1MD2D

Cholera toxin b-pentamer with decavalent ligand bmsc-0013
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
102
Chain Sequence
TPQNITDLAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN B SUBUNIT
publication title Solution and crystallographic studies of branched multivalent ligands that inhibit the receptor-binding of cholera toxin.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 24
structure length 102
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1md2D00
1TS4A 1BXTA 1TY2A 1G8ZD 1LTSD 1XXGA 2AQ1B 2Z8LA 2RDGA 1LTID 3TSSA 1LTBD 2IJ0A 3R2IA 1SJHD 1DJRD 1JCKB 1JWUD 1PTOC 1V1PA 2SEBD 1HQRD 4L63B 1LT6D 1LTRD 2QILA 1FNUA 1UNSA 2XRSD 1I4HA 5ELCA 4OHJA 3O13A 1BCPB 5ELEA 1RF2D 1PRTC 1D5MC 1T5XD 1CT1D 1QILA 1S5BD 1FGBD 3URYA 1PTOH 1S5ED 1CQVA 1V1PB 2XRQD 1STEA 3BZDB 3SEBA 1I4XA 1M4VA 4C56C 1EU4A 4RGMA 5FKAC 4UDUC 1RDPD 1SXTA 1SEBD 1PTOB 3EFXD 1AN8A 3W2DA 1XTCD 3V05A 1SE4A 1LTTD 1B1ZA 4K6LA 4BWGB 2R61A 1KLUD 1EFID 4Z9CB 1BCPD 1FNVA 2CHBD 1B44D 1EEID 1GOZA 3BYTB 1PRTB 5I4DA 1BCPF 3R8BA 2O2LD 2J4XA 1LO5D 3BYYB 1PYWD 3EA6A 4RCOA 5D3DA 1DYQA 1S5FD 1ENFA 3GP7A 2NTTA 1FNWA 4RFBA 1HXYD 3BVZA 5ELBA 2ICIA 3KLSX 1PTOD 1SJED 1FD7D 2RDHA 3DWQA 4RGTA 1PZJD 4RHRA 1D5ZC 3DWAA 4RGOS 1S5CD 1PTOF 1JQYD 4RHSA 1LT3D 1LT4D 4DXGA 1HTLD 1JR0D 4L6TB 4TSSA 4DXFA 1HA5A 1I4QA 1LLRD 5TSSA 1SE3A 1L0XB 1PZID 1KTKA 1PRTF 2WV6D 1I4RA 3MFGA 1D5XC 5D3IB 2XN9C 1I4PA 1ET6A 2G9HD 2TSSA 3DWPA 2XNAC 2AQ3B 1LTGD 1TS2A 3R2TA 1AW7A 1V1OA 1SBBB 3BVMA 1ESFA 5FK9C 1ET9A 2QEJC 1I4GA 4O1NA 1EU3A 1TY0A 1CHPD 1L0YB 1F77A 2NTSA 1RCVD 1TS5A 3OWEB 1JWMD 2IPKD 1JWSD 1LTAD 3MC0B 1LT5D 1KLGD 1PRTD 4ZYSA 1RD9D 1D6EC 1S5DD 1TS3A 3BVGA 1BCPC 1CHQD 4RGNA 2AQ2B 1SE2A 1EEFD 1PZKD 1CK1A 1UUPA 1EWCA 3CHBD 5ELDA 4RH6A 1MD2D 5ELFA
chains in the Genus database with same CATH superfamily
2EY1A 4HJ9A 1RKNA 4S3SA 2CWAA 4RWSC 1HZBA 2F0EA 1SJHD 2H4OA 1B7YB 2HD3A 3BDOA 4JBWA 2F52A 5C44G 5DLQE 1LV9A 1JJ2A 3BU2A 3ULJA 4DAMA 4FYDA 3VR2A 2KCCA 4JI1L 2SOBA 4J6HA 2LKVA 3SK8A 2R93H 5IYBH 3H0GB 2B63G 2E74C 3ULPA 3GQBA 3URYA 1IYUA 1E2ZA 2IHEA 4GOPB 4C2MH 1BF4A 4FF4A 3A7AB 2AWOA 3IRBA 5T1IA 1GKHA 4NPSA 3SXHA 3I55A 1SNMA 2JJQA 4DGZA 2RKSA 1VQNA 4K6LA 1M8AA 4WJ3M 3PO2H 3TZUA 4ILWA 1EFID 3MEFA 3RNUA 4K2KA 5JPMC 3HOUG 3L2PA 4DV0L 1AEXA 4HMJA 2L15A 5KGUA 1VQBA 3L3OC 5FO9B 1HJPA 4LUOA 4DR2Q 2JE6I 1HA6A 2UUBL 4ID6A 4JOIA 2WKCA 4B9WA 4BY7H 4OELB 5FLMG 3J81j 2GVAA 3I70A 2L12A 2VB3X 3D4DA 3HOVG 3VA7A 2YYZA 1QNKA 3Q23A 1Q1EA 4NB3A 3UE1A 4KMUC 4KD4A 1EIYB 1HTLD 2F0LA 1PMRA 1G51A 4JBKA 4K14A 1KAWA 4BS9A 5TSSA 1EFWA 2ZXOA 1IBLL 1G291 5KYIA 3M3YH 5ELNA 1A3UA 1MIUA 5JOBA 1CSPA 3S16H 1DZ1A 2JQOA 3HOWH 4K5WA 1VQJA 3TZDA 1PH9A 4B9XA 4UP7A 4Y7NB 4RA8A 1SSOA 1DCZA 1IW7D 1F2YA 1H9KA 2G9DA 4K5VA 4DV1L 5JPNC 1TU2B 3W5OA 4C1NK 1QUQA 1EOVA 2PMZE 3F8TA 2OEOA 1PRTD 5KEEA 3T16A 3D6CA 1U4RA 2DUDA 1RTOA 3MHBA 2F3VA 1S3OA 2B2TC 2UUCL 2R93B 1JOKA 4A3MH 2JA5H 5JJKA 1SNOA 5M5XH 1UAPA 1LTBD 3GTGH 1STBA 1IBKQ 1X3EA 2K5VA 4C2MB 4BBRG 1I50H 2FJ2A 2LFNA 2OQ0A 3E6ZX 1XPUA 1I3QH 3PO2B 1PYBA 1A2TA 3CCSA 1FL0A 3JAML 1M4VA 1IHZA 4UHVA 3T1YL 2QF7A 2V4DA 2UUCQ 2HCCA 4H13C 2K52A 4HIDA 4LF7Q 3W2DA 3H6MA 5CBAE 1SE4A 2NZOA 5IT9L 4BWGB 2F0JA 4DV4L 1GOZA 3EJIA 2I5MX 3MXUA 4A3IH 3DHQA 4KY5A 1EOTA 3R8BA 3GTLH 2FMCA 2F1MA 2R92B 4NKLA 4RCOA 3F1ZA 1KDBA 4B3SQ 5C5LA 4DR7L 2NTTA 2F0GA 3NXWA 1YJNA 1YNNC 2VQEQ 3T1YQ 5A2QE 3HOZB 3SK4A 4LF8L 2JN4A 1JQYD 3CU7A 2CQOA 5ELOA 5LHY1 3PO3G 3M9BA 2CWPA 3GV6A 4JYAL 1BOSA 2M2LA 1H9MA 2WV6D 3KBXA 3MZ5A 2KEEA 4L5QA 4A3CG 2VQFL 2JA7H 3GTMB 1XNRL 1E3PA 1IXRA 5CMDA 1KD1C 4DR7Q 5IT9c 2D2CC 1ESFA 1UE6A 3NQTA 1EU3A 4A3MB 2NN6I 2K04A 4QB4A 2F3WA 4XYOA 4GKJQ 1VQ7A 1I50B 1XPOA 2NN6G 4N8FA 2D9UA 1EWIA 1CK1A 3DLLA 1I3QB 1TS4A 3S1RH 2Z8LA 1WTQA 1XNRQ 2BDOA 1Y1WH 1VQOA 1JCKB 1F9SA 2N78A 4RMFA 1V1PA 4A3JG 4G7ZC 1I5FA 3PSIA 1E7ZA 5M3MH 3J80L 2MO1A 1O80A 5M5WB 4NXNQ 1PRTC 4HTHA 4IZ8A 4R8IA 1A8VA 1GJXA 2M9VA 1QILA 3MTSA 1I6HH 3TREA 5ISRA 4MNOA 1SNQA 3HEJA 5CC4A 1PTOB 1M90C 4A3LG 1CA5A 1LM0A 2JSOA 2R6GA 2E5LL 4XQQA 4V0BA 3ICEA 4OXPA 3QO2A 2AUKA 1HNZQ 3RZDH 2R7ZH 5J39A 1IKMA 3CCJA 1PYWD 1TWGB 1YVCA 2NBFA 3TS2A 5C4XG 2ALYB 4IO9A 4QMGA 1K9MC 3IFTA 2R7DA 1HCZA 5C44H 1LUZA 4IALA 1KRTA 1FD7D 3DWQA 2EJGC 2JA7B 2X6LA 2B3GA 3CD6A 3SR1A 3KBGA 2F0DA 3WDNA 3RN2A 2B63H 3H3VC 4O2DA 1WVLA 1B50A 2E5LQ 1PFMA 5IWAL 3GV3A 2L0CA 4AH6A 1PZID 4G4KA 4GLXA 5C3EG 2B2UC 4ULLA 4JVZA 2JA8H 4NMZA 1YI2A 1D5XC 4X6AH 4V190 1JJGA 1I4PA 4ZKCB 1AE3A 5J22A 1GVPA 1IL2A 1CUKA 1V1OA 5C3XA 1I94Q 1YHQA 3S1RB 4A93H 4YCUA 3OIPA 4CKCA 1LABA 3NQIA 1LTAD 1SYEA 3A8KE 3MC0B 4X65L 4TKOB 3PUWA 5FLMH 1DOLA 1CZWA 4WJ4A 2A1AA 1ASYA 1J8IA 5IWAQ 3HOVH 4IURA 2KECA 3J7A5 4RAUC 1PHJA 2RF4A 1HR0W 3G6EA 4DK0A 1LTSD 4LWCA 1I6HB 1B4OA 1NUCA 4DF7A 4FF2A 3ERQA 1T9HA 2EYLA 1AZQA 3FMCA 3PV0A 3OPOA 4DUYL 4JI2L 4IOCA 2UU9Q 1NBWA 1YEZA 1A0IA 5BR8L 2MUYA 3ZJYC 5GAHC 3AQQA 4QCLA 4IQZA 3J80i 4X65Q 4J8QA 2EYPA 3UI2A 1N32Q 2XIWA 1PH1A 1STEA 2PCFB 1CKOA 1QZGA 5IGBA 3RZDB 2R7ZB 4C56C 3TN2A 1EU4A 1DGSA 2K05A 5GAGC 2Q2UA 5DEHA 3U58A 4Z9CB 5IP7G 3PQIA 2F0MA 3A54A 1BNZA 1GUOA 3T1HQ 3S14H 4DV5L 1HUMA 2PQEA 3RUZA 1L0WA 2VY3A 1CQFA 1LO5D 1YZ6A 3BJUA 2OWOA 5IIFA 1SMXA 4A3FB 5E1FA 1A63A 4HN7A 2KCMA 5G3LF 2JA8B 4P75A 4C3IH 4X64L 1PH7A 3OWFA 2HQEA 5IE8A 2K75A 2L5TA 3D6WA 4DXGA 3KDFB 1EIGA 3CRKC 5HY6A 4YHHQ 3C1FA 1L0XB 2CFMA 4A93B 3J7AV 5EJWA 1WCMG 4WFN3 4DV5Q 3K5OA 1TVXA 3CXCA 3ULLA 4B3RQ 4B3ML 1MJCA 3KOJA 4TVAB 3CC7A 5CV4A 1QOHA 4YY3L 3FP9A 3RR5A 3UE0A 2JA9A 3IKJA 5EGTA 4MTKA 2C35B 3F2CA 3M4PA 5IY0A 4O1NA 2TMPA 3LWUA 1TWHH 1GUGA 2OQKA 3T13A 4DR5L 1F9RA 1K0SA 3H91A 3HOYG 2JP1A 5D14A 1BCPC 3IFDA 1QVFA 2YTYA 3HS0C 1B8AA 5I6YA 1PXUA 1MD2D 1F2LA 1PH3A 2CW0D 4DAPA 4IN3A 1SYFA 1LTID 3A8JE 2BE5D 4B3MQ 2K7VA 1Q81C 2BCOA 3ND8A 3PO3H 4MIUA 4HSVA 1HQRD 3HZXA 1R9TB 1LTRD 1IBML 4JK1C 4R4OA 1UNSA 2EIFA 1NJIC 4A3CH 5F2DA 3A5UA 1AE2A 2B2WC 2EYJA 2L9HA 1Q7YC 1KRSA 2EVBA 3K7AH 3HP3A 1E1TA 4UPAA 4IUPA 4CGYB 5CV8A 2JA6H 2RSOA 1H95A 2E8GA 3RLOA 5EKLA 1VQ6A 1IZ6A 4L5TA 4F8MA 3S2HH 1AN8A 1PFBA 2PZUA 3DEPA 1CSQA 2A6HD 1VQ4A 2NN6H 4KHVA 4LMQD 4DV6L 1EL0A 2LXKA 4C3IB 1IBMQ 4BBSB 4QUCA 3OHXC 4AQYQ 3CQZB 1K83H 3BYYB 1TT2A 1WI5A 3WOFA 2PMZB 3Q8DA 4R4CA 3LWEA 3J81i 1UE7A 3H3VI 3Q6SA 4FP5D 2A5HA 4A3JH 2CH4A 1E22A 5DM63 2AHOB 3EN2A 3GTJH 3C2PA 4LF6L 1A62A 4L6TB 1EUJA 1ZYRC 2WB1G 1HZ9A 4DR1L 3TDQA 2D5DA 2FHTA 4HCEA 1VF7A 4DR6L 4KLKA 2ZTCA 1L2FA 1EY7A 4XT3B 5GADC 1ICFB 2NVTH 3S17B 3KDFA 1A6XA 4A3EG 5C4HA 2TSSA 1UEBA 2XNAC 3KF6B 4RG1A 1K8OA 3K81C 2ZTDA 3RD4A 4P72A 2WAQE 2N49A 4B08A 1CA6A 2QA4A 2EOTA 3S1QH 2NTSA 2PW7A 2IPKD 1JWSD 4DK1A 2B8GA 1E1OA 4YIJA 3Q0AA 5E4XA 5C4XH 4XQJA 2L11A 3S2DH 3VR5A 1RL2A 4FXKC 4BY1B 1TQOA 4WJWA 3K7AB 1HRJA 3NELA 4R8NA 2F4IA 1DOKA 4F88A 2KHSA 2QDLA 1KQSA 3OTOQ 1ILPA 2JA6B 5NUCA 3HOXB 1FNUA 2WAQG 5C3EH 2K32A 4OO1I 2EJMA 3JC66 2LS01 5FLXL 3CPWA 2CKZB 3MWYW 3BZDB 2CH4W 4OO1G 1SRUA 3VYTA 2CW0C 1O78A 2I5LX 2DGYA 3A0JA 3V2TA 1STHA 4JV5Q 4K0KL 2DNEA 2PO4A 5FJ8G 2K14A 4DR2L 3M4OB 4PV1C 4FNFA 1KHIA 3UDIA 2MQHA 1C9OA 4EQNA 1R4QB 1HNXL 1YNJC 1KABA 4BA1I 2FMMA 5ELBA 2H1EA 2ICIA 3KLSX 1PFNA 2PYKA 2YTVA 1E2VA 2NVTB 2EPBA 2C9OA 1XMOL 3QOJA 4GZYC 3FKIB 5CYUA 1H9RA 1LT4D 3X3MA 5JJIA 1VQAA 3MEHA 4K0KQ 1OO9B 3FPPA 2A19A 2HQLA 4KD3A 3D4RA 1TWAH 4A4IA 5IGDA 3GTKH 1KTKA 4EQPA 3F2UA 1I4RA 3D0FA 4LF4L 3I4MB 1BBUA 3G6JB 5LL6S 2N3SA 1Z7TA 2G9HD 2SNMA 5IGCA 1HNXQ 3S2DB 3TP6A 1TS2A 3S24A 1K3BC 3T56B 1HPCA 4CDFC 1AH9A 1SBBB 1OXUA 1P8LA 1JT8A 4BA2I 1WTXA 1CTMA 1XMOQ 3A7LA 3U9OA 1MHWC 3KF6A 1FR3A 2HIXA 3BG3A 1K8GA 3GTPH 2H5XA 3E0EA 5COYA 3GTOH 1VQ9A 2ID0A 3AEVA 1C4QA 5IGFA 3H15A 4LF4Q 3S1MB 3PF5A 2EJFC 1IBKL 5JEAJ 4PQXA 5KIXA 2BDNA 1DONA 1E2WA 2KUMA 1SYDA 2SEBD 4H44C 1WCMH 4JI8Q 1ZEQX 4LFBL 3UDXA 3OW7A 5CR3A 1YHAA 4K8IA 4N8X1 1Y1VG 1VQEA 4LF9Q 2Y0SB 2JYOA 2HHHQ 1BKBA 1Y8OB 2PZWA 2OCEA 4RKBA 5A35A 2Z0SA 3K57A 1V1PB 4KY7A 2VUMG 4N9TA 4LF7L 1AFPA 3QWNA 1RDPD 1SEBD 3I4LA 3EFXD 5AFWA 1VQHA 3K7UC 3G7LA 2B2VC 1YBYA 5GQOA 4HAEA 4C3JG 3CF5A 4DAVA 2B2YC 2CVRA 3AB9A 3CCEA 4IPCA 5DM73 4RCNA 3OYYA 4LFBQ 3GD7A 1N8RC 3NEMA 4JPBW 2I0QA 4B3SL 4FDBA 2RDFA 1MKHA 1C48A 3DMUA 2VQEL 1GM5A 1O7YA 5JVG3 1PTOD 4LK1C 4ZK9B 4OX9L 2RDHA 1HFGA 4BY7B 1AP0A 1S5CD 1CKMA 5E7NA 3E3XA 5T1GA 2Z6KC 