A;  3C1D A;  2Z9O A;  2P7C B;  4ZYE A;  3TO7 A;  1ZG3 A;  1G4D A;  5LHH A;  2ZCW A;  1QZZ A;  3RPU A;  2HQR A;  3R4K A;  1KYW A;  3IHU A;  1O57 A;  1TQP A;  2FA5 A;  3LA2 A;  2Q2E A;  3FM5 A;  2D1V A;  5D8K B;  2MLK A;  3BJ6 A;  1BI1 A;  5DCF A;  3ML6 A;  3RYP A;  4L5I A;  2UWM A;  2P8T A;  2CO5 A;  1EH6 A;  3RKX A;  4GXO A;  4HX7 A;  4U7B A;  4LFU A;  5D4R A;  5FB2 A;  3F8F A;  5DD4 A;  1YS7 A;  3I71 A;  2Y48 A;  3LST A;  3TDZ C;  3T8R A;  2F5F A;  4KN7 X;  3B02 A;  2LF8 A;  5EEG A;  2FNP A;  1K7A A;  5HLI A;  2ZBK A;  4S04 A;  5D5W B;  4LMY A;  2XAJ A;  1B1B A;  5J8C A;  3NQO A;  4EM2 A;  3FXQ A;  1J59 A;  4I98 B;  3CLO A;  3H92 A;  3T1B A;  2HTS A;  2V1X A;  4HYE A;  3W6J B;  2HEO A;  3WTT C;  2NNN A;  3LAP A;  2O0Y A;  2ZXJ A;  5JFR A;  2K7L A;  1F9N A;  1O3R A;  2FE3 A;  1RUO A;  2GAU A;  2QQA A;  1O3Q A;  2IJL A;  1SFE A;  2W25 A;  3WTS C;  5K5Q A;  1FBQ A;  1XCB A;  1YYV A;  2CW0 F;  4M9Z A;  2V1U A;  3ZMT A;  2VBW A;  3CO7 C;  2LNB A;  2IPQ X;  1ZG5 A;  4OIP F;  3ECO A;  1FLI A;  1KQ0 A;  4P96 A;  2IA1 A;  2FU4 A;  3LQQ A;  3ZMV A;  4RB2 C;  1JXS A;  1CF7 A;  3B73 A;  3N97 A;  3FHZ A;  5E8G A;  5CVV A;  3H3Z A;  3KP4 A;  4LG0 A;  2EFN A;  5HOO A;  3IKT A;  3HSF A;  5LEJ A;  5E1X A;  3C3W A;  3LFK A;  4Z2Y A;  2PG4 A;  4R79 A;  3V8K A;  1IN5 A;  2DK5 A;  1R22 A;  4A5M A;  2PMH A;  4L9N A;  4ASN A;  3FWE A;  1HBX G;  1R5H A;  2PMU A;  4XLN F;  5CVR A;  5DD8 A;  2A6E F;  4OU0 A;  1UCR A;  3GX4 X;  1DUX C;  2ETH A;  3E6D A;  5ICC A;  3OOP A;  4O6J A;  4HF2 A;  2HKX A;  3HRS A;  5FD5 A;  5D4S A;  3P9K A;  5E8I A;  4BHC A;  4IVN A;  3ROU A;  3E6C C;  1A04 A;  3E6M A;  1RZ4 A;  2ISY A;  3BY6 A;  3VOD A;  2COM A;  3TGN A;  1XGO A;  4RGS A;  2NS0 A;  4BNC A;  2QM3 A;  5ILV A;  2FQ3 A;  1BIA A;  1FBU A;  4CIC A;  3QRF F;  4HF0 A;  1Z91 A;  4IHS A;  1XGN A;  3WTU C;  4A12 A;  5LGT A;  4IHT A;  3GFM A;  4HOB A;  5K5R A;  1U3E M;  4Q48 A;  4KMU X;  1XDS A;  1TLH B;  2YR2 A;  1B4A A;  1HXD A;  2EV0 A;  4M6X A;  5E1W A;  2TDX A;  5E1Z B;  4CZZ A;  1ZN2 A;  3Q9S A;  4MEY F;  1Z6R A;  2K86 A;  3HHG A;  4N0B A;  2V6C A;  1KU2 A;  1J0R A;  4LLG F;  4ESF A;  4G9Y A;  3R6S A;  2YX4 A;  2F5E A;  2Y0M A;  1YW8 A;  1HKT A;  1FX7 A;  2VXZ A;  5HS8 A;  4G7H F;  2P5V A;  5DEQ A;  1KA8 A;  2Q8K A;  1OPC A;  3ZQ7 