1MD0A

Crystal structure of an inhibited fragment of ets-1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
138
structure length
138
Chain Sequence
b'PKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-ets-1 protein
publication title Structural Analysis of the Autoinhibition of Ets-1 and Its Role in Protein Partnerships
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 42
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1md0A00
4L9JA 2GWRA 2XGXA 1QQIA 2HEOA 1MDMA 4CXFA 1BIBA 5A2QZ 1ODDA 3NEUA 5HLHA 3M8EA 2CYYA 1IN5A 1R58A 3F8FA 1O3TA 3HHHA 3M8FA 2L02A 4BHCA 1T38A 2XAGA 3FMQA 1UHMA 1HQCA 3W6KB 3G73A 1YG2A 2XAHA 4BAYA 4HBLA 4UVAA 1EH7A 1G6NA 3KFWX 4FX4A 5H20A 1XGOA 1A04A 2CQKA 2OBPA 4OIQF 3KETA 1CGPA 3KE2A 4M72A 2OZUA 2XASA 3Q9SA 2NNNA 4Q5SF 1J5YA 4L9NA 3R6SA 4WWCA 2RC4A 2FA5A 3BWGA 1DPUA 4FT8A 2R7FA 3V7RA 4PGHA 3FXQA 2DBBA 3F8NA 4GCVA 1XD7A 1K7AA 3OOPA 4M9XA 2PN6A 2EV6A 1OR7A 3U2RA 3RPQA 1D5VA 3R0JA 3F6VA 1P4XA 4MTDA 5DD8A 1QO0D 4E70A 2QENA 2QZ8A 3BOQA 3ELKA 3HSRA 4M9SA 1IXSB 1GXPA 3QPHA 4P5OA 4GYGA 4RGUA 5HS7A 1O3SA 3L7WA 2XAFA 1SFEA 2YX7A 3SXYA 4YG2F 3I64A 1W5SA 2P5LC 1FNNA 3T8TA 1K78B 2CSOA 4CDGA 3WGHA 2HZTA 1ZGAA 1KYZA 3H3ZA 1FT9A 2GA2A 2QQAA 3P9KA 4YFKF 4GXOA 1KA8A 5ILUA 1B6AA 3WE3A 3GX4X 1JHHA 2MLGA 5BOXA 1QGPA 1SMTA 5CVIA 4EGZA 2FSWA 1LEAA 5CYVA 5LRSA 1YQAA 2EV0A 3E6DA 3EYYA 2YX4A 2BE5F 1FPQA 2MD5A 2W25A 2M87A 2FBKA 3F8CA 2V1XA 3GXOA 3HHGA 5BPDA 2OU2A 5D8KB 3I0TA 3KCCA 3VFZA 5LHHA 2GAUA 1YW7A 3K2ZA 2COMA 3Q9VA 4L5IA 1F5TA 4BNCA 5HS8A 2A3SA 4HF2A 1WKMA 2XROA 4RB2C 5FGMA 5DUIA 3CO6C 2F5FA 3FXRA 3RKXA 2HFHA 2QM3A 4LJZF 4AVPA 5FLXK 1F9NA 4KICA 3LAJA 3ABTA 3WTYC 1B1BA 4IVNA 1U5TC 4IRHA 4WCGA 4PZJA 3KZYA 2W85A 5EEGA 5E18F 3DPLC 2DQLA 3DP7A 1LJ9A 3HOSA 4EQQA 1MJAA 3MFKA 1USTA 1UHWA 2IJLA 1K79A 1FWZA 3E5UA 1YFHA 2E7WA 1PDNC 4RB3C 3RI4A 3L9FA 4YIIA 1EV7A 3QRFF 3JTGA 1FSHA 2HTSA 1R1UA 1R00A 3HSEA 1OKRA 1O57A 1O7FA 4HDVA 1VTNC 2JZYA 2HYFA 4ENMA 2VE8A 1ZH5A 4A2UA 2HR3A 1J59A 4IJAA 2FXAA 3GLXA 3M9AA 1ON1A 4LFUA 2VBWA 3JAMZ 2FMLA 3EUHA 4EJUA 2ZJ2A 5HLGA 3ZMSA 2XAQA 4CO8A 1QPMA 3TKYA 1YO5C 2STTA 3EETA 3FWEA 3WU1B 2MC3A 1KU3A 3PQJA 1IXRC 3TO6A 4O6JA 5L3FA 5K5OA 3CO7C 2PG4A 1FY7A 2YSRA 5K5QA 3WTXC 4XLNF 5HLIA 2DU9A 1B59A 5LGTA 3K1PA 5CVUA 4OMZA 3MWMA 1KU9A 1HW1A 2EFNA 1ZRFA 1EH8A 3TDUC 2LF8A 3LQRA 3BJAA 4U0VA 2NS0A 4RGXA 2V1DA 3HRUA 2BGCA 4ZZLA 5K1YA 4MTEA 4ZYHA 3D0SA 2FBIA 5J8FA 1LDDA 4GGGA 3T5XA 1LDKB 3FX3A 4G6DA 3K9TA 3RIRA 2VBXA 3K1MA 1JXSA 4N9HA 2OZ6A 1HKTA 1DP7P 3IKTA 3CUOA 3R4KA 5E17F 2H6CA 2ZKZA 1ZG1A 2KJBA 2STWA 2Z5UA 3RKWA 1IRGA 4EGYA 4M74A 2VC0A 1IN6A 1FYMA 1SD5A 3GFJA 3N4MA 4Q48A 3ULQB 4R79A 2L4MA 2P5VA 1IRFA 2VBYA 3HSFA 1XCVA 3LA2A 2R3SA 5J8CA 4P9FA 1JE8A 3GEZA 2BV6A 1BIAA 5DUKA 5LEKA 4OINF 3WTSC 2O3FA 2E7XA 3KZZA 1BI0A 1W4MA 5AIQA 3MAJA 2P6TA 4UXNA 3AAFA 4RS8A 3J81Z 4IHTA 5ICCA 4KUMA 4UVCA 4N0BA 1IW7F 4Z2YA 3GWZA 3RTRA 2GQQA 3ISPA 5CLSA 1WRJA 3SQNA 2H94A 2WC2A 1YS6A 3EQLF 2TDXA 4M9ZA 2V9VA 2D1VA 2K4BA 2EA2A 4PGGA 1HSJA 1YW9A 3I53A 3WODF 3E97A 2EFQA 4YIFA 4OIRF 3OV8A 3MEXA 5LHGA 4O5VA 2JPBA 3J80Z 1S6LA 1YS7A 4L9TA 1OYWA 1BJAA 4RAZA 1T98A 1PP7U 1ZYRF 4A0ZA 2PEXA 2UWMA 1R36A 3R0AA 1YIOA 2LSOA 3N97A 1T0FA 3QP6A 3DPTA 2EFWA 4LLGF 3V8LA 3E6MA 1XDUA 2H27A 2XRNA 4MHGA 2Q0OA 2D2WA 2K7LA 2XKOA 1R5HA 3HUGA 5L3BA 1XDSA 3TOBA 1BC8C 4A0YA 2BYVE 3ZMVA 5LRRA 1QBJA 1R1TA 3GUDA 4HA8A 4ZYDA 2HKXA 3BPXA 2IA2A 2ZXJA 1SFXA 3GO5A 3L09A 1IXCA 3V4GA 4UNOA 2M1BA 5DCMB 3GF2A 4JK1X 1TQMA 1BM9A 4L9VA 4DQ2A 4HF1A 3IWFA 1I1SA 1ZG3A 3O6BB 4ETSA 4ON0A 4S05A 2Q8KA 3MCZA 2JTVA 1YYVA 1RUOA 5D6EA 3ZN1A 1G3SA 4YFNF 1TW3A 3KEOA 2AS5F 1RI7A 3K0LA 4ENJA 4OOIA 5ICEA 2FNAA 3CJNA 2IP2A 1J9IA 3ML6A 1S29A 2ADUA 2YPRA 3L00A 4BHBA 1FLIA 1E17A 3RYRA 3BPVA 3QP5A 4TV7A 2MH9A 2DO7A 1P6RA 2A61A 1R7JA 2MBFA 5TRDA 2RQPA 3VOEA 4A5NA 1KGSA 3R60A 3F8MA 3KP3A 4Y13A 4LB6B 2DQRA 3V8KA 3CTAA 1WSUA 2EK5A 1BOAA 1Y0UA 4YFXF 1ZLKA 5JFRA 2P5KA 3C18A 5KVRA 2YU3A 3TOAA 1O7LA 1I27A 1ZREA 1D8JA 1USSA 1AOYA 1L0OC 2GIVA 3E6BA 3IL2A 5FB2A 4R8HA 4MEXF 4LK1F 1MZBA 3ZMZA 3BP8A 5H6QA 2FMYA 1XSDA 2A68F 1F4KA 1U8RA 4ZH4F 2CO5A 5E8GA 4GYIA 3F21A 2HWVA 2FQ3A 3WG9A 1BI1A 3FM3A 3CUQB 1W7PD 3IKVA 1IN4A 5CVVA 3ERED 5D5VB 2PLYA 1WQ2A 5L3EA 1IZ1A 2P7CB 3E3VA 3F8BA 2DPUA 4L0ZB 3NQOA 1ZLJA 4KMUX 4A6EA 1YTYA 4UVBA 4CICA 2A6EF 4KT5C 2VT2A 1E2XA 3J7AO 3H92A 3COAC 4FX0A 2HS5A 5FFZA 4KA4A 2CG4A 1XSVA 2Y48A 1TTYA 4CHUA 1HW2A 1OMIA 1QZZA 2QWWA 1DUXC 3ECHA 3ZQ7A 3K1NA 5CVJA 3LAPA 1ZARA 3F3XA 4LLLA 1S7AA 4KNYA 4I0BA 5DCFA 2W24A 2VN2A 1SMYF 4LLNA 1U2WA 2EA4A 2KIUA 4XLPF 2D45A 1QZYA 4RGRA 4N9IA 2F5DA 4I01A 1TQPA 1P4AA 1L3LA 3BJOA 2P4WA 3QU3A 1X3UA 5FLXZ 1RNLA 2XAJA 4HQMA 2EFOA 2A07F 3R61A 4Q4ZF 4Y15A 3F72A 5E1XA 4PCQA 3FM5A 2FE3A 2JT1A 2PFBA 3VODA 2VT3A 2OQRA 3IRQA 2Z9OA 3O3KA 2ZMEB 2E1NA 5BPIA 1RUNA 1TNSA 3LWFA 3WGGA 4OIOF 2L54A 4U7DA 3TDZC 3KLNA 2Z99A 3E5QA 4QLCU 3WTVC 4ENNA 1IAWA 4WX9A 4PDKA 5BS6A 2RNJA 2Y75A 1UCRA 2H6BA 4M71A 1UB9A 2RV8A 3BDDA 4KIGA 2BBYA 2HDCA 3ECOA 4I7HA 5J6XA 3MZHA 4EM1A 3LFKA 1SD4A 2EV5A 3TO7A 3C7JA 2IW5A 4MEYF 1HSTA 1EH6A 1GXQA 1JGSA 5CVRA 2P7VB 4I2OA 1IN7A 4ENKA 2P6SA 1V3FA 2WWYA 2ESHA 1J0RA 3JW4A 5FD5A 4AIJA 2ESNA 5LHIA 4WXDA 4M73A 1YLFA 5JR3A 4B8XA 2QBYB 1BI3A 4RGSA 3F6OA 4L0YB 4A6DA 3GZ6A 3I5UA 3NRVA 2RGVA 1REPC 2KIFA 1FYLA 1WI9A 3DQVC 4EJVA 2OQGA 2QUFA 1TNTA 2CGPA 5E1ZB 1FSEA 4KYWA 3JTHA 3KLOA 1J7KA 1FP2A 2PJPA 2ZO4A 2PMUA 4EMSA 2NNYA 1RIOH 2ACJA 3RJPA 2LKPA 2DK8A 4U0YA 1KYWA 2PMHA 3WE2A 2EJRA 5L3CA 5DCMA 4EM2A 4P96A 4ZYEA 4WXHA 2XUBA 1G3TA 4EVIA 5ILSA 2J5OA 1U78A 1W7PB 3DV8A 2IRFG 2KIMA 3U1DA 1T6SA 3ZMTA 4CGZA 2FU4A 2RN7A 3MZYA 4HOBA 4ASNA 3KP5A 3FF5A 1AWCA 4IRIA 4BQAA 2HYGD 3QPTA 1C0WA 3GFLA 1U5TB 2YR2A 3KP4A 2OAZA 2K4JA 4NB5A 1TQIA 4S04A 2CW0F 3W6JB 4ZYGA 2DPDA 3GYHX 2DW4A 2GXGA 3PQKA 2LF7A 1R1VA 3HTUA 2QQ9A 3GZ5A 1HW5A 1ZG5A 5IT9K 4HX7A 2EFPA 2DAOA 1XMKA 4IF4A 2OD5A 5IT9Z 3WU0A 2HGCA 2DT5A 3KEQA 4H0EA 5D5UB 3D5LA 4OIPF 1ZN2A 3HRMA 4Y17A 3MQ0A 2Z33A 5DD4A 4WK8F 1SAXA 3IC7A 1Q1HA 3H3UA 4I0AA 1XCBA 3IHUA 1LDJA 2EB7A 2G9WA 4HYEA 4A5MA 2ISYA 4U0WA 4R1HA 1R23A 1P2FA 2ZNYA 3REOA 2F2EA 3CUQA 3TO9A 3QAHA 5BMZA 2HTJA 2O61A 5DDGA 3P7NA 3BY6A 1SD7A 1QNTA 1W5TA 4AD9A 4LB5A 2ZCWA 1KQ0A 4G9YA 1Z05A 3VB2A 4HV5A 4BH9A 2G7UA 2L4AA 1J75A 5D6FA 2GA1A 3EDPA 2RVCA 5LLQA 3HRSA 2GZWA 2AXLA 5FFXA 4MQVA 4GO1A 4BYYA 3JSOA 4BHPA 2JSCA 6PAXA 2X0LA 4U88A 3CDHA 2D1HA 3T1BA 4EV0A 2VE9A 1KU2A 1YW8A 2A5YB 1XGNA 5FD6A 3LA7A 1DDNA 2VC1A 4MGRA 2HKOA 2VXZA 2B0LA 4UHTA 5BQTA 2UXNA 5HDKA 4KFCA 1Z6TA 1FOKA 5D5XB 2F5EA 5F1RA 4D0PA 5E8IA 3I59B 4ESJA 2FOKA 3C3WA 2FBHA 4G94A 1CF7B 3B73A 3S2WA 4G7HF 1I5ZA 3C1DA 5FO5A 3P9CA 2C6YA 4RAYA 2XV4S 2M45A 2UXXA 2O6GE 1O3QA 1B4AA 1XSXA 1IUYA 4AIKA 1Z1DA 2ZMEA 3LQQA 4DNCA 1ZAOA 4CYDA 2FRHA 1U6GA 5AONA 1OYIA 1FBSA 2DI3A 2V6CA 1ZRDA 2M30A 3WTZA 3FMSA 3FXUA 2NRAC 1PUEE 2PBIA 3FMRA 5ICGA 3I58A 2LDUA 4UUVA 4XBFA 2XIGA 1ON2A 4KIFA 1G3YA 2XVCA 4IXAA 4HQEA 3VEPA 2BEOA 3HTSB 5JHUA 5HOOA 5D4SA 1PP8F 1B9NA 3SZTA 1HBXG 4IPAA 2MH2A 2EWNA 2FF4A 3K69A 4M6XA 2L3DA 3BZ6A 1UFMA 2JPCA 4IHSA 2V79A 1OYYA 2CWEA 1RZ4A 2ETHA 3BROA 1LNWA 5LEJA 2Y0MA 4O3MA 1JHFA 2RDPA 1MD0A 1H9GA 1LVAA 1TLHB 1KQ8A 4FHTA 1MKMA 1FBUA 3HOTA 4HLYA 2QBYA 1FP1D 2DFIA 4LMYA 3LA3A 4HX4A 1ZRCA 1IN8A 2E1CA 2X4HA 4HAMA 5F64A 2DLLA 3I54A 5L3GA 2Q2EA 1P4WA 2O03A 1DPRA 1BC7C 2QLZA 2J5PA 3KP6A 2ZFWA 1T39A 1R22A 1XGSA 3BJ6A 3ABUA 2PQ8A 4RB0A 3RKYA 2VODA 5HS9A 4LG0B 3F23A 1KQ9A 3JSPA 1NHAA 2O0YA 1FBQA 5F6FA 5CJ9A 1MDMB 3ZN0A 1U3EM 1XB4A 1OPCA 4ESFA 3RPUA 4JBAA 1W7PA 2MLKA 2Z3YA 1HKSA 2KKOA 1FC3A 4G7ZF 2A69F 2CFXA 2HQNA 2XHKA 2IT0A 1S3JA 3QOPA 5ICFA 2A6HF 3DEUA 4L5JA 5H6RA 1XMAA 1U5TA 1ZHFA 4KMFA 3WTWC 5HDGA 1Z6RA 2M5WA 2K02A 1GVJA 3GW2A 3E6CC 1STZA 2WV0A 1HXDA 5LBQA 3G3ZA 1SD6A 2V1UA 3KP2A 3LSTA 4OU0A 2P8TA 1HKQA 1TBXA 3KP7A 2QYOA 3HIFA 5KK1A 4A0XA 3PFIA 3JAMK 4G8XA 4OMYA 5IT3A 1Z7UA 4HDUA 2W57A 4EJOA 3FHZA 1Z91A 5JVTA 1K6OA 2HOEA 2QVOA 2MA3A 2ZBKA 5L3DA 4MNUA 1J2XA 4CZZA 3U9GA 3SZPA 4HX8A 3SFZA 1SFUA 3F22A 2W84A 4KN4X 4KN7X 1BI2A 2R7DA 2GXBA 4EM0B 3M1EA 1R5GA 3DKWA 5JI6A 1H0MA 4WF2A 1BN5A 4P55A 3E5XA 4NHJA 2IA0A 2KJCA 4EJWA 4UV8A 1FZPB 3M7GA 1H9TA 3QU6A 1FYKA 1GHCA 4B09A 2K27A 1S8NA 2XKPA 1G4DA 1FX7A 3O2PE 3T0YA 1IF1A 2IVMA 3TQNA 2K86A 4XSXF 2OA4A 1TW2A 2NYXA 1O3RA 1ZGJA 4P9UA 3IRRA 3GVAA 1KU7A 2RKHA 4I09A 5HDNA 5ED4A 5DYMA 2NAZA 1ONVA 4I98B 5HVQC 2VONA 1BBYA 4BXUA 5K5RA 4HLXA 4AWXB 3CLOA 4G7OF 1MJ9A 1XN7A 4WXCA 1LQ1A 3I59A 1XGMA 2DTRA 3ZP5A 5D5WB 1WWXA 3EYIA 4LGWA 3HYIA 5ERIA 4ESBA 1CF7A 1B9MA 4K2EA 4KDPA 2VOOA 3FZVA 3RDIA 4U7BA 3I4PA 1MJBA 2O8XA 4F7ZA 3DFGA 4HZFA 3DXJF 2ISZA 3DF8A 4NQWA 5TJJA 3J81K 2IPQX 4EJTA 5E20A 1I6XA 1ULYA 4HV6A 3ZMUA 1G3WA 3T8RA 2VOPA 2DK5A 4Q47A 2PI0A 3L2CA 2QQBA 1LB2A 4LD5A 4RB1A 3TGNA 3ZMDA 3B02A 4IRGA 1D3YA 3SHFA 2H09A 4HW0A 3V7SA 1P92A 4LK0F 3GFIA 3WTUC 2F5CA 2IA1A 5D4RA 2L01A 4ZZDA 5LGNA 4UV9A 4MQ9F 2JRTA 2LNBA 3J80K 3IWZA 5AIPA 1MGTA 5LGUA 4L18B 4I02A 1D8KA 4QWQA 2VBZA 2ZNZA 3CUQC 1I1GA 2UZKA 2FEZA 1K78A 2M8EA 4AIHA 5EEHA 5E1WA 2FNPA 4A12A 5D8LB 3V7CA 3V8JA 3Q5FA 3GFMA 3HRTA 3RYPA 2G7HA 5ILVA 3ZPLA 1V4RA 3I71A 1Z9CA 4JQFA 4XRFA 2HQRA 1F1ZA 3ROUA 4HF0A 5DV5A 4XSZF 2WTEA 1S7OA 5DEQA 3WGIA 1T2KA 3WTTC 4KIBA 2KRFA 4M6YA 2ELHA 3P9IA 1LEBA 5A2QK 4G6QA 4LG0A
chains in the Genus database with same CATH superfamily
5IYCJ 4L9JA 1UZCA 2X6YA 1MBJA 2GWRA 2XGXA 1QQIA 2R5YA 2E2IJ 2HEOA 3KX2A 4FTHA 1MDMA 4CXFA 1BIBA 5A2QZ 4D5FA 1ODDA 2M7AA 3NEUA 5HLHA 3M8EA 2CYYA 3OYFA 2DA6A 4JOMA 1IN5A 1R58A 3F8FA 1O3TA 2L7FP 2V26A 3HHHA 4XONA 3M8FA 2L02A 5FKMA 4BHCA 1T38A 2XAGA 3FMQA 1UHMA 1HQCA 3W6KB 4HNUA 3GTMJ 2R4GA 2R5ZB 3G73A 3H3VK 1LFBA 1YG2A 2XAHA 2UV1A 4BAYA 4HBLA 4UVAA 1EH7A 1G6NA 4PJLA 2XGEA 3KFWX 4ZYAA 4FX4A 3BG3A 5H20A 1ACIA 1K4TA 5GAEJ 1XGOA 1A04A 3G6EI 2CQKA 2OBPA 1I3AA 1X58A 4OIQF 2QCOA 3KETA 4C30A 1OCRH 2ELJA 1CGPA 2DN0A 3KE2A 2HDDA 5FJ8J 4M72A 2OZUA 5JHFA 5EZHA 2XASA 3Q9SA 3HOYJ 2EZLA 3AG2H 2NNNA 4Q5SF 4I76A 3S15J 4M6VA 2NVQJ 1YJNI 5E79C 1J5YA 4XICA 2R7ZJ 4L9NA 3R6SA 4WWCA 2KL4A 3M8JA 4FASD 2RC4A 3DTKA 2NVTJ 1JTYA 3BR6A 3VWBA 2FA5A 3BWGA 5FRNA 1DPUA 4FT8A 2R7FA 1XS9A 3IAM2 3V7RA 4PGHA 3FXQA 1HOMA 2DBBA 3F8NA 4GCVA 3VYTB 1XD7A 1K7AA 3OOPA 1SFOJ 4M9XA 4AU7A 2PN6A 2EV6A 1W36C 3CJTB 1OR7A 3U2RA 3RPQA 5K7HA 1D5VA 2DJIA 3R0JA 1ORKA 3F6VA 1P4XA 3SYTA 4MTDA 5DD8A 1WJAA 4OAYA 3OS2A 2MD0A 1QO0D 4XR6A 3DU5A 4A3CJ 3VSLA 3RQ4A 5C3EJ 4E70A 2QENA 2QZ8A 3BOQA 3ELKA 5F04A 3K7AJ 5HNFA 2R7SA 5EYRA 3HSRA 3JRIA 2W7NA 1R6RA 2HXIA 5C44J 4M9SA 1IXSB 1GXPA 5FKOA 3QPHA 4P5OA 2EPFA 1IGNA 3CJRB 3C2GA 3JRCA 5F0CA 3GTOJ 3JR9A 2XDVA 1X4OA 4GYGA 4RGUA 5HS7A 2IS6A 1O3SA 4X6AJ 3SEZA 3L7WA 2DA4A 4NNJA 2XAFA 2V9PA 4BQOA 1SFEA 2YX7A 3SXYA 1OQYA 1WVRA 4D7NA 4YG2F 1PYVA 3I64A 1W5SA 2P5LC 1FNNA 3DCFA 5EGOA 3T8TA 1K78B 2CSOA 3TL4X 2VKVA 4CDGA 1RR8C 1QA6A 4KISA 1EA3A 3OYJA 3WGHA 2Y0SN 2HZTA 1PUFB 1ZGAA 1MW7A 1KYZA 3H3ZA 1FT9A 1S72I 2GA2A 2QQAA 3P9KA 4YFKF 3K70C 1R71A 2JA2A 4GXOA 3BR3A 1KA8A 1ZR2A 1TL8A 1HCRA 5ILUA 1B6AA 2O5RA 1VQ7I 3WE3A 4C2UA 2WADA 3KYDB 5CKTA 3GX4X 2KZGA 2VJ5A 4MLOA 3LOCA 5J40A 1ZQ3P 1JHHA 2MLGA 3KZIC 5BOXA 1N75A 4E7KA 1TWAJ 3HUGB 2JSPA 1QGPA 1SMTA 5CVIA 2BY0A 4EGZA 1GDTA 2VQCA 5EDNA 3CCUI 5F08A 2FSWA 3CMYA 1HDDC 1LEAA 5CYVA 5LRSA 4BBRJ 1XG1A 1T8IA 1YQAA 2R7RA 2EV0A 3ABLH 3E6DA 3EYYA 2YX4A 1HDPA 2BE5F 2Q1ZB 1FPQA 2KQRA 2MD5A 2W25A 3S32A 2M87A 2FBKA 3BC8A 2V1XA 3F8CA 3GXOA 2Y2ZA 3HHGA 5BPDA 9ANTA 4C3IJ 2OU2A 2R7XA 1EF4A 1VFCA 5D8KB 1LFUP 3I0TA 2DXIA 3E0JB 3KCCA 2MG4A 3VFZA 3GZNB 5LHHA 2GAUA 