1JJCB 1H9SB 4DFAA 3L0OA 4DXFA 5M3FG 1PH4A 2ZT9C 1PDQA 3GO5A 4MHEA 1X9NA 1EYDA 1F9PA 1IL8A 3E9IA 4HIKA 1G6ZA 2F0HA 1WD1A 1EY9A 3GTPB 2A8VA 1B3QA 3S9WA 5G3LD 1ET6A 4J15A 3M3YB 1V9PA 4A3BG 2EYMA 3GTQH 3S16B 5CV5A 3HOWB 2RHSB 4OX9Q 2Q8IB 3NPPA 2JEAI 4GKJL 1PLFA 5HGQA 2A6ED 3U4ZA 1LT5D 1TS3A 2KA7A 1JOOA 4KV6A 2E2DC 1VQCA 3JAMc 1WFQA 1UUPA 2IY5B 4EQ5A 5ELFA 4LNQA 3H3VH 2F03A 3R2IA 4QUFA 1V43A 1VQKA 2NZHA 4XXEA 1JE4A 3EIVA 4DA2A 2JA5B 1HFNA 2QILA 4OWTB 5M5XB 1PH6A 4JC0A 2F0FA 3GTGB 1I4HA 5EAYA 3V96A 4APVA 4NXNL 3K58A 4A3EH 2D62A 4FF3A 1T5XD 1EZ8A 4HJAA 1SFOH 4IJLA 4QIWE 5J1ZA 3QR8A 4GNXC 1HR0L 1WYDA 2MJ8A 1Q90A 2NVQH 3D31A 3U4VA 4XDXA 3AYHB 3STBD 2B2TA 4XIGS 1IW7C 2F0NA 1DM0B 2OT2A 3CMEA 2CHBD 1HNZL 2X6GA 2WINB 5M5YH 3KFUA 1PRTB 2WIIB 5EKKA 2E76C 2MHVA 4CHTB 5C0XJ 4RFBA 1GUTA 3I7FA 4A3IB 1X3PA 3GTLB 1HR0Q 3PCOB 1JOQA 4UY8C 3SVMA 1VCIA 2Q2HA 3DXJC 4IOAA 1Y14B 5I9PA 3JAME 2HDLA 1SE3A 4LW1A 3K80C 4LUZA 4OO1H 3HFZB 3H0GG 3BZKA 3IAYA 1Z47A 4I7AA 2QCPX 4OWWB 2DJGC 1RJTA 5IT9E 1H9SA 1WD0A 4HSPA 3AFQA 1G91A 5D3IB 5BN3A 4J1MA 4XYQA 3P7JA 3SGIA 1I94L 1CKNB 3CW2C 1V8QA 2B29A 3N52A 3SDZA 3DEOA 1ET9A 1NCVA 2EE1A 5FJ8H 1K8MA 2N55A 2QGQA 1CHPD 2KCTA 5JJLA 1HTPA 4KN4C 3J80c 3PIOA 4IUNA 4JBJA 2LY7A 4KKSA 5FOBB 3PMFA 2QDBA 4ZYSA 1U4MA 4HIMA 2K01A 1VQDA 3Q22A 1Z9FA 5K5PA 1BR9A 1L1OC 2EXDA 1G8ZD 1NSNS 1G6PA 4FXGC 1SFOB 1OXSC 4IJHA 2Z9HA 5CV6A 2UU9L 5JAVA 2KOLA 1G2TA 3HOUH 3R3OA 2GA4B 4LFAQ 3I4NG 1Y1WB 2Q2IA 2EYOA 4DR3L 2ZM6Q 4OIJA 1ENCA 2A6EC 2HT1A 4DUZQ 3ERSX 1V1QA 1N32L 2F4VL 2K5QA 1P16A 4K5XA 1CT1D 1F2ZA 4AYBE 1S5BD 2GVBA 5M3MB 1U4PA 5M5YB 1W6JA 1N36L 3S1NH 4X62Q 2DN8A 4L8JA 2DNCA 2K1BA 4GS3A 4B3TL 3LGJA 3PUVA 3BDCA 4ABNA 4IUVA 2HUGA 3VA5A 3PGZA 4DNTB 3T1HL 1S40A 4HCSA 4A3GG 4ZAIA 1FYCA 4M1UB 5I4DA 4DR3Q 3K5LA 1QWYA 1EIFA 2F4VQ 2MGSA 1NNXA 4KJNA 3NP8A 1SYBA 1QB5D 4AYBG 1N36Q 1C8CA 3J80E 1U4LA 4I65A 2F0WA 1D5ZC 3R93A 1PTOF 1GD7A 2P5ZX 2Z6BA 1Y1VH 4B3TQ 3VR6A 2NUCA 4KY6A 2M00A 5C44B 3QIAA 4ZKBB 3VR4A 4YHHL 1X3QA 1QCBD 1SDFA 5BN5A 1EYCA 2VUMH 5EQ0A 1SMYD 1BQQT 3P1HA 1VF5C 4B3RL 1STAA 4JG2A 2B63B 3K6OA 4HJ5A 4R4TA 2A74C 4DK6C 3J81L 1YIJA 4BBRH 1ASZA 4XQNA 4HIOA 4C3JH 3BVMA 1ML0D 5FK9C 1Q3LA 1F77A 4JI0Q 3L9AX 3IL8A 3HRZC 1N33Q 4EX5A 2UXCQ 1B9NA 1CKNA 3G48A 5EPLA 5AJ3L 2QEXA 1RD9D 3HOUB 1S72A 2R92G 2A69D 2B39A 4RH6A 3WWVA 3OMGA 4JI6Q 1HNWL 4TRDA 4JI5L 3D8GA 4HJ7A 1LYLA 1CM9A 3HOVB 2IJ0A 2B2UA 1KAAA 3HOZG 5M3FH 1LTLA 2KQ3A 5IP9G 1OXTA 2YTXA 1NE3A 4EVOA 3VYUA 2DY8A 4OHJA 3ND9A 3T4AC 1BCPB 1XWEA 5ELEA 4KHPQ 5AJ3Q 1D5MC 2JEBI 3J81c 1ZKOA 2IT1A 2IWHA 3NE5B 4A3BH 1CQVA 1X3FA 2HDMA 4FO2A 4EGVA 4PNYA 1PVOA 2L4NA 2EY6A 2ES2A 2RBMA 1HNWQ 2F0IA 4ZUJA 4JI5Q 4CJ0B 4A3MG 1K3RA 1HQMC 2ENBA 1BBXC 4NP5A 1LTTD 2R61A 3LNNA 1WTOA 2Q8TA 1SN8A 3EROA 3FDTA 4AQYL 5J3BA 4ZRZA 1CZGA 4POGA 4F87A 5LMUQ 3FVQA 1HH2P 2PI2E 3H94A 2J7ZA 1WTRA 3DUZA 4K2LA 5I9OA 4QF4A 3S14B 2K03A 3GP7A 4IPDA 3CCUA 3BVZA 1ICWA 5C4JH 3NUCA 3S15H 5K36G 2LSSA 3B6YA 1SJED 3PUZA 4M8AA 4EQOA 2F0OA 1JB7A 1BUVT 1DXMA 3C46A 2O5IC 2UXBL 4X3TA 4Q5VA 4DAYB 4K6DA 2WB1E 1GUWA 3MAQA 4BBRB 4CDEC 3A56A 1R4PB 2F0KA 4TQUS 2KCNA 3P20A 2UXDQ 1OTCA 4CJ2C 2ZTEA 3FHWA 4A3DG 1D8LA 4DV3Q 2XN9C 1QNUA 1X55A 4A75A 4R9WA 3AMUA 1XJVA 3R2TA 5JEAG 4QJFA 3MFYA 4KKUA 5GROA 3WOEA 3I8ZA 1TWCH 2WP8J 3VDYA 2UXBQ 1TS5A 2AMCB 2L1BA 1EYGA 4PMWA 2Z1CA 4KI0A 2WKDA 3MXNB 3CCQA 4JI3L 1D2BA 1TWHB 3TP5A 3KLWA 1SNPA 2N8NA 3HKSA 1TY2A 1RTNA 3A5ZB 2Q2TA 1FVIA 4A3LH 1FJGQ 2L55A 4A3BB 2JA7G 3OTOL 1W6KA 4IUTA 4L63B 3H0GH 5JVH3 4JOIC 4GKKQ 4POFA 4JI7L 2PNRC 3O13A 2UUAQ 3PO3B 2VL6A 1RODA 4WORA 3BDLA 1RF2D 4OL7A 1J5EL 4JI3Q 4IFDI 2A69C 3TMEA 4PMCA 2K5DA 1Q82C 2XTIA 4PZ8A 4RGMA 1XNQL 3MA2B 4IFDG 4WRDA 4JV5L 1PFSA 4DNRB 2KBNA 2MNAA 3I3CA 2I46A 1FNVA 3P75A 4P2CB 5EKIA 3KF8B 3S2HB 4DV7Q 4JI7Q 1A15A 3PIO3 4PG3A 3X3NA 4R4IA 2OF1A 4R1JA 4OEMB 2EDGA 5D3DA 3LX0A 3VR3A 1J5EQ 1K83B 2B2WA 2CQAA 2PNHA 2G5DA 1EY4A 1Q1BA 3QB3A 2F0VA 2NZ1D 3I4NH 4RHRA 5IYDG 2NVXH 4FVMA 2ZJRA 1XNQQ 3RLNA 2BE5C 1VQ5A 1KNAA 2A73B 2EYFA 1OXVA 4ZCKA 2FXQA 4A3JB 2EY5A 2DY7A 2RA4A 3EQLC 4NXMQ 2K5NA 3KLRA 1IKLA 4JCVE 3BS1A 3OMCA 4DAYA 4Y7NH 3CC2A 3GTJB 4ZLTF 2K33A 2R7ZG 2NVYH 1SLJA 4CKEA 1HZAA 1LTGD 5E4WC 1TXYA 4QIWB 2XWBB 4HMIA 2D0OA 3I91A 1K73C 4A3GH 4BXXG 2IW3A 4K8JA 2VS1A 4KN7C 5KNDA 2E2HH 1GUSA 3T51B 1SNDA 2A6HC 3NTIA 5FLXc 4OONA 1X3GA 4LF5L 4C1NI 1SE2A 1PZKD 4CJ1B 3TP8A 3S1QB 2RCFA 4G7HC 1SYCA 3I2ZA 4OWXB 1J9OA 4A3FG 4HEDA 1YNND 1VQGA 4ALPA 1Q12A 1XXGA 3MXNA 4GOPC 4P73A 5C4XB 1TWFH 4NDXA 2JA8G 4PZ7A 1QVCA 1DJRD 1IYJB 5IP7H 3M4YA 4JI8L 4QY7A 4UAIA 4HR7B 1T5EA 4PZ6A 5C0XI 3PIPA 2Q8RE 4A93G 4LF9L 2PW5A 4JI1Q 2HHHL 5A2QL 5CV9A 5LMNW 1ILQA 1W2BA 4LF5Q 5C3EB 2R3ZA 1FGBD 5C0XG 3NSWA 1I4XA 4MTNA 3G71A 3CRLC 3FEWX 4ZQ3A 5HGTA 3T53B 4UDUC 1SXTA 2I5HA 2ZJPA 1MJEA 1SNCA 2Z4IA 1II3A 3CPFA 1KLUD 2R92H 1EY6A 3I4NB 2RCNA 2YV5A 5CBEE 1B44D 3K0XA 2NVXB 2MP1A 5CGKA 4C3HG 2KEDA 2RVLA 1E24A 4DV0Q 1HHVA 1X65A 1YJWA 2UUBQ 1DYQA 3KLSA 3BZCA 4DV2L 3HOZH 1EY8A 3KUPA 1B3AA 1YHBA 1A2UA 1FNWA 1EY5A 3KF8A 5IP9H 5EBDA 2XGTA 1GUNA 1UWVA 1A3VA 1CFMA 1PZJD 1WOCA 2NVYB 3AU7A 5FLXE 1VQIA 4XT1B 3HOYH 3W1BA 3TQYA 2X69A 4I7ZC 4RHSA 1AZPA 1JICA 1JR0D 3D3RA 1SR3A 4TSSA 4A3GB 3GTMH 1ENAA 2R7FA 3NBHB 2VW9A 4ME3A 4DR4L 2E2HB 1IBLQ 1QG7A 3C3LA 4A3KG 1NAPA 3U50C 3DWPA 5I2YA 3K5NA 3GTKB 1TWAB 1X56A 2AQ3B 4AYBB 5M9OA 4DV2Q 5C6AA 5I2XA 1AW7A 1JMCA 3FRPB 4IFDJ 2K5WA 1TY0A 3RN5A 1TWFB 4KTAA 4DV1Q 1XMQL 1RCVD 4C3IG 1KDAA 3W3AA 4BBSG 2XSCA 5IODA 4YCWA 5C3WA 3SE0A 4R4QA 1I6VC 1TKWB 5K36H 3A74A 1EWCA 1SAPA 1O7ZA 4YWKA 4DR4Q 4MN3A 1MSGA 1BXTA 3GTOB 5D65A 2O5JC 2RDGA 4IPHA 1KXLA 3CC4A 1ONLA 3MVVA 1JWUD 5M5WH 2LXJA 4GOPA 3RLFA 1GHKA 1PH5A 1D1IA 3NWTA 2F0UA 5ELCA 1XMQQ 4A3DH 1EQRA 3OSOA 1C7YA 2HIVA 2EYHA 3I72A 1WCMB 1STGA 2AWNA 3W1GA 1KIXA 1VQFA 3N6RA 3NENA 5JEAH 1VQPA 1PTOH 5C4ZA 1E0BA 3HKZE 1S4ZA 1PV4A 1JB3A 3K5MA 5FO7B 1VQLA 2JK8A 1GXDC 1XTCD 1JORA 2NB0A 5DAUA 1TWGH 3G4SA 1WTWA 1K8AC 1YJ9A 1N9WA 3HOYB 4DV4Q 5IYCG 1GO3E 2O2LD 2K50A 3TP7A 4GNXB 2VZAA 4H0LC 5BN4A 4BY1G 4UP9A 2F0QA 3M7NA 1MBYA 1VMPA 3J7AF 3SK6A 2E2JH 2GN5A 4KJOA 5CORA 4RGTA 4JW0A 3DWAA 3HKZG 2JA6G 3HOXG 4LF8Q 4GN4B 4E6IA 1M1KC 3KJOA 1Z6HA 1LLRD 2J0TD 2EXZA 1VMCA 2VB2X 4JYAQ 1QZHA 2B2VA 4IFDH 2B2YA 1KDCA 1KL9A 4N9PA 1XYIA 2PZTA 2VQFQ 1EWHA 1EQQA 2KENA 2OXPA 3NBHA 1PH8A 4GLAC 1B9MA 1I4GA 4IUUA 5DNFA 4H7BA 5I6WA 3E5SA 4KKTA 4ZUIA 1OXXK 3GTQB 2VNUD 1Y8NB 1FGUA 2C5CA 4IUQA 1N34L 3NHHA 4GLVB 4AIMA 5EPJA 2DJFC 5ELDA 2Z6KA 3CHBD 1W3SA 5IYDH 4A3DB 1Q86C 3JAMi 3E9HA 2BA1A 1PYSB 1WTPA 3EVQA 1PTOC 3FKIG 1TIID 4LFAL 1MGSA 1JE5A 2ZM6L 4L5SA 4DPGA 2ZJQA 4DUZL 1SROA 1BBWA 4LJZC 2WB1B 1WJJA 2AUJD 2F3IA 1ZXTA 4YWMA 2IX0A 3FPUB 3I4MG 4O42A 1S5ED 1L1OB 4GN3B 3VYSA 1WTVA 1N34Q 3PUYA 1LACA 4X62L 4BXXH 4A3EB 1XX8A 1EQTA 2HCIA 5IGEA 2RSNA 3CMAA 2NVQB 2Y0SE 2E2JB 4QL5A 2IX1A 4GN5A 1BCPD 1EYAA 3PF4A 2SNSA 5IOCA 4A3FH 3UDFA 4A76A 4PMBA 2J4XA 1PH2A 3U9SA 1CI3M 5CV7A 2K28A 4CBVA 2KHIA 2ATWA 1S5FD 1ENFA 3PUXA 1SE8A 1Q8IA 2ZXRA 4LUVA 1HXYD 2XVSA 3NTHA 2PPBC 5KNBA 3QG1A 1BO0A 1QVGA 3CCLA 4XTCS 1Y8PB 4GNXA 3K59A 3I56A 2E2IH 1KNEA 1HA5A 2WAQB 1A3TA 3TS0A 5C0XH 3I73A 2FINB 2Y0SG 1PRTF 3E0JA 1GHJA 3PIP3 4QGUA 3M85A 2OTLA 3K8AA 2R93G 5IYBG 3L7ZC 4X3KA 1SYGA 1XTDA 1MSHA 3CCRA 2EY2A 1UE5A 3KYHC 3TEHB 4JI0L 4ODGA 1N33L 3OOCA 4QQBX 3STBC 4C3HH 4O0AA 2UXCL 3OWEB 3K0YA 2KVMA 4H02A 3SK5A 1D7QA 3OIQA 1B70B 4FF1A 3PO2G 2SDFA 2MO0A 3I4OA 5HURA 1EZ6A 1RHPA 3HG9A 1KC8C 4JI6L 4FXDA 2VXWA 2BH2A 3MXGA 4JI4L 4JBMA 1F9QA 3CKIB 1R9TH 2AQ1B 5EBCA 4CDDC 3TSSA 5FO8B 4BY7G 1NR4A 2A68D 1EY0A 2OTJA 1WTHA 3M4QA 5H1SE 1LT6D 3CCMA 1ZYRD 4DUYQ 4JI2Q 2XRSD 2PI2A 5BR8Q 4A3KH 1NMFA 4KHPL 1XPRA 3M7GA 3ER0A 1IYVA 5JJZA 4UP8A 3SEBA 2XRQD 4MZ9A 2LMCB 3EBEA 2ICEC 3GDEA 4JI4Q 4CDCC 1VQ8A 2FFKB 2F0PA 3HOWG 4BBSH 1J6QA 2D0PA 3V05A 1L1OA 3CQZH 2I07B 3S1NB 2ZXPA 4KHZA 2RHQB 4DKAC 1B53A 1EEID 2E75C 4DN4M 5LMUL 3RZOH 3BYTB 1UE1A 2WACA 2E2IB 1HZCA 5EPKA 3EA6A 2AKWB 3NBIA 3SHLA 1NTGA 2BOSA 2PQAB 4U68A 1C0AA 3NWSA 4NW2A 1EIHA 5L37A 3AFPA 4YWLA 4RGOS 4X64Q 1VS0A 4CKBA 2JA5G 1STNA 1QJOA 2UXDL 3CCVA 3S17H 1K28A 2O4XA 3OW2A 4C3HB 1Y1VB 2WFWA 1F2MA 4DV3L 1U5KA 2VUMB 1VQMA 1U0LA 2K5HA 1U9RA 4X66L 3H09A 3MXPA 4YY3Q 5E3FA 2QEJC 2RQXA 1L0YB 4LFCL 5IYCH 4DNIA 2KJXA 4OGQC 4C3JB 4BY1H 1KLGD 4L5RC 4DR5Q 3DM3A 1S5DD 1X6OA 3BVGA 1CHQD 1YNJD 2AQ2B 1EEFD 2IL8A 3ITPA 2V1CC 1DD2A 1NMGA 2EZVA 4A3KB 1NY4A 2K6AA 3F2DA 4A3IG 1FJGL 4KK7A 1PA6A 1MI2A 3J7YW 4X3SA 2F0SA 3HOXH 1BVSA 2B8FA 4F7XA 2NYZD 3VYRA 4X66Q 2YU9H 3UDGA 4GKKL 1BDOA 3QOLA 4Q0FA 2UUAL 4LFCQ 3J81E 5M3FB 1Q8KA 2Z4HA 1UEAB 4DU9A 1HUNA 1NR2A 2KHJA 5KNCA 4IPGA 2EQSA 3TBIB 1SMYC 3RZOB 2N88A 2IX3A 3KJPA 3RMHA 3F2BA 3C1EA 5FKAC 2CCZA 4HJ8A 4P71A 3A55A 3M4OH 3CAMA 2QKIC 2A68C 1B1ZA 1STYA 1Q46A 3KK7A 4DV7L 3NK9A 3CP0A 1H9JA 4DV6Q 5LMNL 1EQVA 1G2SA 3ONAB 1BCPF 2JXMB 3D4WA 1QE6A 1DOMA 3QJYA 2BH8A 3FKIH 3I90A 1ESRA 1RIPA 4G7OC 3ZYYX 3NTKA 5LL6X 2NWGA 1K0RA 2PQAA 4NXML 5C4JB 2IHFA 1LT3D 1Y1WG 1Y69U 3S15B 3I4MH 1I4QA 4LF6Q 4X3UA 4DR1Q 1YITA 4P74A 4DR6Q 5LMNQ 1O7LA 4U673 5M3MG 3MFGA 4LAAA 2K4KA 1VDZA 4YCVA 1QUQB 5IGGA 4Y52H 2XWJB 4RKLA 4DK3C 1JC7A 5KYLA 1YNXA 3HKZB 1TR5A 5C5MA 2BA0A 2F0TA 1D1KA 2MFIA 3A8IE 1B2TA 1JWMD 5KRUA 2YU9B 4OIKA 3Q24A 2ASBA 1D6EC 1TWCB 4ME5A 4RGNA 3S1MH 4G57A 1X54A 1O7IA 3DM1A 3HGBA 1X32A 5GAEC 3TRZA 2MPMA 2QW7A 3J7ZC