A;  1KYZ A;  3K1P A;  2FRH A;  4RGR A;  2P7V B;  1BN5 A;  1SMY F;  3KZZ A;  2EV6 A;  1G3S A;  5L3D A;  4YIF A;  1XN7 A;  2G7U A;  2XUB A;  4R1H A;  2P5K A;  2D1H A;  3DP7 A;  3L09 A;  5D8L B;  2MH2 A;  1C0W A;  1ON1 A;  1U8R A;  2QYO A;  2VE8 A;  3KP3 A;  3EQL F;  2XKO A;  4JQF A;  5BS6 A;  2QZ8 A;  4L0Z B;  2EFW A;  3WTY C;  4EJO A;  4ENM A;  3MZH A;  2OU2 A;  4KN4 X;  4YFN F;  4AIH A;  3WTX C;  1O7L A;  4ETS A;  4O3M A;  2O03 A;  2LF7 A;  3I0T A;  1Z7U A;  5LHG A;  2K4J A;  2FMY A;  1UHW A;  2L01 A;  3O2P E;  1ZG1 A;  1HKQ A;  5IT9 Z;  2A69 F;  4MEX F;  2YX7 A;  3V7R A;  2XAS A;  3KFW X;  3DV8 A;  3G3Z A;  5D5V B;  4M74 A;  1R7J A;  1SD4 A;  3GZ6 A;  5F1R A;  2D2W A;  4UUV A;  3CUQ B;  3WU0 A;  5FD6 A;  1TW3 A;  2DQL A;  3K2Z A;  5HLH A;  2PEX A;  3BRO A;  4LB6 B;  1MDM B;  4XBF A;  1BOA A;  2RV8 A;  4HX8 A;  4FX0 A;  2HQN A;  4UVB A;  4OOI A;  2GWR A;  2ZO4 A;  3GUD A;  1IN4 A;  4U88 A;  3V4G A;  3BDD A;  3GW2 A;  3TKY A;  4ZH4 F;  3BWG A;  5CLS A;  1WRJ A;  2VOO A;  3TDU C;  5KVR A;  4HQE A;  2XAG A;  2XHK A;  3LWF A;  3V8L A;  2O3F A;  2CFX A;  1KU7 A;  2HKO A;  5CJ9 A;  1E17 A;  4ZZL A;  4I09 A;  2L4A A;  2ZKZ A;  3L2C A;  1O7F A;  3IL2 A;  2JT1 A;  3V7S A;  4CYD A;  2MD5 A;  4GCV A;  1OYW A;  4CDG A;  5L3E A;  1YO5 C;  3BPX A;  2CQK A;  3TO6 A;  4N9H A;  1R1V A;  1BC7 C;  1W5S A;  1QQI A;  1TTY A;  1S3J A;  3SHF A;  2BGC A;  5KK1 A;  1WSU A;  2E7X A;  3GZ5 A;  4EGY A;  2E1N A;  1XGM A;  1O3S A;  2STW A;  1SAX A;  1MJB A;  3ZN0 A;  1NHA A;  1B59 A;  3DQV C;  4JK1 X;  2H27 A;  2ZJ2 A;  1RNL A;  1LEA A;  3RI4 A;  3KEQ A;  2KKO A;  4AWX B;  4GO1 A;  2O6G E;  4ON0 A;  3ZN1 A;  1FSH A;  1OYI A;  4KIB A;  1P6R A;  1J9I A;  4MQ9 F;  2Z33 A;  5E18 F;  5K5O A;  4OMZ A;  1IXR C;  4GYG A;  5CVJ A;  1FP1 D;  2OAZ A;  4B09 A;  2JPC A;  3GLX A;  3J81 K;  4Q5S F;  1W5T A;  2JSC A;  3HIF A;  1W7P D;  3N4M A;  2Y75 A;  3VFZ A;  4I2O A;  5A2Q Z;  1TNS A;  3I64 A;  5IT9 K;  3T0Y A;  2VT3 A;  1J7K A;  5EEH A;  2PFB A;  3EET A;  3LA7 A;  2Z3Y A;  1QZY A;  3KCC A;  3QPH A;  5JHU A;  2BEO A;  1K79 A;  2V79 A;  2DFI A;  5DDG A;  4MNU A;  2DPD A;  3NEU A;  4WCG A;  1RI7 A;  4I0B A;  1D3Y A;  2G9W A;  3ABT A;  2IT0 A;  2W24 A;  5H20 A;  4L9V A;  4HQM A;  2R7F A;  2NYX A;  2HZT A;  3ZMZ A;  4ENN A;  2H94 A;  