2E35A 1YW7A 3O8GA 3K2ZA 2COMA 3Q9VA 4L5IA 1F5TA 4BNCA 3QODA 3HJEA 5HS8A 2XF5A 2EZKA 2A3SA 2VXDA 4HF2A 1WKMA 2XROA 2X9DA 4RB2C 5FGMA 5DUIA 1X4PA 2KDOA 3CO6C 1JKOC 2F5FA 5LD2C 3FXRA 2VQGA 3RKXA 2HFHA 2QM3A 4LJZF 4AVPA 5FLXK 1F9NA 4KICA 3LAJA 2BY2A 4BY7J 4IO9F 3ABTA 3WTYC 1B1BA 4IVNA 1IV6A 3ZGKA 1E0EA 3J7AY 1QHGA 1U5TC 3LSMA 1MH4A 4IRHA 4WCGA 2JMWA 4PZJA 3FXLA 2EZIA 2CQ7A 3KZYA 2W85A 5EEGA 5E18F 2DODA 1BR2A 3DPLC 2WAQA 4LG3A 2DQLA 3DP7A 4BE1A 1LJ9A 1SVOA 4EQQA 1MJAA 3HOSA 3PNVA 4XOPA 3MFKA 1USTA 1UHWA 2IJLA 3FXKA 1K79A 1FWZA 3E5UA 2BZTA 4MFDA 1V5GA 3RZOJ 1YFHA 1G59A 4XN3A 2E7WA 1PDNC 4RB3C 3LSJA 4CCOA 4IKFA 4HSRA 3RI4A 2AO9A 3L9FA 5JLXA 4YIIA 1EV7A 1NG7A 2MGQA 3QRFF 2BHZA 3ZR8X 3JTGA 1FSHA 2HTSA 1KZHA 1R1UA 2DOEA 1R00A 3HSEA 5IOYA 3HOVJ 1OKRA 1O57A 1O7FA 2LLKA 4HDVA 2VI6A 1VTNC 3FK6A 4ZDPA 3M3YJ 2JZYA 2HYFA 1VNDA 1TWGJ 4XN0A 4KT6A 1DQUA 2H1KA 2FD5A 3PUFA 4ENMA 1ZK8A 2VE8A 4A2UA 1ZH5A 2HR3A 1J59A 5J1UA 4B47A 4IJAA 3PSIA 3IP4B 2JWTA 4G6TB 2FXAA 3C2BA 3GLXA 2M3AA 1NK3P 2X1DA 3M9AA 1ON1A 4LFUA 2VBWA 3EUHC 5C4XJ 3JAMZ 2FMLA 1CQTA 4IQJA 3EUHA 5KAIC 4EJUA 2DMPA 4RBOA 2ZJ2A 1DGRM 5HLGA 3ZMSA 2XAQA 5F0HA 4BE0A 1AHDP 2W48A 4CO8A 1QPMA 3TKYA 4XRMA 1YO5C 2HOSA 2K9LA 2STTA 3HDDA 3EETA 3FWEA 5CPRB 3WU1B 4RAFA 4A3BJ 2MC3A 1KU3A 3PQJA 1IXRC 3GTQJ 1WJEA 1WI3A 3TO6A 4O6JA 1TWCJ 3AL0B 3S2HJ 1Y0NA 3HEFA 5L3FA 1ZTRA 5K5OA 2PG4A 1FY7A 2YSRA 5K5QA 3CO7C 3WTXC 2QGUA 4XLNF 5HLIA 2DU9A 4DIQA 3DLLF 4DOZA 5JLWA 1YX3A 1B59A 5FKKA 4MO7A 5LGTA 3K1PA 4OWRB 2JJ7A 5CVUA 4OMZA 4A3IJ 3MWMA 1KU9A 1JTXA 2IBDA 1HW1A 2EFNA 2O9LA 5TGTA 1ZRFA 1EH8A 3TDUC 1VQ9I 2L9VA 2X1CA 2LF8A 3LQRA 2EINH 3BJAA 4U0VA 5F27A 2NS0A 4AYBN 4RGXA 2IGMA 3ZQHA 2V1DA 4IHWA 2GXAA 2HVRA 2L9SA 3HRUA 1MBHA 2BGCA 3Q3SA 2EZHA 4ZZLA 5K1YA 1VQOI 3RKQA 1AKHA 3OYEA 4MTEA 5M3FJ 2OCCH 4H4KC 2WAEA 3D0SA 4ZYHA 2FBIA 5J8FA 3QPLA 1LDDA 4Y7NJ 4GGGA 3T5XA 3E1SA 1LDKB 3FX3A 3TW7A 2ZSHB 3U21A 4G6DA 1T95A 3K9TA 3RIRA 3F9KA 4AVZA 2VBXA 3K1MA 2XSDC 1JXSA 2YU9J 4N9HA 2OZ6A 3WHCA 1HKTA 4ZC3A 1DP7P 3OR1C 3IKTA 3CUOA 3X2QH 3R4KA 5E17F 2H6CA 2ZKZA 5E3OA 2E1OA 2L5QA 3QOEA 1ZG1A 2COBA 2KJBA 2STWA 4I6ZA 2Z5UA 3RKWA 1ETOA 1IRGA 4XOTA 3D5SC 4EGYA 3DEEA 4M74A 2VC0A 3OYAA 1SEUA 2QF7A 2R5ZA 2WV1A 3CJQB 1IN6A 1D0ZA 1MBKA 4JX4A 1SD5A 3GFJA 2PX9A 4BJTA 3OYHA 5GP9A 4B44A 3N4MA 2DFEA 4Q48A 4A3JJ 3ULQB 1Z3XA 2ME6A 2L4MA 2P5VA 4R79A 1IRFA 4BACA 2VBYA 3L2WA 2XB5A 3HSFA 3HB9A 1RKWA 3M1CA 1XCVA 1VI0A 1IV8A 3LA2A 3BQZA 2R3SA 5J8CA 4P9FA 1UAAA 1JE8A 3IV5A 4HSTA 3KYLA 2WY7Q 3GEZA 1DU0A 2BV6A 1SAUA 5HODA 1BIAA 4B4CA 5DUKA 3QYBA 2CQNA 5LEKA 2DYRH 4OINF 3WTSC 2O3FA 2R7UA 2E7XA 2ZC2A 3A01B 3KZZA 1BI0A 1W4MA 1K83J 2MC4A 1EJ9A 3A02A 5AIQA 3MAJA 4Y52J 2PMZN 1RC9A 2P6TA 4UXNA 1FMVA 3AAFA 3OWTA 3CESA 4RS8A 4XLCA 5CQGA 3J81Z 4CCKA 4IHTA 3W3CA 3LL7A 5ICCA 2OPTA 2GBYA 1K61A 5E3NA 2LY9A 1S7EA 4KUMA 4UVCA 5FKNA 2HYJA 4N0BA 4C9YA 1IW7F 2DJNA 5IYBJ 2NVYJ 4Z2YA 4XRSA 3GWZA 3RTRA 4CCLA 2GQQA 1X1AA 4A93J 3RCOA 2VKDA 3ISPA 5CLSA 5HLTA 1WRJA 3SQNA 5J1RA 2H94A 1NG6A 1VQMI 1R4MB 1I50J 2WC2A 1YS6A 3EQLF 2TDXA 4M9ZA 2V9VA 2D1VA 2K4BA 2EA2A 2IS2A 4D1QA 5J3LA 4PGGA 3A1YA 3I56I 1HSJA 2MABA 4ZTJA 1YW9A 3S14J 3I53A 3WODF 2WA0A 3E97A 2EFQA 4YIFA 4D9JA 3OYBA 4OIRF 2R92J 4CZCA 3OV8A 3MEXA 2Y9YA 5LHGA 2P81A 4FQGA 4O5VA 1GVDA 1KONA 2JPBA 2K9MA 3J80Z 2CRGA 1UG2A 1BA5A 3FBNB 1S6LA 2CW8A 1YS7A 3DU6A 3IAS2 1OYWA 4L9TA 1BJAA 4RAZA 1T98A 2L9RA 5C4JJ 1PP7U 1ZYRF 4A0ZA 2I8DA 4E7SA 2PEXA 2UWMA 3CCRI 2LBFB 1PUFA 3FBIB 4B3AA 1R36A 1T0FC 3R0AA 1YIOA 2LSOA 4RA2A 2L7ZA 3L1PA 3N97A 1T0FA 4ZDLA 2LYCA 3B6CA 3QP6A 3MKWB 3CC4I 3DPTA 3CDLA 2EFWA 2V1NA 4LLGF 3V8LA 1U9OA 3E6MA 1FMWA 3A0HC 1XDUA 4BUPA 4HRIA 4BE2A 1WJBA 2TRTA 4DJAA 1W0UA 3VYUB 4RLQA 2H27A 2JK3A 2XRNA 4MHGA 2Q0OA 2D2WA 2YS9A 2K7LA 2XKOA 1R5HA 2HXOA 1OCPA 2IGKA 1LE8B 3HUGA 5GTHC 5L3BA 1APLC 2HVQA 4W1UA 5FKLA 1XDSA 3TOBA 1BC8C 4A0YA 2BYVE 3ZMVA 5LRRA 4DZPA 1QBJA 3K4KA 2DOAA 2VLAA 1R1TA 4XLEA 1OISA 3GUDA 3HOZJ 4HA8A 4ZYDA 2HKXA 3CCQI 1A31A 3BPXA 2IA2A 2ZXJA 2HI3A 2F4OB 1SFXA 2Y69H 3GO5A 3IH4A 2MSYA 3L09A 2X51A 3BG5A 5J1YA 1IXCA 1V54H 2M4GA 3V4GA 4UNOA 2H8WA 2M1BA 1F43A 3IH3A 5DCMB 3GF2A 3QWLA 1WZ2A 2IAIA 4JK1X 5B5EC 1TQMA 1BM9A 2CH0A 3HC7A 3DBRB 4L9VA 4NC7A 4DQ2A 3L2QA 4HF1A 1F36A 3IWFA 1VQPI 1I1SA 1D0YA 1ZG3A 4F92B 3O6BB 1JKPC 4ETSA 1LKXA 3CF5F 1X2NA 4ON0A 4S05A 2Q8KA 3MCZA 5CQEA 1W36D 2JTVA 1YYVA 1GUUA 1OCTC 1RUOA 4FCYA 5D6EA 3I4MJ 1IRZA 3ZN1A 3S3OA 3DLAA 1Y39A 3S2DJ 3KEYA 3FKIJ 1G3SA 4YFNF 1TW3A 3KEOA 2AS5F 1RI7A 5FRMA 3K0LA 3LSIA 4ENJA 4OOIA 3K4MA 2KMUA 2FNAA 5ICEA 5JVGF 2JN6A 3A4CA 3CJNA 2IP2A 4ZJZA 2M34A 3ML6A 1J9IA 1S29A 2ADUA 2YPRA 3L00A 5KNLA 2QQ8A 4BHBA 2R93J 2CS3A 4M3FA 1FLIA 1E17A 3RYRA 1P7IA 3BPVA 3FDYA 3QP5A 4XL9A 1Y1WJ 1RESA 3D5RC 3W6VA 4TV7A 2VJIA 1TT5B 2MH9A 2ZJPF 2DO7A 2FUG2 1OCCH 1P6RA 4F55A 2A61A 1R7JA 3ASNH 2MBFA 5TRDA 3O8HA 2JVGA 3NWTA 4RM3A 2RQPA 3LSHA 3VOEA 1G2HA 1OR7C 3H5AA 1Z7LA 1KGSA 4A5NA 2MFZA 3R60A 4LIUA 1UHSA 5TISC 3F8MA 3KP3A 3SDGA 1ENHA 4Y13A 4LB6B 3Q0VA 2DQRA 2LVSA 3V8KA 3BZKA 3CTAA 1WSUA 2EK5A 5F1JA 1RKTA 3K70D 5BNGA 2HOTA 1BOAA 2VKHA 1Y0UA 3HOWJ 3A0BC 2WB1A 1OFCX 4YFXF 1ZLKA 5JFRA 2P5KA 3C18A 5KVRA 2VUMJ 1ETVA 2CUFA 2X48A 2ICWG 2AXTC 2YU3A 3TOAA 4CCJA 2WBMA 4N4OB 4Z6YA 3G2BA 1O7LA 4BEHB 1UMQA 3HGGA 1I27A 1ZREA 3QYEA 1D8JA 1USSA 4XIDA 1AOYA 1L0OC 3PL8A 2ECBA 3OYLA 5DS9A 1S9HA 2GIVA 2R0QC 3E6BA 1NH3A 2O8KA 2PJRB 3K4CA 3IL2A 4S0HB 4M3BA 5FB2A 4R8HA 4IHYA 4XNFA 4MEXF 4LK1F 3S1NJ 1MZBA 3G1MA 4L5EA 2HU9A 3ZMZA 3BP8A 4LOCA 5H6QA 5IP7J 2FMYA 1XSDA 1VQLI 2DFHA 2A68F 3OSFA 1F4KA 1U8RA 4ZH4F 1PJRA 2CO5A 5E8GA 4GYIA 4II3A 3F21A 2HWVA 2OCEA 3RPUD 2FQ3A 3WG9A 1T33A 1BI1A 3FM3A 3CUQB 1W7PD 3IKVA 1IN4A 5CVVA 1FIAA 4ITVA 3G1OA 1MMGA 3ERED 5D5VB 1NK2P 3CD6I 1YITI 5H2FC 2PLYA 1WQ2A 5L3EA 1IZ1A 1Z0XA 2P7CB 4ZDOA 1W1WE 3E3VA 4A3FJ 3F8BA 1HF0A 2DPUA 4L0ZB 3NQOA 4UB8C 3TMOA 1ZLJA 3MMYB 4KMUX 4A6EA 1YTYA 1FIPA 1IDYA 4UVBA 4HNVA 4CICA 5IP9J 2RAEA 4DGWB 2A6EF 3ERMA 3LNQA 1N78A 4KT5C 2VT2A 1E2XA 3J7AO 3U1KA 3H92A 3COAC 4A69C 4FX0A 3IUOA 2HS5A 2DTZA 2LRDA 3RZDJ 1W0TA 5FFZA 4KA4A 2CG4A 5M5XJ 1XSVA 2F6CA 1TTYA 1QVTA 2K5CA 2Y48A 4CHUA 1HW2A 1OMIA 1QZZA 2EQRA 2QWWA 3DTIA 1DUXC 3ECHA 3BR1A 4BXFA 2HDWA 3ZQ7A 3K1NA 5CVJA 3LAPA 1VQNI 1ZARA 3F3XA 4LLLA 1S7AA 3BR2A 4JX5A 4KNYA 4XLHA 2M0MA 4I0BA 2G0EA 5EEAA 2KIQA 1MSEC 3AG3H 2W24A 5DCFA 4A3GJ 2VN2A 1SMYF 4LLNA 3OL4A 2Z16A 1U2WA 1X2MA 2DA7A 2EA4A 2KIUA 3BR5A 3HZJA 4ANJA 3GTPJ 1P9QC 4IOCF 2DYSH 4HNTA 4XLPF 2D45A 1QZYA 4RGRA 5DM7F 3V42A 5GPAA 4N9IA 2F5DA 4I01A 1TQPA 1P4AA 3TP3A 5GPCA 1L3LA 3BJOA 2ME0A 3I9V2 2CU7A 1SVMA 2P4WA 3CP8A 4IL6C 4LITA 3QU3A 2ZXHA 1X3UA 3WG7H 3B6AA 4ZTFA 5FLXZ 3WHBA 4IEJA 1RNLA 2XAJA 2GM4A 4HQMA 2EFOA 3CQZJ 2A07F 3CC7I 4PUSA 2R7OA 3MN2A 4HEA2 3R61A 3OYGA 5DM6F 4Q4ZF 2QSGX 2VL8A 4Y15A 3F72A 5E1XA 4PCQA 4BDZA 3A01A 2EBIA 3FM5A 3VPRA 4XRSG 3GTGJ 2FE3A 2JT1A 2PFBA 3VODA 2VT3A 3OY9A 1FOYA 2OQRA 2GOXB 2BVMA 1W5CC 2XPVA 2Y0SA 3IRQA 2Z9OA 3S17J 1DP3A 1XC5A 3O3KA 2ZMEB 5M5WJ 2E1NA 5BPIA 3DBLB 2E5NA 3S8PA 1TNSA 1RUNA 3LWFA 3WGGA 3P5JA 1R5ID 2DFFA 3EUAA 4OIOF 2L54A 1WH7A 5B66C 4U7DA 2K9NA 2Y30A 3S3NA 1MNMC 2XB0X 3CCJI 1X1PA 2CMPA 1R9TJ 3TDZC 3KLNA 1JKRC 1BW6A 3FISA 4F91B 2Z99A 3OYKA 3E5QA 4PSWA 4QLCU 2GIZA 3WTVC 4ENNA 1IAWA 1LUJB 3S93A 4RM2A 4WX9A 4PDKA 3ZQQA 5KHDA 2CUEA 3S1QJ 2LK2A 2YUSA 5BS6A 3EPZA 2XGCA 2RNJA 2Y75A 3ZQGA 1UCRA 2H6BA 3TP0A 4U87A 4M71A 2VPLA 4A3MJ 2LMDA 1UB9A 1U0JA 2RV8A 3BDDA 4KIGA 2UUZA 2BBYA 4Y33A 2VPRA 2HDCA 5B1BH 3ECOA 4I7HA 5J6XA 4V2FA 1Y8QB 3CMEI 2OV7A 3MZHA 4EM1A 3LFKA 2CUZA 3PM1A 4XK4A 1SD4A 2EV5A 2K3PA 3C7JA 3TO7A 2IW5A 3H9GA 4XM3A 1WCMJ 1EKEA 2JA8J 4MEYF 3PFYA 1HSTA 2E36A 3K4JA 3HPGA 5M3MJ 1EH6A 1GXQA 1JGSA 5CVRA 2P7VB 3BG7A 1IC8A 1IN7A 2LBFA 2XF7A 3UNGC 4ENKA 4I2OA 3ZQIA 2P6SA 1V3FA 3HKZN 2WWYA 2ESHA 1J0RA 3JW4A 5FD5A 4AIJA 2ESNA 2HZDA 3OS1A 5LHIA 4WXDA 1MNEA 1ZR4A 1YRNB 1RR7A 2DA1A 2XPWA 4M73A 1YLFA 5JR3A 4B8XA 2QBYB 1IUFA 3RSNA 1U8BA 2V6EA 1BI3A 4RGSA 3F6OA 3D1NI 4L0YB 4GFBA 4A6DA 3GZ6A 3JRHA 3I5UA 2NVXJ 4BXXJ 3NRVA 2RGVA 1REPC 1P7JA 2LH9A 4FETA 4CH7A 2Q2EB 1LE8A 2JUGA 2KIFA 1FYLA 1WI9A 3DQVC 4EJVA 1D1AA 2OQGA 2QA4I 2QUFA 1TNTA 4PJNA 2L2OA 5EZGA 2CGPA 2DOFA 2Y31A 5LFAA 5E1ZB 4BGDA 1FSEA 2ELKA 2L0KA 3W2AA 1BR1A 3JCUC 5GAGJ 4KYWA 3HG9A 3JTHA 3ZQLA 3KLOA 3AL0C 3FXMA 4X1EA 1J7KA 1FP2A 2ZXIA 3PSFA 2PJPA 2ZO4A 3K10A 4IOAF 2IEKA 2PMUA 4EMSA 2NNYA 1RIOH 2ACJA 1QHHD 3RJPA 3ZCOA 2LKPA 1RETA 2EIKH 2DK8A 4NC8A 4U0YA 1KYWA 1QRYA 2PMHA 3WE2A 2EJRA 5L3CA 1WFXA 5DCMA 2M4KA 3J7YJ 5J4YA 1WJ5A 4PK4A 4EM2A 5FLVA 1D1BA 1BJZA 3HXLA 2FQ4A 2KPMA 4P96A 4ZYEA 4WXHA 2IGNA 1BR4A 1ERDA 2XUBA 1G3TA 4KJZA 3BG9A 2NOGA 4PJ0C 5ILSA 4EVIA 2J5OA 1U78A 2N8GA 1QU3A 1W7PB 3SFIA 3MZ8A 3DV8A 3OYDA 2IRFG 2KRCA 2KIMA 4MFEA 3U1DA 1T6SA 2EH3A 3ZQFA 3ZMTA 4CGZA 1Y6IA 2IGOA 2FU4A 2O7OA 2RN7A 2H8RA 2DDBA 2OTLI 3MZYA 5IOZA 4HOBA 4ASNA 3KP5A 4DYRA 3FF5A 1AWCA 1B8IB 4IRIA 4BQAA 1NTCA 2L9NA 2HYGD 4UUSA 2WAFA 3QPTA 3GTLJ 3GTJJ 2E71A 3ZRGA 4AC0A 3GFLA 1C0WA 1U5TB 3DEWA 2YR2A 3KP4A 2A6TA 1B72B 2OAZA 1VF9A 2K4JA 1JKQC 4NB5A 1TQIA 4BQQA 4S04A 2CW0F 3W6JB 4ZYGA 2CV1A 2W1OA 2DPDA 1YIJI 2R7WA 3GYHX 2DW4A 3PO3J 5HNHA 5IY5H 2GXGA 3PQKA 3HL2A 3PNTA 3DPUA 2LF7A 1R1VA 3CMMA 3HTUA 3HKZA 2QQ9A 5B1AH 3GZ5A 3G1LA 1HW5A 4D5CA 3OYIA 1ZG5A 1T56A 2IS1A 5IT9K 2OUMA 1A6IA 2W82A 4AYBA 3CCEI 2CFOA 3OYMA 2VJJA 3I55I 4DW6A 2RQQA 3H9JA 4M3GA 2HOAA 2BOLA 3MD2A 1XTAA 4HX7A 2EFPA 1LVKA 4XMYA 4E7ZA 4OAZA 3CCVI 3VSKA 2DAOA 3TEDA 1XMKA 4C3JJ 1QZEA 4YEJA 4IF4A 2OD5A 2ZXWH 2K9QA 3WU0A 3ZQCA 2HGCA 2KHMA 2DT5A 2NXNB 2K9SA 3KEQA 5IT9Z 2E60A 4H0EA 3ZXSA 5D5UB 3D5LA 4Y4RA 4OIPF 1ZN2A 4BEHA 3HRMA 4Y17A 2QKMB 2HVSA 3MQ0A 3HPHA 2A5WA 1FOXA 3I3LA 5EF6A 2Z33A 5DD4A 2PJRA 4WK8F 3GMEA 2CQQA 1SAXA 5B3SH 1A6QA 2R7VA 3IC7A 1Q1HA 1X1DA 3H3UA 4I0AA 3BCAA 3HOXJ 1XCBA 3IHUA 1LDJA 1VQ4I 3H35A 2DA2A 2EB7A 2G9WA 3MVPA 1TWHJ 3PUBA 4HYEA 4A5MA 2R7QA 5M5YJ 2ISYA 3BLYA 4JP0A 2R7TA 3FXOA 4R1HA 4U0WA 1R23A 1XMXA 1P2FA 1VQ5I 1D0XA 1X1BA 2ZNYA 3REOA 4J00A 4IHXA 2F2EA 5E3MA 3CUQA 3TO9A 2LR8A 3QAHA 2HQAA 4YRVA 1SC7A 2MYSA 5BMZA 1QPIA 2HTJA 2O61A 5DDGA 2WY8Q 3TBIA 4II2A 1LPQA 3P7NA 3ONQA 4DYQA 3BY6A 2Z2SB 1JI8A 1SD7A 2LD5A 1QNTA 3OR2C 1MSFC 2F4IA 3CZ6A 1FTTA 1W5TA 2F4MB 4AD9A 4LB5A 2ZCWA 2NS8A 1KQ0A 4G9YA 4NBQA 1Z05A 3VB2A 4LIVA 1A35A 1TP4A 2M9HA 2NVUB 4HV5A 1MNDA 4BH9A 2G7UA 1FJLA 2L4AA 3K4NA 1J75A 2JA5J 4M3EA 2JQ7A 5EG0B 1PVEA 5D6FA 2GA1A 1GLNA 3FIWA 4DBRA 3H5NA 3S16J 3EDPA 2DMTA 3E7LA 2RVCA 3HRSA 2GZWA 2AXLA 5FFXA 2PMZA 4MQVA 4F52A 5LLQA 4GO1A 4BYYA 1IG7A 4QTRA 3JSOA 4BHPA 2JSCA 6PAXA 2Y9ZA 2X0LA 1V5FA 5J4VA 4U88A 3CDHA 1YJWI 4UUTA 5EJCA 2D1HA 3T1BA 4EV0A 1HC8A 3LSGA 2VE9A 2OJED 1KU2A 1YW8A 3OIPA 2A5YB 4FE4A 1GV5A 2E1MB 1XGNA 2OF7A 5FD6A 3LA7A 4RDUA 1DDNA 2VC1A 4MGRA 1VQ8I 2HKOA 2VXZA 2B0LA 2KZVA 4UHTA 4EATA 2CJJA 5BQTA 2UXNA 2EIMH 3F0CA 5HDKA 4KFCA 1Z6TA 2M8GX 1ETQA 1YOVB 1FOKA 5D5XB 1E3PA 4PFOA 2F5EA 1UG0A 5F1RA 1YX5A 2XAUA 3SDBA 4D0PA 5E8IA 3I59B 1WH5A 2FOKA 1M1EB 4ESJA 3C3WA 1TZLA 2ZSIB 2V7FA 1ZELA 4JYKA 2FBHA 3C2HA 1LFPA 1R4NB 3OL3A 4UUSB 4G94A 4C2TA 3OMYA 1CF7B 2KP6A 3B73A 1H88C 2DDAA 3S2WA 4G7HF 1I5ZA 3C1DA 4UB6C 2HQ5A 3ZOBA 5FO5A 2NOJB 2W4SA 3P9CA 2C6YA 4RAYA 1GV2A 2XV4S 4XQFA 4MIMA 2M45A 2UXXA 1I3QJ 2O6GE 1WJDA 1O3QA 1B4AA 2L7MP 5J47A 1XSXA 4NQWB 1IUYA 3BTCA 4AIKA 2ZMEC 1Z1DA 2ZMEA 3OSGA 3LQQA 4DNCA 2BW3B 1ZAOA 4CYDA 2FRHA 1U6GA 5AONA 2W00A 3BQYA 1OYIA 2VKEA 1FBSA 4P1WA 2XPUA 1RPWA 2DI3A 3GBGA 2V6CA 1ZRDA 1POGA 2M30A 4V19K 1X3WB 4XLAA 3WTZA 4F3QA 3HOUJ 1UELB 3FMSA 2X6OA 3FXUA 2NRAC 2IS4A 3OOUA 1PUEE 