chains in the Genus database with same CATH topology
2EY1A 1RKNA 4S3SA 4RWSC 2F0EA 1SJHD 2H4OA 3BDOA 4JBWA 1LV9A 4FYDA 3VR2A 2KCCA 2SOBA 4J6HA 2LKVA 3SK8A 3H0GB 2E74C 3GQBA 3URYA 1IYUA 1E2ZA 1BF4A 4FF4A 3A7AB 2AWOA 5T1IA 3SXHA 1SNMA 4DGZA 2RKSA 4K6LA 1M8AA 3TZUA 4ILWA 1EFID 4K2KA 5JPMC 1AEXA 4HMJA 5KGUA 3L3OC 5FO9B 2JE6I 1HA6A 4ID6A 2WKCA 4B9WA 3I70A 2L12A 2VB3X 3D4DA 3VA7A 2YYZA 1QNKA 3Q23A 1Q1EA 4KMUC 4KD4A 1HTLD 2F0LA 1PMRA 4K14A 4BS9A 5TSSA 2ZXOA 1G291 5KYIA 1A3UA 5JOBA 1DZ1A 4K5WA 3TZDA 4B9XA 4Y7NB 4RA8A 1SSOA 1DCZA 1IW7D 1F2YA 1H9KA 2G9DA 4K5VA 5JPNC 1TU2B 4C1NK 2OEOA 1PRTD 5KEEA 3T16A 3D6CA 1U4RA 1RTOA 3MHBA 2F3VA 2B2TC 2R93B 1JOKA 1SNOA 1UAPA 1LTBD 1STBA 4C2MB 2FJ2A 2LFNA 3E6ZX 3PO2B 1A2TA 3JAML 1M4VA 1IHZA 2QF7A 2V4DA 2HCCA 4H13C 3W2DA 3H6MA 5CBAE 1SE4A 5IT9L 4BWGB 2F0JA 1GOZA 3EJIA 3MXUA 3DHQA 4KY5A 1EOTA 3R8BA 2FMCA 2F1MA 2R92B 4NKLA 4RCOA 1KDBA 5C5LA 2NTTA 2F0GA 3NXWA 1YNNC 5A2QE 3HOZB 3SK4A 1JQYD 3CU7A 5LHY1 3GV6A 1BOSA 2M2LA 1H9MA 2WV6D 3KBXA 3MZ5A 2KEEA 3GTMB 5CMDA 2D2CC 1ESFA 3NQTA 1EU3A 4A3MB 2NN6I 2K04A 4QB4A 2F3WA 4XYOA 1I50B 2NN6G 2D9UA 1CK1A 1I3QB 1TS4A 2Z8LA 1WTQA 2BDOA 1JCKB 1F9SA 1V1PA 4G7ZC 3J80L 1O80A 5M5WB 1GJXA 1PRTC 4HTHA 4IZ8A 4R8IA 2M9VA 1QILA 3MTSA 5ISRA 1SNQA 3HEJA 5CC4A 1PTOB 1CA5A 2JSOA 2R6GA 4XQQA 4V0BA 3QO2A 2AUKA 5J39A 1IKMA 1PYWD 1TWGB 2NBFA 4QMGA 3IFTA 1HCZA 4IALA 1FD7D 3DWQA 2EJGC 2JA7B 2X6LA 3SR1A 3KBGA 2F0DA 3WDNA 3H3VC 1WVLA 1B50A 1PFMA 3GV3A 2L0CA 1PZID 4G4KA 2B2UC 4ULLA 4NMZA 1D5XC 4V190 1I4PA 4ZKCB 5J22A 1V1OA 5C3XA 3S1RB 3OIPA 4CKCA 1LABA 3NQIA 1LTAD 1SYEA 3A8KE 3MC0B 4TKOB 3PUWA 1DOLA 1CZWA 1J8IA 4IURA 2KECA 4RAUC 4DK0A 1LTSD 1I6HB 1B4OA 1NUCA 4DF7A 4FF2A 3ERQA 2EYLA 1AZQA 3FMCA 3PV0A 3OPOA 2MUYA 4QCLA 4IQZA 4J8QA 2EYPA 3UI2A 2XIWA 1STEA 2PCFB 5IGBA 3RZDB 2R7ZB 4C56C 3TN2A 1EU4A 2K05A 5DEHA 4Z9CB 2F0MA 3A54A 1BNZA 1GUOA 1HUMA 2PQEA 3RUZA 1CQFA 1LO5D 5IIFA 4A3FB 5E1FA 4HN7A 5G3LF 2JA8B 3OWFA 2HQEA 2L5TA 3D6WA 4DXGA 1EIGA 3CRKC 3C1FA 1L0XB 4A93B 3J7AV 5EJWA 4WFN3 3K5OA 1TVXA 5CV4A 1QOHA 3IKJA 5EGTA 4O1NA 2TMPA 3LWUA 1GUGA 3T13A 1F9RA 3H91A 2JP1A 5D14A 1BCPC 3IFDA 3HS0C 5I6YA 1PXUA 1MD2D 1F2LA 2CW0D 4DAPA 4IN3A 1SYFA 1LTID 3A8JE 2BE5D 2K7VA 2BCOA 3ND8A 4MIUA 4HSVA 1HQRD 3HZXA 1R9TB 1LTRD 4JK1C 1UNSA 5F2DA 2B2WC 2EYJA 2L9HA 2EVBA 3HP3A 4IUPA 4CGYB 5CV8A 2RSOA 5EKLA 4F8MA 1AN8A 1PFBA 2PZUA 3DEPA 2A6HD 2NN6H 4KHVA 4LMQD 1EL0A 4C3IB 4BBSB 4QUCA 3OHXC 3CQZB 3BYYB 1TT2A 3WOFA 2PMZB 3LWEA 3Q6SA 4FP5D 2A5HA 5DM63 3C2PA 4L6TB 1ZYRC 3TDQA 2D5DA 2FHTA 4HCEA 1VF7A 1EY7A 4XT3B 3S17B 1A6XA 5C4HA 2TSSA 2XNAC 1K8OA 3RD4A 4B08A 1CA6A 2EOTA 2NTSA 2PW7A 2IPKD 1JWSD 4DK1A 2B8GA 4YIJA 3Q0AA 5E4XA 4XQJA 2L11A 3VR5A 4FXKC 4BY1B 1TQOA 4WJWA 3K7AB 1HRJA 4R8NA 2F4IA 1DOKA 4F88A 2KHSA 1ILPA 2JA6B 5NUCA 3HOXB 1FNUA 2K32A 4OO1I 2EJMA 2LS01 5FLXL 3MWYW 3BZDB 4OO1G 3VYTA 2CW0C 1O78A 3V2TA 1STHA 2DNEA 2PO4A 3M4OB 4PV1C 4FNFA 4EQNA 1R4QB 1YNJC 1KABA 4BA1I 2FMMA 5ELBA 2H1EA 2ICIA 3KLSX 1PFNA 2PYKA 1E2VA 2NVTB 2EPBA 2C9OA 3QOJA 4GZYC 3FKIB 5CYUA 1H9RA 1LT4D 3X3MA 3MEHA 1OO9B 3FPPA 4KD3A 3D4RA 5IGDA 1KTKA 4EQPA 3F2UA 1I4RA 3I4MB 3G6JB 5LL6S 1Z7TA 2G9HD 2SNMA 5IGCA 3S2DB 3TP6A 1TS2A 3T56B 1HPCA 1SBBB 1OXUA 4BA2I 1WTXA 1CTMA 3A7LA 3U9OA 1FR3A 3BG3A 5COYA 2ID0A 1C4QA 5IGFA 3S1MB 2EJFC 5JEAJ 4PQXA 5KIXA 2BDNA 1DONA 1E2WA 2KUMA 1SYDA 2SEBD 4H44C 1ZEQX 3OW7A 5CR3A 4K8IA 2Y0SB 2JYOA 1Y8OB 2PZWA 4RKBA 5A35A 3K57A 1V1PB 4KY7A 4N9TA 1AFPA 3QWNA 1RDPD 1SEBD 3I4LA 3EFXD 5AFWA 3G7LA 2B2VC 4HAEA 4C3JG 4DAVA 2B2YC 2CVRA 3AB9A 5DM73 4RCNA 3GD7A 2RDFA 1C48A 3DMUA 1O7YA 5JVG3 1PTOD 4LK1C 4ZK9B 2RDHA 1HFGA 4BY7B 1AP0A 1S5CD 5T1GA 1H9SB 4DFAA 4DXFA 2ZT9C 1PDQA 3GO5A 4MHEA 1EYDA 1F9PA 1IL8A 1G6ZA 2F0HA 1WD1A 1EY9A 3GTPB 3S9WA 5G3LD 1ET6A 3M3YB 2EYMA 3S16B 5CV5A 3HOWB 2Q8IB 3NPPA 2JEAI 1PLFA 2A6ED 1LT5D 1TS3A 2KA7A 1JOOA 4KV6A 2E2DC 1UUPA 5ELFA 2F03A 3R2IA 4QUFA 1V43A 4XXEA 1JE4A 4DA2A 2JA5B 1HFNA 2QILA 5M5XB 3GTGB 2F0FA 1I4HA 3V96A 3K58A 2D62A 4FF3A 1T5XD 1EZ8A 5J1ZA 2MJ8A 1Q90A 3D31A 4XDXA 2B2TA 4XIGS 1IW7C 2F0NA 1DM0B 2OT2A 2CHBD 2X6GA 2WINB 1PRTB 2WIIB 5EKKA 2E76C 2MHVA 4CHTB 5C0XJ 4RFBA 1GUTA 4A3IB 1X3PA 3GTLB 1JOQA 3SVMA 1VCIA 3DXJC 5I9PA 3JAME 2HDLA 1SE3A 4OO1H 3IAYA 1Z47A 2QCPX 1RJTA 5IT9E 1H9SA 1WD0A 4HSPA 1G91A 5D3IB 5BN3A 4J1MA 4XYQA 3P7JA 1V8QA 3N52A 3SDZA 3DEOA 1ET9A 1NCVA 2EE1A 1K8MA 2N55A 1CHPD 1HTPA 4KN4C 4IUNA 2LY7A 4KKSA 5FOBB 3PMFA 2QDBA 4ZYSA 1U4MA 2K01A 3Q22A 5K5PA 1BR9A 1G8ZD 1NSNS 4FXGC 1SFOB 1OXSC 5CV6A 5JAVA 2KOLA 1G2TA 3R3OA 2GA4B 1Y1WB 2EYOA 4OIJA 1ENCA 2A6EC 2K5QA 4K5XA 1CT1D 1F2ZA 1S5BD 5M3MB 1U4PA 5M5YB 1W6JA 2DN8A 4L8JA 2DNCA 2K1BA 3PUVA 4ABNA 3BDCA 4IUVA 2HUGA 3VA5A 4DNTB 4HCSA 4ZAIA 1FYCA 4M1UB 5I4DA 3K5LA 1QWYA 2MGSA 4KJNA 3NP8A 1SYBA 1QB5D 1C8CA 3J80E 1U4LA 4I65A 2F0WA 1D5ZC 3R93A 1PTOF 3VR6A 2NUCA 4KY6A 2M00A 5C44B 3QIAA 4ZKBB 3VR4A 1X3QA 1QCBD 1SDFA 5BN5A 1EYCA 5EQ0A 1SMYD 1BQQT 3P1HA 1VF5C 1STAA 2B63B 3K6OA 2A74C 3J81L 4XQNA 3BVMA 1ML0D 5FK9C 1Q3LA 1F77A 3L9AX 3IL8A 3HRZC 1B9NA 5EPLA 1RD9D 3HOUB 2A69D 2B39A 4RH6A 3OMGA 4TRDA 3D8GA 1CM9A 3HOVB 2IJ0A 2B2UA 1KAAA 2KQ3A 1OXTA 4EVOA 3VYUA 2DY8A 4OHJA 3ND9A 3T4AC 1BCPB 1XWEA 5ELEA 1D5MC 2JEBI 1ZKOA 2IT1A 2IWHA 3NE5B 1CQVA 2HDMA 4FO2A 4EGVA 4PNYA 2L4NA 2EY6A 2RBMA 2F0IA 4ZUJA 4CJ0B 1HQMC 2ENBA 1BBXC 4NP5A 1LTTD 2R61A 3LNNA 1WTOA 2Q8TA 3EROA 3FDTA 4ZRZA 1CZGA 4F87A 3FVQA 3H94A 2J7ZA 1WTRA 3DUZA 4K2LA 5I9OA 4QF4A 3S14B 2K03A 3GP7A 3BVZA 1ICWA 5K36G 3NUCA 1SJED 3PUZA 4M8AA 4EQOA 2F0OA 3C46A 1BUVT 1DXMA 2O5IC 4X3TA 4Q5VA 4K6DA 1GUWA 3MAQA 4BBRB 3A56A 1R4PB 2F0KA 4TQUS 2KCNA 3P20A 4CJ2C 2XN9C 1QNUA 3AMUA 4R9WA 3R2TA 5JEAG 3MFYA 4KKUA 3WOEA 3I8ZA 2WP8J 1TS5A 2L1BA 4PMWA 2Z1CA 4KI0A 2WKDA 1D2BA 1TWHB 3TP5A 1SNPA 1TY2A 1RTNA 2L55A 4A3BB 1W6KA 4IUTA 4L63B 5JVH3 2PNRC 3O13A 3PO3B 1RODA 4WORA 3BDLA 1RF2D 4OL7A 4IFDI 2A69C 3TMEA 4PMCA 2K5DA 4RGMA 3MA2B 4IFDG 4WRDA 4DNRB 3I3CA 2I46A 1FNVA 3P75A 4P2CB 5EKIA 3S2HB 1A15A 3PIO3 3X3NA 2OF1A 2EDGA 5D3DA 3LX0A 3VR3A 1K83B 2B2WA 2CQAA 1EY4A 1Q1BA 3QB3A 2F0VA 2NZ1D 4RHRA 4FVMA 2BE5C 1KNAA 2A73B 2EYFA 1OXVA 4A3JB 2EY5A 2DY7A 2RA4A 3EQLC 3KLRA 1IKLA 3BS1A 3OMCA 4DAYA 3GTJB 4ZLTF 2K33A 4CKEA 1LTGD 5E4WC 4QIWB 2XWBB 4HMIA 3I91A 2IW3A 4K8JA 4KN7C 5KNDA 1GUSA 3T51B 1SNDA 2A6HC 3NTIA 4C1NI 1SE2A 1PZKD 4CJ1B 3TP8A 3S1QB 4G7HC 1SYCA 1J9OA 4HEDA 1YNND 1Q12A 1XXGA 3MXNA 5C4XB 4NDXA 1DJRD 3M4YA 4UAIA 4HR7B 1T5EA 5C0XI 2Q8RE 2PW5A 5A2QL 5CV9A 1ILQA 5C3EB 2R3ZA 1FGBD 5C0XG 3NSWA 1I4XA 3CRLC 3FEWX 4ZQ3A 5HGTA 3T53B 4UDUC 1SXTA 1SNCA 2Z4IA 1II3A 1KLUD 1EY6A 3I4NB 5CBEE 1B44D 2NVXB 2MP1A 5CGKA 4C3HG 2KEDA 2RVLA 1HHVA 1DYQA 3KLSA 1EY8A 1B3AA 3KUPA 1A2UA 1FNWA 1EY5A 3KF8A 5EBDA 1GUNA 1A3VA 1CFMA 1PZJD 2NVYB 3AU7A 5FLXE 4XT1B 2X69A 4I7ZC 4RHSA 1AZPA 1JICA 1JR0D 3D3RA 4TSSA 4A3GB 1ENAA 2E2HB 1QG7A 3C3LA 1NAPA 3DWPA 5I2YA 3K5NA 3GTKB 1TWAB 2AQ3B 5M9OA 4AYBB 5C6AA 5I2XA 1AW7A 3FRPB 4IFDJ 2K5WA 1TY0A 1TWFB 4KTAA 1RCVD 4C3IG 1KDAA 3W3AA 2XSCA 5IODA 5C3WA 3SE0A 1I6VC 1TKWB 5K36H 1EWCA 1SAPA 1O7ZA 4MN3A 1MSGA 1BXTA 3GTOB 5D65A 2O5JC 2RDGA 1ONLA 3MVVA 1JWUD 3RLFA 1GHKA 1D1IA 3NWTA 2F0UA 5ELCA 3OSOA 2EYHA 3I72A 1WCMB 1STGA 2AWNA 3N6RA 5JEAH 1PTOH 5C4ZA 1E0BA 1S4ZA 1JB3A 3K5MA 