3E97 A;  1ZYR F;  5DUK A;  1I6X A;  1U78 A;  5LHI A;  2RDP A;  2OZ6 A;  1LB2 A;  2EA2 A;  2GIV A;  1ONV A;  1HKS A;  1FPQ A;  3F72 A;  2XRN A;  3REO A;  4KDP A;  5AIP A;  2ZME B;  2MC3 A;  3K1M A;  1G3W A;  3RJP A;  3IC7 A;  4HA8 A;  2HS5 A;  2EFO A;  1YIO A;  1G3T A;  1ZRE A;  1FY7 A;  3JAM Z;  1LDK B;  2MBF A;  4JBA A;  4FHT A;  2PI0 A;  2QLZ A;  1LDJ A;  4I02 A;  4EJV A;  2NRA C;  1DPR A;  3MCZ A;  6PAX A;  1FC3 A;  1I1S A;  3L00 A;  4EJW A;  2PQ8 A;  2Q0O A;  3KET A;  2MH9 A;  3ZMU A;  1U2W A;  1XSD A;  3WGH A;  4CO8 A;  3BJA A;  4HX4 A;  3M8F A;  4A2U A;  3D0S A;  3KP2 A;  3ZMD A;  1KU3 A;  3HOT A;  2M8E A;  4MTD A;  1WWX A;  3JW4 A;  4ENK A;  3C7J A;  3TOB A;  2O8X A;  4YFX F;  2XAF A;  4M9S A;  4KIC A;  2DU9 A;  2DT5 A;  3MWM A;  1V3F A;  2VBY A;  3ZPL A;  4BHP A;  1HST A;  3BP8 A;  3P7N A;  3F8N A;  1YG2 A;  4FT8 A;  3ELK A;  3GO5 A;  4HZF A;  2M45 A;  3I5U A;  1P4A A;  2B0L A;  1H0M A;  3K1N A;  2XVC A;  4QLC U;  3DPL C;  1ZLK A;  5A2Q K;  4OMY A;  2ISZ A;  2GQQ A;  2FSW A;  4HDV A;  2GZW A;  4BHB A;  1AOY A;  1OYY A;  1W7P B;  4LB5 A;  1XB4 A;  2BBY A;  4CXF A;  5HVQ C;  1PP7 U;  3ZP5 A;  2RC4 A;  2R3S A;  5J8F A;  4ZZD A;  2V1D A;  2OZU A;  4HV5 A;  4G94 A;  3I59 B;  1FT9 A;  4ESJ A;  3H3U A;  2EWN A;  2QEN A;  2HWV A;  3GEZ A;  1TNT A;  3ULQ B;  3HYI A;  1R1T A;  2JPB A;  2CG4 A;  2BYV E;  1R5G A;  5L3B A;  1R1U A;  3KZY A;  1B6A A;  1SFX A;  3KP7 A;  3GF2 A;  4HV6 A;  3IRR A;  4HAM A;  1WQ2 A;  1J75 A;  2AXL A;  2RGV A;  1PDN C;  5BPI A;  3GFI A;  4B8X A;  2FML A;  1XMK A;  2VBX A;  4M6Y A;  5K1Y A;  3WU1 B;  1HW1 A;  4K2E A;  3F23 A;  4Q47 A;  3JSO A;  4WXC A;  4FX4 A;  2KIU A;  4A6D A;  1T98 A;  3JAM K;  4NHJ A;  5CYV A;  4YG2 F;  4F7Z A;  1IXC A;  1S7O A;  4WX9 A;  5ERI A;  1IRG A;  1YW7 A;  2ZME A;  3HRU A;  2A07 F;  1EH8 A;  3JSP A;  2FNA A;  1HW5 A;  1U6G A;  3L7W A;  5E17 F;  5ILU A;  4G7Z F;  5D5X B;  1IN8 A;  3VOE A;  4IJA A;  4NQW A;  1HQC A;  4UVC A;  4G7O F;  2K02 A;  3HOS A;  4EM1 A;  2PBI A;  5E20 A;  1BJA A;  4PGH A;  3MFK A;  4RB1 A;  1YS6 A;  2IA2 A;  3MZY A;  3CJN A;  5D6E A;  5CVI A;  3QP6 A;  3WE2 A;  4EVI A;  1KU9 A;  2EFP A;  3WG9 A;  4A0Y A;  1VTN C;  5FGM A;  4WK8 F;  3R0A A;  2QQB A;  3IRQ A;  4RS8 A;  2FBK A;  3V8J A;  3HRM A;  5DYM A;  4OIN F;  1D5V A;  