3K2AA 1K4SA 2PBIA 2X6XA 3CCSI 3FMRA 5ICGA 3I58A 2DMNA 2LDUA 4UUVA 4XBFA 2XIGA 1ON2A 1S5LC 4KIFA 1G3YA 2XVCA 4IXAA 4HQEA 3VEPA 2LY2A 3BR0A 3BTIA 2BEOA 2VQLA 3H1CA 1AU7A 3HTSB 3PJRA 5JHUA 5HOOA 5D4SA 1PP8F 2I10A 3QPSA 1B9NA 1FEXA 3SZTA 4DYCA 2GOMA 1JGGA 4Y3OA 1HBXG 4JX6A 4IPAA 3GLLA 4BDYA 2MH2A 1IJWC 3BTJA 2CV0A 2RREA 1J09A 2EWNA 2DMQA 2FF4A 3K69A 4EEFG 4M6XA 4ABZA 1ETKA 1DGWY 2L3DA 3BZ6A 2DMUA 1UFMA 4V2GA 2JPCA 4IHSA 2V79A 1OYYA 2CWEA 4BJ6C 2FX0A 2BXYA 2JVHA 2HPIA 2Z1DA 1RZ4A 2WAQN 2ZB9A 2ETHA 2CV2A 2BY3A 3BROA 1LNWA 5LEJA 3JRDA 2Y0MA 4O3MA 1JHFA 2RDPA 1MD0A 1H9GA 1LVAA 1TLHB 1KQ8A 4GDFA 1N77A 4FHTA 1MKMA 3Q0UA 4FE7A 4D7MA 1GT0C 1FBUA 1FYMA 2FOWA 3KPHA 2KRHA 1E3OC 1YRNA 3BTLA 3HOTA 4HLYA 2QBYA 1A36A 1FP1D 2DFIA 4LMYA 5GADJ 3LA3A 4HX4A 1ZRCA 1IN8A 2E1CA 1BOBA 1OCOH 3MKYB 2X4HA 4HAMA 5F64A 2P0WA 2DLLA 3I54A 4XKVA 5L3GA 2Q2EA 1P4WA 1H89C 4BU2A 2XC7A 2O03A 2VIXA 2ZFUA 1DPRA 2ZJRF 1YE9A 1SVLA 1I6HJ 2B7EA 1BC7C 2HNHA 2QLZA 2VQHA 2J5PA 3KP6A 2ZFWA 1T39A 4FISA 1R22A 1XGSA 2AQEA 3CCYA 2NS7A 3CP2A 3BJ6A 3N05A 4PJMA 4CYCB 1RRJA 4B43A 3ABUA 2PQ8A 4RB0A 1JUPA 3RKYA 4XLFA 2VODA 1WGXA 2CW7A 1OLTA 3HBLA 5HS9A 4IZZA 3VYRB 4LG0B 1WJFA 1Z67A 3BT9A 3F23A 1KQ9A 2A05A 3QQAA 3JSPA 4IX7A 1NHAA 2O0YA 4NUBA 3PIPF 4N4NB 1FBQA 2LKSA 5F6FA 1ETWA 1MIJA 2R5YB 5CJ9A 1MDMB 1IRXA 1MMDA 2AQFA 3OYNA 3ZN0A 1U3EM 1XB4A 1OPCA 3CF2A 4ESFA 3RPUA 2DT7B 4JBAA 4QPQA 1W7PA 1VZ0A 1K6YA 3S1RJ 2MLKA 2Z3YA 2F48A 1HKSA 2KKOA 1U9NA 1FC3A 3UR3C 4G7ZF 1Q1VA 4IHVA 2A69F 2CFXA 2HQNA 3EUKL 2E19A 3AKZA 4UY8I 2RNGA 3ESWB 2XHKA 2IT0A 1HLVA 2ECCA 1S3JA 4IQ4A 3QOPA 5ICFA 3ABKH 1BL0A 1B8IA 2A6HF 1YI2I 1YHQI 2VASA 3LSKA 2E2HJ 3DEUA 4L5JA 4A3LJ 5H6RA 1XMAA 1ZKGA 5FROA 5IP6A 1U5TA 1ZHFA 4KITB 4KMFA 1B72A 3NAUA 2JRMA 3WTWC 3W2VA 5HDGA 1Z6RA 3FKJA 2M5WA 2K02A 3DKXA 1E3HA 2V9KA 2LKXA 1GVJA 3GW2A 3KYCB 3E6CC 1STZA 2WV0A 1HXDA 2QKLB 5LBQA 1V5EA 4E7LA 3G3ZA 1D1CA 1SD6A 4GRIA 2V1UA 4BKXA 4BL0B 2X1EA 2X85A 3KP2A 3LSTA 4OU0A 4XKWA 2X6WA 2P8TA 1HKQA 2TCTA 1A5JA 1TBXA 3A03A 3KP7A 2QYOA 2FJ1A 3HIFA 4HPQA 5KK1A 1Z3YA 3GCMA 1MBGA 4A0XA 4CSWA 3S3MA 3PFIA 1JJ6C 3JAMK 4QIWN 4G8XA 3L2VA 4OMYA 5IT3A 1Z7UA 4HDUA 2VJ4A 3W2WA 2W57A 1G8XA 4RMNA 4EJOA 3VYSB 3FHZA 1SANA 3JRFA 2ZJQF 1JUMA 3JRGA 1Z91A 5JVTA 1K6OA 2HOEA 2QVOA 2MA3A 2KT0A 1UJ8A 3G71I 2ZBKA 5L3DA 4MNUA 3WU2C 1J2XA 4CZZA 2JA6J 3U9GA 3SZPA 3CMAI 1JUSA 4HX8A 3SFZA 5KCMA 1SFUA 3F22A 2GLOA 4A3DJ 2W84A 4QPOA 4KN4X 4A3KJ 4KN7X 2JUCA 1BI2A 2R7DA 3VDXA 5FLMJ 1R49A 1OJLA 3LSRA 1SFKA 2GXBA 1ETYA 4EM0B 5EGOB 3M1EA 2BHYA 1R5GA 3DKWA 1MMAA 4YELA 3M4OJ 5JI6A 1H0MA 1BN5A 4WF2A 4E4HA 1IDZA 5GAHJ 2EILH 4P55A 3E5XA 4E7JA 4NHJA 2IA0A 1YJ9I 2KJCA 2M7BA 4EJWA 4UV8A 3AFHA 3S1MJ 2KFDA 3LMMA 4B48A 1FZPB 3M7GA 1H9TA 3QU6A 1FYKA 1GHCA 4B09A 2K27A 3Q0WA 3PIOF 3KIOA 2CUJA 3H5RA 3SJMA 1S8NA 2XKPA 1G4DA 1FX7A 4W97A 3O2PE 2VB6A 3T0YA 2BY1A 2IVMA 1IF1A 2MW8A 3TQNA 2K86A 3MKZA 5EG0A 4XSXF 2OA4A 1TW2A 2NYXA 1O3RA 5KAFC 3G4SI 1ZGJA 3DKYA 3HM5A 2EIJH 4P9UA 3IRRA 1Y56A 1D5YA 3GVAA 3K4BA 4BJ5C 1KU7A 3PNYA 2RKHA 4I09A 5HDNA 1MMNA 5ED4A 2I5UA 5DYMA 2NAZA 1ONVA 4HG2A 1JT0A 1MMSA 3AG4H 2E1MC 4I98B 5HVQC 1MBEA 4XORA 4DBQA 3DWLE 4M3DA 3SZGA 2CQXA 1X19A 2VONA 1BBYA 4BXUA 2K85A 5IYDJ 5K5RA 4HLXA 4AWXB 4CUGA 3CLOA 3L2UA 3LFUA 4G7OF 4BQNA 1MJ9A 1XN7A 4B3XA 4WXCA 4B1RA 2LTPA 1LQ1A 2E34A 3L2RA 2LOOA 2KLOA 3I59A 3MKLA 1XGMA 2IXSA 2F5VA 2DTRA 1X3ZB 3K6GA 2QEXI 3ZP5A 1ZGWA 2LC2A 2LG4A 4CA0A 3PO2J 4G12A 5D5WB 3TW6A 3ABMH 1WWXA 3EYIA 2E5ZA 1T08B 1TWFJ 3HYIA 4LGWA 2QSHX 5GTIC 5ERIA 4ESBA 3BG6A 3OYCA 1CF7A 1B9MA 2L7KA 4K2EA 4AM3A 4KDPA 2VOOA 3FZVA 3RDIA 2D5VA 1VQKI 1WJCA 4RLFA 4U7BA 3A2KA 3JREA 3I4PA 4DZJA 1MJBA 1VQ6I 1BW5A 2O8XA 4F7ZA 2OTJI 3DFGA 4HZFA 2HPMA 2LFBA 3DXJF 2ISZA 1DU6A 3DF8A 1V55H 4XKBA 4NQWA 3RQIA 1TT0A 3J7ZI 2XRLA 5TJJA 3J81K 2ID6A 4J01A 2IPQX 2BW3A 3FHNA 3FXJA 4EJTA 3SEQA 5E20A 1I6XA 5IPAA 1Z21A 2M2EA 4X0GA 1ULYA 2LY1A 3QYFA 2BXZA 3IH2A 2DA5A 2V4JC 4HV6A 1ITYA 3CLQA 1FTZA 3CC2I 3ZMUA 1H8AC 1G3WA 2H1LA 3T8RA 2E2JJ 2DK5A 2VOPA 4Q47A 2PI0A 3L2CA 2QQBA 1I39A 3ASOH 3I4NJ 1LB2A 2OC6A 4LD5A 3TGNA 3ZMDA 4RB1A 3OIQA 1O4XA 3B02A 2XSJC 4IRGA 5K7FA 3H0DA 3OIOA 1D3YA 3SHFA 2AHQA 2H09A 3FK7A 4PSXA 4HW0A 3V7SA 1P92A 3NARA 4BS9A 4LK0F 3GFIA 3UKGA 2XF6A 3WTUC 2F5CA 4XKCA 2IA1A 4I99C 1MBFA 5K7ZA 5D4RA 2L01A 4ZZDA 5LGNA 4UV9A 4MQ9F 4AUXA 2JRTA 2LNBA 3H36A 2M0CA 3J80K 3IWZA 1N25A 5AIPA 4CCMA 3CCLI 1MGTA 1WHUA 5LGUA 4J19A 3NWSA 4L18B 4I02A 4E6KG 1JT6A 3JRBA 1JJ8C 5DTDA 1D8KA 4QWQA 2VBZA 2ZNZA 4NC6A 3CUQC 1MH3A 3BCBA 2KISA 1I1GA 1OCZH 1Y8RB 1Z77A 2UZKA 4PJJA 2K40A 2FEZA 4CCNA 1ETXA 3DTEA 4QSHA 5F0FA 4E7HA 1K78A 1TC3C 4AIDA 2M8EA 2B63J 4AIHA 1XX5A 5E3LA 2LP0A 5EEHA 2JA7J 5E1WA 4F93B 4NDLA 4RAGA 1WPKA 2FNPA 4YIRX 4A12A 5D8LB 3V7CA 3V8JA 3Q5FA 3GFMA 3HRTA 3RYPA 2G7HA 3K4LA 5ILVA 4A3EJ 3ZPLA 2B9SA 1IO2A 3H0GJ 1V4RA 4PFPA 3I71A 1Z9CA 4C3HJ 4JQFA 2K3FA 2LREA 4XRFA 2HQRA 2DT6A 1F1ZA 1FOWA 1Y1VJ 3ROUA 3AG1H 3CDIA 3BZCA 2KDZA 4HF0A 1QVUA 5DV5A 4XSZF 2WTEA 3H9QA 1S7OA 2QSFX 5DEQA 3WGIA 1T2KA 3OS0A 2ID3A 2WB1N 3WTTC 4KIBA 1AKHB 4BBSJ 1HA8A 3CCMI 2KRFA 4M6YA 3JRAA 2ELHA 3P9IA 2BVLA 1LEBA 1AA7A 4C2MJ 3DBHB 4CYCA 3HGYA 3LSPA 4BY1J 5A2QK 4E7IA 1XPXA 3GTKJ 2DA3A 2DCEA 1X1CA 4G6QA 3M07A 4LG0A 2XGDA
chains in the Genus database with same CATH topology
4L9JA 2GWRA 2XGXA 1QQIA 2HEOA 1MDMA 4CXFA 1BIBA 5A2QZ 1ODDA 3NEUA 5HLHA 3M8EA 2CYYA 1IN5A 1R58A 3F8FA 1O3TA 3HHHA 3M8FA 2L02A 4BHCA 1T38A 2XAGA 3FMQA 1UHMA 1HQCA 3W6KB 3G73A 1YG2A 2XAHA 4BAYA 4HBLA 4UVAA 1EH7A 1G6NA 3KFWX 4FX4A 5H20A 1XGOA 1A04A 2CQKA 2OBPA 4OIQF 3KETA 1CGPA 3KE2A 4M72A 2OZUA 2XASA 3Q9SA 2NNNA 4Q5SF 1J5YA 4L9NA 3R6SA 4WWCA 2RC4A 2FA5A 3BWGA 1DPUA 4FT8A 2R7FA 3V7RA 4PGHA 3FXQA 2DBBA 3F8NA 4GCVA 1XD7A 1K7AA 3OOPA 4M9XA 2PN6A 2EV6A 1OR7A 3U2RA 3RPQA 1D5VA 3R0JA 3F6VA 1P4XA 4MTDA 5DD8A 1QO0D 4E70A 2QENA 2QZ8A 3BOQA 3ELKA 3HSRA 4M9SA 1IXSB 1GXPA 3QPHA 4P5OA 4GYGA 4RGUA 5HS7A 1O3SA 3L7WA 2XAFA 1SFEA 2YX7A 3SXYA 4YG2F 3I64A 1W5SA 2P5LC 1FNNA 3T8TA 1K78B 2CSOA 4CDGA 3WGHA 2HZTA 1ZGAA 1KYZA 3H3ZA 1FT9A 2GA2A 2QQAA 3P9KA 4YFKF 4GXOA 1KA8A 5ILUA 1B6AA 3WE3A 3GX4X 1JHHA 2MLGA 5BOXA 1QGPA 1SMTA 5CVIA 4EGZA 2FSWA 1LEAA 5CYVA 5LRSA 1YQAA 2EV0A 3E6DA 3EYYA 2YX4A 2BE5F 1FPQA 2MD5A 2W25A 2M87A 2FBKA 3F8CA 2V1XA 3GXOA 3HHGA 5BPDA 2OU2A 5D8KB 3I0TA 3KCCA 3VFZA 5LHHA 2GAUA 1YW7A 3K2ZA 2COMA 3Q9VA 4L5IA 1F5TA 4BNCA 5HS8A 2A3SA 4HF2A 1WKMA 2XROA 4RB2C 5FGMA 5DUIA 3CO6C 2F5FA 3FXRA 3RKXA 2HFHA 2QM3A 4LJZF 4AVPA 5FLXK 1F9NA 4KICA 3LAJA 3ABTA 3WTYC 1B1BA 4IVNA 1U5TC 4IRHA 4WCGA 4PZJA 3KZYA 2W85A 5EEGA 5E18F 3DPLC 2DQLA 3DP7A 1LJ9A 3HOSA 4EQQA 1MJAA 3MFKA 1USTA 1UHWA 2IJLA 1K79A 1FWZA 3E5UA 1YFHA 2E7WA 1PDNC 4RB3C 3RI4A 3L9FA 4YIIA 1EV7A 3QRFF 3JTGA 1FSHA 2HTSA 1R1UA 1R00A 3HSEA 1OKRA 1O57A 1O7FA 4HDVA 1VTNC 2JZYA 2HYFA 4ENMA 2VE8A 1ZH5A 4A2UA 2HR3A 1J59A 4IJAA 2FXAA 3GLXA 3M9AA 1ON1A 4LFUA 2VBWA 3JAMZ 2FMLA 3EUHA 4EJUA 2ZJ2A 5HLGA 3ZMSA 2XAQA 4CO8A 1QPMA 3TKYA 1YO5C 2STTA 3EETA 3FWEA 3WU1B 2MC3A 1KU3A 3PQJA 1IXRC 3TO6A 4O6JA 5L3FA 5K5OA 3CO7C 2PG4A 1FY7A 2YSRA 5K5QA 3WTXC 4XLNF 5HLIA 2DU9A 1B59A 5LGTA 3K1PA 5CVUA 4OMZA 3MWMA 1KU9A 1HW1A 2EFNA 1ZRFA 1EH8A 3TDUC 2LF8A 3LQRA 3BJAA 4U0VA 2NS0A 4RGXA 2V1DA 3HRUA 2BGCA 4ZZLA 5K1YA 4MTEA 4ZYHA 3D0SA 2FBIA 5J8FA 1LDDA 4GGGA 3T5XA 1LDKB 3FX3A 4G6DA 3K9TA 3RIRA 2VBXA 3K1MA 1JXSA 4N9HA 2OZ6A 1HKTA 1DP7P 3IKTA 3CUOA 3R4KA 5E17F 2H6CA 2ZKZA 1ZG1A 2KJBA 2STWA 2Z5UA 3RKWA 1IRGA 4EGYA 4M74A 2VC0A 1IN6A 1FYMA 1SD5A 3GFJA 3N4MA 4Q48A 3ULQB 4R79A 2L4MA 2P5VA 1IRFA 2VBYA 3HSFA 1XCVA 3LA2A 2R3SA 5J8CA 4P9FA 1JE8A 3GEZA 2BV6A 1BIAA 5DUKA 5LEKA 4OINF 3WTSC 2O3FA 2E7XA 3KZZA 1BI0A 1W4MA 5AIQA 3MAJA 2P6TA 4UXNA 3AAFA 4RS8A 3J81Z 4IHTA 5ICCA 4KUMA 4UVCA 4N0BA 1IW7F 4Z2YA 3GWZA 3RTRA 2GQQA 3ISPA 5CLSA 1WRJA 3SQNA 2H94A 2WC2A 1YS6A 3EQLF 2TDXA 4M9ZA 2V9VA 2D1VA 2K4BA 2EA2A 4PGGA 1HSJA 1YW9A 3I53A 3WODF 3E97A 2EFQA 4YIFA 4OIRF 3OV8A 3MEXA 5LHGA 4O5VA 2JPBA 3J80Z 1S6LA 1YS7A 4L9TA 1OYWA 1BJAA 4RAZA 1T98A 1PP7U 1ZYRF 4A0ZA 2PEXA 2UWMA 1R36A 3R0AA 1YIOA 2LSOA 3N97A 1T0FA 3QP6A 3DPTA 2EFWA 4LLGF 3V8LA 3E6MA 1XDUA 2H27A 2XRNA 4MHGA 2Q0OA 2D2WA 2K7LA 2XKOA 1R5HA 3HUGA 5L3BA 1XDSA 3TOBA 1BC8C 4A0YA 2BYVE 3ZMVA 5LRRA 1QBJA 1R1TA 3GUDA 4HA8A 4ZYDA 2HKXA 3BPXA 2IA2A 2ZXJA 1SFXA 3GO5A 3L09A 1IXCA 3V4GA 4UNOA 2M1BA 5DCMB 3GF2A 4JK1X 1TQMA 1BM9A 4L9VA 4DQ2A 4HF1A 3IWFA 1I1SA 1ZG3A 3O6BB 4ETSA 4ON0A 4S05A 2Q8KA 3MCZA 2JTVA 1YYVA 1RUOA 5D6EA 3ZN1A 1G3SA 4YFNF 1TW3A 3KEOA 2AS5F 1RI7A 3K0LA 4ENJA 4OOIA 5ICEA 2FNAA 3CJNA 2IP2A 1J9IA 3ML6A 1S29A 2ADUA 2YPRA 3L00A 4BHBA 1FLIA 1E17A 3RYRA 3BPVA 3QP5A 4TV7A 2MH9A 2DO7A 1P6RA 2A61A 1R7JA 2MBFA 5TRDA 2RQPA 3VOEA 4A5NA 1KGSA 3R60A 3F8MA 3KP3A 4Y13A 4LB6B 2DQRA 3V8KA 3CTAA 1WSUA 2EK5A 1BOAA 1Y0UA 4YFXF 1ZLKA 5JFRA 2P5KA 3C18A 5KVRA 2YU3A 3TOAA 1O7LA 1I27A 1ZREA 1D8JA 1USSA 1AOYA 1L0OC 2GIVA 3E6BA 3IL2A 5FB2A 4R8HA 4MEXF 4LK1F 1MZBA 3ZMZA 3BP8A 5H6QA 2FMYA 1XSDA 2A68F 1F4KA 1U8RA 4ZH4F 2CO5A 5E8GA 4GYIA 3F21A 2HWVA 2FQ3A 3WG9A 1BI1A 3FM3A 3CUQB 1W7PD 3IKVA 1IN4A 5CVVA 3ERED 5D5VB 2PLYA 1WQ2A 5L3EA 1IZ1A 2P7CB 3E3VA 3F8BA 2DPUA 4L0ZB 3NQOA 1ZLJA 4KMUX 4A6EA 1YTYA 4UVBA 4CICA 2A6EF 4KT5C 2VT2A 1E2XA 3J7AO 3H92A 3COAC 4FX0A 2HS5A 5FFZA 4KA4A 2CG4A 1XSVA 2Y48A 1TTYA 4CHUA 1HW2A 1OMIA 1QZZA 2QWWA 1DUXC 3ECHA 3ZQ7A 3K1NA 5CVJA 3LAPA 1ZARA 3F3XA 4LLLA 1S7AA 4KNYA 4I0BA 5DCFA 2W24A 2VN2A 1SMYF 4LLNA 1U2WA 2EA4A 2KIUA 4XLPF 2D45A 1QZYA 4RGRA 4N9IA 2F5DA 4I01A 1TQPA 1P4AA 1L3LA 3BJOA 2P4WA 3QU3A 1X3UA 5FLXZ 1RNLA 2XAJA 4HQMA 2EFOA 2A07F 3R61A 4Q4ZF 4Y15A 3F72A 5E1XA 4PCQA 3FM5A 2FE3A 2JT1A 2PFBA 3VODA 2VT3A 2OQRA 3IRQA 2Z9OA 3O3KA 2ZMEB 2E1NA 5BPIA 1RUNA 1TNSA 3LWFA 3WGGA 4OIOF 2L54A 4U7DA 3TDZC 3KLNA 2Z99A 3E5QA 4QLCU 3WTVC 4ENNA 1IAWA 4WX9A 4PDKA 5BS6A 2RNJA 2Y75A 1UCRA 2H6BA 4M71A 1UB9A 2RV8A 3BDDA 4KIGA 2BBYA 2HDCA 3ECOA 4I7HA 5J6XA 3MZHA 4EM1A 3LFKA 1SD4A 2EV5A 3TO7A 3C7JA 2IW5A 4MEYF 1HSTA 1EH6A 1GXQA 1JGSA 5CVRA 2P7VB 4I2OA 1IN7A 4ENKA 2P6SA 1V3FA 2WWYA 2ESHA 1J0RA 3JW4A 5FD5A 4AIJA 2ESNA 5LHIA 4WXDA 4M73A 1YLFA 5JR3A 4B8XA 2QBYB 1BI3A 4RGSA 3F6OA 4L0YB 4A6DA 3GZ6A 3I5UA 3NRVA 2RGVA 1REPC 2KIFA 1FYLA 1WI9A 3DQVC 4EJVA 2OQGA 2QUFA 1TNTA 2CGPA 5E1ZB 1FSEA 4KYWA 3JTHA 3KLOA 1J7KA 1FP2A 2PJPA 2ZO4A 2PMUA 4EMSA 2NNYA 1RIOH 2ACJA 3RJPA 2LKPA 2DK8A 4U0YA 1KYWA 2PMHA 3WE2A 2EJRA 5L3CA 5DCMA 4EM2A 4P96A 4ZYEA 4WXHA 2XUBA 1G3TA 4EVIA 5ILSA 2J5OA 1U78A 1W7PB 3DV8A 2IRFG 2KIMA 3U1DA 1T6SA 3ZMTA 4CGZA 2FU4A 2RN7A 3MZYA 4HOBA 4ASNA 3KP5A 3FF5A 1AWCA 4IRIA 4BQAA 2HYGD 3QPTA 1C0WA 3GFLA 1U5TB 2YR2A 3KP4A 2OAZA 2K4JA 4NB5A 1TQIA 4S04A 2CW0F 3W6JB 4ZYGA 2DPDA 3GYHX 2DW4A 2GXGA 3PQKA 2LF7A 1R1VA 3HTUA 2QQ9A 3GZ5A 1HW5A 1ZG5A 5IT9K 4HX7A 2EFPA 2DAOA 1XMKA 4IF4A 2OD5A 5IT9Z 3WU0A 2HGCA 2DT5A 3KEQA 4H0EA 5D5UB 3D5LA 4OIPF 1ZN2A 3HRMA 4Y17A 3MQ0A 2Z33A 5DD4A 4WK8F 1SAXA 3IC7A 1Q1HA 3H3UA 4I0AA 1XCBA 3IHUA 1LDJA 2EB7A 2G9WA 4HYEA 4A5MA 2ISYA 4U0WA 4R1HA 1R23A 1P2FA 2ZNYA 3REOA 2F2EA 3CUQA 3TO9A 3QAHA 5BMZA 2HTJA 2O61A 5DDGA 3P7NA 3BY6A 1SD7A 1QNTA 1W5TA 4AD9A 4LB5A 2ZCWA 1KQ0A 4G9YA 1Z05A 3VB2A 4HV5A 4BH9A 2G7UA 2L4AA 1J75A 5D6FA 2GA1A 3EDPA 2RVCA 5LLQA 3HRSA 2GZWA 2AXLA 5FFXA 4MQVA 4GO1A 4BYYA 3JSOA 4BHPA 2JSCA 6PAXA 2X0LA 4U88A 3CDHA 2D1HA 3T1BA 4EV0A 2VE9A 1KU2A 1YW8A 2A5YB 1XGNA 5FD6A 3LA7A 1DDNA 2VC1A 4MGRA 2HKOA 2VXZA 2B0LA 4UHTA 5BQTA 2UXNA 5HDKA 4KFCA 1Z6TA 1FOKA 5D5XB 2F5EA 5F1RA 4D0PA 5E8IA 3I59B 4ESJA 2FOKA 3C3WA 2FBHA 4G94A 1CF7B 3B73A 3S2WA 4G7HF 1I5ZA 3C1DA 5FO5A 3P9CA 2C6YA 4RAYA 2XV4S 2M45A 2UXXA 2O6GE 1O3QA 