5FO7B 1GXDC 1XTCD 1JORA 2NB0A 5DAUA 1WTWA 3HOYB 2O2LD 3TP7A 4H0LC 5BN4A 2F0QA 3M7NA 1MBYA 1VMPA 3J7AF 3SK6A 4KJOA 5CORA 4RGTA 3DWAA 4E6IA 1Z6HA 1LLRD 2J0TD 2EXZA 1VMCA 2VB2X 2B2VA 4IFDH 2B2YA 1KDCA 4N9PA 1XYIA 2PZTA 1EWHA 2OXPA 3NBHA 1B9MA 1I4GA 4IUUA 5DNFA 4H7BA 5I6WA 3E5SA 4KKTA 4ZUIA 1OXXK 3GTQB 2VNUD 1Y8NB 2C5CA 4IUQA 3NHHA 5EPJA 5ELDA 3CHBD 4A3DB 2BA1A 1WTPA 3EVQA 1PTOC 1TIID 1MGSA 4LJZC 2WB1B 2AUJD 1ZXTA 2IX0A 3FPUB 4O42A 1S5ED 3VYSA 1WTVA 3PUYA 1LACA 4A3EB 1XX8A 1EQTA 2HCIA 5IGEA 2RSNA 2NVQB 2E2JB 2IX1A 1BCPD 1EYAA 2SNSA 5IOCA 4PMBA 2J4XA 3U9SA 1CI3M 5CV7A 2K28A 4CBVA 1S5FD 1ENFA 3PUXA 1Q8IA 2ZXRA 1HXYD 2XVSA 3NTHA 2PPBC 5KNBA 3QG1A 1BO0A 4XTCS 1Y8PB 3K59A 1KNEA 1HA5A 2WAQB 1A3TA 5C0XH 3I73A 2FINB 1PRTF 3E0JA 1GHJA 3PIP3 3M85A 3L7ZC 4X3KA 1SYGA 1MSHA 2EY2A 4ODGA 3OOCA 3OWEB 3K0YA 2KVMA 3SK5A 3OIQA 4FF1A 2SDFA 5HURA 1EZ6A 1RHPA 3HG9A 4FXDA 2VXWA 3MXGA 1F9QA 3CKIB 2AQ1B 5EBCA 3TSSA 5FO8B 1NR4A 2A68D 1EY0A 1LT6D 1ZYRD 2XRSD 3M7GA 1IYVA 5JJZA 3SEBA 2XRQD 2LMCB 2ICEC 2FFKB 2F0PA 3V05A 2I07B 3S1NB 2ZXPA 4KHZA 1B53A 1EEID 2E75C 4DN4M 3BYTB 2WACA 2E2IB 5EPKA 3EA6A 3NBIA 3SHLA 2BOSA 4U68A 3NWSA 4NW2A 1EIHA 4RGOS 4CKBA 1STNA 1QJOA 2O4XA 4C3HB 1Y1VB 1F2MA 2VUMB 1U9RA 3H09A 3MXPA 5E3FA 2QEJC 2RQXA 1L0YB 2KJXA 4OGQC 4C3JB 1KLGD 1S5DD 3BVGA 1CHQD 1YNJD 2AQ2B 1EEFD 2IL8A 3ITPA 1DD2A 2EZVA 4A3KB 2K6AA 4KK7A 1MI2A 3J7YW 4X3SA 2F0SA 2B8FA 4F7XA 2NYZD 3VYRA 1BDOA 3QOLA 4Q0FA 3J81E 5M3FB 2Z4HA 1UEAB 4DU9A 1HUNA 1NR2A 5KNCA 3TBIB 1SMYC 3RZOB 2N88A 2IX3A 3RMHA 3C1EA 5FKAC 3A55A 2QKIC 2A68C 1B1ZA 1STYA 3KK7A 3NK9A 1H9JA 1EQVA 1G2SA 3ONAB 1BCPF 2JXMB 3D4WA 1QE6A 1DOMA 3QJYA 3I90A 1ESRA 4G7OC 3ZYYX 3NTKA 5LL6X 2NWGA 5C4JB 3S15B 1LT3D 1Y69U 1I4QA 4X3UA 1O7LA 4U673 3MFGA 4LAAA 1VDZA 5IGGA 2XWJB 4RKLA 1JC7A 5KYLA 3HKZB 1TR5A 5C5MA 2BA0A 2F0TA 1D1KA 3A8IE 1B2TA 1JWMD 5KRUA 2YU9B 4OIKA 3Q24A 1D6EC 1TWCB 4ME5A 4RGNA 3DM1A 4G57A 3HGBA 1X32A 2MPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS4 A;  1BXT A;  1TY2 A;  1G8Z D;  1LTS D;  1XXG A;  2AQ1 B;  2Z8L A;  2RDG A;  1LTI D;  3TSS A;  1LTB D;  2IJ0 A;  3R2I A;  1SJH D;  1DJR D;  1JCK B;  1JWU D;  1PTO C;  1V1P A;  2SEB D;  1HQR D;  4L63 B;  1LT6 D;  1LTR D;  2QIL A;  1FNU A;  1UNS A;  2XRS D;  1I4H A;  5ELC A;  4OHJ A;  3O13 A;  1BCP B;  5ELE A;  1RF2 D;  1PRT C;  1D5M C;  1T5X D;  1CT1 D;  1QIL A;  1S5B D;  1FGB D;  3URY A;  1PTO H;  1S5E D;  1CQV A;  1V1P B;  2XRQ D;  1STE A;  3BZD B;  3SEB A;  1I4X A;  1M4V A;  4C56 C;  1EU4 A;  4RGM A;  5FKA C;  4UDU C;  1RDP D;  1SXT A;  1SEB D;  1PTO B;  3EFX D;  1AN8 A;  3W2D A;  1XTC D;  3V05 A;  1SE4 A;  1LTT D;  1B1Z A;  4K6L A;  4BWG B;  2R61 A;  1KLU D;  1EFI D;  4Z9C B;  1BCP D;  1FNV A;  2CHB D;  1B44 D;  1EEI D;  1GOZ A;  3BYT B;  1PRT B;  5I4D A;  1BCP F;  3R8B A;  2O2L D;  2J4X A;  1LO5 D;  3BYY B;  1PYW D;  3EA6 A;  4RCO A;  5D3D A;  1DYQ A;  1S5F D;  1ENF A;  3GP7 A;  2NTT A;  1FNW A;  4RFB A;  1HXY D;  3BVZ A;  5ELB A;  2ICI A;  3KLS X;  1PTO D;  1SJE D;  1FD7 D;  2RDH A;  3DWQ A;  4RGT A;  1PZJ D;  4RHR A;  1D5Z C;  3DWA A;  4RGO S;  1S5C D;  1PTO F;  1JQY D;  4RHS A;  1LT3 D;  1LT4 D;  4DXG A;  1HTL D;  1JR0 D;  4L6T B;  4TSS A;  4DXF A;  1HA5 A;  1I4Q A;  1LLR D;  5TSS A;  1SE3 A;  1L0X B;  1PZI D;  1KTK A;  1PRT F;  2WV6 D;  1I4R A;  3MFG A;  1D5X C;  5D3I B;  2XN9 C;  1I4P A;  1ET6 A;  2G9H D;  2TSS A;  3DWP A;  2XNA C;  2AQ3 B;  1LTG D;  1TS2 A;  3R2T A;  1AW7 A;  1V1O A;  1SBB B;  3BVM A;  1ESF A;  5FK9 C;  1ET9 A;  2QEJ C;  1I4G A;  4O1N A;  1EU3 A;  1TY0 A;  1CHP D;  1L0Y B;  1F77 A;  2NTS A;  1RCV D;  1TS5 A;  3OWE B;  1JWM D;  2IPK D;  1JWS D;  1LTA D;  3MC0 B;  1LT5 D;  1KLG D;  1PRT D;  4ZYS A;  1RD9 D;  1D6E C;  1S5D D;  1TS3 A;  3BVG A;  1BCP C;  1CHQ D;  4RGN A;  2AQ2 B;  1SE2 A;  1EEF D;  1PZK D;  1CK1 A;  1UUP A;  1EWC A;  3CHB D;  5ELD A;  4RH6 A;  1MD2 D;  5ELF A; 
#chains in the Genus database with same CATH topology
 2EY1 A;  4HJ9 A;  1RKN A;  4S3S A;  2CWA A;  4RWS C;  1HZB A;  2F0E A;  1SJH D;  2H4O A;  1B7Y B;  2HD3 A;  3BDO A;  4JBW A;  2F52 A;  5C44 G;  5DLQ E;  1LV9 A;  1JJ2 A;  3BU2 A;  3ULJ A;  4DAM A;  4FYD A;  3VR2 A;  2KCC A;  4JI1 L;  2SOB A;  4J6H A;  2LKV A;  3SK8 A;  2R93 H;  5IYB H;  3H0G B;  2B63 G;  2E74 C;  3ULP A;  3GQB A;  3URY A;  1IYU A;  1E2Z A;  2IHE A;  4GOP B;  4C2M H;  1BF4 A;  4FF4 A;  3A7A B;  2AWO A;  3IRB A;  5T1I A;  1GKH A;  4NPS A;  3SXH A;  3I55 A;  1SNM A;  2JJQ A;  4DGZ A;  2RKS A;  1VQN A;  4K6L A;  1M8A A;  4WJ3 M;  3PO2 H;  3TZU A;  4ILW A;  1EFI D;  3MEF A;  3RNU A;  4K2K A;  5JPM C;  3HOU G;  3L2P A;  4DV0 L;  1AEX A;  4HMJ A;  2L15 A;  5KGU A;  1VQB A;  3L3O C;  5FO9 B;  1HJP A;  4LUO A;  4DR2 Q;  2JE6 I;  1HA6 A;  2UUB L;  4ID6 A;  4JOI A;  2WKC A;  4B9W A;  4BY7 H;  4OEL B;  5FLM G;  3J81 j;  2GVA A;  3I70 A;  2L12 A;  2VB3 X;  3D4D A;  3HOV G;  3VA7 A;  2YYZ A;  1QNK A;  3Q23 A;  1Q1E A;  4NB3 A;  3UE1 A;  4KMU C;  4KD4 A;  1EIY B;  1HTL D;  2F0L A;  1PMR A;  1G51 A;  4JBK A;  4K14 A;  1KAW A;  4BS9 A;  5TSS A;  1EFW A;  2ZXO A;  1IBL L;  1G29 1;  5KYI A;  3M3Y H;  5ELN A;  1A3U A;  1MIU A;  5JOB A;  1CSP A;  3S16 H;  1DZ1 A;  2JQO A;  3HOW H;  4K5W A;  1VQJ A;  3TZD A;  1PH9 A;  4B9X A;  4UP7 A;  4Y7N B;  4RA8 A;  1SSO A;  1DCZ A;  1IW7 D;  1F2Y A;  1H9K A;  2G9D A;  4K5V A;  4DV1 L;  5JPN C;  1TU2 B;  3W5O A;  4C1N K;  1QUQ A;  1EOV A;  2PMZ E;  3F8T A;  2OEO A;  1PRT D;  5KEE A;  3T16 A;  3D6C A;  1U4R A;  2DUD A;  1RTO A;  3MHB A;  2F3V A;  1S3O A;  2B2T C;  2UUC L;  2R93 B;  1JOK A;  4A3M H;  2JA5 H;  5JJK A;  1SNO A;  5M5X H;  1UAP A;  1LTB D;  3GTG H;  1STB A;  1IBK Q;  1X3E A;  2K5V A;  4C2M B;  4BBR G;  1I50 H;  2FJ2 A;  2LFN A;  2OQ0 A;  3E6Z X;  1XPU A;  1I3Q H;  3PO2 B;  1PYB A;  1A2T A;  3CCS A;  1FL0 A;  3JAM L;  1M4V A;  1IHZ A;  4UHV A;  3T1Y L;  2QF7 A;  2V4D A;  2UUC Q;  2HCC A;  4H13 C;  2K52 A;  4HID A;  4LF7 Q;  3W2D A;  3H6M A;  5CBA E;  1SE4 A;  2NZO A;  5IT9 L;  4BWG B;  2F0J A;  4DV4 L;  1GOZ A;  3EJI A;  2I5M X;  3MXU A;  4A3I H;  3DHQ A;  4KY5 A;  1EOT A;  3R8B A;  3GTL H;  2FMC A;  2F1M A;  2R92 B;  4NKL A;  4RCO A;  3F1Z A;  1KDB A;  4B3S Q;  5C5L A;  4DR7 L;  2NTT A;  2F0G A;  3NXW A;  1YJN A;  1YNN C;  2VQE Q;  3T1Y Q;  5A2Q E;  3HOZ B;  3SK4 A;  4LF8 L;  2JN4 A;  1JQY D;  3CU7 A;  2CQO A;  5ELO A;  5LHY 1;  3PO3 G;  3M9B A;  2CWP A;  3GV6 A;  4JYA L;  1BOS A;  2M2L A;  1H9M A;  2WV6 D;  3KBX A;  3MZ5 A;  2KEE A;  4L5Q A;  4A3C G;  2VQF L;  2JA7 H;  3GTM B;  1XNR L;  1E3P A;  1IXR A;  5CMD A;  1KD1 C;  4DR7 Q;  5IT9 c;  2D2C C;  1ESF A;  1UE6 A;  3NQT A;  1EU3 A;  4A3M B;  2NN6 I;  2K04 A;  4QB4 A;  2F3W A;  4XYO A;  4GKJ Q;  1VQ7 A;  1I50 B;  1XPO A;  2NN6 G;  4N8F A;  2D9U A;  1EWI A;  1CK1 A;  3DLL A;  1I3Q B;  1TS4 A;  3S1R H;  2Z8L A;  1WTQ A;  1XNR Q;  2BDO A;  1Y1W H;  1VQO A;  1JCK B;  1F9S A;  2N78 A;  4RMF A;  1V1P A;  4A3J G;  4G7Z C;  1I5F A;  3PSI A;  1E7Z A;  5M3M H;  3J80 L;  2MO1 A;  1O80 A;  5M5W B;  4NXN Q;  1PRT C;  4HTH A;  4IZ8 A;  4R8I A;  1A8V A;  1GJX A;  2M9V A;  1QIL A;  3MTS A;  1I6H H;  3TRE A;  5ISR A;  4MNO A;  1SNQ A;  3HEJ A;  5CC4 A;  1PTO B;  1M90 C;  4A3L G;  1CA5 A;  1LM0 A;  2JSO A;  2R6G A;  2E5L L;  4XQQ A;  4V0B A;  3ICE A;  4OXP A;  3QO2 A;  2AUK A;  1HNZ Q;  3RZD H;  2R7Z H;  5J39 A;  1IKM A;  3CCJ A;  1PYW D;  1TWG B;  1YVC A;  2NBF A;  3TS2 A;  5C4X G;  2ALY B;  4IO9 A;  4QMG A;  1K9M C;  3IFT A;  2R7D A;  1HCZ A;  5C44 H;  1LUZ A;  4IAL A;  1KRT A;  1FD7 D;  3DWQ A;  2EJG C;  2JA7 B;  2X6L A;  2B3G A;  3CD6 A;  3SR1 A;  3KBG A;  2F0D A;  3WDN A;  3RN2 A;  2B63 H;  3H3V C;  4O2D A;  1WVL A;  1B50 A;  2E5L Q;  1PFM A;  5IWA L;  3GV3 A;  2L0C A;  4AH6 A;  1PZI D;  4G4K A;  4GLX A;  5C3E G;  2B2U C;  4ULL A;  4JVZ A;  2JA8 H;  4NMZ A;  1YI2 A;  1D5X C;  4X6A H;  4V19 0;  1JJG A;  1I4P A;  4ZKC B;  1AE3 A;  5J22 A;  1GVP A;  1IL2 A;  1CUK A;  1V1O A;  5C3X A;  1I94 Q;  1YHQ A;  3S1R B;  4A93 H;  4YCU A;  3OIP A;  4CKC A;  1LAB A;  3NQI A;  1LTA D;  1SYE A;  3A8K E;  3MC0 B;  4X65 L;  4TKO B;  3PUW A;  5FLM H;  1DOL A;  1CZW A;  4WJ4 A;  2A1A A;  1ASY A;  1J8I A;  5IWA Q;  3HOV H;  4IUR A;  2KEC A;  3J7A 5;  4RAU