1K78 B;  4AIK A;  3RTR A;  2KIM A;  3G73 A;  3WTW C;  3DPT A;  4DQ2 A;  2E1C A;  4MGR A;  2X0L A;  2KIF A;  3OV8 A;  4Y15 A;  5HLG A;  1U5T B;  5F64 A;  3J7A O;  2H6B A;  1K6O A;  1L0O C;  2NNY A;  4U7D A;  3F21 A;  4AVP A;  3DEU A;  3HUG A;  1GVJ A;  3R0J A;  4WXH A;  3AAF A;  1UHM A;  4UV8 A;  1LJ9 A;  2L3D A;  3MEX A;  2NAZ A;  3WE3 A;  3FXU A;  4RGX A;  2L02 A;  2RVC A;  2W85 A;  2RQP A;  3V7C A;  2H6C A;  2LKP A;  2LSO A;  3M7G A;  5JVT A;  4M72 A;  2STT A;  2X4H A;  3F8C A;  3SZT A;  1DDN A;  3PQJ A;  3DF8 A;  3M8E A;  2FXA A;  4KMF A;  1YQA A;  2DO7 A;  5TRD A;  2UXX A;  1IW7 F;  1IN7 A;  2PN6 A;  4XSZ F;  2W84 A;  4HBL A;  3FZV A;  5FFZ A;  2M30 A;  4G8X A;  5LLQ A;  2H09 A;  4BQA A;  5LGU A;  3SQN A;  4RB0 A;  3JTH A;  1YW9 A;  3M1E A;  1SD5 A;  3SFZ A;  1YTY A;  2ZFW A;  4HLY A;  4IRG A;  4LGW A;  1JHF A;  1ZH5 A;  2IA0 A;  2E7W A;  5L3F A;  1IF1 A;  1Q1H A;  2A5Y B;  3RKY A;  1PP8 F;  1T0F A;  3I4P A;  1J2X A;  2M5W A;  4H0E A;  2OQR A;  4XRF A;  5LGN A;  2C6Y A;  2A61 A;  5IT3 A;  3LQR A;  4P55 A;  1USS A;  5DV5 A;  2HGC A;  2CWE A;  4BXU A;  3RIR A;  3U1D A;  1GXP A;  2O61 A;  1FSE A;  1Z6T A;  1LNW A;  3HRT A;  1XSX A;  4CGZ A;  1G6N A;  1S6L A;  5DCM B;  4OIO F;  2XRO A;  3HSE A;  5BQT A;  1BI3 A;  3DXJ F;  1STZ A;  1X3U A;  3TQN A;  3RKW A;  2JTV A;  2A3S A;  3IKV A;  1CGP A;  4KIG A;  3TOA A;  1D8J A;  1S29 A;  2VOD A;  4P5O A;  1T38 A;  4LLL A;  2CYY A;  1R00 A;  3ABU A;  3CTA A;  1IRF A;  3GWZ A;  2A6H F;  3U9G A;  2W57 A;  4EGZ A;  2HOE A;  3C18 A;  3K69 A;  3Q9V A;  4S05 A;  3EYI A;  3BJO A;  1BBY A;  1JGS A;  3ISP A;  5LRR A;  1CF7 B;  4L9J A;  2QUF A;  2DI3 A;  3WGI A;  4CHU A;  1LVA A;  4L0Y B;  2R7D A;  1I27 A;  2HR3 A;  1U5T A;  1ZHF A;  1BM9 A;  3FMR A;  3T8T A;  2Z5U A;  4LJZ F;  4PZJ A;  1WI9 A;  1KQ9 A;  2QWW A;  4PCQ A;  3VEP A;  1FWZ A;  4P9U A;  1MD0 A;  4MTE A;  4BH9 A;  1MGT A;  4XLP F;  4TV7 A;  5ILS A;  3CUQ C;  2Z99 A;  1T2K A;  1LQ1 A;  3IWF A;  1KGS A;  4EJU A;  2VBZ A;  2ELH A;  3CUQ A;  1EV7 A;  2OQG A;  4Y13 A;  5LEK A;  2LDU A;  5HDN A;  2EFQ A;  2RNJ A;  2IRF G;  2YSR A;  3DKW A;  4HDU A;  1MDM A;  1OKR A;  3CDH A;  1ZGJ A;  4ENJ A;  4EV0 A;  1Y0U A;  2XV4 S;  3GXO A;  4AIJ A;  4Y17 A;  5L3C A;  5CVU A;  3E5X A;  3Q5F A;  4BAY A;  2ADU A;  5LRS