1B4AA 1XSXA 1IUYA 4AIKA 1Z1DA 2ZMEA 3LQQA 4DNCA 1ZAOA 4CYDA 2FRHA 1U6GA 5AONA 1OYIA 1FBSA 2DI3A 2V6CA 1ZRDA 2M30A 3WTZA 3FMSA 3FXUA 2NRAC 1PUEE 2PBIA 3FMRA 5ICGA 3I58A 2LDUA 4UUVA 4XBFA 2XIGA 1ON2A 4KIFA 1G3YA 2XVCA 4IXAA 4HQEA 3VEPA 2BEOA 3HTSB 5JHUA 5HOOA 5D4SA 1PP8F 1B9NA 3SZTA 1HBXG 4IPAA 2MH2A 2EWNA 2FF4A 3K69A 4M6XA 2L3DA 3BZ6A 1UFMA 2JPCA 4IHSA 2V79A 1OYYA 2CWEA 1RZ4A 2ETHA 3BROA 1LNWA 5LEJA 2Y0MA 4O3MA 1JHFA 2RDPA 1MD0A 1H9GA 1LVAA 1TLHB 1KQ8A 4FHTA 1MKMA 1FBUA 3HOTA 4HLYA 2QBYA 1FP1D 2DFIA 4LMYA 3LA3A 4HX4A 1ZRCA 1IN8A 2E1CA 2X4HA 4HAMA 5F64A 2DLLA 3I54A 5L3GA 2Q2EA 1P4WA 2O03A 1DPRA 1BC7C 2QLZA 2J5PA 3KP6A 2ZFWA 1T39A 1R22A 1XGSA 3BJ6A 3ABUA 2PQ8A 4RB0A 3RKYA 2VODA 5HS9A 4LG0B 3F23A 1KQ9A 3JSPA 1NHAA 2O0YA 1FBQA 5F6FA 5CJ9A 1MDMB 3ZN0A 1U3EM 1XB4A 1OPCA 4ESFA 3RPUA 4JBAA 1W7PA 2MLKA 2Z3YA 1HKSA 2KKOA 1FC3A 4G7ZF 2A69F 2CFXA 2HQNA 2XHKA 2IT0A 1S3JA 3QOPA 5ICFA 2A6HF 3DEUA 4L5JA 5H6RA 1XMAA 1U5TA 1ZHFA 4KMFA 3WTWC 5HDGA 1Z6RA 2M5WA 2K02A 1GVJA 3GW2A 3E6CC 1STZA 2WV0A 1HXDA 5LBQA 3G3ZA 1SD6A 2V1UA 3KP2A 3LSTA 4OU0A 2P8TA 1HKQA 1TBXA 3KP7A 2QYOA 3HIFA 5KK1A 4A0XA 3PFIA 3JAMK 4G8XA 4OMYA 5IT3A 1Z7UA 4HDUA 2W57A 4EJOA 3FHZA 1Z91A 5JVTA 1K6OA 2HOEA 2QVOA 2MA3A 2ZBKA 5L3DA 4MNUA 1J2XA 4CZZA 3U9GA 3SZPA 4HX8A 3SFZA 1SFUA 3F22A 2W84A 4KN4X 4KN7X 1BI2A 2R7DA 2GXBA 4EM0B 3M1EA 1R5GA 3DKWA 5JI6A 1H0MA 4WF2A 1BN5A 4P55A 3E5XA 4NHJA 2IA0A 2KJCA 4EJWA 4UV8A 1FZPB 3M7GA 1H9TA 3QU6A 1FYKA 1GHCA 4B09A 2K27A 1S8NA 2XKPA 1G4DA 1FX7A 3O2PE 3T0YA 1IF1A 2IVMA 3TQNA 2K86A 4XSXF 2OA4A 1TW2A 2NYXA 1O3RA 1ZGJA 4P9UA 3IRRA 3GVAA 1KU7A 2RKHA 4I09A 5HDNA 5ED4A 5DYMA 2NAZA 1ONVA 4I98B 5HVQC 2VONA 1BBYA 4BXUA 5K5RA 4HLXA 4AWXB 3CLOA 4G7OF 1MJ9A 1XN7A 4WXCA 1LQ1A 3I59A 1XGMA 2DTRA 3ZP5A 5D5WB 1WWXA 3EYIA 4LGWA 3HYIA 5ERIA 4ESBA 1CF7A 1B9MA 4K2EA 4KDPA 2VOOA 3FZVA 3RDIA 4U7BA 3I4PA 1MJBA 2O8XA 4F7ZA 3DFGA 4HZFA 3DXJF 2ISZA 3DF8A 4NQWA 5TJJA 3J81K 2IPQX 4EJTA 5E20A 1I6XA 1ULYA 4HV6A 3ZMUA 1G3WA 3T8RA 2VOPA 2DK5A 4Q47A 2PI0A 3L2CA 2QQBA 1LB2A 4LD5A 4RB1A 3TGNA 3ZMDA 3B02A 4IRGA 1D3YA 3SHFA 2H09A 4HW0A 3V7SA 1P92A 4LK0F 3GFIA 3WTUC 2F5CA 2IA1A 5D4RA 2L01A 4ZZDA 5LGNA 4UV9A 4MQ9F 2JRTA 2LNBA 3J80K 3IWZA 5AIPA 1MGTA 5LGUA 4L18B 4I02A 1D8KA 4QWQA 2VBZA 2ZNZA 3CUQC 1I1GA 2UZKA 2FEZA 1K78A 2M8EA 4AIHA 5EEHA 5E1WA 2FNPA 4A12A 5D8LB 3V7CA 3V8JA 3Q5FA 3GFMA 3HRTA 3RYPA 2G7HA 5ILVA 3ZPLA 1V4RA 3I71A 1Z9CA 4JQFA 4XRFA 2HQRA 1F1ZA 3ROUA 4HF0A 5DV5A 4XSZF 2WTEA 1S7OA 5DEQA 3WGIA 1T2KA 3WTTC 4KIBA 2KRFA 4M6YA 2ELHA 3P9IA 1LEBA 5A2QK 4G6QA 4LG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9J A;  2GWR A;  2XGX A;  1QQI A;  2HEO A;  1MDM A;  4CXF A;  1BIB A;  5A2Q Z;  1ODD A;  3NEU A;  5HLH A;  3M8E A;  2CYY A;  1IN5 A;  1R58 A;  3F8F A;  1O3T A;  3HHH A;  3M8F A;  2L02 A;  4BHC A;  1T38 A;  2XAG A;  3FMQ A;  1UHM A;  1HQC A;  3W6K B;  3G73 A;  1YG2 A;  2XAH A;  4BAY A;  4HBL A;  4UVA A;  1EH7 A;  1G6N A;  3KFW X;  4FX4 A;  5H20 A;  1XGO A;  1A04 A;  2CQK A;  2OBP A;  4OIQ F;  3KET A;  1CGP A;  3KE2 A;  4M72 A;  2OZU A;  2XAS A;  3Q9S A;  2NNN A;  4Q5S F;  1J5Y A;  4L9N A;  3R6S A;  4WWC A;  2RC4 A;  2FA5 A;  3BWG A;  1DPU A;  4FT8 A;  2R7F A;  3V7R A;  4PGH A;  3FXQ A;  2DBB A;  3F8N A;  4GCV A;  1XD7 A;  1K7A A;  3OOP A;  4M9X A;  2PN6 A;  2EV6 A;  1OR7 A;  3U2R A;  3RPQ A;  1D5V A;  3R0J A;  3F6V A;  1P4X A;  4MTD A;  5DD8 A;  1QO0 D;  4E70 A;  2QEN A;  2QZ8 A;  3BOQ A;  3ELK A;  3HSR A;  4M9S A;  1IXS B;  1GXP A;  3QPH A;  4P5O A;  4GYG A;  4RGU A;  5HS7 A;  1O3S A;  3L7W A;  2XAF A;  1SFE A;  2YX7 A;  3SXY A;  4YG2 F;  3I64 A;  1W5S A;  2P5L C;  1FNN A;  3T8T A;  1K78 B;  2CSO A;  4CDG A;  3WGH A;  2HZT A;  1ZGA A;  1KYZ A;  3H3Z A;  1FT9 A;  2GA2 A;  2QQA A;  3P9K A;  4YFK F;  4GXO A;  1KA8 A;  5ILU A;  1B6A A;  3WE3 A;  3GX4 X;  1JHH A;  2MLG A;  5BOX A;  1QGP A;  1SMT A;  5CVI A;  4EGZ A;  2FSW A;  1LEA A;  5CYV A;  5LRS A;  1YQA A;  2EV0 A;  3E6D A;  3EYY A;  2YX4 A;  2BE5 F;  1FPQ A;  2MD5 A;  2W25 A;  2M87 A;  2FBK A;  3F8C A;  2V1X A;  3GXO A;  3HHG A;  5BPD A;  2OU2 A;  5D8K B;  3I0T A;  3KCC A;  3VFZ A;  5LHH A;  2GAU A;  1YW7 A;  3K2Z A;  2COM A;  3Q9V A;  4L5I A;  1F5T A;  4BNC A;  5HS8 A;  2A3S A;  4HF2 A;  1WKM A;  2XRO A;  4RB2 C;  5FGM A;  5DUI A;  3CO6 C;  2F5F A;  3FXR A;  3RKX A;  2HFH A;  2QM3 A;  4LJZ F;  4AVP A;  5FLX K;  1F9N A;  4KIC A;  3LAJ A;  3ABT A;  3WTY C;  1B1B A;  4IVN A;  1U5T C;  4IRH A;  4WCG A;  4PZJ A;  3KZY A;  2W85 A;  5EEG A;  5E18 F;  3DPL C;  2DQL A;  3DP7 A;  1LJ9 A;  3HOS A;  4EQQ A;  1MJA A;  3MFK A;  1UST A;  1UHW A;  2IJL A;  1K79 A;  1FWZ A;  3E5U A;  1YFH A;  2E7W A;  1PDN C;  4RB3 C;  3RI4 A;  3L9F A;  4YII A;  1EV7 A;  3QRF F;  3JTG A;  1FSH A;  2HTS A;  1R1U A;  1R00 A;  3HSE A;  1OKR A;  1O57 A;  1O7F A;  4HDV A;  1VTN C;  2JZY A;  2HYF A;  4ENM A;  2VE8 A;  1ZH5 A;  4A2U A;  2HR3 A;  1J59 A;  4IJA A;  2FXA A;  3GLX A;  3M9A A;  1ON1 A;  4LFU A;  2VBW A;  3JAM Z;  2FML A;  3EUH A;  4EJU A;  2ZJ2 A;  5HLG A;  3ZMS A;  2XAQ A;  4CO8 A;  1QPM A;  3TKY A;  1YO5 C;  2STT A;  3EET A;  3FWE A;  3WU1 B;  2MC3 A;  1KU3 A;  3PQJ A;  1IXR C;  3TO6 A;  4O6J A;  5L3F A;  5K5O A;  3CO7 C;  2PG4 A;  1FY7 A;  2YSR A;  5K5Q A;  3WTX C;  4XLN F;  5HLI A;  2DU9 A;  1B59 A;  5LGT A;  3K1P A;  5CVU A;  4OMZ A;  3MWM A;  1KU9 A;  1HW1 A;  2EFN A;  1ZRF A;  1EH8 A;  3TDU C;  2LF8 A;  3LQR A;  3BJA A;  4U0V A;  2NS0 A;  4RGX A;  2V1D A;  3HRU A;  2BGC A;  4ZZL A;  5K1Y A;  4MTE A;  4ZYH A;  3D0S A;  2FBI A;  5J8F A;  1LDD A;  4GGG A;  3T5X A;  1LDK B;  3FX3 A;  4G6D A;  3K9T A;  3RIR A;  2VBX A;  3K1M A;  1JXS A;  4N9H A;  2OZ6 A;  1HKT A;  1DP7 P;  3IKT A;  3CUO A;  3R4K A;  5E17 F;  2H6C A;  2ZKZ A;  1ZG1 A;  2KJB A;  2STW A;  2Z5U A;  3RKW A;  1IRG A;  4EGY A;  4M74 A;  2VC0 A;  1IN6 A;  1FYM A;  1SD5 A;  3GFJ A;  3N4M A;  4Q48 A;  3ULQ B;  4R79 A;  2L4M A;  2P5V A;  1IRF A;  2VBY A;  3HSF A;  1XCV A;  3LA2 A;  2R3S A;  5J8C A;  4P9F A;  1JE8 A;  3GEZ A;  2BV6 A;  1BIA A;  5DUK A;  5LEK A;  4OIN F;  3WTS C;  2O3F A;  2E7X A;  3KZZ A;  1BI0 A;  1W4M A;  5AIQ A;  3MAJ A;  2P6T A;  4UXN A;  3AAF A;  4RS8 A;  3J81 Z;  4IHT A;  5ICC A;  4KUM A;  4UVC A;  4N0B A;  1IW7 F;  4Z2Y A;  3GWZ A;  3RTR A;  2GQQ A;  3ISP A;  5CLS A;  1WRJ A;  3SQN A;  2H94 A;  2WC2 A;  1YS6 A;  3EQL F;  2TDX A;  4M9Z A;  2V9V A;  2D1V A;  2K4B A;  2EA2 A;  4PGG A;  1HSJ A;  1YW9 A;  3I53 A;  3WOD F;  3E97 A;  2EFQ A;  4YIF A;  4OIR F;  3OV8 A;  3MEX A;  5LHG A;  4O5V A;  2JPB A;  3J80 Z;  1S6L A;  1YS7 A;  4L9T A;  1OYW A;  1BJA A;  4RAZ A;  1T98 A;  1PP7 U;  1ZYR F;  4A0Z A;  2PEX A;  2UWM A;  1R36 A;  3R0A A;  1YIO A;  2LSO A;  3N97 A;  1T0F A;  3QP6 A;  3DPT A;  2EFW A;  4LLG F;  3V8L A;  3E6M A;  1XDU A;  2H27 A;  2XRN A;  4MHG A;  2Q0O A;  2D2W A;  2K7L A;  2XKO A;  1R5H A;  3HUG A;  5L3B A;  1XDS A;  3TOB A;  1BC8 C;  4A0Y A;  2BYV E;  3ZMV A;  5LRR A;  1QBJ A;  1R1T A;  3GUD A;  4HA8 A;  4ZYD A;  2HKX A;  3BPX A;  2IA2 A;  2ZXJ A;  1SFX A;  3GO5 A;  3L09 A;  1IXC A;  3V4G A;  4UNO A;  2M1B A;  5DCM B;  3GF2 A;  4JK1 X;  1TQM A;  1BM9 A;  4L9V A;  4DQ2 A;  4HF1 A;  3IWF A;  1I1S A;  1ZG3 A;  3O6B B;  4ETS A;  4ON0 A;  4S05 A;  2Q8K A;  3MCZ A;  2JTV A;  1YYV A;  1RUO A;  5D6E A;  3ZN1 A;  1G3S A;  4YFN F;  1TW3 A;  3KEO A;  2AS5 F;  1RI7 A;  3K0L A;  4ENJ A;  4OOI A;  5ICE A;  2FNA A;  3CJN A;  2IP2 A;  1J9I A;  3ML6 A;  1S29 A;  2ADU A;  2YPR A;  3L00 A;  4BHB A;  1FLI A;  1E17 A;  3RYR A;  3BPV A;  3QP5 A;  4TV7 A;  2MH9 A;  2DO7 A;  1P6R A;  2A61 A;  1R7J A;  2MBF A;  5TRD A;  2RQP A;  3VOE A;  4A5N A;  1KGS A;  3R60 A;  3F8M A;  3KP3 A;  4Y13 A;  4LB6 B;  2DQR A;  3V8K A;  3CTA A;  1WSU A;  2EK5 A;  1BOA A;  1Y0U A;  4YFX F;  1ZLK A;  5JFR A;  2P5K A;  3C18 A;  5KVR A;  2YU3 A;  3TOA A;  1O7L A;  1I27 A;  1ZRE A;  1D8J A;  1USS A;  1AOY A;  1L0O C;  2GIV A;  3E6B A;  3IL2 A;  5FB2 A;  4R8H A;  4MEX F;  4LK1 F;  1MZB A;  3ZMZ A;  3BP8 A;  5H6Q A;  2FMY A;  1XSD A;  2A68 F;  1F4K A;  1U8R A;  4ZH4 F;  2CO5 A;  5E8G A;  4GYI A;  3F21 A;  2HWV A;  2FQ3 A;  3WG9 A;  1BI1 A;  3FM3 A;  3CUQ B;  1W7P D;  3IKV A;  1IN4 A;  5CVV A;  3ERE D;  5D5V B;  2PLY A;  1WQ2 A;  5L3E A;  1IZ1 A;  2P7C B;  3E3V A;  3F8B A;  2DPU A;  4L0Z B;  3NQO A;  1ZLJ A;  4KMU X;  4A6E A;  1YTY A;  4UVB A;  4CIC A;  2A6E F;  4KT5 C;  2VT2 A;  1E2X A;  3J7A O;  3H92 A;  3COA C;  4FX0 A;  2HS5 A;  5FFZ A;  4KA4 A;  2CG4 A;  1XSV A;  2Y48 A;  1TTY A;  4CHU A;  1HW2 A;  1OMI A;  1QZZ A;  2QWW A;  1DUX C;  3ECH A;  3ZQ7 A;  3K1N A;  5CVJ A;  3LAP A;  1ZAR A;  3F3X A;  4LLL A;  1S7A A;  4KNY A;  4I0B A;  5DCF A;  2W24 A;  2VN2 A;  1SMY F;  4LLN A;  1U2W A;  2EA4 A;  2KIU A;  4XLP F;  2D45 A;  1QZY A;  4RGR A;  4N9I A;  2F5D A;  4I01 A;  1TQP A;  1P4A A;  1L3L A;  3BJO A;  2P4W A;  3QU3 A;  1X3U A;  5FLX Z;  1RNL A;  2XAJ A;  4HQM A;  2EFO A;  2A07 F;  3R61 A;  4Q4Z F;  4Y15 A;  3F72 A;  5E1X A;  4PCQ A;  3FM5 A;  2FE3 A;  2JT1 A;  2PFB A;  3VOD A;  2VT3 A;  2OQR A;  3IRQ A;  2Z9O A;  3O3K A;  2ZME B;  2E1N A;  5BPI A;  1RUN A;  1TNS A;  3LWF A;  3WGG A;  4OIO F;  2L54 A;  4U7D A;  3TDZ C;  3KLN A;  2Z99 A;  3E5Q A;  4QLC U;  3WTV C;  4ENN A;  1IAW A;  4WX9 A;  4PDK A;  5BS6 A;  2RNJ A;  2Y75 A;  1UCR A;  2H6B A;  4M71 A;  1UB9 A;  2RV8 A;  3BDD A;  4KIG A;  2BBY A;  2HDC A;  3ECO A;  4I7H A;  5J6X A;  3MZH A;  4EM1 A;  3LFK A;  1SD4 A;  2EV5 A;  3TO7 A;  3C7J A;  2IW5 A;  4MEY F;  1HST A;  1EH6 A;  1GXQ A;  1JGS A;  5CVR A;  2P7V B;  4I2O A;  1IN7 A;  4ENK A;  2P6S A;  1V3F A;  2WWY A;  2ESH A;  1J0R A;  3JW4 A;  5FD5 A;  4AIJ A;  2ESN A;  5LHI A;  4WXD A;  4M73 A;  1YLF A;  5JR3 A;  4B8X A;  2QBY B;  1BI3 A;  4RGS A;  3F6O A;  4L0Y B;  4A6D A;  3GZ6 A;  3I5U A;  3NRV A;  2RGV A;  1REP C;  2KIF A;  1FYL A;  1WI9 A;  3DQV C;  4EJV A;  2OQG A;  2QUF A;  1TNT A;  2CGP A;  5E1Z B;  1FSE A;  4KYW A;  3JTH A;  3KLO A;  1J7K A;  1FP2 A;  2PJP A;  2ZO4 A;  2PMU A;  4EMS A;  2NNY A;  1RIO H;  2ACJ A;  3RJP A;  2LKP A;  2DK8 A;  4U0Y A;  1KYW A;  2PMH A;  3WE2 A;  2EJR A;  5L3C A;  5DCM A;  4EM2 A;  4P96 A;  4ZYE A;  4WXH A;  2XUB A;  1G3T A;  4EVI A;  5ILS A;  2J5O A;  1U78 A;  1W7P B;  3DV8 A;  2IRF G;  2KIM A;  3U1D A;  1T6S A;  3ZMT A;  4CGZ A;  2FU4 A;  2RN7 A;  3MZY A;  4HOB A;  4ASN A;  3KP5 A;  3FF5 A;  1AWC A;  4IRI A;  4BQA A;  2HYG D;  3QPT A;  1C0W A;  3GFL A;  1U5T B;  2YR2 A;  3KP4 A;  2OAZ A;  2K4J A;  4NB5 A;  1TQI A;  4S04 A;  2CW0 F;  3W6J B;  4ZYG A;  2DPD A;  3GYH X;  2DW4 A;  2GXG A;  3PQK A;  2LF7 A;  1R1V A;  3HTU A;  2QQ9 A;  3GZ5 A;  1HW5 A;  1ZG5 A;  5IT9 K;  4HX7 A;  2EFP A;  2DAO A;  1XMK A;  4IF4 A;  2OD5 A;  5IT9 Z;  3WU0 A;  2HGC A;  2DT5 A;  3KEQ A;  4H0E A;  5D5U B;  3D5L A;  4OIP F;  1ZN2 A;  3HRM A;  4Y17 A;  3MQ0 A;  2Z33 A;  5DD4 A;  4WK8 F;  1SAX A;  3IC7 A;  1Q1H A;  3H3U A;  4I0A A;  1XCB A;  3IHU A;  1LDJ A;  2EB7 A;  2G9W A;  4HYE A;  4A5M A;  2ISY A;  4U0W A;  4R1H A;  1R23 A;  1P2F A;  2ZNY A;  3REO A;  2F2E A;  3CUQ A;  3TO9 A;  3QAH A;  5BMZ A;  2HTJ A;  2O61 A;  5DDG A;  3P7N A;  3BY6 A;  1SD7 A;  1QNT A;  1W5T A;  4AD9 A;  4LB5 A;  2ZCW A;  1KQ0 A;  4G9Y A;  1Z05 A;  3VB2 A;  4HV5 A;  4BH9 A;  2G7U A;  2L4A A;  1J75 A;  5D6F A;  2GA1 A;  3EDP A;  2RVC A;  5LLQ A;  3HRS A;  2GZW A;  2AXL A;  5FFX A;  4MQV A;  4GO1 A;  4BYY A;  3JSO A;  4BHP A;  2JSC A;  6PAX A;  2X0L A;  4U88 A;  3CDH A;  2D1H A;  