C;  1PHJ A;  2RF4 A;  1HR0 W;  3G6E A;  4DK0 A;  1LTS D;  4LWC A;  1I6H B;  1B4O A;  1NUC A;  4DF7 A;  4FF2 A;  3ERQ A;  1T9H A;  2EYL A;  1AZQ A;  3FMC A;  3PV0 A;  3OPO A;  4DUY L;  4JI2 L;  4IOC A;  2UU9 Q;  1NBW A;  1YEZ A;  1A0I A;  5BR8 L;  2MUY A;  3ZJY C;  5GAH C;  3AQQ A;  4QCL A;  4IQZ A;  3J80 i;  4X65 Q;  4J8Q A;  2EYP A;  3UI2 A;  1N32 Q;  2XIW A;  1PH1 A;  1STE A;  2PCF B;  1CKO A;  1QZG A;  5IGB A;  3RZD B;  2R7Z B;  4C56 C;  3TN2 A;  1EU4 A;  1DGS A;  2K05 A;  5GAG C;  2Q2U A;  5DEH A;  3U58 A;  4Z9C B;  5IP7 G;  3PQI A;  2F0M A;  3A54 A;  1BNZ A;  1GUO A;  3T1H Q;  3S14 H;  4DV5 L;  1HUM A;  2PQE A;  3RUZ A;  1L0W A;  2VY3 A;  1CQF A;  1LO5 D;  1YZ6 A;  3BJU A;  2OWO A;  5IIF A;  1SMX A;  4A3F B;  5E1F A;  1A63 A;  4HN7 A;  2KCM A;  5G3L F;  2JA8 B;  4P75 A;  4C3I H;  4X64 L;  1PH7 A;  3OWF A;  2HQE A;  5IE8 A;  2K75 A;  2L5T A;  3D6W A;  4DXG A;  3KDF B;  1EIG A;  3CRK C;  5HY6 A;  4YHH Q;  3C1F A;  1L0X B;  2CFM A;  4A93 B;  3J7A V;  5EJW A;  1WCM G;  4WFN 3;  4DV5 Q;  3K5O A;  1TVX A;  3CXC A;  3ULL A;  4B3R Q;  4B3M L;  1MJC A;  3KOJ A;  4TVA B;  3CC7 A;  5CV4 A;  1QOH A;  4YY3 L;  3FP9 A;  3RR5 A;  3UE0 A;  2JA9 A;  3IKJ A;  5EGT A;  4MTK A;  2C35 B;  3F2C A;  3M4P A;  5IY0 A;  4O1N A;  2TMP A;  3LWU A;  1TWH H;  1GUG A;  2OQK A;  3T13 A;  4DR5 L;  1F9R A;  1K0S A;  3H91 A;  3HOY G;  2JP1 A;  5D14 A;  1BCP C;  3IFD A;  1QVF A;  2YTY A;  3HS0 C;  1B8A A;  5I6Y A;  1PXU A;  1MD2 D;  1F2L A;  1PH3 A;  2CW0 D;  4DAP A;  4IN3 A;  1SYF A;  1LTI D;  3A8J E;  2BE5 D;  4B3M Q;  2K7V A;  1Q81 C;  2BCO A;  3ND8 A;  3PO3 H;  4MIU A;  4HSV A;  1HQR D;  3HZX A;  1R9T B;  1LTR D;  1IBM L;  4JK1 C;  4R4O A;  1UNS A;  2EIF A;  1NJI C;  4A3C H;  5F2D A;  3A5U A;  1AE2 A;  2B2W C;  2EYJ A;  2L9H A;  1Q7Y C;  1KRS A;  2EVB A;  3K7A H;  3HP3 A;  1E1T A;  4UPA A;  4IUP A;  4CGY B;  5CV8 A;  2JA6 H;  2RSO A;  1H95 A;  2E8G A;  3RLO A;  5EKL A;  1VQ6 A;  1IZ6 A;  4L5T A;  4F8M A;  3S2H H;  1AN8 A;  1PFB A;  2PZU A;  3DEP A;  1CSQ A;  2A6H D;  1VQ4 A;  2NN6 H;  4KHV A;  4LMQ D;  4DV6 L;  1EL0 A;  2LXK A;  4C3I B;  1IBM Q;  4BBS B;  4QUC A;  3OHX C;  4AQY Q;  3CQZ B;  1K83 H;  3BYY B;  1TT2 A;  1WI5 A;  3WOF A;  2PMZ B;  3Q8D A;  4R4C A;  3LWE A;  3J81 i;  1UE7 A;  3H3V I;  3Q6S A;  4FP5 D;  2A5H A;  4A3J H;  2CH4 A;  1E22 A;  5DM6 3;  2AHO B;  3EN2 A;  3GTJ H;  3C2P A;  4LF6 L;  1A62 A;  4L6T B;  1EUJ A;  1ZYR C;  2WB1 G;  1HZ9 A;  4DR1 L;  3TDQ A;  2D5D A;  2FHT A;  4HCE A;  1VF7 A;  4DR6 L;  4KLK A;  2ZTC A;  1L2F A;  1EY7 A;  4XT3 B;  5GAD C;  1ICF B;  2NVT H;  3S17 B;  3KDF A;  1A6X A;  4A3E G;  5C4H A;  2TSS A;  1UEB A;  2XNA C;  3KF6 B;  4RG1 A;  1K8O A;  3K81 C;  2ZTD A;  3RD4 A;  4P72 A;  2WAQ E;  2N49 A;  4B08 A;  1CA6 A;  2QA4 A;  2EOT A;  3S1Q H;  2NTS A;  2PW7 A;  2IPK D;  1JWS D;  4DK1 A;  2B8G A;  1E1O A;  4YIJ A;  3Q0A A;  5E4X A;  5C4X H;  4XQJ A;  2L11 A;  3S2D H;  3VR5 A;  1RL2 A;  4FXK C;  4BY1 B;  1TQO A;  4WJW A;  3K7A B;  1HRJ A;  3NEL A;  4R8N A;  2F4I A;  1DOK A;  4F88 A;  2KHS A;  2QDL A;  1KQS A;  3OTO Q;  1ILP A;  2JA6 B;  5NUC A;  3HOX B;  1FNU A;  2WAQ G;  5C3E H;  2K32 A;  4OO1 I;  2EJM A;  3JC6 6;  2LS0 1;  5FLX L;  3CPW A;  2CKZ B;  3MWY W;  3BZD B;  2CH4 W;  4OO1 G;  1SRU A;  3VYT A;  2CW0 C;  1O78 A;  2I5L X;  2DGY A;  3A0J A;  3V2T A;  1STH A;  4JV5 Q;  4K0K L;  2DNE A;  2PO4 A;  5FJ8 G;  2K14 A;  4DR2 L;  3M4O B;  4PV1 C;  4FNF A;  1KHI A;  3UDI A;  2MQH A;  1C9O A;  4EQN A;  1R4Q B;  1HNX L;  1YNJ C;  1KAB A;  4BA1 I;  2FMM A;  5ELB A;  2H1E A;  2ICI A;  3KLS X;  1PFN A;  2PYK A;  2YTV A;  1E2V A;  2NVT B;  2EPB A;  2C9O A;  1XMO L;  3QOJ A;  4GZY C;  3FKI B;  5CYU A;  1H9R A;  1LT4 D;  3X3M A;  5JJI A;  1VQA A;  3MEH A;  4K0K Q;  1OO9 B;  3FPP A;  2A19 A;  2HQL A;  4KD3 A;  3D4R A;  1TWA H;  4A4I A;  5IGD A;  3GTK H;  1KTK A;  4EQP A;  3F2U A;  1I4R A;  3D0F A;  4LF4 L;  3I4M B;  1BBU A;  3G6J B;  5LL6 S;  2N3S A;  1Z7T A;  2G9H D;  2SNM A;  5IGC A;  1HNX Q;  3S2D B;  3TP6 A;  1TS2 A;  3S24 A;  1K3B C;  3T56 B;  1HPC A;  4CDF C;  1AH9 A;  1SBB B;  1OXU A;  1P8L A;  1JT8 A;  4BA2 I;  1WTX A;  1CTM A;  1XMO Q;  3A7L A;  3U9O A;  1MHW C;  3KF6 A;  1FR3 A;  2HIX A;  3BG3 A;  1K8G A;  3GTP H;  2H5X A;  3E0E A;  5COY A;  3GTO H;  1VQ9 A;  2ID0 A;  3AEV A;  1C4Q A;  5IGF A;  3H15 A;  4LF4 Q;  3S1M B;  3PF5 A;  2EJF C;  1IBK L;  5JEA J;  4PQX A;  5KIX A;  2BDN A;  1DON A;  1E2W A;  2KUM A;  1SYD A;  2SEB D;  4H44 C;  1WCM H;  4JI8 Q;  1ZEQ X;  4LFB L;  3UDX A;  3OW7 A;  5CR3 A;  1YHA A;  4K8I A;  4N8X 1;  1Y1V G;  1VQE A;  4LF9 Q;  2Y0S B;  2JYO A;  2HHH Q;  1BKB A;  1Y8O B;  2PZW A;  2OCE A;  4RKB A;  5A35 A;  2Z0S A;  3K57 A;  1V1P B;  4KY7 A;  2VUM G;  4N9T A;  4LF7 L;  1AFP A;  3QWN A;  1RDP D;  1SEB D;  3I4L A;  3EFX D;  5AFW A;  1VQH A;  3K7U C;  3G7L A;  2B2V C;  1YBY A;  5GQO A;  4HAE A;  4C3J G;  3CF5 A;  4DAV A;  2B2Y C;  2CVR A;  3AB9 A;  3CCE A;  4IPC A;  5DM7 3;  4RCN A;  3OYY A;  4LFB Q;  3GD7 A;  1N8R C;  3NEM A;  4JPB W;  2I0Q A;  4B3S L;  4FDB A;  2RDF A;  1MKH A;  1C48 A;  3DMU A;  2VQE L;  1GM5 A;  1O7Y A;  5JVG 3;  1PTO D;  4LK1 C;  4ZK9 B;  4OX9 L;  2RDH A;  1HFG A;  4BY7 B;  1AP0 A;  1S5C D;  1CKM A;  5E7N A;  3E3X A;  5T1G A;  2Z6K C;  1JJC B;  1H9S B;  4DFA A;  3L0O A;  4DXF A;  5M3F G;  1PH4 A;  2ZT9 C;  1PDQ A;  3GO5 A;  4MHE A;  1X9N A;  1EYD A;  1F9P A;  1IL8 A;  3E9I A;  4HIK A;  1G6Z A;  2F0H A;  1WD1 A;  1EY9 A;  3GTP B;  2A8V A;  1B3Q A;  3S9W A;  5G3L D;  1ET6 A;  4J15 A;  3M3Y B;  1V9P A;  4A3B G;  2EYM A;  3GTQ H;  3S16 B;  5CV5 A;  3HOW B;  2RHS B;  4OX9 Q;  2Q8I B;  3NPP A;  2JEA I;  4GKJ L;  1PLF A;  5HGQ A;  2A6E D;  3U4Z A;  1LT5 D;  1TS3 A;  2KA7 A;  1JOO A;  4KV6 A;  2E2D C;  1VQC A;  3JAM c;  1WFQ A;  1UUP A;  2IY5 B;  4EQ5 A;  5ELF A;  4LNQ A;  3H3V H;  2F03 A;  3R2I A;  4QUF A;  1V43 A;  1VQK A;  2NZH A;  4XXE A;  1JE4 A;  3EIV A;  4DA2 A;  2JA5 B;  1HFN A;  2QIL A;  4OWT B;  5M5X B;  1PH6 A;  4JC0 A;  2F0F A;  3GTG B;  1I4H A;  5EAY A;  3V96 A;  4APV A;  4NXN L;  3K58 A;  4A3E H;  2D62 A;  4FF3 A;  1T5X D;  1EZ8 A;  4HJA A;  1SFO H;  4IJL A;  4QIW E;  5J1Z A;  3QR8 A;  4GNX C;  1HR0 L;  1WYD A;  2MJ8 A;  1Q90 A;  2NVQ H;  3D31 A;  3U4V A;  4XDX A;  3AYH B;  3STB D;  2B2T A;  4XIG S;  1IW7 C;  2F0N A;  1DM0 B;  2OT2 A;  3CME A;  2CHB D;  1HNZ L;  2X6G A;  2WIN B;  5M5Y H;  3KFU A;  1PRT B;  2WII B;  5EKK A;  2E76 C;  2MHV A;  4CHT B;  5C0X J;  4RFB A;  1GUT A;  3I7F A;  4A3I B;  1X3P A;  3GTL B;  1HR0 Q;  3PCO B;  1JOQ A;  4UY8 C;  3SVM A;  1VCI A;  2Q2H A;  3DXJ C;  4IOA A;  1Y14 B;  5I9P A;  3JAM E;  2HDL A;  1SE3 A;  4LW1 A;  3K80 C;  4LUZ A;  4OO1 H;  3HFZ B;  3H0G G;  3BZK A;  3IAY A;  1Z47 A;  4I7A A;  2QCP X;  4OWW B;  2DJG C;  1RJT A;  5IT9 E;  1H9S A;  1WD0 A;  4HSP A;  3AFQ A;  1G91 A;  5D3I B;  5BN3 A;  4J1M A;  4XYQ A;  3P7J A;  3SGI A;  1I94 L;  1CKN B;  3CW2 C;  1V8Q A;  2B29 A;  3N52 A;  3SDZ A;  3DEO A;  1ET9 A;  1NCV A;  2EE1 A;  5FJ8 H;  1K8M A;  2N55 A;  2QGQ A;  1CHP D;  2KCT A;  5JJL A;  1HTP A;  4KN4 C;  3J80 c;  3PIO A;  4IUN A;  4JBJ A;  2LY7 A;  4KKS A;  5FOB B;  3PMF A;  2QDB A;  4ZYS A;  1U4M A;  4HIM A;  2K01 A;  1VQD A;  3Q22 A;  1Z9F A;  5K5P A;  1BR9 A;  1L1O C;  2EXD A;  1G8Z D;  1NSN S;  1G6P A;  4FXG C;  1SFO B;  1OXS C;  4IJH A;  2Z9H A;  5CV6 A;  2UU9 L;  5JAV A;  2KOL A;  1G2T A;  3HOU H;  3R3O A;  2GA4 B;  4LFA Q;  3I4N G;  1Y1W B;  2Q2I A;  2EYO A;  4DR3 L;  2ZM6 Q;  4OIJ A;  1ENC A;  2A6E C;  2HT1 A;  4DUZ Q;  3ERS X;  1V1Q A;  1N32 L;  2F4V L;  2K5Q A;  1P16 A;  4K5X A;  1CT1 D;  1F2Z A;  4AYB E;  1S5B D;  2GVB A;  5M3M B;  1U4P A;  5M5Y B;  1W6J A;  1N36 L;  3S1N H;  4X62 Q;  2DN8 A;  4L8J A;  2DNC A;  2K1B A;  4GS3 A;  4B3T L;  3LGJ A;  3PUV A;  3BDC A;  4ABN A;  4IUV A;  2HUG A;  3VA5 A;  3PGZ A;  4DNT B;  3T1H L;  1S40 A;  4HCS A;  4A3G G;  4ZAI A;  1FYC A;  4M1U B;  5I4D A;  4DR3 Q;  3K5L A;  1QWY A;  1EIF A;  2F4V Q;  2MGS A;  1NNX A;  4KJN A;  3NP8 A;  1SYB A;  1QB5 D;  4AYB G;  1N36 Q;  1C8C A;  3J80 E;  1U4L A;  4I65 A;  2F0W A;  1D5Z C;  3R93 A;  1PTO F;  1GD7 A;  2P5Z X;  2Z6B A;  1Y1V H;  4B3T Q;  3VR6 A;  2NUC