A;  5AIQ A;  5ICF A;  4IPA A;  1ON2 A;  1J5Y A;  1YLF A;  3J80 Z;  3PQK A;  3ZMS A;  1LDD A;  4KNY A;  3MQ0 A;  2EV5 A;  1ZRD A;  5D5U B;  3ERE D;  3ECH A;  2WTE A;  5LBQ A;  3SZP A;  1D8K A;  2FBH A;  1MJA A;  4G6D A;  1UST A;  3M9A A;  1TQM A;  2VON A;  2UXN A;  3HTS B;  2QBY B;  1I5Z A;  4Q4Z F;  1Z05 A;  2DW4 A;  2OBP A;  1P4W A;  3E5U A;  4RGU A;  4EJT A;  1ULY A;  3RDI A;  5DCM A;  4U0Y A;  2IVM A;  1DP7 P;  1IXS B;  2XAQ A;  3RYR A;  2J5P A;  4IXA A;  2ZNY A;  4UNO A;  3IWZ A;  2L54 A;  3K9T A;  2CGP A;  1O3T A;  5DUI A;  3EDP A;  3GYH X;  4A6E A;  3FM3 A;  4A5N A;  3JTG A;  2FF4 A;  2GA1 A;  4ZYG A;  2M1B A;  4HF1 A;  1XSV A;  4G6Q A;  1QPM A;  4I01 A;  4EQQ A;  4MQV A;  3F3X A;  5HDG A;  1FBS A;  1HW2 A;  4KT5 C;  1ZAO A;  3EYY A;  1F1Z A;  2UZK A;  3I53 A;  4AD9 A;  1R23 A;  1FOK A;  1R58 A;  2QVO A;  3QPT A;  2D45 A;  2DQR A;  5AON A;  3COA C;  5BMZ A;  1FYK A;  2HDC A;  4NB5 A;  2P5L C;  1IN6 A;  4A0X A;  5ICE A;  4GYI A;  2F5D A;  5JR3 A;  4OIQ F;  2XIG A;  3WOD F;  2M87 A;  1Z1D A;  4L5J A;  2FBI A;  1EH7 A;  2K4B A;  1T39 A;  2DAO A;  1IUY A;  1SD7 A;  2RKH A;  1RIO H;  4LK0 F;  1W4M A;  4M73 A;  3FXR A;  4GGG A;  1RUN A;  1P92 A;  4RAZ A;  5L3G A;  1BC8 C;  1SFU A;  2P6T A;  3L9F A;  4R8H A;  2PJP A;  3QP5 A;  2ACJ A;  3P9C A;  3QU6 A;  1ZAR A;  2VC1 A;  3J80 K;  2EA4 A;  1IAW A;  3I58 A;  2BE5 F;  5FLX Z;  2YPR A;  2VT2 A;  2A68 F;  3F8B A;  1AWC A;  2L4M A;  3BOQ A;  3K0L A;  4I0A A;  3D5L A;  2XAH A;  4HLX A;  4KA4 A;  3S2W A;  4WWC A;  5ED4 A;  3I54 A;  4QWQ A;  1JE8 A;  2OD5 A;  3GVA A;  2VOP A;  3KEO A;  1F5T A;  2JZY A;  3W6K B;  2VC0 A;  3SXY A;  5HS7 A;  4IRI A;  2VN2 A;  1YFH A;  2RN7 A;  2CSO A;  2VE9 A;  4RAY A;  3HHH A;  1ODD A;  3BZ6 A;  4UHT A;  2HYF A;  4ZYD A;  4ZYH A;  5H6Q A;  1UB9 A;  1FYL A;  1S7A A;  2QBY A;  3KLN A;  3GFJ A;  2IP2 A;  3NRV A;  1GHC A;  4RB3 C;  2XKP A;  1ZGA A;  2DBB A;  3DFG A;  1BI0 A;  2ZNZ A;  2HYG D;  2IW5 A;  2K27 A;  3CO6 C;  4LD5 A;  3BPV A;  5ICG A;  4KYW A;  1R36 A;  2BV6 A;  4I7H A;  2G7H A;  1T6S A;  2EB7 A;  4WF2 A;  1XCV A;  1S8N A;  4EM0 B;  4PDK A;  3FMQ A;  4PGG A;  4A0Z A;  1L3L A;  2WC2 A;  5HS9 A;  2F2E A;  3F22 A;  4DNC A;  2KRF A;  5BPD A;  5FFX A;  4P9F A;  1QBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...