3T1B A;  4EV0 A;  2VE9 A;  1KU2 A;  1YW8 A;  2A5Y B;  1XGN A;  5FD6 A;  3LA7 A;  1DDN A;  2VC1 A;  4MGR A;  2HKO A;  2VXZ A;  2B0L A;  4UHT A;  5BQT A;  2UXN A;  5HDK A;  4KFC A;  1Z6T A;  1FOK A;  5D5X B;  2F5E A;  5F1R A;  4D0P A;  5E8I A;  3I59 B;  4ESJ A;  2FOK A;  3C3W A;  2FBH A;  4G94 A;  1CF7 B;  3B73 A;  3S2W A;  4G7H F;  1I5Z A;  3C1D A;  5FO5 A;  3P9C A;  2C6Y A;  4RAY A;  2XV4 S;  2M45 A;  2UXX A;  2O6G E;  1O3Q A;  1B4A A;  1XSX A;  1IUY A;  4AIK A;  1Z1D A;  2ZME A;  3LQQ A;  4DNC A;  1ZAO A;  4CYD A;  2FRH A;  1U6G A;  5AON A;  1OYI A;  1FBS A;  2DI3 A;  2V6C A;  1ZRD A;  2M30 A;  3WTZ A;  3FMS A;  3FXU A;  2NRA C;  1PUE E;  2PBI A;  3FMR A;  5ICG A;  3I58 A;  2LDU A;  4UUV A;  4XBF A;  2XIG A;  1ON2 A;  4KIF A;  1G3Y A;  2XVC A;  4IXA A;  4HQE A;  3VEP A;  2BEO A;  3HTS B;  5JHU A;  5HOO A;  5D4S A;  1PP8 F;  1B9N A;  3SZT A;  1HBX G;  4IPA A;  2MH2 A;  2EWN A;  2FF4 A;  3K69 A;  4M6X A;  2L3D A;  3BZ6 A;  1UFM A;  2JPC A;  4IHS A;  2V79 A;  1OYY A;  2CWE A;  1RZ4 A;  2ETH A;  3BRO A;  1LNW A;  5LEJ A;  2Y0M A;  4O3M A;  1JHF A;  2RDP A;  1MD0 A;  1H9G A;  1LVA A;  1TLH B;  1KQ8 A;  4FHT A;  1MKM A;  1FBU A;  3HOT A;  4HLY A;  2QBY A;  1FP1 D;  2DFI A;  4LMY A;  3LA3 A;  4HX4 A;  1ZRC A;  1IN8 A;  2E1C A;  2X4H A;  4HAM A;  5F64 A;  2DLL A;  3I54 A;  5L3G A;  2Q2E A;  1P4W A;  2O03 A;  1DPR A;  1BC7 C;  2QLZ A;  2J5P A;  3KP6 A;  2ZFW A;  1T39 A;  1R22 A;  1XGS A;  3BJ6 A;  3ABU A;  2PQ8 A;  4RB0 A;  3RKY A;  2VOD A;  5HS9 A;  4LG0 B;  3F23 A;  1KQ9 A;  3JSP A;  1NHA A;  2O0Y A;  1FBQ A;  5F6F A;  5CJ9 A;  1MDM B;  3ZN0 A;  1U3E M;  1XB4 A;  1OPC A;  4ESF A;  3RPU A;  4JBA A;  1W7P A;  2MLK A;  2Z3Y A;  1HKS A;  2KKO A;  1FC3 A;  4G7Z F;  2A69 F;  2CFX A;  2HQN A;  2XHK A;  2IT0 A;  1S3J A;  3QOP A;  5ICF A;  2A6H F;  3DEU A;  4L5J A;  5H6R A;  1XMA A;  1U5T A;  1ZHF A;  4KMF A;  3WTW C;  5HDG A;  1Z6R A;  2M5W A;  2K02 A;  1GVJ A;  3GW2 A;  3E6C C;  1STZ A;  2WV0 A;  1HXD A;  5LBQ A;  3G3Z A;  1SD6 A;  2V1U A;  3KP2 A;  3LST A;  4OU0 A;  2P8T A;  1HKQ A;  1TBX A;  3KP7 A;  2QYO A;  3HIF A;  5KK1 A;  4A0X A;  3PFI A;  3JAM K;  4G8X A;  4OMY A;  5IT3 A;  1Z7U A;  4HDU A;  2W57 A;  4EJO A;  3FHZ A;  1Z91 A;  5JVT A;  1K6O A;  2HOE A;  2QVO A;  2MA3 A;  2ZBK A;  5L3D A;  4MNU A;  1J2X A;  4CZZ A;  3U9G A;  3SZP A;  4HX8 A;  3SFZ A;  1SFU A;  3F22 A;  2W84 A;  4KN4 X;  4KN7 X;  1BI2 A;  2R7D A;  2GXB A;  4EM0 B;  3M1E A;  1R5G A;  3DKW A;  5JI6 A;  1H0M A;  4WF2 A;  1BN5 A;  4P55 A;  3E5X A;  4NHJ A;  2IA0 A;  2KJC A;  4EJW A;  4UV8 A;  1FZP B;  3M7G A;  1H9T A;  3QU6 A;  1FYK A;  1GHC A;  4B09 A;  2K27 A;  1S8N A;  2XKP A;  1G4D A;  1FX7 A;  3O2P E;  3T0Y A;  1IF1 A;  2IVM A;  3TQN A;  2K86 A;  4XSX F;  2OA4 A;  1TW2 A;  2NYX A;  1O3R A;  1ZGJ A;  4P9U A;  3IRR A;  3GVA A;  1KU7 A;  2RKH A;  4I09 A;  5HDN A;  5ED4 A;  5DYM A;  2NAZ A;  1ONV A;  4I98 B;  5HVQ C;  2VON A;  1BBY A;  4BXU A;  5K5R A;  4HLX A;  4AWX B;  3CLO A;  4G7O F;  1MJ9 A;  1XN7 A;  4WXC A;  1LQ1 A;  3I59 A;  1XGM A;  2DTR A;  3ZP5 A;  5D5W B;  1WWX A;  3EYI A;  4LGW A;  3HYI A;  5ERI A;  4ESB A;  1CF7 A;  1B9M A;  4K2E A;  4KDP A;  2VOO A;  3FZV A;  3RDI A;  4U7B A;  3I4P A;  1MJB A;  2O8X A;  4F7Z A;  3DFG A;  4HZF A;  3DXJ F;  2ISZ A;  3DF8 A;  4NQW A;  5TJJ A;  3J81 K;  2IPQ X;  4EJT A;  5E20 A;  1I6X A;  1ULY A;  4HV6 A;  3ZMU A;  1G3W A;  3T8R A;  2VOP A;  2DK5 A;  4Q47 A;  2PI0 A;  3L2C A;  2QQB A;  1LB2 A;  4LD5 A;  4RB1 A;  3TGN A;  3ZMD A;  3B02 A;  4IRG A;  1D3Y A;  3SHF A;  2H09 A;  4HW0 A;  3V7S A;  1P92 A;  4LK0 F;  3GFI A;  3WTU C;  2F5C A;  2IA1 A;  5D4R A;  2L01 A;  4ZZD A;  5LGN A;  4UV9 A;  4MQ9 F;  2JRT A;  2LNB A;  3J80 K;  3IWZ A;  5AIP A;  1MGT A;  5LGU A;  4L18 B;  4I02 A;  1D8K A;  4QWQ A;  2VBZ A;  2ZNZ A;  3CUQ C;  1I1G A;  2UZK A;  2FEZ A;  1K78 A;  2M8E A;  4AIH A;  5EEH A;  5E1W A;  2FNP A;  4A12 A;  5D8L B;  3V7C A;  3V8J A;  3Q5F A;  3GFM A;  3HRT A;  3RYP A;  2G7H A;  5ILV A;  3ZPL A;  1V4R A;  3I71 A;  1Z9C A;  4JQF A;  4XRF A;  2HQR A;  1F1Z A;  3ROU A;  4HF0 A;  5DV5 A;  4XSZ F;  2WTE A;  1S7O A;  5DEQ A;  3WGI A;  1T2K A;  3WTT C;  4KIB A;  2KRF A;  4M6Y A;  2ELH A;  3P9I A;  1LEB A;  5A2Q K;  4G6Q A;  4LG0 A; 
#chains in the Genus database with same CATH topology
 5IYC J;  4L9J A;  1UZC A;  2X6Y A;  1MBJ A;  2GWR A;  2XGX A;  1QQI A;  2R5Y A;  2E2I J;  2HEO A;  3KX2 A;  4FTH A;  1MDM A;  4CXF A;  1BIB A;  5A2Q Z;  4D5F A;  1ODD A;  2M7A A;  3NEU A;  5HLH A;  3M8E A;  2CYY A;  3OYF A;  2DA6 A;  4JOM A;  1IN5 A;  1R58 A;  3F8F A;  1O3T A;  2L7F P;  2V26 A;  3HHH A;  4XON A;  3M8F A;  2L02 A;  5FKM A;  4BHC A;  1T38 A;  2XAG A;  3FMQ A;  1UHM A;  1HQC A;  3W6K B;  4HNU A;  3GTM J;  2R4G A;  2R5Z B;  3G73 A;  3H3V K;  1LFB A;  1YG2 A;  2XAH A;  2UV1 A;  4BAY A;  4HBL A;  4UVA A;  1EH7 A;  1G6N A;  4PJL A;  2XGE A;  3KFW X;  4ZYA A;  4FX4 A;  3BG3 A;  5H20 A;  1ACI A;  1K4T A;  5GAE J;  1XGO A;  1A04 A;  3G6E I;  2CQK A;  2OBP A;  1I3A A;  1X58 A;  4OIQ F;  2QCO A;  3KET A;  4C30 A;  1OCR H;  2ELJ A;  1CGP A;  2DN0 A;  3KE2 A;  2HDD A;  5FJ8 J;  4M72 A;  2OZU A;  5JHF A;  5EZH A;  2XAS A;  3Q9S A;  3HOY J;  2EZL A;  3AG2 H;  2NNN A;  4Q5S F;  4I76 A;  3S15 J;  4M6V A;  2NVQ J;  1YJN I;  5E79 C;  1J5Y A;  4XIC A;  2R7Z J;  4L9N A;  3R6S A;  4WWC A;  2KL4 A;  3M8J A;  4FAS D;  2RC4 A;  3DTK A;  2NVT J;  1JTY A;  3BR6 A;  3VWB A;  2FA5 A;  3BWG A;  5FRN A;  1DPU A;  4FT8 A;  2R7F A;  1XS9 A;  3IAM 2;  3V7R A;  4PGH A;  3FXQ A;  1HOM A;  2DBB A;  3F8N A;  4GCV A;  3VYT B;  1XD7 A;  1K7A A;  3OOP A;  1SFO J;  4M9X A;  4AU7 A;  2PN6 A;  2EV6 A;  1W36 C;  3CJT B;  1OR7 A;  3U2R A;  3RPQ A;  5K7H A;  1D5V A;  2DJI A;  3R0J A;  1ORK A;  3F6V A;  1P4X A;  3SYT A;  4MTD A;  5DD8 A;  1WJA A;  4OAY A;  3OS2 A;  2MD0 A;  1QO0 D;  4XR6 A;  3DU5 A;  4A3C J;  3VSL A;  3RQ4 A;  5C3E J;  4E70 A;  2QEN A;  2QZ8 A;  3BOQ A;  3ELK A;  5F04 A;  3K7A J;  5HNF A;  2R7S A;  5EYR A;  3HSR A;  3JRI A;  2W7N A;  1R6R A;  2HXI A;  5C44 J;  4M9S A;  1IXS B;  1GXP A;  5FKO A;  3QPH A;  4P5O A;  2EPF A;  1IGN A;  3CJR B;  3C2G A;  3JRC A;  5F0C A;  3GTO J;  3JR9 A;  2XDV A;  1X4O A;  4GYG A;  4RGU A;  5HS7 A;  2IS6 A;  1O3S A;  4X6A J;  3SEZ A;  3L7W A;  2DA4 A;  4NNJ A;  2XAF A;  2V9P A;  4BQO A;  1SFE A;  2YX7 A;  3SXY A;  1OQY A;  1WVR A;  4D7N A;  4YG2 F;  1PYV A;  3I64 A;  1W5S A;  2P5L C;  1FNN A;  3DCF A;  5EGO A;  3T8T A;  1K78 B;  2CSO A;  3TL4 X;  2VKV A;  4CDG A;  1RR8 C;  1QA6 A;  4KIS A;  1EA3 A;  3OYJ A;  3WGH A;  2Y0S N;  2HZT A;  1PUF B;  1ZGA A;  1MW7 A;  1KYZ A;  3H3Z A;  1FT9 A;  1S72 I;  2GA2 A;  2QQA A;  3P9K A;  4YFK F;  3K70 C;  1R71 A;  2JA2 A;  4GXO A;  3BR3 A;  1KA8 A;  1ZR2 A;  1TL8 A;  1HCR A;  5ILU A;  1B6A A;  2O5R A;  1VQ7 I;  3WE3 A;  4C2U A;  2WAD A;  3KYD B;  5CKT A;  3GX4 X;  2KZG A;  2VJ5 A;  4MLO A;  3LOC A;  5J40 A;  1ZQ3 P;  1JHH A;  2MLG A;  3KZI C;  5BOX A;  1N75 A;  4E7K A;  1TWA J;  3HUG B;  2JSP A;  1QGP A;  1SMT A;  5CVI A;  2BY0 A;  4EGZ A;  1GDT A;  2VQC A;  5EDN A;  3CCU I;  5F08 A;  2FSW A;  3CMY A;  1HDD C;  1LEA A;  5CYV A;  5LRS A;  4BBR J;  1XG1 A;  1T8I A;  1YQA A;  2R7R A;  2EV0 A;  3ABL H;  3E6D A;  3EYY A;  2YX4 A;  1HDP A;  2BE5 F;  2Q1Z B;  1FPQ A;  2KQR A;  2MD5 A;  2W25 A;  3S32 A;  2M87 A;  2FBK A;  3BC8 A;  2V1X A;  3F8C A;  3GXO A;  2Y2Z A;  3HHG A;  5BPD A;  9ANT A;  4C3I J;  2OU2 A;  2R7X A;  1EF4 A;  1VFC A;  5D8K B;  1LFU P;  3I0T A;  2DXI A;  3E0J B;  3KCC A;  2MG4 A;  3VFZ A;  3GZN B;  5LHH A;  2GAU A;  2E35 A;  1YW7 A;  3O8G A;  3K2Z A;  2COM A;  3Q9V A;  4L5I A;  1F5T A;  4BNC A;  3QOD A;  3HJE A;  5HS8 A;  2XF5 A;  2EZK A;  2A3S A;  2VXD A;  4HF2 A;  1WKM A;  2XRO A;  2X9D A;  4RB2 C;  5FGM A;  5DUI A;  1X4P A;  2KDO A;  3CO6 C;  1JKO C;  2F5F A;  5LD2 C;  3FXR A;  2VQG A;  3RKX A;  2HFH A;  2QM3 A;  4LJZ F;  4AVP A;  5FLX K;  1F9N A;  4KIC A;  3LAJ A;  2BY2 A;  4BY7 J;  4IO9 F;  3ABT A;  3WTY C;  1B1B A;  4IVN A;  1IV6 A;  3ZGK A;  1E0E A;  3J7A Y;  1QHG A;  1U5T C;  3LSM A;  1MH4 A;  4IRH A;  4WCG A;  2JMW A;  4PZJ A;  3FXL A;  2EZI A;  2CQ7 A;  3KZY A;  2W85 A;  5EEG A;  5E18 F;  2DOD A;  1BR2 A;  3DPL C;  2WAQ A;  4LG3 A;  2DQL A;  3DP7 A;  4BE1 A;  1LJ9 A;  1SVO A;  4EQQ A;  1MJA A;  3HOS A;  3PNV A;  4XOP A;  3MFK A;  1UST A;  1UHW A;  2IJL A;  3FXK A;  1K79 A;  1FWZ A;  3E5U A;  2BZT A;  4MFD A;  1V5G A;  3RZO J;  1YFH A;  1G59 A;  4XN3 A;  2E7W A;  1PDN C;  4RB3 C;  3LSJ A;  4CCO A;  4IKF A;  4HSR A;  3RI4 A;  2AO9 A;  3L9F A;  5JLX A;  4YII A;  1EV7 A;  1NG7 A;  2MGQ A;  3QRF F;  2BHZ A;  3ZR8 X;  3JTG A;  1FSH A;  2HTS A;  1KZH A;  1R1U A;  2DOE A;  1R00 A;  3HSE A;  5IOY A;  3HOV J;  1OKR A;  1O57 A;  1O7F A;  2LLK A;  4HDV A;  2VI6 A;  1VTN C;  3FK6 A;  4ZDP A;  3M3Y J;  2JZY A;  2HYF A;  1VND A;  1TWG J;  4XN0 A;  4KT6 A;  1DQU A;  2H1K A;  2FD5 A;  3PUF A;  4ENM A;  1ZK8 A;  2VE8 A;  4A2U A;  1ZH5 A;  2HR3 A;  1J59 A;  5J1U A;  4B47 A;  4IJA A;  3PSI A;  3IP4 B;  2JWT A;  4G6T B;  2FXA A;  3C2B A;  3GLX A;  2M3A A;  1NK3 P;  2X1D A;  3M9A A;  1ON1 A;  4LFU A;  2VBW A;  3EUH C;  5C4X J;  3JAM Z;  2FML A;  1CQT A;  4IQJ A;  3EUH A;  5KAI C;  4EJU A;  2DMP A;  4RBO A;  2ZJ2 A;  1DGR M;  5HLG A;  3ZMS A;  2XAQ A;  5F0H A;  4BE0 A;  1AHD P;  2W48 A;  4CO8 A;  1QPM A;  3TKY A;  4XRM A;  1YO5 C;  2HOS A;  2K9L A;  2STT A;  3HDD A;  3EET A;  3FWE A;  5CPR B;  3WU1 B;  4RAF A;  4A3B J;  2MC3 A;  1KU3 A;  3PQJ A;  1IXR C;  3GTQ J;  1WJE A;  1WI3 A;  3TO6 A;  4O6J A;  1TWC J;  3AL0 B;  3S2H J;  1Y0N A;  3HEF A;  5L3F A;  1ZTR A;  5K5O A;  2PG4 A;  1FY7 A;  2YSR A;  5K5Q A;  3CO7 C;  3WTX C;  2QGU A;  4XLN F;  5HLI A;  2DU9 A;  4DIQ A;  3DLL F;  4DOZ A;  5JLW A;  1YX3 A;  1B59 A;  5FKK A;  4MO7 A;  5LGT A;  3K1P A;  4OWR B;  2JJ7 A;  5CVU A;  4OMZ A;  4A3I J;  3MWM A;  1KU9 A;  1JTX A;  2IBD A;  1HW1 A;  2EFN A;  2O9L A;  5TGT A;  1ZRF A;  1EH8 A;  3TDU C;  1VQ9 I;  2L9V A;  2X1C A;  2LF8 A;  3LQR A;  2EIN H;  3BJA A;  4U0V A;  5F27 A;  2NS0 A;  4AYB N;  4RGX A;  2IGM A;  3ZQH A;  2V1D A;  4IHW A;  2GXA A;  2HVR A;  2L9S A;  3HRU A;  1MBH A;  2BGC A;  3Q3S A;  2EZH A;  4ZZL A;  5K1Y A;  1VQO I;  3RKQ A;  1AKH A;  3OYE A;  4MTE A;  5M3F J;  2OCC H;  4H4K C;  2WAE A;  3D0S A;  4ZYH A;  2FBI A;  5J8F A;  3QPL A;  1LDD A;  4Y7N J;  4GGG A;  3T5X A;  3E1S A;  1LDK B;  3FX3 A;  3TW7 A;  2ZSH B;  3U21 A;  4G6D A;  1T95 A;  3K9T A;  3RIR A;  3F9K A;  4AVZ A;  2VBX A;  3K1M A;  2XSD C;  1JXS A;  2YU9 J;  4N9H A;  2OZ6 A;  3WHC A;  1HKT A;  4ZC3 A;  1DP7 P;  3OR1 C;  3IKT A;  3CUO A;  3X2Q H;  3R4K A;  5E17 F;  2H6C A;  2ZKZ A;  5E3O A;  2E1O A;  2L5Q A;  3QOE A;  1ZG1 A;  2COB A;  2KJB A;  2STW A;  4I6Z A;  2Z5U A;  3RKW A;  1ETO A;  1IRG A;  4XOT A;  3D5S C;  4EGY A;  3DEE A;  4M74 A;  2VC0 A;  3OYA A;  1SEU A;  2QF7 A;  2R5Z A;  2WV1 A;  3CJQ B;  1IN6 A;  1D0Z A;  1MBK A;  4JX4 A;  1SD5 A;  3GFJ A;  2PX9 A;  4BJT A;  3OYH A;  5GP9 A;  4B44 A;  3N4M A;  2DFE A;  4Q48 A;  4A3J J;  3ULQ B;  1Z3X A;  2ME6 A;  2L4M A;  2P5V A;  4R79 A;  1IRF A;  4BAC A;  2VBY A;  3L2W A;  2XB5 A;  3HSF A;  3HB9 A;  1RKW A;  3M1C A;  1XCV A;  1VI0 A;  1IV8 A;  3LA2 A;  3BQZ A;  2R3S A;  5J8C A;  4P9F A;  1UAA A;  1JE8 A;  3IV5 A;  4HST A;  3KYL A;  2WY7 Q;  3GEZ A;  1DU0 A;  2BV6 A;  1SAU A;  5HOD A;  1BIA A;  4B4C A;  5DUK A;  3QYB A;  2CQN A;  5LEK