A;  4KY6 A;  2M00 A;  5C44 B;  3QIA A;  4ZKB B;  3VR4 A;  4YHH L;  1X3Q A;  1QCB D;  1SDF A;  5BN5 A;  1EYC A;  2VUM H;  5EQ0 A;  1SMY D;  1BQQ T;  3P1H A;  1VF5 C;  4B3R L;  1STA A;  4JG2 A;  2B63 B;  3K6O A;  4HJ5 A;  4R4T A;  2A74 C;  4DK6 C;  3J81 L;  1YIJ A;  4BBR H;  1ASZ A;  4XQN A;  4HIO A;  4C3J H;  3BVM A;  1ML0 D;  5FK9 C;  1Q3L A;  1F77 A;  4JI0 Q;  3L9A X;  3IL8 A;  3HRZ C;  1N33 Q;  4EX5 A;  2UXC Q;  1B9N A;  1CKN A;  3G48 A;  5EPL A;  5AJ3 L;  2QEX A;  1RD9 D;  3HOU B;  1S72 A;  2R92 G;  2A69 D;  2B39 A;  4RH6 A;  3WWV A;  3OMG A;  4JI6 Q;  1HNW L;  4TRD A;  4JI5 L;  3D8G A;  4HJ7 A;  1LYL A;  1CM9 A;  3HOV B;  2IJ0 A;  2B2U A;  1KAA A;  3HOZ G;  5M3F H;  1LTL A;  2KQ3 A;  5IP9 G;  1OXT A;  2YTX A;  1NE3 A;  4EVO A;  3VYU A;  2DY8 A;  4OHJ A;  3ND9 A;  3T4A C;  1BCP B;  1XWE A;  5ELE A;  4KHP Q;  5AJ3 Q;  1D5M C;  2JEB I;  3J81 c;  1ZKO A;  2IT1 A;  2IWH A;  3NE5 B;  4A3B H;  1CQV A;  1X3F A;  2HDM A;  4FO2 A;  4EGV A;  4PNY A;  1PVO A;  2L4N A;  2EY6 A;  2ES2 A;  2RBM A;  1HNW Q;  2F0I A;  4ZUJ A;  4JI5 Q;  4CJ0 B;  4A3M G;  1K3R A;  1HQM C;  2ENB A;  1BBX C;  4NP5 A;  1LTT D;  2R61 A;  3LNN A;  1WTO A;  2Q8T A;  1SN8 A;  3ERO A;  3FDT A;  4AQY L;  5J3B A;  4ZRZ A;  1CZG A;  4POG A;  4F87 A;  5LMU Q;  3FVQ A;  1HH2 P;  2PI2 E;  3H94 A;  2J7Z A;  1WTR A;  3DUZ A;  4K2L A;  5I9O A;  4QF4 A;  3S14 B;  2K03 A;  3GP7 A;  4IPD A;  3CCU A;  3BVZ A;  1ICW A;  5C4J H;  3NUC A;  3S15 H;  5K36 G;  2LSS A;  3B6Y A;  1SJE D;  3PUZ A;  4M8A A;  4EQO A;  2F0O A;  1JB7 A;  1BUV T;  1DXM A;  3C46 A;  2O5I C;  2UXB L;  4X3T A;  4Q5V A;  4DAY B;  4K6D A;  2WB1 E;  1GUW A;  3MAQ A;  4BBR B;  4CDE C;  3A56 A;  1R4P B;  2F0K A;  4TQU S;  2KCN A;  3P20 A;  2UXD Q;  1OTC A;  4CJ2 C;  2ZTE A;  3FHW A;  4A3D G;  1D8L A;  4DV3 Q;  2XN9 C;  1QNU A;  1X55 A;  4A75 A;  4R9W A;  3AMU A;  1XJV A;  3R2T A;  5JEA G;  4QJF A;  3MFY A;  4KKU A;  5GRO A;  3WOE A;  3I8Z A;  1TWC H;  2WP8 J;  3VDY A;  2UXB Q;  1TS5 A;  2AMC B;  2L1B A;  1EYG A;  4PMW A;  2Z1C A;  4KI0 A;  2WKD A;  3MXN B;  3CCQ A;  4JI3 L;  1D2B A;  1TWH B;  3TP5 A;  3KLW A;  1SNP A;  2N8N A;  3HKS A;  1TY2 A;  1RTN A;  3A5Z B;  2Q2T A;  1FVI A;  4A3L H;  1FJG Q;  2L55 A;  4A3B B;  2JA7 G;  3OTO L;  1W6K A;  4IUT A;  4L63 B;  3H0G H;  5JVH 3;  4JOI C;  4GKK Q;  4POF A;  4JI7 L;  2PNR C;  3O13 A;  2UUA Q;  3PO3 B;  2VL6 A;  1ROD A;  4WOR A;  3BDL A;  1RF2 D;  4OL7 A;  1J5E L;  4JI3 Q;  4IFD I;  2A69 C;  3TME A;  4PMC A;  2K5D A;  1Q82 C;  2XTI A;  4PZ8 A;  4RGM A;  1XNQ L;  3MA2 B;  4IFD G;  4WRD A;  4JV5 L;  1PFS A;  4DNR B;  2KBN A;  2MNA A;  3I3C A;  2I46 A;  1FNV A;  3P75 A;  4P2C B;  5EKI A;  3KF8 B;  3S2H B;  4DV7 Q;  4JI7 Q;  1A15 A;  3PIO 3;  4PG3 A;  3X3N A;  4R4I A;  2OF1 A;  4R1J A;  4OEM B;  2EDG A;  5D3D A;  3LX0 A;  3VR3 A;  1J5E Q;  1K83 B;  2B2W A;  2CQA A;  2PNH A;  2G5D A;  1EY4 A;  1Q1B A;  3QB3 A;  2F0V A;  2NZ1 D;  3I4N H;  4RHR A;  5IYD G;  2NVX H;  4FVM A;  2ZJR A;  1XNQ Q;  3RLN A;  2BE5 C;  1VQ5 A;  1KNA A;  2A73 B;  2EYF A;  1OXV A;  4ZCK A;  2FXQ A;  4A3J B;  2EY5 A;  2DY7 A;  2RA4 A;  3EQL C;  4NXM Q;  2K5N A;  3KLR A;  1IKL A;  4JCV E;  3BS1 A;  3OMC A;  4DAY A;  4Y7N H;  3CC2 A;  3GTJ B;  4ZLT F;  2K33 A;  2R7Z G;  2NVY H;  1SLJ A;  4CKE A;  1HZA A;  1LTG D;  5E4W C;  1TXY A;  4QIW B;  2XWB B;  4HMI A;  2D0O A;  3I91 A;  1K73 C;  4A3G H;  4BXX G;  2IW3 A;  4K8J A;  2VS1 A;  4KN7 C;  5KND A;  2E2H H;  1GUS A;  3T51 B;  1SND A;  2A6H C;  3NTI A;  5FLX c;  4OON A;  1X3G A;  4LF5 L;  4C1N I;  1SE2 A;  1PZK D;  4CJ1 B;  3TP8 A;  3S1Q B;  2RCF A;  4G7H C;  1SYC A;  3I2Z A;  4OWX B;  1J9O A;  4A3F G;  4HED A;  1YNN D;  1VQG A;  4ALP A;  1Q12 A;  1XXG A;  3MXN A;  4GOP C;  4P73 A;  5C4X B;  1TWF H;  4NDX A;  2JA8 G;  4PZ7 A;  1QVC A;  1DJR D;  1IYJ B;  5IP7 H;  3M4Y A;  4JI8 L;  4QY7 A;  4UAI A;  4HR7 B;  1T5E A;  4PZ6 A;  5C0X I;  3PIP A;  2Q8R E;  4A93 G;  4LF9 L;  2PW5 A;  4JI1 Q;  2HHH L;  5A2Q L;  5CV9 A;  5LMN W;  1ILQ A;  1W2B A;  4LF5 Q;  5C3E B;  2R3Z A;  1FGB D;  5C0X G;  3NSW A;  1I4X A;  4MTN A;  3G71 A;  3CRL C;  3FEW X;  4ZQ3 A;  5HGT A;  3T53 B;  4UDU C;  1SXT A;  2I5H A;  2ZJP A;  1MJE A;  1SNC A;  2Z4I A;  1II3 A;  3CPF A;  1KLU D;  2R92 H;  1EY6 A;  3I4N B;  2RCN A;  2YV5 A;  5CBE E;  1B44 D;  3K0X A;  2NVX B;  2MP1 A;  5CGK A;  4C3H G;  2KED A;  2RVL A;  1E24 A;  4DV0 Q;  1HHV A;  1X65 A;  1YJW A;  2UUB Q;  1DYQ A;  3KLS A;  3BZC A;  4DV2 L;  3HOZ H;  1EY8 A;  3KUP A;  1B3A A;  1YHB A;  1A2U A;  1FNW A;  1EY5 A;  3KF8 A;  5IP9 H;  5EBD A;  2XGT A;  1GUN A;  1UWV A;  1A3V A;  1CFM A;  1PZJ D;  1WOC A;  2NVY B;  3AU7 A;  5FLX E;  1VQI A;  4XT1 B;  3HOY H;  3W1B A;  3TQY A;  2X69 A;  4I7Z C;  4RHS A;  1AZP A;  1JIC A;  1JR0 D;  3D3R A;  1SR3 A;  4TSS A;  4A3G B;  3GTM H;  1ENA A;  2R7F A;  3NBH B;  2VW9 A;  4ME3 A;  4DR4 L;  2E2H B;  1IBL Q;  1QG7 A;  3C3L A;  4A3K G;  1NAP A;  3U50 C;  3DWP A;  5I2Y A;  3K5N A;  3GTK B;  1TWA B;  1X56 A;  2AQ3 B;  4AYB B;  5M9O A;  4DV2 Q;  5C6A A;  5I2X A;  1AW7 A;  1JMC A;  3FRP B;  4IFD J;  2K5W A;  1TY0 A;  3RN5 A;  1TWF B;  4KTA A;  4DV1 Q;  1XMQ L;  1RCV D;  4C3I G;  1KDA A;  3W3A A;  4BBS G;  2XSC A;  5IOD A;  4YCW A;  5C3W A;  3SE0 A;  4R4Q A;  1I6V C;  1TKW B;  5K36 H;  3A74 A;  1EWC A;  1SAP A;  1O7Z A;  4YWK A;  4DR4 Q;  4MN3 A;  1MSG A;  1BXT A;  3GTO B;  5D65 A;  2O5J C;  2RDG A;  4IPH A;  1KXL A;  3CC4 A;  1ONL A;  3MVV A;  1JWU D;  5M5W H;  2LXJ A;  4GOP A;  3RLF A;  1GHK A;  1PH5 A;  1D1I A;  3NWT A;  2F0U A;  5ELC A;  1XMQ Q;  4A3D H;  1EQR A;  3OSO A;  1C7Y A;  2HIV A;  2EYH A;  3I72 A;  1WCM B;  1STG A;  2AWN A;  3W1G A;  1KIX A;  1VQF A;  3N6R A;  3NEN A;  5JEA H;  1VQP A;  1PTO H;  5C4Z A;  1E0B A;  3HKZ E;  1S4Z A;  1PV4 A;  1JB3 A;  3K5M A;  5FO7 B;  1VQL A;  2JK8 A;  1GXD C;  1XTC D;  1JOR A;  2NB0 A;  5DAU A;  1TWG H;  3G4S A;  1WTW A;  1K8A C;  1YJ9 A;  1N9W A;  3HOY B;  4DV4 Q;  5IYC G;  1GO3 E;  2O2L D;  2K50 A;  3TP7 A;  4GNX B;  2VZA A;  4H0L C;  5BN4 A;  4BY1 G;  4UP9 A;  2F0Q A;  3M7N A;  1MBY A;  1VMP A;  3J7A F;  3SK6 A;  2E2J H;  2GN5 A;  4KJO A;  5COR A;  4RGT A;  4JW0 A;  3DWA A;  3HKZ G;  2JA6 G;  3HOX G;  4LF8 Q;  4GN4 B;  4E6I A;  1M1K C;  3KJO A;  1Z6H A;  1LLR D;  2J0T D;  2EXZ A;  1VMC A;  2VB2 X;  4JYA Q;  1QZH A;  2B2V A;  4IFD H;  2B2Y A;  1KDC A;  1KL9 A;  4N9P A;  1XYI A;  2PZT A;  2VQF Q;  1EWH A;  1EQQ A;  2KEN A;  2OXP A;  3NBH A;  1PH8 A;  4GLA C;  1B9M A;  1I4G A;  4IUU A;  5DNF A;  4H7B A;  5I6W A;  3E5S A;  4KKT A;  4ZUI A;  1OXX K;  3GTQ B;  2VNU D;  1Y8N B;  1FGU A;  2C5C A;  4IUQ A;  1N34 L;  3NHH A;  4GLV B;  4AIM A;  5EPJ A;  2DJF C;  5ELD A;  2Z6K A;  3CHB D;  1W3S A;  5IYD H;  4A3D B;  1Q86 C;  3JAM i;  3E9H A;  2BA1 A;  1PYS B;  1WTP A;  3EVQ A;  1PTO C;  3FKI G;  1TII D;  4LFA L;  1MGS A;  1JE5 A;  2ZM6 L;  4L5S A;  4DPG A;  2ZJQ A;  4DUZ L;  1SRO A;  1BBW A;  4LJZ C;  2WB1 B;  1WJJ A;  2AUJ D;  2F3I A;  1ZXT A;  4YWM A;  2IX0 A;  3FPU B;  3I4M G;  4O42 A;  1S5E D;  1L1O B;  4GN3 B;  3VYS A;  1WTV A;  1N34 Q;  3PUY A;  1LAC A;  4X62 L;  4BXX H;  4A3E B;  1XX8 A;  1EQT A;  2HCI A;  5IGE A;  2RSN A;  3CMA A;  2NVQ B;  2Y0S E;  2E2J B;  4QL5 A;  2IX1 A;  4GN5 A;  1BCP D;  1EYA A;  3PF4 A;  2SNS A;  5IOC A;  4A3F H;  3UDF A;  4A76 A;  4PMB A;  2J4X A;  1PH2 A;  3U9S A;  1CI3 M;  5CV7 A;  2K28 A;  4CBV A;  2KHI A;  2ATW A;  1S5F D;  1ENF A;  3PUX A;  1SE8 A;  1Q8I A;  2ZXR A;  4LUV A;  1HXY D;  2XVS A;  3NTH A;  2PPB C;  5KNB A;  3QG1 A;  1BO0 A;  1QVG A;  3CCL A;  4XTC S;  1Y8P B;  4GNX A;  3K59 A;  3I56 A;  2E2I H;  1KNE A;  1HA5 A;  2WAQ B;  1A3T A;  3TS0 A;  5C0X H;  3I73 A;  2FIN B;  2Y0S G;  1PRT F;  3E0J A;  1GHJ A;  3PIP 3;  4QGU A;  3M85 A;  2OTL A;  3K8A A;  2R93 G;  5IYB G;  3L7Z C;  4X3K A;  1SYG A;  1XTD A;  1MSH A;  3CCR A;  2EY2 A;  1UE5 A;  3KYH C;  3TEH B;  4JI0 L;  4ODG A;  1N33 L;  3OOC A;  4QQB X;  3STB C;  4C3H H;  4O0A A;  2UXC L;  3OWE B;  3K0Y A;  2KVM A;  4H02 A;  3SK5 A;  1D7Q A;  3OIQ A;  1B70 B;  4FF1 A;  3PO2 G;  2SDF A;  2MO0 A;  3I4O A;  5HUR A;  1EZ6 A;  1RHP A;  3HG9 A;  1KC8 C;  4JI6 L;  4FXD A;  2VXW A;  2BH2 A;  3MXG A;  4JI4 