A;  2DYR H;  4OIN F;  3WTS C;  2O3F A;  2R7U A;  2E7X A;  2ZC2 A;  3A01 B;  3KZZ A;  1BI0 A;  1W4M A;  1K83 J;  2MC4 A;  1EJ9 A;  3A02 A;  5AIQ A;  3MAJ A;  4Y52 J;  2PMZ N;  1RC9 A;  2P6T A;  4UXN A;  1FMV A;  3AAF A;  3OWT A;  3CES A;  4RS8 A;  4XLC A;  5CQG A;  3J81 Z;  4CCK A;  4IHT A;  3W3C A;  3LL7 A;  5ICC A;  2OPT A;  2GBY A;  1K61 A;  5E3N A;  2LY9 A;  1S7E A;  4KUM A;  4UVC A;  5FKN A;  2HYJ A;  4N0B A;  4C9Y A;  1IW7 F;  2DJN A;  5IYB J;  2NVY J;  4Z2Y A;  4XRS A;  3GWZ A;  3RTR A;  4CCL A;  2GQQ A;  1X1A A;  4A93 J;  3RCO A;  2VKD A;  3ISP A;  5CLS A;  5HLT A;  1WRJ A;  3SQN A;  5J1R A;  2H94 A;  1NG6 A;  1VQM I;  1R4M B;  1I50 J;  2WC2 A;  1YS6 A;  3EQL F;  2TDX A;  4M9Z A;  2V9V A;  2D1V A;  2K4B A;  2EA2 A;  2IS2 A;  4D1Q A;  5J3L A;  4PGG A;  3A1Y A;  3I56 I;  1HSJ A;  2MAB A;  4ZTJ A;  1YW9 A;  3S14 J;  3I53 A;  3WOD F;  2WA0 A;  3E97 A;  2EFQ A;  4YIF A;  4D9J A;  3OYB A;  4OIR F;  2R92 J;  4CZC A;  3OV8 A;  3MEX A;  2Y9Y A;  5LHG A;  2P81 A;  4FQG A;  4O5V A;  1GVD A;  1KON A;  2JPB A;  2K9M A;  3J80 Z;  2CRG A;  1UG2 A;  1BA5 A;  3FBN B;  1S6L A;  2CW8 A;  1YS7 A;  3DU6 A;  3IAS 2;  1OYW A;  4L9T A;  1BJA A;  4RAZ A;  1T98 A;  2L9R A;  5C4J J;  1PP7 U;  1ZYR F;  4A0Z A;  2I8D A;  4E7S A;  2PEX A;  2UWM A;  3CCR I;  2LBF B;  1PUF A;  3FBI B;  4B3A A;  1R36 A;  1T0F C;  3R0A A;  1YIO A;  2LSO A;  4RA2 A;  2L7Z A;  3L1P A;  3N97 A;  1T0F A;  4ZDL A;  2LYC A;  3B6C A;  3QP6 A;  3MKW B;  3CC4 I;  3DPT A;  3CDL A;  2EFW A;  2V1N A;  4LLG F;  3V8L A;  1U9O A;  3E6M A;  1FMW A;  3A0H C;  1XDU A;  4BUP A;  4HRI A;  4BE2 A;  1WJB A;  2TRT A;  4DJA A;  1W0U A;  3VYU B;  4RLQ A;  2H27 A;  2JK3 A;  2XRN A;  4MHG A;  2Q0O A;  2D2W A;  2YS9 A;  2K7L A;  2XKO A;  1R5H A;  2HXO A;  1OCP A;  2IGK A;  1LE8 B;  3HUG A;  5GTH C;  5L3B A;  1APL C;  2HVQ A;  4W1U A;  5FKL A;  1XDS A;  3TOB A;  1BC8 C;  4A0Y A;  2BYV E;  3ZMV A;  5LRR A;  4DZP A;  1QBJ A;  3K4K A;  2DOA A;  2VLA A;  1R1T A;  4XLE A;  1OIS A;  3GUD A;  3HOZ J;  4HA8 A;  4ZYD A;  2HKX A;  3CCQ I;  1A31 A;  3BPX A;  2IA2 A;  2ZXJ A;  2HI3 A;  2F4O B;  1SFX A;  2Y69 H;  3GO5 A;  3IH4 A;  2MSY A;  3L09 A;  2X51 A;  3BG5 A;  5J1Y A;  1IXC A;  1V54 H;  2M4G A;  3V4G A;  4UNO A;  2H8W A;  2M1B A;  1F43 A;  3IH3 A;  5DCM B;  3GF2 A;  3QWL A;  1WZ2 A;  2IAI A;  4JK1 X;  5B5E C;  1TQM A;  1BM9 A;  2CH0 A;  3HC7 A;  3DBR B;  4L9V A;  4NC7 A;  4DQ2 A;  3L2Q A;  4HF1 A;  1F36 A;  3IWF A;  1VQP I;  1I1S A;  1D0Y A;  1ZG3 A;  4F92 B;  3O6B B;  1JKP C;  4ETS A;  1LKX A;  3CF5 F;  1X2N A;  4ON0 A;  4S05 A;  2Q8K A;  3MCZ A;  5CQE A;  1W36 D;  2JTV A;  1YYV A;  1GUU A;  1OCT C;  1RUO A;  4FCY A;  5D6E A;  3I4M J;  1IRZ A;  3ZN1 A;  3S3O A;  3DLA A;  1Y39 A;  3S2D J;  3KEY A;  3FKI J;  1G3S A;  4YFN F;  1TW3 A;  3KEO A;  2AS5 F;  1RI7 A;  5FRM A;  3K0L A;  3LSI A;  4ENJ A;  4OOI A;  3K4M A;  2KMU A;  2FNA A;  5ICE A;  5JVG F;  2JN6 A;  3A4C A;  3CJN A;  2IP2 A;  4ZJZ A;  2M34 A;  3ML6 A;  1J9I A;  1S29 A;  2ADU A;  2YPR A;  3L00 A;  5KNL A;  2QQ8 A;  4BHB A;  2R93 J;  2CS3 A;  4M3F A;  1FLI A;  1E17 A;  3RYR A;  1P7I A;  3BPV A;  3FDY A;  3QP5 A;  4XL9 A;  1Y1W J;  1RES A;  3D5R C;  3W6V A;  4TV7 A;  2VJI A;  1TT5 B;  2MH9 A;  2ZJP F;  2DO7 A;  2FUG 2;  1OCC H;  1P6R A;  4F55 A;  2A61 A;  1R7J A;  3ASN H;  2MBF A;  5TRD A;  3O8H A;  2JVG A;  3NWT A;  4RM3 A;  2RQP A;  3LSH A;  3VOE A;  1G2H A;  1OR7 C;  3H5A A;  1Z7L A;  1KGS A;  4A5N A;  2MFZ A;  3R60 A;  4LIU A;  1UHS A;  5TIS C;  3F8M A;  3KP3 A;  3SDG A;  1ENH A;  4Y13 A;  4LB6 B;  3Q0V A;  2DQR A;  2LVS A;  3V8K A;  3BZK A;  3CTA A;  1WSU A;  2EK5 A;  5F1J A;  1RKT A;  3K70 D;  5BNG A;  2HOT A;  1BOA A;  2VKH A;  1Y0U A;  3HOW J;  3A0B C;  2WB1 A;  1OFC X;  4YFX F;  1ZLK A;  5JFR A;  2P5K A;  3C18 A;  5KVR A;  2VUM J;  1ETV A;  2CUF A;  2X48 A;  2ICW G;  2AXT C;  2YU3 A;  3TOA A;  4CCJ A;  2WBM A;  4N4O B;  4Z6Y A;  3G2B A;  1O7L A;  4BEH B;  1UMQ A;  3HGG A;  1I27 A;  1ZRE A;  3QYE A;  1D8J A;  1USS A;  4XID A;  1AOY A;  1L0O C;  3PL8 A;  2ECB A;  3OYL A;  5DS9 A;  1S9H A;  2GIV A;  2R0Q C;  3E6B A;  1NH3 A;  2O8K A;  2PJR B;  3K4C A;  3IL2 A;  4S0H B;  4M3B A;  5FB2 A;  4R8H A;  4IHY A;  4XNF A;  4MEX F;  4LK1 F;  3S1N J;  1MZB A;  3G1M A;  4L5E A;  2HU9 A;  3ZMZ A;  3BP8 A;  4LOC A;  5H6Q A;  5IP7 J;  2FMY A;  1XSD A;  1VQL I;  2DFH A;  2A68 F;  3OSF A;  1F4K A;  1U8R A;  4ZH4 F;  1PJR A;  2CO5 A;  5E8G A;  4GYI A;  4II3 A;  3F21 A;  2HWV A;  2OCE A;  3RPU D;  2FQ3 A;  3WG9 A;  1T33 A;  1BI1 A;  3FM3 A;  3CUQ B;  1W7P D;  3IKV A;  1IN4 A;  5CVV A;  1FIA A;  4ITV A;  3G1O A;  1MMG A;  3ERE D;  5D5V B;  1NK2 P;  3CD6 I;  1YIT I;  5H2F C;  2PLY A;  1WQ2 A;  5L3E A;  1IZ1 A;  1Z0X A;  2P7C B;  4ZDO A;  1W1W E;  3E3V A;  4A3F J;  3F8B A;  1HF0 A;  2DPU A;  4L0Z B;  3NQO A;  4UB8 C;  3TMO A;  1ZLJ A;  3MMY B;  4KMU X;  4A6E A;  1YTY A;  1FIP A;  1IDY A;  4UVB A;  4HNV A;  4CIC A;  5IP9 J;  2RAE A;  4DGW B;  2A6E F;  3ERM A;  3LNQ A;  1N78 A;  4KT5 C;  2VT2 A;  1E2X A;  3J7A O;  3U1K A;  3H92 A;  3COA C;  4A69 C;  4FX0 A;  3IUO A;  2HS5 A;  2DTZ A;  2LRD A;  3RZD J;  1W0T A;  5FFZ A;  4KA4 A;  2CG4 A;  5M5X J;  1XSV A;  2F6C A;  1TTY A;  1QVT A;  2K5C A;  2Y48 A;  4CHU A;  1HW2 A;  1OMI A;  1QZZ A;  2EQR A;  2QWW A;  3DTI A;  1DUX C;  3ECH A;  3BR1 A;  4BXF A;  2HDW A;  3ZQ7 A;  3K1N A;  5CVJ A;  3LAP A;  1VQN I;  1ZAR A;  3F3X A;  4LLL A;  1S7A A;  3BR2 A;  4JX5 A;  4KNY A;  4XLH A;  2M0M A;  4I0B A;  2G0E A;  5EEA A;  2KIQ A;  1MSE C;  3AG3 H;  2W24 A;  5DCF A;  4A3G J;  2VN2 A;  1SMY F;  4LLN A;  3OL4 A;  2Z16 A;  1U2W A;  1X2M A;  2DA7 A;  2EA4 A;  2KIU A;  3BR5 A;  3HZJ A;  4ANJ A;  3GTP J;  1P9Q C;  4IOC F;  2DYS H;  4HNT A;  4XLP F;  2D45 A;  1QZY A;  4RGR A;  5DM7 F;  3V42 A;  5GPA A;  4N9I A;  2F5D A;  4I01 A;  1TQP A;  1P4A A;  3TP3 A;  5GPC A;  1L3L A;  3BJO A;  2ME0 A;  3I9V 2;  2CU7 A;  1SVM A;  2P4W A;  3CP8 A;  4IL6 C;  4LIT A;  3QU3 A;  2ZXH A;  1X3U A;  3WG7 H;  3B6A A;  4ZTF A;  5FLX Z;  3WHB A;  4IEJ A;  1RNL A;  2XAJ A;  2GM4 A;  4HQM A;  2EFO A;  3CQZ J;  2A07 F;  3CC7 I;  4PUS A;  2R7O A;  3MN2 A;  4HEA 2;  3R61 A;  3OYG A;  5DM6 F;  4Q4Z F;  2QSG X;  2VL8 A;  4Y15 A;  3F72 A;  5E1X A;  4PCQ A;  4BDZ A;  3A01 A;  2EBI A;  3FM5 A;  3VPR A;  4XRS G;  3GTG J;  2FE3 A;  2JT1 A;  2PFB A;  3VOD A;  2VT3 A;  3OY9 A;  1FOY A;  2OQR A;  2GOX B;  2BVM A;  1W5C C;  2XPV A;  2Y0S A;  3IRQ A;  2Z9O A;  3S17 J;  1DP3 A;  1XC5 A;  3O3K A;  2ZME B;  5M5W J;  2E1N A;  5BPI A;  3DBL B;  2E5N A;  3S8P A;  1TNS A;  1RUN A;  3LWF A;  3WGG A;  3P5J A;  1R5I D;  2DFF A;  3EUA A;  4OIO F;  2L54 A;  1WH7 A;  5B66 C;  4U7D A;  2K9N A;  2Y30 A;  3S3N A;  1MNM C;  2XB0 X;  3CCJ I;  1X1P A;  2CMP A;  1R9T J;  3TDZ C;  3KLN A;  1JKR C;  1BW6 A;  3FIS A;  4F91 B;  2Z99 A;  3OYK A;  3E5Q A;  4PSW A;  4QLC U;  2GIZ A;  3WTV C;  4ENN A;  1IAW A;  1LUJ B;  3S93 A;  4RM2 A;  4WX9 A;  4PDK A;  3ZQQ A;  5KHD A;  2CUE A;  3S1Q J;  2LK2 A;  2YUS A;  5BS6 A;  3EPZ A;  2XGC A;  2RNJ A;  2Y75 A;  3ZQG A;  1UCR A;  2H6B A;  3TP0 A;  4U87 A;  4M71 A;  2VPL A;  4A3M J;  2LMD A;  1UB9 A;  1U0J A;  2RV8 A;  3BDD A;  4KIG A;  2UUZ A;  2BBY A;  4Y33 A;  2VPR A;  2HDC A;  5B1B H;  3ECO A;  4I7H A;  5J6X A;  4V2F A;  1Y8Q B;  3CME I;  2OV7 A;  3MZH A;  4EM1 A;  3LFK A;  2CUZ A;  3PM1 A;  4XK4 A;  1SD4 A;  2EV5 A;  2K3P A;  3C7J A;  3TO7 A;  2IW5 A;  3H9G A;  4XM3 A;  1WCM J;  1EKE A;  2JA8 J;  4MEY F;  3PFY A;  1HST A;  2E36 A;  3K4J A;  3HPG A;  5M3M J;  1EH6 A;  1GXQ A;  1JGS A;  5CVR A;  2P7V B;  3BG7 A;  1IC8 A;  1IN7 A;  2LBF A;  2XF7 A;  3UNG C;  4ENK A;  4I2O A;  3ZQI A;  2P6S A;  1V3F A;  3HKZ N;  2WWY A;  2ESH A;  1J0R A;  3JW4 A;  5FD5 A;  4AIJ A;  2ESN A;  2HZD A;  3OS1 A;  5LHI A;  4WXD A;  1MNE A;  1ZR4 A;  1YRN B;  1RR7 A;  2DA1 A;  2XPW A;  4M73 A;  1YLF A;  5JR3 A;  4B8X A;  2QBY B;  1IUF A;  3RSN A;  1U8B A;  2V6E A;  1BI3 A;  4RGS A;  3F6O A;  3D1N I;  4L0Y B;  4GFB A;  4A6D A;  3GZ6 A;  3JRH A;  3I5U A;  2NVX J;  4BXX J;  3NRV A;  2RGV A;  1REP C;  1P7J A;  2LH9 A;  4FET A;  4CH7 A;  2Q2E B;  1LE8 A;  2JUG A;  2KIF A;  1FYL A;  1WI9 A;  3DQV C;  4EJV A;  1D1A A;  2OQG A;  2QA4 I;  2QUF A;  1TNT A;  4PJN A;  2L2O A;  5EZG A;  2CGP A;  2DOF A;  2Y31 A;  5LFA A;  5E1Z B;  4BGD A;  1FSE A;  2ELK A;  2L0K A;  3W2A A;  1BR1 A;  3JCU C;  5GAG J;  4KYW A;  3HG9 A;  3JTH A;  3ZQL A;  3KLO A;  3AL0 C;  3FXM A;  4X1E A;  1J7K A;  1FP2 A;  2ZXI A;  3PSF A;  2PJP A;  2ZO4 A;  3K10 A;  4IOA F;  2IEK A;  2PMU A;  4EMS A;  2NNY A;  1RIO H;  2ACJ A;  1QHH D;  3RJP A;  3ZCO A;  2LKP A;  1RET A;  2EIK H;  2DK8 A;  4NC8 A;  4U0Y A;  1KYW A;  1QRY A;  2PMH A;  3WE2 A;  2EJR A;  5L3C A;  1WFX A;  5DCM A;  2M4K A;  3J7Y J;  5J4Y A;  1WJ5 A;  4PK4 A;  4EM2 A;  5FLV A;  1D1B A;  1BJZ A;  3HXL A;  2FQ4 A;  2KPM A;  4P96 A;  4ZYE A;  4WXH A;  2IGN A;  1BR4 A;  1ERD A;  2XUB A;  1G3T A;  4KJZ A;  3BG9 A;  2NOG A;  4PJ0 C;  5ILS A;  4EVI A;  2J5O A;  1U78 A;  2N8G A;  1QU3 A;  1W7P B;  3SFI A;  3MZ8 A;  3DV8 A;  3OYD A;  2IRF G;  2KRC A;  2KIM A;  4MFE A;  3U1D A;  1T6S A;  2EH3 A;  3ZQF A;  3ZMT A;  4CGZ A;  1Y6I A;  2IGO A;  2FU4 A;  2O7O A;  2RN7 A;  2H8R A;  2DDB A;  2OTL I;  3MZY A;  5IOZ A;  4HOB A;  4ASN A;  3KP5 A;  4DYR A;  3FF5 A;  1AWC A;  1B8I B;  4IRI A;  4BQA A;  1NTC A;  2L9N A;  2HYG D;  4UUS A;  2WAF A;  3QPT A;  3GTL J;  3GTJ J;  2E71 A;  3ZRG A;  4AC0 A;  3GFL A;  1C0W A;  1U5T B;  3DEW A;  2YR2 A;  3KP4 A;  2A6T A;  1B72 B;  2OAZ A;  1VF9 A;  2K4J A;  1JKQ C;  4NB5 A;  1TQI A;  4BQQ A;  4S04 A;  2CW0 F;  3W6J B;  4ZYG A;  2CV1 A;  2W1O A;  2DPD A;  1YIJ I;  2R7W A;  3GYH X;  2DW4 A;  3PO3 J;  5HNH A;  5IY5 H;  2GXG A;  3PQK A;  3HL2 A;  3PNT A;  3DPU A;  2LF7 A;  1R1V A;  3CMM A;  3HTU A;  3HKZ A;  2QQ9 A;  5B1A H;  3GZ5 A;  3G1L A;  1HW5 A;  4D5C A;  3OYI A;  1ZG5 A;  1T56 A;  2IS1 A;  5IT9 K;  2OUM A;  1A6I A;  2W82 A;  4AYB A;  3CCE I;  2CFO A;  3OYM A;  2VJJ A;  3I55 I;  4DW6 A;  2RQQ A;  3H9J A;  4M3G A;  2HOA A;  2BOL A;  3MD2 A;  1XTA A;  4HX7 A;  2EFP A;  1LVK A;  4XMY A;  4E7Z A;  4OAZ A;  3CCV I;  3VSK A;  2DAO A;  3TED A;  1XMK A;  4C3J J;  1QZE A;  4YEJ A;  4IF4 A;  2OD5 A;  2ZXW H;  2K9Q A;  3WU0 A;  3ZQC A;  2HGC A;  2KHM A;  2DT5 A;  2NXN B;  2K9S A;  3KEQ A;  5IT9 Z;  2E60 A;  4H0E A;  3ZXS A;  5D5U B;  3D5L A;  4Y4R A;  4OIP F;  1ZN2 A;  4BEH A;  3HRM A;  4Y17 A;  2QKM B;  2HVS A;  3MQ0 A;  3HPH A;  2A5W A;  1FOX A;  3I3L A;  5EF6 A;  2Z33 A;  5DD4 A;  2PJR A;  4WK8 F;  3GME A;  2CQQ A;  1SAX A;  5B3S H;  1A6Q A;  2R7V A;  3IC7 A;  1Q1H A;  1X1D A;  3H3U A;  4I0A A;  3BCA A;  3HOX J;  1XCB A;  3IHU A;  1LDJ A;  1VQ4 I;  3H35 A;  2DA2 A;  2EB7 A;  2G9W A;  3MVP A;  1TWH J;  3PUB A;  4HYE A;  4A5M A;  2R7Q A;  5M5Y J;  2ISY A;  3BLY A;  4JP0 A;  2R7T A;  3FXO A;  4R1H A;  4U0W A;  1R23 A;  1XMX A;  1P2F A;  1VQ5 I;  1D0X A;  1X1B A;  2ZNY A;  3REO A;  4J00 A;  4IHX A;  2F2E A;  5E3M A;  3CUQ A;  3TO9 A;  2LR8 A;  3QAH A;  2HQA A;  4YRV A;  1SC7 A;  2MYS A;  5BMZ A;  1QPI A;  2HTJ A;  2O61 A;  5DDG A;  2WY8 Q;  3TBI A;  4II2 A;  1LPQ A;  3P7N A;  3ONQ A;  4DYQ A;  3BY6 A;  2Z2S B;  1JI8 A;  1SD7 A;  2LD5 A;  1QNT A;  3OR2 C;  1MSF C;  2F4I A;  3CZ6 A;  1FTT A;  1W5T A;  2F4M B;  4AD9 A;  4LB5 A;  2ZCW A;  2NS8 A;  1KQ0 A;  4G9Y A;  4NBQ A;  1Z05 A;  3VB2 A;  4LIV A;  1A35 A;  1TP4 A;  2M9H A;  2NVU B;  4HV5 A;  1MND A;  4BH9 A;  2G7U A;  1FJL A;  2L4A A;  3K4N A;  1J75 A;  2JA5 J;  4M3E A;  2JQ7 A;  5EG0 B;  1PVE A;  5D6F A;  2GA1 A;  1GLN A;  3FIW A;  4DBR A;  3H5N A;  3S16 J;  3EDP A;  2DMT A;  3E7L A;  2RVC A;  3HRS A;  2GZW A;  2AXL A;  5FFX A;  2PMZ A;  4MQV A;  4F52 A;  5LLQ A;  4GO1 A;  4BYY A;  1IG7 A;  4QTR A;  3JSO A;  4BHP A;  2JSC A;  6PAX A;  2Y9Z A;  2X0L A;  1V5F A;  5J4V A;  4U88 A;  3CDH A;  1YJW I;  4UUT A;  5EJC A;  2D1H A;  3T1B A;  4EV0 A;  1HC8 A;  3LSG A;  2VE9 A;  2OJE D;  1KU2 A;  1YW8 A;  3OIP A;  2A5Y B;  4FE4 A;  1GV5 A;  2E1M B;  1XGN A;  2OF7 A;  5FD6 A;  3LA7 A;  4RDU A;  1DDN A;  2VC1 A;  4MGR A;  1VQ8 I;  2HKO A;  2VXZ A;  2B0L A;  2KZV A;  4UHT A;  4EAT A;  2CJJ A;  5BQT A;  2UXN A;  2EIM H;  3F0C A;  5HDK A;  4KFC A;  1Z6T A;  2M8G X;  1ETQ A;  1YOV B;  1FOK A;  5D5X B;  1E3P A;  4PFO A;  2F5E A;  1UG0 A;  5F1R A;  1YX5 A;  2XAU A;  3SDB A;  4D0P A;  5E8I A;  3I59 B;  1WH5 A;  2FOK A;  1M1E B;  4ESJ A;  3C3W A;  1TZL A;  2ZSI B;  2V7F A;  1ZEL A;  4JYK A;  2FBH A;  3C2H A;  1LFP A;  1R4N B;  3OL3 A;  4UUS B;  4G94 A;  4C2T A;  3OMY A;  1CF7 B;  2KP6 A;  3B73 A;  1H88 C;  2DDA A;  3S2W A;  4G7H F;  1I5Z A;  3C1D A;  4UB6 C;  2HQ5 A;  3ZOB A;  5FO5 A;  2NOJ B;  2W4S A;  3P9C A;  2C6Y A;  4RAY A;  1GV2 A;  2XV4 S;  4XQF A;  4MIM A;  2M45 A;  2UXX A;  1I3Q J;  2O6G E;  1WJD A;  1O3Q A;  1B4A A;  2L7M P;  5J47 A;  1XSX A;  4NQW B;  1IUY A;  3BTC A;  4AIK A;  2ZME C;  1Z1D A;  2ZME A;  3OSG A;  3LQQ A;  4DNC A;  2BW3 B;  1ZAO A;  4CYD A;  2FRH A;  1U6G A;  5AON A;  2W00 A;  3BQY A;  1OYI A;  2VKE A;  1FBS A;  4P1W A;  2XPU A;  1RPW A;  2DI3 A;  3GBG A;  2V6C A;  1ZRD A;  1POG A;  2M30 A;  4V19 K;  1X3W B;  4XLA A;  3WTZ A;  4F3Q A;  3HOU J;  1UEL B;  3FMS A;  2X6O A;  3FXU A;  2NRA C;  2IS4 A;  3OOU A;  1PUE E;  3K2A A;  1K4S A;  2PBI A;  2X6X A;  3CCS I;  3FMR A;  5ICG A;  3I58 A;  2DMN A;  2LDU A;  4UUV A;  4XBF A;  2XIG A;  1ON2 A;  1S5L C;  4KIF A;  1G3Y A;  2XVC A;  4IXA A;  4HQE A;  3VEP A;  2LY2 A;  3BR0 A;  3BTI A;  2BEO A;  2VQL A;  3H1C A;  1AU7 A;  3HTS B;  3PJR A;  5JHU A;  5HOO A;  5D4S A;  1PP8 F;  2I10 A;  3QPS A;  1B9N A;  1FEX A;  3SZT A;  4DYC A;  2GOM A;  1JGG A;  4Y3O A;  1HBX G;  4JX6 A;  4IPA A;  3GLL A;  4BDY A;  2MH2 A;  1IJW C;  3BTJ A;  2CV0 A;  2RRE A;  1J09 A;  2EWN A;  2DMQ A;  2FF4 A;  3K69 A;  4EEF G;  4M6X A;  4ABZ A;  1ETK A;  1DGW Y;  2L3D A;  3BZ6 A;  2DMU A;  1UFM A;  4V2G A;  2JPC A;  4IHS A;  2V79 A;  1OYY A;  2CWE A;  4BJ6 C;  2FX0 A;  2BXY A;  2JVH A;  2HPI A;  2Z1D A;  1RZ4 A;  2WAQ N;  2ZB9 A;  2ETH A;  2CV2 A;  2BY3 A;  3BRO A;  1LNW A;  5LEJ A;  3JRD A;  2Y0M A;  4O3M A;  1JHF A;  2RDP A;  1MD0 A;  1H9G A;  1LVA A;  1TLH B;  1KQ8 A;  4GDF A;  1N77 A;  4FHT A;  1MKM A;  3Q0U A;  4FE7 A;  4D7M A;  1GT0 C;  1FBU A;  1FYM A;  2FOW A;  3KPH A;  2KRH A;  1E3O C;  1YRN A;  3BTL A;  3HOT A;  4HLY A;  2QBY A;  1A36 A;  1FP1 D;  2DFI A;  4LMY A;  5GAD J;  3LA3 A;  4HX4 A;  1ZRC A;  1IN8 A;  2E1C A;  1BOB A;  1OCO H;  3MKY B;  2X4H A;  4HAM A;  5F64 A;  2P0W A;  2DLL A;  3I54 A;  4XKV A;  5L3G A;  2Q2E A;  1P4W A;  1H89 C;  4BU2 A;  2XC7 A;  2O03 A;  2VIX A;  2ZFU A;  1DPR A;  2ZJR F;  1YE9 A;  1SVL A;  1I6H J;  2B7E A;  1BC7 C;  2HNH A;  2QLZ A;  2VQH A;  2J5P A;  3KP6 A;  2ZFW A;  1T39 A;  4FIS A;  1R22 A;  1XGS A;  2AQE A;  3CCY A;  2NS7 A;  3CP2 A;  3BJ6 A;  3N05 A;  4PJM A;  4CYC B;  1RRJ A;  4B43 A;  3ABU A;  2PQ8 A;  4RB0 A;  1JUP A;  3RKY A;  4XLF A;  2VOD A;  1WGX A;  2CW7 A;  1OLT A;  3HBL A;  5HS9 A;  4IZZ A;  3VYR B;  4LG0 B;  1WJF A;  1Z67 A;  3BT9 A;  3F23 A;  1KQ9 A;  2A05 A;  3QQA A;  3JSP A;  4IX7 A;  1NHA A;  2O0Y A;  4NUB A;  3PIP F;  4N4N B;  1FBQ A;  2LKS A;  5F6F A;  1ETW A;  1MIJ A;  2R5Y B;  5CJ9 A;  1MDM B;  1IRX A;  1MMD A;  2AQF A;  3OYN A;  3ZN0 A;  1U3E M;  1XB4 A;  1OPC A;  3CF2 A;  4ESF A;  3RPU A;  2DT7 B;  4JBA A;  4QPQ A;  1W7P A;  1VZ0 A;  1K6Y A;  3S1R J;  2MLK A;  2Z3Y A;  2F48 A;  1HKS A;  2KKO A;  1U9N A;  1FC3 A;  3UR3 C;  4G7Z F;  1Q1V A;  4IHV A;  2A69 F;  2CFX A;  2HQN A;  3EUK L;  2E19 A;  3AKZ A;  4UY8 I;  2RNG A;  3ESW B;  2XHK A;  2IT0 A;  1HLV A;  2ECC A;  1S3J A;  4IQ4 A;  3QOP A;  5ICF A;  3ABK H;  1BL0 A;  1B8I A;  2A6H F;  1YI2 I;  1YHQ I;  2VAS A;  3LSK A;  2E2H J;  3DEU A;  4L5J A;  4A3L J;  5H6R A;  1XMA A;  1ZKG A;  5FRO A;  5IP6 A;  1U5T A;  1ZHF A;  4KIT B;  4KMF A;  1B72 A;  3NAU A;  2JRM A;  3WTW C;  3W2V A;  5HDG A;  1Z6R A;  3FKJ A;  2M5W A;  2K02 A;  3DKX A;  1E3H A;  2V9K A;  2LKX A;  1GVJ A;  3GW2 A;  3KYC B;  3E6C C;  1STZ A;  2WV0 A;  1HXD A;  2QKL B;  5LBQ A;  1V5E A;  4E7L A;  3G3Z A;  1D1C A;  1SD6 A;  4GRI A;  2V1U A;  4BKX A;  4BL0 B;  2X1E A;  2X85 A;  3KP2 A;  3LST A;  4OU0 A;  4XKW A;  2X6W A;  2P8T A;  1HKQ A;  2TCT A;  1A5J A;  1TBX A;  3A03 A;  3KP7 A;  2QYO A;  2FJ1 A;  3HIF A;  4HPQ A;  5KK1 A;  1Z3Y A;  3GCM A;  1MBG A;  4A0X A;  4CSW A;  3S3M A;  3PFI A;  1JJ6 C;  3JAM K;  4QIW N;  4G8X A;  3L2V A;  4OMY A;  5IT3 A;  1Z7U A;  4HDU A;  2VJ4 A;  3W2W A;  2W57 A;  1G8X A;  4RMN A;  4EJO A;  3VYS B;  3FHZ A;  1SAN A;  3JRF A;  2ZJQ F;  1JUM A;  3JRG A;  1Z91 A;  5JVT A;  1K6O A;  2HOE A;  2QVO A;  2MA3 A;  2KT0 A;  1UJ8 A;  3G71 I;  2ZBK A;  5L3D A;  4MNU A;  3WU2 C;  1J2X A;  4CZZ A;  2JA6 J;  3U9G A;  3SZP A;  3CMA I;  1JUS A;  4HX8 A;  3SFZ A;  5KCM A;  1SFU A;  3F22 A;  2GLO A;  4A3D J;  2W84 A;  4QPO A;  4KN4 X;  4A3K J;  4KN7 X;  2JUC A;  1BI2 A;  2R7D A;  3VDX A;  5FLM J;  1R49 A;  1OJL A;  3LSR A;  1SFK A;  2GXB A;  1ETY A;  4EM0 B;  5EGO B;  3M1E A;  2BHY A;  1R5G A;  3DKW A;  1MMA A;  4YEL A;  3M4O J;  5JI6 A;  1H0M A;  1BN5 A;  4WF2 A;  4E4H A;  1IDZ A;  5GAH J;  2EIL H;  4P55 A;  3E5X A;  4E7J A;  4NHJ A;  2IA0 A;  1YJ9 I;  2KJC A;  2M7B A;  4EJW A;  4UV8 A;  3AFH A;  3S1M J;  2KFD A;  3LMM A;  4B48 A;  1FZP B;  3M7G A;  1H9T A;  3QU6 A;  1FYK A;  1GHC A;  4B09 A;  2K27 A;  3Q0W A;  3PIO F;  3KIO A;  2CUJ A;  3H5R A;  3SJM A;  1S8N A;  2XKP A;  1G4D A;  1FX7 A;  4W97 A;  3O2P E;  2VB6 A;  3T0Y A;  2BY1 A;  2IVM A;  1IF1 A;  2MW8 A;  3TQN A;  2K86 A;  3MKZ A;  5EG0 A;  4XSX F;  2OA4 A;  1TW2 A;  2NYX A;  1O3R A;  5KAF C;  3G4S I;  1ZGJ A;  3DKY A;  3HM5 A;  2EIJ H;  4P9U A;  3IRR A;  1Y56 A;  1D5Y A;  3GVA A;  3K4B A;  4BJ5 C;  1KU7 A;  3PNY A;  2RKH A;  4I09 A;  5HDN A;  1MMN A;  5ED4 A;  2I5U A;  5DYM A;  2NAZ A;  1ONV A;  4HG2 A;  1JT0 A;  1MMS A;  3AG4 H;  2E1M C;  4I98 B;  5HVQ C;  1MBE A;  4XOR A;  4DBQ A;  3DWL E;  4M3D A;  3SZG A;  2CQX A;  1X19 A;  2VON A;  1BBY A;  4BXU A;  2K85 A;  5IYD J;  5K5R A;  4HLX A;  4AWX B;  4CUG A;  3CLO A;  3L2U A;  3LFU A;  4G7O F;  4BQN A;  1MJ9 A;  1XN7 A;  4B3X A;  4WXC A;  4B1R A;  2LTP A;  1LQ1 A;  2E34 A;  3L2R A;  2LOO A;  2KLO A;  3I59 A;  3MKL A;  1XGM A;  2IXS A;  2F5V A;  2DTR A;  1X3Z B;  3K6G A;  2QEX I;  3ZP5 A;  1ZGW A;  2LC2 A;  2LG4 A;  4CA0 A;  3PO2 J;  4G12 A;  5D5W B;  3TW6 A;  3ABM H;  1WWX A;  3EYI A;  2E5Z A;  1T08 B;  1TWF J;  3HYI A;  4LGW A;  2QSH X;  5GTI C;  5ERI A;  4ESB A;  3BG6 A;  3OYC A;  1CF7 A;  1B9M A;  2L7K A;  4K2E A;  4AM3 A;  4KDP A;  2VOO A;  3FZV A;  3RDI A;  2D5V A;  1VQK I;  1WJC A;  4RLF A;  4U7B A;  3A2K A;  3JRE A;  3I4P A;  4DZJ A;  1MJB A;  1VQ6 I;  1BW5 A;  2O8X A;  4F7Z A;  2OTJ I;  3DFG A;  4HZF A;  2HPM A;  2LFB A;  3DXJ F;  2ISZ A;  1DU6 A;  3DF8 A;  1V55 H;  4XKB A;  4NQW A;  3RQI A;  1TT0 A;  3J7Z I;  2XRL A;  5TJJ A;  3J81 K;  2ID6 A;  4J01 A;  2IPQ X;  2BW3 A;  3FHN A;  3FXJ A;  4EJT A;  3SEQ A;  5E20 A;  1I6X A;  5IPA A;  1Z21 A;  2M2E A;  4X0G A;  1ULY A;  2LY1 A;  3QYF A;  2BXZ A;  3IH2 A;  2DA5 A;  2V4J C;  4HV6 A;  1ITY A;  3CLQ A;  1FTZ A;  3CC2 I;  3ZMU A;  1H8A C;  1G3W A;  2H1L A;  3T8R A;  2E2J J;  2DK5 A;  2VOP A;  4Q47 A;  2PI0 A;  3L2C A;  2QQB A;  1I39 A;  3ASO H;  3I4N J;  1LB2 A;  2OC6 A;  4LD5 A;  3TGN A;  3ZMD A;  4RB1 A;  3OIQ A;  1O4X A;  3B02 A;  2XSJ C;  4IRG A;  5K7F A;  3H0D A;  3OIO A;  1D3Y A;  3SHF A;  2AHQ A;  2H09 A;  3FK7 A;  4PSX A;  4HW0 A;  3V7S A;  1P92 A;  3NAR A;  4BS9 A;  4LK0 F;  3GFI A;  3UKG A;  2XF6 A;  3WTU C;  2F5C A;  4XKC A;  2IA1 A;  4I99 C;  1MBF A;  5K7Z A;  5D4R A;  2L01 A;  4ZZD A;  5LGN A;  4UV9 A;  4MQ9 F;  4AUX A;  2JRT A;  2LNB A;  3H36 A;  2M0C A;  3J80 K;  3IWZ A;  1N25 A;  5AIP A;  4CCM A;  3CCL I;  1MGT A;  1WHU A;  5LGU A;  4J19 A;  3NWS A;  4L18 B;  4I02 A;  4E6K G;  1JT6 A;  3JRB A;  1JJ8 C;  5DTD A;  1D8K A;  4QWQ A;  2VBZ A;  2ZNZ A;  4NC6 A;  3CUQ C;  1MH3 A;  3BCB A;  2KIS A;  1I1G A;  1OCZ H;  1Y8R B;  1Z77 A;  2UZK A;  4PJJ A;  2K40 A;  2FEZ A;  4CCN A;  1ETX A;  3DTE A;  4QSH A;  5F0F A;  4E7H A;  1K78 A;  1TC3 C;  4AID A;  2M8E A;  2B63 J;  4AIH A;  1XX5 A;  5E3L A;  2LP0 A;  5EEH A;  2JA7 J;  5E1W A;  4F93 B;  4NDL A;  4RAG A;  1WPK A;  2FNP A;  4YIR X;  4A12 A;  5D8L B;  3V7C A;  3V8J A;  3Q5F A;  3GFM A;  3HRT A;  3RYP A;  2G7H A;  3K4L A;  5ILV A;  4A3E J;  3ZPL A;  2B9S A;  1IO2 A;  3H0G J;  1V4R A;  4PFP A;  3I71 A;  1Z9C A;  4C3H J;  4JQF A;  2K3F A;  2LRE A;  4XRF A;  2HQR A;  2DT6 A;  1F1Z A;  1FOW A;  1Y1V J;  3ROU A;  3AG1 H;  3CDI A;  3BZC A;  2KDZ A;  4HF0 A;  1QVU A;  5DV5 A;  4XSZ F;  2WTE A;  3H9Q A;  1S7O A;  2QSF X;  5DEQ A;  3WGI A;  1T2K A;  3OS0 A;  2ID3 A;  2WB1 N;  3WTT C;  4KIB A;  1AKH B;  4BBS J;  1HA8 A;  3CCM I;  2KRF A;  4M6Y A;  3JRA A;  2ELH A;  3P9I A;  2BVL A;  1LEB A;  1AA7 A;  4C2M J;  3DBH B;  4CYC A;  3HGY A;  3LSP A;  4BY1 J;  5A2Q K;  4E7I A;  1XPX A;  3GTK J;  2DA3 A;  2DCE A;  1X1C A;  4G6Q A;  3M07 A;  4LG0 A;  2XGD A; 
#chains in the Genus database with same CATH homology
 4L9J A;  2GWR A;  2XGX A;  1QQI A;  2HEO A;  1MDM A;  4CXF A;  1BIB A;  5A2Q Z;  1ODD A;  3NEU A;  5HLH A;  3M8E A;  2CYY A;  1IN5 A;  1R58 A;  3F8F A;  1O3T A;  3HHH A;  3M8F A;  2L02 A;  4BHC A;  1T38 A;  2XAG A;  3FMQ A;  1UHM A;  1HQC A;  3W6K B;  3G73 A;  1YG2 A;  2XAH A;  4BAY A;  4HBL A;  4UVA A;  1EH7 A;  1G6N A;  3KFW X;  4FX4 A;  5H20 A;  1XGO A;  1A04 A;  2CQK A;  2OBP A;  4OIQ F;  3KET A;  1CGP A;  3KE2 A;  4M72 A;  2OZU A;  2XAS A;  3Q9S A;  2NNN A;  4Q5S F;  1J5Y A;  4L9N A;  3R6S A;  4WWC A;  2RC4 A;  2FA5 A;  3BWG A;  1DPU A;  4FT8 A;  2R7F A;  3V7R A;  4PGH A;  3FXQ A;  2DBB A;  3F8N A;  4GCV A;  1XD7 A;  1K7A A;  3OOP A;  4M9X A;  2PN6 A;  2EV6 A;  1OR7 A;  3U2R A;  3RPQ A;  1D5V A;  3R0J A;  3F6V A;  1P4X A;  4MTD A;  5DD8 A;  1QO0 D;  4E70 A;  2QEN A;  2QZ8 A;  3BOQ A;  3ELK A;  3HSR A;  4M9S A;  1IXS B;  1GXP A;  3QPH A;  4P5O A;  4GYG A;  4RGU A;  5HS7 A;  1O3S A;  3L7W A;  2XAF A;  1SFE A;  2YX7 A;  3SXY A;  4YG2 F;  3I64 A;  1W5S A;  2P5L C;  1FNN A;  3T8T A;  1K78 B;  2CSO A;  4CDG A;  3WGH A;  2HZT A;  1ZGA A;  1KYZ A;  3H3Z A;  1FT9 A;  2GA2 A;  2QQA A;  3P9K A;  4YFK F;  4GXO A;  1KA8 A;  5ILU A;  1B6A A;  3WE3 A;  3GX4 X;  1JHH A;  2MLG A;  5BOX A;  1QGP A;  1SMT A;  5CVI A;  4EGZ A;  2FSW A;  1LEA A;  5CYV A;  5LRS A;  1YQA A;  2EV0 A;  3E6D A;  3EYY A;  2YX4 A;  2BE5 F;  1FPQ A;  2MD5 A;  2W25 A;  2M87 A;  2FBK A;  3F8C A;  2V1X A;  3GXO A;  3HHG A;  5BPD A;  2OU2 A;  5D8K B;  3I0T A;  3KCC A;  3VFZ A;  5LHH A;  2GAU A;  1YW7 A;  3K2Z A;  2COM A;  3Q9V A;  4L5I A;  1F5T A;  4BNC A;  5HS8 A;  2A3S A;  4HF2 A;  1WKM A;  2XRO A;  4RB2 C;  5FGM A;  5DUI A;  3CO6 C;  2F5F A;  3FXR A;  3RKX A;  2HFH A;  