L;  4JBM A;  1F9Q A;  3CKI B;  1R9T H;  2AQ1 B;  5EBC A;  4CDD C;  3TSS A;  5FO8 B;  4BY7 G;  1NR4 A;  2A68 D;  1EY0 A;  2OTJ A;  1WTH A;  3M4Q A;  5H1S E;  1LT6 D;  3CCM A;  1ZYR D;  4DUY Q;  4JI2 Q;  2XRS D;  2PI2 A;  5BR8 Q;  4A3K H;  1NMF A;  4KHP L;  1XPR A;  3M7G A;  3ER0 A;  1IYV A;  5JJZ A;  4UP8 A;  3SEB A;  2XRQ D;  4MZ9 A;  2LMC B;  3EBE A;  2ICE C;  3GDE A;  4JI4 Q;  4CDC C;  1VQ8 A;  2FFK B;  2F0P A;  3HOW G;  4BBS H;  1J6Q A;  2D0P A;  3V05 A;  1L1O A;  3CQZ H;  2I07 B;  3S1N B;  2ZXP A;  4KHZ A;  2RHQ B;  4DKA C;  1B53 A;  1EEI D;  2E75 C;  4DN4 M;  5LMU L;  3RZO H;  3BYT B;  1UE1 A;  2WAC A;  2E2I B;  1HZC A;  5EPK A;  3EA6 A;  2AKW B;  3NBI A;  3SHL A;  1NTG A;  2BOS A;  2PQA B;  4U68 A;  1C0A A;  3NWS A;  4NW2 A;  1EIH A;  5L37 A;  3AFP A;  4YWL A;  4RGO S;  4X64 Q;  1VS0 A;  4CKB A;  2JA5 G;  1STN A;  1QJO A;  2UXD L;  3CCV A;  3S17 H;  1K28 A;  2O4X A;  3OW2 A;  4C3H B;  1Y1V B;  2WFW A;  1F2M A;  4DV3 L;  1U5K A;  2VUM B;  1VQM A;  1U0L A;  2K5H A;  1U9R A;  4X66 L;  3H09 A;  3MXP A;  4YY3 Q;  5E3F A;  2QEJ C;  2RQX A;  1L0Y B;  4LFC L;  5IYC H;  4DNI A;  2KJX A;  4OGQ C;  4C3J B;  4BY1 H;  1KLG D;  4L5R C;  4DR5 Q;  3DM3 A;  1S5D D;  1X6O A;  3BVG A;  1CHQ D;  1YNJ D;  2AQ2 B;  1EEF D;  2IL8 A;  3ITP A;  2V1C C;  1DD2 A;  1NMG A;  2EZV A;  4A3K B;  1NY4 A;  2K6A A;  3F2D A;  4A3I G;  1FJG L;  4KK7 A;  1PA6 A;  1MI2 A;  3J7Y W;  4X3S A;  2F0S A;  3HOX H;  1BVS A;  2B8F A;  4F7X A;  2NYZ D;  3VYR A;  4X66 Q;  2YU9 H;  3UDG A;  4GKK L;  1BDO A;  3QOL A;  4Q0F A;  2UUA L;  4LFC Q;  3J81 E;  5M3F B;  1Q8K A;  2Z4H A;  1UEA B;  4DU9 A;  1HUN A;  1NR2 A;  2KHJ A;  5KNC A;  4IPG A;  2EQS A;  3TBI B;  1SMY C;  3RZO B;  2N88 A;  2IX3 A;  3KJP A;  3RMH A;  3F2B A;  3C1E A;  5FKA C;  2CCZ A;  4HJ8 A;  4P71 A;  3A55 A;  3M4O H;  3CAM A;  2QKI C;  2A68 C;  1B1Z A;  1STY A;  1Q46 A;  3KK7 A;  4DV7 L;  3NK9 A;  3CP0 A;  1H9J A;  4DV6 Q;  5LMN L;  1EQV A;  1G2S A;  3ONA B;  1BCP F;  2JXM B;  3D4W A;  1QE6 A;  1DOM A;  3QJY A;  2BH8 A;  3FKI H;  3I90 A;  1ESR A;  1RIP A;  4G7O C;  3ZYY X;  3NTK A;  5LL6 X;  2NWG A;  1K0R A;  2PQA A;  4NXM L;  5C4J B;  2IHF A;  1LT3 D;  1Y1W G;  1Y69 U;  3S15 B;  3I4M H;  1I4Q A;  4LF6 Q;  4X3U A;  4DR1 Q;  1YIT A;  4P74 A;  4DR6 Q;  5LMN Q;  1O7L A;  4U67 3;  5M3M G;  3MFG A;  4LAA A;  2K4K A;  1VDZ A;  4YCV A;  1QUQ B;  5IGG A;  4Y52 H;  2XWJ B;  4RKL A;  4DK3 C;  1JC7 A;  5KYL A;  1YNX A;  3HKZ B;  1TR5 A;  5C5M A;  2BA0 A;  2F0T A;  1D1K A;  2MFI A;  3A8I E;  1B2T A;  1JWM D;  5KRU A;  2YU9 B;  4OIK A;  3Q24 A;  2ASB A;  1D6E C;  1TWC B;  4ME5 A;  4RGN A;  3S1M H;  4G57 A;  1X54 A;  1O7I A;  3DM1 A;  3HGB A;  1X32 A;  5GAE C;  3TRZ A;  2MPM A;  2QW7 A;  3J7Z C; 
#chains in the Genus database with same CATH homology
 2EY1 A;  1RKN A;  4S3S A;  4RWS C;  2F0E A;  1SJH D;  2H4O A;  3BDO A;  4JBW A;  1LV9 A;  4FYD A;  3VR2 A;  2KCC A;  2SOB A;  4J6H A;  2LKV A;  3SK8 A;  3H0G B;  2E74 C;  3GQB A;  3URY A;  1IYU A;  1E2Z A;  1BF4 A;  4FF4 A;  3A7A B;  2AWO A;  5T1I A;  3SXH A;  1SNM A;  4DGZ A;  2RKS A;  4K6L A;  1M8A A;  3TZU A;  4ILW A;  1EFI D;  4K2K A;  5JPM C;  1AEX A;  4HMJ A;  5KGU A;  3L3O C;  5FO9 B;  2JE6 I;  1HA6 A;  4ID6 A;  2WKC A;  4B9W A;  3I70 A;  2L12 A;  2VB3 X;  3D4D A;  3VA7 A;  2YYZ A;  1QNK A;  3Q23 A;  1Q1E A;  4KMU C;  4KD4 A;  1HTL D;  2F0L A;  1PMR A;  4K14 A;  4BS9 A;  5TSS A;  2ZXO A;  1G29 1;  5KYI A;  1A3U A;  5JOB A;  1DZ1 A;  4K5W A;  3TZD A;  4B9X A;  4Y7N B;  4RA8 A;  1SSO A;  1DCZ A;  1IW7 D;  1F2Y A;  1H9K A;  2G9D A;  4K5V A;  5JPN C;  1TU2 B;  4C1N K;  2OEO A;  1PRT D;  5KEE A;  3T16 A;  3D6C A;  1U4R A;  1RTO A;  3MHB A;  2F3V A;  2B2T C;  2R93 B;  1JOK A;  1SNO A;  1UAP A;  1LTB D;  1STB A;  4C2M B;  2FJ2 A;  2LFN A;  3E6Z X;  3PO2 B;  1A2T A;  3JAM L;  1M4V A;  1IHZ A;  2QF7 A;  2V4D A;  2HCC A;  4H13 C;  3W2D A;  3H6M A;  5CBA E;  1SE4 A;  5IT9 L;  4BWG B;  2F0J A;  1GOZ A;  3EJI A;  3MXU A;  3DHQ A;  4KY5 A;  1EOT A;  3R8B A;  2FMC A;  2F1M A;  2R92 B;  4NKL A;  4RCO A;  1KDB A;  5C5L A;  2NTT A;  2F0G A;  3NXW A;  1YNN C;  5A2Q E;  3HOZ B;  3SK4 A;  1JQY D;  3CU7 A;  5LHY 1;  3GV6 A;  1BOS A;  2M2L A;  1H9M A;  2WV6 D;  3KBX A;  3MZ5 A;  2KEE A;  3GTM B;  5CMD A;  2D2C C;  1ESF A;  3NQT A;  1EU3 A;  4A3M B;  2NN6 I;  2K04 A;  4QB4 A;  2F3W A;  4XYO A;  1I50 B;  2NN6 G;  2D9U A;  1CK1 A;  1I3Q B;  1TS4 A;  2Z8L A;  1WTQ A;  2BDO A;  1JCK B;  1F9S A;  1V1P A;  4G7Z C;  3J80 L;  1O80 A;  5M5W B;  1GJX A;  1PRT C;  4HTH A;  4IZ8 A;  4R8I A;  2M9V A;  1QIL A;  3MTS A;  5ISR A;  1SNQ A;  3HEJ A;  5CC4 A;  1PTO B;  1CA5 A;  2JSO A;  2R6G A;  4XQQ A;  4V0B A;  3QO2 A;  2AUK A;  5J39 A;  1IKM A;  1PYW D;  1TWG B;  2NBF A;  4QMG A;  3IFT A;  1HCZ A;  4IAL A;  1FD7 D;  3DWQ A;  2EJG C;  2JA7 B;  2X6L A;  3SR1 A;  3KBG A;  2F0D A;  3WDN A;  3H3V C;  1WVL A;  1B50 A;  1PFM A;  3GV3 A;  2L0C A;  1PZI D;  4G4K A;  2B2U C;  4ULL A;  4NMZ A;  1D5X C;  4V19 0;  1I4P A;  4ZKC B;  5J22 A;  1V1O A;  5C3X A;  3S1R B;  3OIP A;  4CKC A;  1LAB A;  3NQI A;  1LTA D;  1SYE A;  3A8K E;  3MC0 B;  4TKO B;  3PUW A;  1DOL A;  1CZW A;  1J8I A;  4IUR A;  2KEC A;  4RAU C;  4DK0 A;  1LTS D;  1I6H B;  1B4O A;  1NUC A;  4DF7 A;  4FF2 A;  3ERQ A;  2EYL A;  1AZQ A;  3FMC A;  3PV0 A;  3OPO A;  2MUY A;  4QCL A;  4IQZ A;  4J8Q A;  2EYP A;  3UI2 A;  2XIW A;  1STE A;  2PCF B;  5IGB A;  3RZD B;  2R7Z B;  4C56 C;  3TN2 A;  1EU4 A;  2K05 A;  5DEH A;  4Z9C B;  2F0M A;  3A54 A;  1BNZ A;  1GUO A;  1HUM A;  2PQE A;  3RUZ A;  1CQF A;  1LO5 D;  5IIF A;  4A3F B;  5E1F A;  4HN7 A;  5G3L F;  2JA8 B;  3OWF A;  2HQE A;  2L5T A;  3D6W A;  4DXG A;  1EIG A;  3CRK C;  3C1F A;  1L0X B;  4A93 B;  3J7A V;  5EJW A;  4WFN 3;  3K5O A;  1TVX A;  5CV4 A;  1QOH A;  3IKJ A;  5EGT A;  4O1N A;  2TMP A;  3LWU A;  1GUG A;  3T13 A;  1F9R A;  3H91 A;  2JP1 A;  5D14 A;  1BCP C;  3IFD A;  3HS0 C;  5I6Y A;  1PXU A;  1MD2 D;  1F2L A;  2CW0 D;  4DAP A;  4IN3 A;  1SYF A;  1LTI D;  3A8J E;  2BE5 D;  2K7V A;  2BCO A;  3ND8 A;  4MIU A;  4HSV A;  1HQR D;  3HZX A;  1R9T B;  1LTR D;  4JK1 C;  1UNS A;  5F2D A;  2B2W C;  2EYJ A;  2L9H A;  2EVB A;  3HP3 A;  4IUP A;  4CGY B;  5CV8 A;  2RSO A;  5EKL A;  4F8M A;  1AN8 A;  1PFB A;  2PZU A;  3DEP A;  2A6H D;  2NN6 H;  4KHV A;  4LMQ D;  1EL0 A;  4C3I B;  4BBS B;  4QUC A;  3OHX C;  3CQZ B;  3BYY B;  1TT2 A;  3WOF A;  2PMZ B;  3LWE A;  3Q6S A;  4FP5 D;  2A5H A;  5DM6 3;  3C2P A;  4L6T B;  1ZYR C;  3TDQ A;  2D5D A;  2FHT A;  4HCE A;  1VF7 A;  1EY7 A;  4XT3 B;  3S17 B;  1A6X A;  5C4H A;  2TSS A;  2XNA C;  1K8O A;  3RD4 A;  4B08 A;  1CA6 A;  2EOT A;  2NTS A;  2PW7 A;  2IPK D;  1JWS D;  4DK1 A;  2B8G A;  4YIJ A;  3Q0A A;  5E4X A;  4XQJ A;  2L11 A;  3VR5 A;  4FXK C;  4BY1 B;  1TQO A;  4WJW A;  3K7A B;  1HRJ A;  4R8N A;  2F4I A;  1DOK A;  4F88 A;  2KHS A;  1ILP A;  2JA6 B;  5NUC A;  3HOX B;  1FNU A;  2K32 A;  4OO1 I;  2EJM A;  2LS0 1;  5FLX L;  3MWY W;  3BZD B;  4OO1 G;  3VYT A;  2CW0 C;  1O78 A;  3V2T A;  1STH A;  2DNE A;  2PO4 A;  3M4O B;  4PV1 C;  4FNF A;  4EQN A;  1R4Q B;  1YNJ C;  1KAB A;  4BA1 I;  2FMM A;  5ELB A;  2H1E A;  2ICI A;  3KLS X;  1PFN A;  2PYK A;  1E2V A;  2NVT B;  2EPB A;  2C9O A;  3QOJ A;  4GZY C;  3FKI B;  5CYU A;  1H9R A;  1LT4 D;  3X3M A;  3MEH A;  1OO9 B;  3FPP A;  4KD3 A;  3D4R A;  5IGD A;  1KTK A;  4EQP A;  3F2U A;  1I4R A;  3I4M B;  3G6J B;  5LL6 S;  1Z7T A;  2G9H D;  2SNM A;  5IGC A;  3S2D B;  3TP6 A;  1TS2 A;  3T56 B;  1HPC A;  1SBB B;  1OXU A;  4BA2 I;  1WTX A;  1CTM A;  3A7L A;  3U9O A;  1FR3 A;  3BG3 A;  5COY A;  2ID0 A;  1C4Q A;  5IGF A;  3S1M B;  2EJF C;  5JEA J;  4PQX A;  5KIX A;  2BDN A;  1DON A;  1E2W A;  2KUM A;  1SYD A;  2SEB D;  4H44 C;  1ZEQ X;  3OW7 A;  5CR3 A;  4K8I A;  2Y0S B;  2JYO A;  1Y8O B;  2PZW A;  4RKB A;  5A35 A;  3K57 A;  1V1P B;  4KY7 A;  4N9T A;  1AFP A;  3QWN A;  1RDP D;  1SEB D;  3I4L A;  3EFX D;  5AFW A;  3G7L A;  2B2V C;  4HAE A;  4C3J G;  4DAV A;  2B2Y C;  2CVR A;  3AB9 A;  5DM7 3;  4RCN A;  3GD7 A;  2RDF A;  1C48 A;  3DMU A;  1O7Y A;  5JVG 3;  1PTO D;  4LK1 C;  4ZK9 B;  2RDH A;  1HFG A;  4BY7 B;  1AP0 A;  1S5C D;  5T1G A;  1H9S B;  4DFA A;  4DXF A;  2ZT9 C;  1PDQ A;  3GO5 A;  4MHE A;  1EYD A;  1F9P A;  1IL8 A;  1G6Z A;  2F0H A;  1WD1 A;  1EY9 A;  3GTP B;  3S9W A;  5G3L D;  1ET6 A;  3M3Y B;  2EYM A;  3S16 B;  5CV5 A;  3HOW B;  2Q8I B;  3NPP A;  2JEA I;  1PLF A;  2A6E D;  1LT5 D;  1TS3 A;  2KA7 A;  1JOO A;  4KV6 A;  2E2D C;  1UUP A;  5ELF A;  2F03 A;  3R2I A;  4QUF A;  1V43 A;  4XXE A;  1JE4 A;  4DA2 A;  2JA5 B;  1HFN A;  2QIL A;  5M5X B;  3GTG B;  2F0F A;  1I4H A;  3V96 A;  3K58 A;  2D62 A;  4FF3 A;  1T5X D;  1EZ8 A;  5J1Z A;  2MJ8 A;  1Q90 A;  3D31 A;  4XDX A;  2B2T A;  4XIG S;  1IW7 C;  2F0N A;  1DM0 B;  2OT2 A;  2CHB D;  2X6G A;  2WIN B;  1PRT B;  2WII B;  5EKK A;  2E76 C;  2MHV A;  4CHT B;  5C0X J;  4RFB A;  1GUT A;  4A3I B;  1X3P A;  3GTL B;  1JOQ A;  3SVM A;  1VCI A;  3DXJ C;  5I9P A;  3JAM E;  2HDL A;  1SE3 A;  4OO1 H;  3IAY A;  1Z47 A;  2QCP X;  1RJT A;  5IT9 E;  1H9S A;  1WD0 A;  4HSP A;  1G91 A;  5D3I B;  5BN3 A;  4J1M A;  4XYQ A;  3P7J A;  1V8Q A;  3N52 A;  3SDZ A;  3DEO A;  1ET9 A;  1NCV A;  2EE1 A;  1K8M A;  2N55 A;  1CHP D;  1HTP A;  4KN4 C;  4IUN A;  2LY7 A;  4KKS A;  5FOB B;  3PMF A;  2QDB A;  4ZYS A;  1U4M A;  2K01 A;  3Q22 A;  5K5P A;  1BR9 A;  1G8Z D;  1NSN S;  4FXG C;  1SFO B;  1OXS C;  5CV6 A;  5JAV A;  2KOL A;  1G2T A;  3R3O A;  2GA4 B;  1Y1W B;  2EYO A;  4OIJ A;  1ENC A;  2A6E C;  2K5Q A;  4K5X A;  1CT1 D;  1F2Z A;  1S5B D;  5M3M B;  1U4P A;  5M5Y B;  1W6J A;  2DN8 A;  4L8J A;  2DNC A;  2K1B A;  3PUV A;  4ABN A;  3BDC A;  4IUV A;  2HUG A;  3VA5 A;  4DNT B;  4HCS A;  4ZAI A;  1FYC A;  4M1U B;  5I4D A;  3K5L A;  1QWY A;  2MGS A;  4KJN A;  3NP8 A;  1SYB A;  1QB5 D;  1C8C A;  3J80 E;  1U4L A;  4I65 A;  2F0W A;  1D5Z C;  3R93 A;  1PTO F;  3VR6 A;  2NUC A;  4KY6 A;  2M00 A;  5C44 B;  3QIA A;  4ZKB B;  3VR4 A;  1X3Q A;  1QCB D;  1SDF A;  5BN5 A;  1EYC A;  5EQ0 A;  1SMY D;  1BQQ T;  3P1H A;  1VF5 C;  1STA A;  2B63 B;  3K6O A;  2A74 C;  3J81 L;  4XQN A;  3BVM A;  1ML0 D;  5FK9 C;  1Q3L A;  1F77 A;  3L9A X;  3IL8 A;  3HRZ C;  1B9N A;  5EPL A;  1RD9 D;  3HOU B;  2A69 D;  2B39 A;  4RH6 A;  3OMG A;  4TRD A;  3D8G A;  1CM9 A;  3HOV B;  2IJ0 A;  2B2U A;  1KAA A;  2KQ3 A;  1OXT A;  4EVO A;  3VYU A;  2DY8 A;  4OHJ A;  3ND9 A;  3T4A C;  1BCP B;  1XWE A;  5ELE A;  1D5M C;  2JEB I;  1ZKO A;  2IT1 A;  2IWH A;  3NE5 B;  1CQV A;  2HDM A;  4FO2 A;  4EGV A;  4PNY A;  2L4N A;  2EY6 A;  2RBM A;  2F0I A;  4ZUJ A;  4CJ0 B;  1HQM C;  2ENB A;  1BBX C;  4NP5 A;  1LTT D;  2R61 A;  3LNN A;  1WTO A;  2Q8T A;  3ERO A;  3FDT A;  4ZRZ A;  1CZG A;  4F87 A;  3FVQ A;  3H94 A;  2J7Z A;  1WTR A;  3DUZ A;  4K2L A;  5I9O A;  4QF4 A;  3S14 B;  2K03 A;  3GP7 A;  3BVZ A;  1ICW A;  5K36 G;  3NUC A;  1SJE D;  3PUZ A;  4M8A A;  4EQO A;  2F0O A;  3C46 A;  1BUV T;  1DXM A;  2O5I C;  4X3T A;  4Q5V A;  4K6D A;  1GUW A;  3MAQ A;  4BBR B;  3A56 A;  1R4P B;  2F0K A;  4TQU S;  2KCN A;  3P20 A;  4CJ2 C;  2XN9 C;  1QNU A;  3AMU A;  4R9W A;  3R2T A;  5JEA G;  3MFY A;  4KKU A;  3WOE A;  3I8Z A;  2WP8 J;  1TS5 A;  2L1B A;  4PMW A;  2Z1C A;  4KI0 A;  2WKD A;  1D2B A;  1TWH B;  3TP5 A;  1SNP A;  1TY2 A;  1RTN A;  2L55 A;  4A3B B;  1W6K A;  4IUT A;  4L63 B;  5JVH 3;  2PNR C;  3O13 A;  3PO3 B;  1ROD A;  4WOR A;  3BDL A;  1RF2 D;  4OL7 A;  4IFD I;  2A69 C;  3TME A;  4PMC A;  2K5D A;  4RGM A;  3MA2 B;  4IFD G;  4WRD A;  4DNR B;  3I3C A;  2I46 A;  1FNV A;  3P75 A;  4P2C B;  5EKI A;  3S2H B;  1A15 A;  3PIO 3;  3X3N A;  2OF1 A;  2EDG A;  5D3D A;  3LX0 A;  3VR3 A;  1K83 B;  2B2W A;  2CQA A;  1EY4 A;  1Q1B A;  3QB3 A;  2F0V A;  2NZ1 D;  4RHR A;  4FVM A;  2BE5 C;  1KNA A;  2A73 B;  2EYF A;  1OXV A;  4A3J B;  2EY5 A;  2DY7 A;  2RA4 A;  3EQL C;  3KLR A;  1IKL A;  3BS1 A;  3OMC A;  4DAY A;  3GTJ B;  4ZLT F;  2K33 A;  4CKE A;  1LTG D;  5E4W C;  4QIW B;  2XWB B;  4HMI A;  3I91 A;  2IW3 A;  4K8J A;  4KN7 C;  5KND A;  1GUS A;  3T51 B;  1SND A;  2A6H C;  3NTI A;  4C1N I;  1SE2 A;  1PZK D;  4CJ1 B;  3TP8 A;  3S1Q B;  4G7H C;  1SYC A;  1J9O A;  4HED A;  1YNN D;  1Q12 A;  1XXG A;  3MXN A;  5C4X B;  4NDX A;  1DJR D;  3M4Y A;  4UAI A;  4HR7 B;  1T5E A;  5C0X I;  2Q8R E;  2PW5 A;  5A2Q L;  5CV9 A;  1ILQ A;  5C3E B;  2R3Z A;  1FGB D;  5C0X G;  3NSW A;  1I4X A;  3CRL C;  3FEW X;  4ZQ3 A;  5HGT A;  3T53 B;  4UDU C;  1SXT A;  1SNC A;  2Z4I A;  1II3 A;  1KLU D;  1EY6 A;  3I4N B;  5CBE E;  1B44 D;  2NVX B;  2MP1 A;  5CGK A;  4C3H G;  2KED A;  2RVL A;  1HHV A;  1DYQ A;  3KLS A;  1EY8 A;  1B3A A;  3KUP A;  1A2U A;  1FNW A;  1EY5 A;  3KF8 A;  5EBD A;  1GUN A;  1A3V A;  1CFM A;  1PZJ D;  2NVY B;  3AU7 A;  5FLX E;  4XT1 B;  2X69 A;  4I7Z C;  4RHS A;  1AZP A;  1JIC A;  1JR0 D;  3D3R A;  4TSS A;  4A3G B;  1ENA A;  2E2H B;  1QG7 A;  3C3L A;  1NAP A;  3DWP A;  5I2Y A;  3K5N A;  3GTK B;  1TWA B;  2AQ3 B;  5M9O A;  4AYB B;  5C6A A;  5I2X A;  1AW7 A;  3FRP B;  4IFD J;  2K5W A;  1TY0 A;  1TWF B;  4KTA A;  1RCV D;  4C3I G;  1KDA A;  3W3A A;  2XSC A;  5IOD A;  5C3W A;  3SE0 A;  1I6V C;  1TKW B;  5K36 H;  1EWC A;  1SAP A;  1O7Z A;  4MN3 A;  1MSG A;  1BXT A;  3GTO B;  5D65 A;  2O5J C;  2RDG A;  1ONL A;  3MVV A;  1JWU D;  3RLF A;  1GHK A;  1D1I A;  3NWT A;  2F0U A;  5ELC A;  3OSO A;  2EYH A;  3I72 A;  1WCM B;  1STG A;  2AWN A;  3N6R A;  5JEA H;  1PTO H;  5C4Z A;  1E0B A;  1S4Z A;  1JB3 A;  3K5M A;  5FO7 B;  1GXD C;  1XTC D;  1JOR A;  2NB0 A;  5DAU A;  1WTW A;  3HOY B;  2O2L D;  3TP7 A;  4H0L C;  5BN4 A;  2F0Q A;  3M7N A;  1MBY A;  1VMP A;  3J7A F;  3SK6 A;  4KJO A;  5COR A;  4RGT A;  3DWA A;  4E6I A;  1Z6H A;  1LLR D;  2J0T D;  2EXZ A;  1VMC A;  2VB2 X;  2B2V A;  4IFD H;  2B2Y A;  1KDC A;  4N9P A;  1XYI A;  2PZT A;  1EWH A;  2OXP A;  3NBH A;  1B9M A;  1I4G A;  4IUU A;  5DNF A;  4H7B A;  5I6W A;  3E5S A;  4KKT A;  4ZUI A;  1OXX K;  3GTQ B;  2VNU D;  1Y8N B;  2C5C A;  4IUQ A;  3NHH A;  5EPJ A;  5ELD A;  3CHB D;  4A3D B;  2BA1 A;  1WTP A;  3EVQ A;  1PTO C;  1TII D;  1MGS A;  4LJZ C;  2WB1 B;  2AUJ D;  1ZXT A;  2IX0 A;  3FPU B;  4O42 A;  1S5E D;  3VYS A;  1WTV A;  3PUY A;  1LAC A;  4A3E B;  1XX8 A;  1EQT A;  2HCI A;  5IGE A;  2RSN A;  2NVQ B;  2E2J B;  2IX1 A;  1BCP D;  1EYA A;  2SNS A;  5IOC A;  4PMB A;  2J4X A;  3U9S A;  1CI3 M;  5CV7 A;  2K28 A;  4CBV A;  1S5F D;  1ENF A;  3PUX A;  1Q8I A;  2ZXR A;  1HXY D;  2XVS A;  3NTH A;  2PPB C;  5KNB A;  3QG1 A;  1BO0 A;  4XTC S;  1Y8P B;  3K59 A;  1KNE A;  1HA5 A;  2WAQ B;  1A3T A;  5C0X H;  3I73 A;  2FIN B;  1PRT F;  3E0J A;  1GHJ A;  3PIP 3;  3M85 A;  3L7Z C;  4X3K A;  1SYG A;  1MSH A;  2EY2 A;  4ODG A;  3OOC A;  3OWE B;  3K0Y A;  2KVM A;  3SK5 A;  3OIQ A;  4FF1 A;  2SDF A;  5HUR A;  1EZ6 A;  1RHP A;  3HG9 A;  4FXD A;  2VXW A;  3MXG A;  1F9Q A;  3CKI B;  2AQ1 B;  5EBC A;  3TSS A;  5FO8 B;  1NR4 A;  2A68 D;  1EY0 A;  1LT6 D;  1ZYR D;  2XRS D;  3M7G A;  1IYV A;  5JJZ A;  3SEB A;  2XRQ D;  2LMC B;  2ICE C;  2FFK B;  2F0P A;  3V05 A;  2I07 B;  3S1N B;  2ZXP A;  4KHZ A;  1B53 A;  1EEI D;  2E75 C;  4DN4 M;  3BYT B;  2WAC A;  2E2I B;  5EPK A;  3EA6 A;  3NBI A;  3SHL A;  2BOS A;  4U68 A;  3NWS A;  4NW2 A;  1EIH A;  4RGO S;  4CKB A;  1STN A;  1QJO A;  2O4X A;  4C3H B;  1Y1V B;  1F2M A;  2VUM B;  1U9R A;  3H09 A;  3MXP A;  5E3F A;  2QEJ C;  2RQX A;  1L0Y B;  2KJX A;  4OGQ C;  4C3J B;  1KLG D;  1S5D D;  3BVG A;  1CHQ D;  1YNJ D;  2AQ2 B;  1EEF D;  2IL8 A;  3ITP A;  1DD2 A;  2EZV A;  4A3K B;  2K6A A;  4KK7 A;  1MI2 A;  3J7Y W;  4X3S A;  2F0S A;  2B8F A;  4F7X A;  2NYZ D;  3VYR A;  1BDO A;  3QOL A;  4Q0F A;  3J81 E;  5M3F B;  2Z4H A;  1UEA B;  4DU9 A;  1HUN A;  1NR2 A;  5KNC A;  3TBI B;  1SMY C;  3RZO B;  2N88 A;  2IX3 A;  3RMH A;  3C1E A;  5FKA C;  3A55 A;  2QKI C;  2A68 C;  1B1Z A;  1STY A;  3KK7 A;  3NK9 A;  1H9J A;  1EQV A;  1G2S A;  3ONA B;  1BCP F;  2JXM B;  3D4W A;  1QE6 A;  1DOM A;  3QJY A;  3I90 A;  1ESR A;  4G7O C;  3ZYY X;  3NTK A;  5LL6 X;  2NWG A;  5C4J B;  3S15 B;  1LT3 D;  1Y69 U;  1I4Q A;  4X3U A;  1O7L A;  4U67 3;  3MFG A;  4LAA A;  1VDZ A;  5IGG A;  2XWJ B;  4RKL A;  1JC7 A;  5KYL A;  3HKZ B;  1TR5 A;  5C5M A;  2BA0 A;  2F0T A;  1D1K A;  3A8I E;  1B2T A;  1JWM D;  5KRU A;  2YU9 B;  4OIK A;  3Q24 A;  1D6E C;  1TWC B;  4ME5 A;  4RGN A;  3DM1 A;  4G57 A;  3HGB A;  1X32 A;  2MPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...