2QM3 A;  4LJZ F;  4AVP A;  5FLX K;  1F9N A;  4KIC A;  3LAJ A;  3ABT A;  3WTY C;  1B1B A;  4IVN A;  1U5T C;  4IRH A;  4WCG A;  4PZJ A;  3KZY A;  2W85 A;  5EEG A;  5E18 F;  3DPL C;  2DQL A;  3DP7 A;  1LJ9 A;  3HOS A;  4EQQ A;  1MJA A;  3MFK A;  1UST A;  1UHW A;  2IJL A;  1K79 A;  1FWZ A;  3E5U A;  1YFH A;  2E7W A;  1PDN C;  4RB3 C;  3RI4 A;  3L9F A;  4YII A;  1EV7 A;  3QRF F;  3JTG A;  1FSH A;  2HTS A;  1R1U A;  1R00 A;  3HSE A;  1OKR A;  1O57 A;  1O7F A;  4HDV A;  1VTN C;  2JZY A;  2HYF A;  4ENM A;  2VE8 A;  1ZH5 A;  4A2U A;  2HR3 A;  1J59 A;  4IJA A;  2FXA A;  3GLX A;  3M9A A;  1ON1 A;  4LFU A;  2VBW A;  3JAM Z;  2FML A;  3EUH A;  4EJU A;  2ZJ2 A;  5HLG A;  3ZMS A;  2XAQ A;  4CO8 A;  1QPM A;  3TKY A;  1YO5 C;  2STT A;  3EET A;  3FWE A;  3WU1 B;  2MC3 A;  1KU3 A;  3PQJ A;  1IXR C;  3TO6 A;  4O6J A;  5L3F A;  5K5O A;  3CO7 C;  2PG4 A;  1FY7 A;  2YSR A;  5K5Q A;  3WTX C;  4XLN F;  5HLI A;  2DU9 A;  1B59 A;  5LGT A;  3K1P A;  5CVU A;  4OMZ A;  3MWM A;  1KU9 A;  1HW1 A;  2EFN A;  1ZRF A;  1EH8 A;  3TDU C;  2LF8 A;  3LQR A;  3BJA A;  4U0V A;  2NS0 A;  4RGX A;  2V1D A;  3HRU A;  2BGC A;  4ZZL A;  5K1Y A;  4MTE A;  4ZYH A;  3D0S A;  2FBI A;  5J8F A;  1LDD A;  4GGG A;  3T5X A;  1LDK B;  3FX3 A;  4G6D A;  3K9T A;  3RIR A;  2VBX A;  3K1M A;  1JXS A;  4N9H A;  2OZ6 A;  1HKT A;  1DP7 P;  3IKT A;  3CUO A;  3R4K A;  5E17 F;  2H6C A;  2ZKZ A;  1ZG1 A;  2KJB A;  2STW A;  2Z5U A;  3RKW A;  1IRG A;  4EGY A;  4M74 A;  2VC0 A;  1IN6 A;  1FYM A;  1SD5 A;  3GFJ A;  3N4M A;  4Q48 A;  3ULQ B;  4R79 A;  2L4M A;  2P5V A;  1IRF A;  2VBY A;  3HSF A;  1XCV A;  3LA2 A;  2R3S A;  5J8C A;  4P9F A;  1JE8 A;  3GEZ A;  2BV6 A;  1BIA A;  5DUK A;  5LEK A;  4OIN F;  3WTS C;  2O3F A;  2E7X A;  3KZZ A;  1BI0 A;  1W4M A;  5AIQ A;  3MAJ A;  2P6T A;  4UXN A;  3AAF A;  4RS8 A;  3J81 Z;  4IHT A;  5ICC A;  4KUM A;  4UVC A;  4N0B A;  1IW7 F;  4Z2Y A;  3GWZ A;  3RTR A;  2GQQ A;  3ISP A;  5CLS A;  1WRJ A;  3SQN A;  2H94 A;  2WC2 A;  1YS6 A;  3EQL F;  2TDX A;  4M9Z A;  2V9V A;  2D1V A;  2K4B A;  2EA2 A;  4PGG A;  1HSJ A;  1YW9 A;  3I53 A;  3WOD F;  3E97 A;  2EFQ A;  4YIF A;  4OIR F;  3OV8 A;  3MEX A;  5LHG A;  4O5V A;  2JPB A;  3J80 Z;  1S6L A;  1YS7 A;  4L9T A;  1OYW A;  1BJA A;  4RAZ A;  1T98 A;  1PP7 U;  1ZYR F;  4A0Z A;  2PEX A;  2UWM A;  1R36 A;  3R0A A;  1YIO A;  2LSO A;  3N97 A;  1T0F A;  3QP6 A;  3DPT A;  2EFW A;  4LLG F;  3V8L A;  3E6M A;  1XDU A;  2H27 A;  2XRN A;  4MHG A;  2Q0O A;  2D2W A;  2K7L A;  2XKO A;  1R5H A;  3HUG A;  5L3B A;  1XDS A;  3TOB A;  1BC8 C;  4A0Y A;  2BYV E;  3ZMV A;  5LRR A;  1QBJ A;  1R1T A;  3GUD A;  4HA8 A;  4ZYD A;  2HKX A;  3BPX A;  2IA2 A;  2ZXJ A;  1SFX A;  3GO5 A;  3L09 A;  1IXC A;  3V4G A;  4UNO A;  2M1B A;  5DCM B;  3GF2 A;  4JK1 X;  1TQM A;  1BM9 A;  4L9V A;  4DQ2 A;  4HF1 A;  3IWF A;  1I1S A;  1ZG3 A;  3O6B B;  4ETS A;  4ON0 A;  4S05 A;  2Q8K A;  3MCZ A;  2JTV A;  1YYV A;  1RUO A;  5D6E A;  3ZN1 A;  1G3S A;  4YFN F;  1TW3 A;  3KEO A;  2AS5 F;  1RI7 A;  3K0L A;  4ENJ A;  4OOI A;  5ICE A;  2FNA A;  3CJN A;  2IP2 A;  1J9I A;  3ML6 A;  1S29 A;  2ADU A;  2YPR A;  3L00 A;  4BHB A;  1FLI A;  1E17 A;  3RYR A;  3BPV A;  3QP5 A;  4TV7 A;  2MH9 A;  2DO7 A;  1P6R A;  2A61 A;  1R7J A;  2MBF A;  5TRD A;  2RQP A;  3VOE A;  4A5N A;  1KGS A;  3R60 A;  3F8M A;  3KP3 A;  4Y13 A;  4LB6 B;  2DQR A;  3V8K A;  3CTA A;  1WSU A;  2EK5 A;  1BOA A;  1Y0U A;  4YFX F;  1ZLK A;  5JFR A;  2P5K A;  3C18 A;  5KVR A;  2YU3 A;  3TOA A;  1O7L A;  1I27 A;  1ZRE A;  1D8J A;  1USS A;  1AOY A;  1L0O C;  2GIV A;  3E6B A;  3IL2 A;  5FB2 A;  4R8H A;  4MEX F;  4LK1 F;  1MZB A;  3ZMZ A;  3BP8 A;  5H6Q A;  2FMY A;  1XSD A;  2A68 F;  1F4K A;  1U8R A;  4ZH4 F;  2CO5 A;  5E8G A;  4GYI A;  3F21 A;  2HWV A;  2FQ3 A;  3WG9 A;  1BI1 A;  3FM3 A;  3CUQ B;  1W7P D;  3IKV A;  1IN4 A;  5CVV A;  3ERE D;  5D5V B;  2PLY A;  1WQ2 A;  5L3E A;  1IZ1 A;  2P7C B;  3E3V A;  3F8B A;  2DPU A;  4L0Z B;  3NQO A;  1ZLJ A;  4KMU X;  4A6E A;  1YTY A;  4UVB A;  4CIC A;  2A6E F;  4KT5 C;  2VT2 A;  1E2X A;  3J7A O;  3H92 A;  3COA C;  4FX0 A;  2HS5 A;  5FFZ A;  4KA4 A;  2CG4 A;  1XSV A;  2Y48 A;  1TTY A;  4CHU A;  1HW2 A;  1OMI A;  1QZZ A;  2QWW A;  1DUX C;  3ECH A;  3ZQ7 A;  3K1N A;  5CVJ A;  3LAP A;  1ZAR A;  3F3X A;  4LLL A;  1S7A A;  4KNY A;  4I0B A;  5DCF A;  2W24 A;  2VN2 A;  1SMY F;  4LLN A;  1U2W A;  2EA4 A;  2KIU A;  4XLP F;  2D45 A;  1QZY A;  4RGR A;  4N9I A;  2F5D A;  4I01 A;  1TQP A;  1P4A A;  1L3L A;  3BJO A;  2P4W A;  3QU3 A;  1X3U A;  5FLX Z;  1RNL A;  2XAJ A;  4HQM A;  2EFO A;  2A07 F;  3R61 A;  4Q4Z F;  4Y15 A;  3F72 A;  5E1X A;  4PCQ A;  3FM5 A;  2FE3 A;  2JT1 A;  2PFB A;  3VOD A;  2VT3 A;  2OQR A;  3IRQ A;  2Z9O A;  3O3K A;  2ZME B;  2E1N A;  5BPI A;  1RUN A;  1TNS A;  3LWF A;  3WGG A;  4OIO F;  2L54 A;  4U7D A;  3TDZ C;  3KLN A;  2Z99 A;  3E5Q A;  4QLC U;  3WTV C;  4ENN A;  1IAW A;  4WX9 A;  4PDK A;  5BS6 A;  2RNJ A;  2Y75 A;  1UCR A;  2H6B A;  4M71 A;  1UB9 A;  2RV8 A;  3BDD A;  4KIG A;  2BBY A;  2HDC A;  3ECO A;  4I7H A;  5J6X A;  3MZH A;  4EM1 A;  3LFK A;  1SD4 A;  2EV5 A;  3TO7 A;  3C7J A;  2IW5 A;  4MEY F;  1HST A;  1EH6 A;  1GXQ A;  1JGS A;  5CVR A;  2P7V B;  4I2O A;  1IN7 A;  4ENK A;  2P6S A;  1V3F A;  2WWY A;  2ESH A;  1J0R A;  3JW4 A;  5FD5 A;  4AIJ A;  2ESN A;  5LHI A;  4WXD A;  4M73 A;  1YLF A;  5JR3 A;  4B8X A;  2QBY B;  1BI3 A;  4RGS A;  3F6O A;  4L0Y B;  4A6D A;  3GZ6 A;  3I5U A;  3NRV A;  2RGV A;  1REP C;  2KIF A;  1FYL A;  1WI9 A;  3DQV C;  4EJV A;  2OQG A;  2QUF A;  1TNT A;  2CGP A;  5E1Z B;  1FSE A;  4KYW A;  3JTH A;  3KLO A;  1J7K A;  1FP2 A;  2PJP A;  2ZO4 A;  2PMU A;  4EMS A;  2NNY A;  1RIO H;  2ACJ A;  3RJP A;  2LKP A;  2DK8 A;  4U0Y A;  1KYW A;  2PMH A;  3WE2 A;  2EJR A;  5L3C A;  5DCM A;  4EM2 A;  4P96 A;  4ZYE A;  4WXH A;  2XUB A;  1G3T A;  4EVI A;  5ILS A;  2J5O A;  1U78 A;  1W7P B;  3DV8 A;  2IRF G;  2KIM A;  3U1D A;  1T6S A;  3ZMT A;  4CGZ A;  2FU4 A;  2RN7 A;  3MZY A;  4HOB A;  4ASN A;  3KP5 A;  3FF5 A;  1AWC A;  4IRI A;  4BQA A;  2HYG D;  3QPT A;  1C0W A;  3GFL A;  1U5T B;  2YR2 A;  3KP4 A;  2OAZ A;  2K4J A;  4NB5 A;  1TQI A;  4S04 A;  2CW0 F;  3W6J B;  4ZYG A;  2DPD A;  3GYH X;  2DW4 A;  2GXG A;  3PQK A;  2LF7 A;  1R1V A;  3HTU A;  2QQ9 A;  3GZ5 A;  1HW5 A;  1ZG5 A;  5IT9 K;  4HX7 A;  2EFP A;  2DAO A;  1XMK A;  4IF4 A;  2OD5 A;  5IT9 Z;  3WU0 A;  2HGC A;  2DT5 A;  3KEQ A;  4H0E A;  5D5U B;  3D5L A;  4OIP F;  1ZN2 A;  3HRM A;  4Y17 A;  3MQ0 A;  2Z33 A;  5DD4 A;  4WK8 F;  1SAX A;  3IC7 A;  1Q1H A;  3H3U A;  4I0A A;  1XCB A;  3IHU A;  1LDJ A;  2EB7 A;  2G9W A;  4HYE A;  4A5M A;  2ISY A;  4U0W A;  4R1H A;  1R23 A;  1P2F A;  2ZNY A;  3REO A;  2F2E A;  3CUQ A;  3TO9 A;  3QAH A;  5BMZ A;  2HTJ A;  2O61 A;  5DDG A;  3P7N A;  3BY6 A;  1SD7 A;  1QNT A;  1W5T A;  4AD9 A;  4LB5 A;  2ZCW A;  1KQ0 A;  4G9Y A;  1Z05 A;  3VB2 A;  4HV5 A;  4BH9 A;  2G7U A;  2L4A A;  1J75 A;  5D6F A;  2GA1 A;  3EDP A;  2RVC A;  5LLQ A;  3HRS A;  2GZW A;  2AXL A;  5FFX A;  4MQV A;  4GO1 A;  4BYY A;  3JSO A;  4BHP A;  2JSC A;  6PAX A;  2X0L A;  4U88 A;  3CDH A;  2D1H A;  3T1B A;  4EV0 A;  2VE9 A;  1KU2 A;  1YW8 A;  2A5Y B;  1XGN A;  5FD6 A;  3LA7 A;  1DDN A;  2VC1 A;  4MGR A;  2HKO A;  2VXZ A;  2B0L A;  4UHT A;  5BQT A;  2UXN A;  5HDK A;  4KFC A;  1Z6T A;  1FOK A;  5D5X B;  2F5E A;  5F1R A;  4D0P A;  5E8I A;  3I59 B;  4ESJ A;  2FOK A;  3C3W A;  2FBH A;  4G94 A;  1CF7 B;  3B73 A;  3S2W A;  4G7H F;  1I5Z A;  3C1D A;  5FO5 A;  3P9C A;  2C6Y A;  4RAY A;  2XV4 S;  2M45 A;  2UXX A;  2O6G E;  1O3Q A;  1B4A A;  1XSX A;  1IUY A;  4AIK A;  1Z1D A;  2ZME A;  3LQQ A;  4DNC A;  1ZAO A;  4CYD A;  2FRH A;  1U6G A;  5AON A;  1OYI A;  1FBS A;  2DI3 A;  2V6C A;  1ZRD A;  2M30 A;  3WTZ A;  3FMS A;  3FXU A;  2NRA C;  1PUE E;  2PBI A;  3FMR A;  5ICG A;  3I58 A;  2LDU A;  4UUV A;  4XBF A;  2XIG A;  1ON2 A;  4KIF A;  1G3Y A;  2XVC A;  4IXA A;  4HQE A;  3VEP A;  2BEO A;  3HTS B;  5JHU A;  5HOO A;  5D4S A;  1PP8 F;  1B9N A;  3SZT A;  1HBX G;  4IPA A;  2MH2 A;  2EWN A;  2FF4 A;  3K69 A;  4M6X A;  2L3D A;  3BZ6 A;  1UFM A;  2JPC A;  4IHS A;  2V79 A;  1OYY A;  2CWE A;  1RZ4 A;  2ETH A;  3BRO A;  1LNW A;  5LEJ A;  2Y0M A;  4O3M A;  1JHF A;  2RDP A;  1MD0 A;  1H9G A;  1LVA A;  1TLH B;  1KQ8 A;  4FHT A;  1MKM A;  1FBU A;  3HOT A;  4HLY A;  2QBY A;  1FP1 D;  2DFI A;  4LMY A;  3LA3 A;  4HX4 A;  1ZRC A;  1IN8 A;  2E1C A;  2X4H A;  4HAM A;  5F64 A;  2DLL A;  3I54 A;  5L3G A;  2Q2E A;  1P4W A;  2O03 A;  1DPR A;  1BC7 C;  2QLZ A;  2J5P A;  3KP6 A;  2ZFW A;  1T39 A;  1R22 A;  1XGS A;  3BJ6 A;  3ABU A;  2PQ8 A;  4RB0 A;  3RKY A;  2VOD A;  5HS9 A;  4LG0 B;  3F23 A;  1KQ9 A;  3JSP A;  1NHA A;  2O0Y A;  1FBQ A;  5F6F A;  5CJ9 A;  1MDM B;  3ZN0 A;  1U3E M;  1XB4 A;  1OPC A;  4ESF A;  3RPU A;  4JBA A;  1W7P A;  2MLK A;  2Z3Y A;  1HKS A;  2KKO A;  1FC3 A;  4G7Z F;  2A69 F;  2CFX A;  2HQN A;  2XHK A;  2IT0 A;  1S3J A;  3QOP A;  5ICF A;  2A6H F;  3DEU A;  4L5J A;  5H6R A;  1XMA A;  1U5T A;  1ZHF A;  4KMF A;  3WTW C;  5HDG A;  1Z6R A;  2M5W A;  2K02 A;  1GVJ A;  3GW2 A;  3E6C C;  1STZ A;  2WV0 A;  1HXD A;  5LBQ A;  3G3Z A;  1SD6 A;  2V1U A;  3KP2 A;  3LST A;  4OU0 A;  2P8T A;  1HKQ A;  1TBX A;  3KP7 A;  2QYO A;  3HIF A;  5KK1 A;  4A0X A;  3PFI A;  3JAM K;  4G8X A;  4OMY A;  5IT3 A;  1Z7U A;  4HDU A;  2W57 A;  4EJO A;  3FHZ A;  1Z91 A;  5JVT A;  1K6O A;  2HOE A;  2QVO A;  2MA3 A;  2ZBK A;  5L3D A;  4MNU A;  1J2X A;  4CZZ A;  3U9G A;  3SZP A;  4HX8 A;  3SFZ A;  1SFU A;  3F22 A;  2W84 A;  4KN4 X;  4KN7 X;  1BI2 A;  2R7D A;  2GXB A;  4EM0 B;  3M1E A;  1R5G A;  3DKW A;  5JI6 A;  1H0M A;  4WF2 A;  1BN5 A;  4P55 A;  3E5X A;  4NHJ A;  2IA0 A;  2KJC A;  4EJW A;  4UV8 A;  1FZP B;  3M7G A;  1H9T A;  3QU6 A;  1FYK A;  1GHC A;  4B09 A;  2K27 A;  1S8N A;  2XKP A;  1G4D A;  1FX7 A;  3O2P E;  3T0Y A;  1IF1 A;  2IVM A;  3TQN A;  2K86 A;  4XSX F;  2OA4 A;  1TW2 A;  2NYX A;  1O3R A;  1ZGJ A;  4P9U A;  3IRR A;  3GVA A;  1KU7 A;  2RKH A;  4I09 A;  5HDN A;  5ED4 A;  5DYM A;  2NAZ A;  1ONV A;  4I98 B;  5HVQ C;  2VON A;  1BBY A;  4BXU A;  5K5R A;  4HLX A;  4AWX B;  3CLO A;  4G7O F;  1MJ9 A;  1XN7 A;  4WXC A;  1LQ1 A;  3I59 A;  1XGM A;  2DTR A;  3ZP5 A;  5D5W B;  1WWX A;  3EYI A;  4LGW A;  3HYI A;  5ERI A;  4ESB A;  1CF7 A;  1B9M A;  4K2E A;  4KDP A;  2VOO A;  3FZV A;  3RDI A;  4U7B A;  3I4P A;  1MJB A;  2O8X A;  4F7Z A;  3DFG A;  4HZF A;  3DXJ F;  2ISZ A;  3DF8 A;  4NQW A;  5TJJ A;  3J81 K;  2IPQ X;  4EJT A;  5E20 A;  1I6X A;  1ULY A;  4HV6 A;  3ZMU A;  1G3W A;  3T8R A;  2VOP A;  2DK5 A;  4Q47 A;  2PI0 A;  3L2C A;  2QQB A;  1LB2 A;  4LD5 A;  4RB1 A;  3TGN A;  3ZMD A;  3B02 A;  4IRG A;  1D3Y A;  3SHF A;  2H09 A;  4HW0 A;  3V7S A;  1P92 A;  4LK0 F;  3GFI A;  3WTU C;  2F5C A;  2IA1 A;  5D4R A;  2L01 A;  4ZZD A;  5LGN A;  4UV9 A;  4MQ9 F;  2JRT A;  2LNB A;  3J80 K;  3IWZ A;  5AIP A;  1MGT A;  5LGU A;  4L18 B;  4I02 A;  1D8K A;  4QWQ A;  2VBZ A;  2ZNZ A;  3CUQ C;  1I1G A;  2UZK A;  2FEZ A;  1K78 A;  2M8E A;  4AIH A;  5EEH A;  5E1W A;  2FNP A;  4A12 A;  5D8L B;  3V7C A;  3V8J A;  3Q5F A;  3GFM A;  3HRT A;  3RYP A;  2G7H A;  5ILV A;  3ZPL A;  1V4R A;  3I71 A;  1Z9C A;  4JQF A;  4XRF A;  2HQR A;  1F1Z A;  3ROU A;  4HF0 A;  5DV5 A;  4XSZ F;  2WTE A;  1S7O A;  5DEQ A;  3WGI A;  1T2K A;  3WTT C;  4KIB A;  2KRF A;  4M6Y A;  2ELH A;  3P9I A;  1LEB A;  5A2Q K;  4G6Q A;  4LG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...