1MD2D

Cholera toxin b-pentamer with decavalent ligand bmsc-0013
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
102
Chain Sequence
TPQNITDLAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution and crystallographic studies of branched multivalent ligands that inhibit the receptor-binding of cholera toxin.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords CHOLERA TOXIN B SUBUNIT
total genus 24
structure length 102
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1md2D00
2AQ1B 2J4XA 4O1NA 1T5XD 1D6EC 3DWPA 1S5BD 3R2IA 3EFXD 1S5CD 1JCKB 2CHBD 1PRTC 1V1PB 3MFGA 1I4HA 1PRTB 2O2LD 1PYWD 4RHSA 1LTGD 1AN8A 4DXGA 1M4VA 2QEJC 1LTAD 1XXGA 3MC0B 1DJRD 1LT4D 2XN9C 1TY2A 1L0YB 1V1OA 1ESFA 1UNSA 1F77A 4RGOS 3CHBD 4RFBA 5ELEA 1S5ED 4Z9CB 3W2DA 2Z8LA 1SJHD 1JWSD 1PTOF 1D5XC 5ELCA 1D5MC 1JWMD 1RCVD 1I4GA 4RGMA 1CQVA 3R2TA 3O13A 2ICIA 1EU3A 1UUPA 1FGBD 1TY0A 1PZJD 1LT5D 1LTSD 5D3DA 1JWUD 4TSSA 1KLUD 3R8BA 1RF2D 4OHJA 1PTOB 5TSSA 2AQ2B 1EWCA 1RD9D 2RDGA 3BZDB 5ELFA 1TS3A 1SBBB 1FNUA 1I4RA 1BCPC 4BWGB 1LT6D 1PRTD 2QILA 1FNWA 1HTLD 1LT3D 1XTCD 2WV6D 1PTOC 1SJED 1FD7D 1GOZA 1QILA 3URYA 1DYQA 1HA5A 3GP7A 1LTRD 1G8ZD 1FNVA 1HXYD 1SEBD 5ELBA 1CK1A 1SXTA 3BYTB 2IPKD 2R61A 1SE3A 4DXFA 1TS5A 3OWEB 1EFID 1LLRD 2XRSD 1I4XA 3KLSX 1L0XB 5ELDA 1LTTD 1LTBD 1AW7A 1BCPD 2RDHA 4UDUC 1SE4A 2AQ3B 1ENFA 1PTOD 1LO5D 1EEID 1PZID 1LTID 4C56C 1I4QA 3BVMA 5FKAC 5I4DA 1BCPF 1I4PA 2SEBD 1ET9A 5D3IB 2XRQD 1PRTF 2TSSA 4K6LA 2NTTA 4RH6A 4RGNA 1PZKD 1TS4A 2IJ0A 1CHQD 1CT1D 1PTOH 4RGTA 1HQRD 1S5DD 4L6TB 1JQYD 1KTKA 3TSSA 1TS2A 1B1ZA 3DWAA 1KLGD 1RDPD 1EEFD 2NTSA 1V1PA 2XNAC 3BVGA 3DWQA 1ET6A 1BCPB 1MD2D 1EU4A 1STEA 3SEBA 4ZYSA 1S5FD 3BVZA 3V05A 1CHPD 1SE2A 4L63B 1D5ZC 1JR0D 3BYYB 4RCOA 1BXTA 2G9HD 5FK9C 4RHRA 3EA6A 1B44D
chains in the Genus database with same CATH superfamily
1VQKA 1BNZA 1EZ6A 3PO3G 1D6EC 4LF7Q 3DWPA 4KHZA 2B29A 3A7AB 3GQBA 4ZK9B 3H3VI 3J7A5 3M3YB 5CV9A 2CVRA 4HJ9A 1EOVA 3DEPA 4EQNA 2MUYA 3NTKA 1L1OC 1EQQA 2CCZA 5M5XB 4KD4A 3NTHA 4JI7L 3NBIA 4RGOS 2Z4IA 4KN7C 3CC7A 1IYVA 1K83B 3W3AA 4K2KA 3PIP3 3Q24A 1UAPA 4KHPQ 2SDFA 2A6HC 1TWHB 4HSVA 1PHJA 2LXJA 3KK7A 5EJWA 3ER0A 4HJ7A 4K2LA 3QOLA 4GKJL 2A19A 1FGUA 1JWUD 5HGQA 3VR4A 2ZJQA 2E2JB 3RD4A 3AFQA 2XGTA 2EY2A 2K28A 3OPOA 5M9OA 4H7BA 2ZJRA 4RKBA 2EYFA 1HTLD 1BKBA 5E4XA 4JVZA 5IGCA 1A3VA 4RKLA 1LTRD 2PW7A 1SMXA 1HZBA 4GNXB 2YV5A 3NSWA 5M3MH 1VQJA 2UXBL 4UP7A 4HN7A 1C7YA 4IOCA 3M4QA 4LUZA 3S2HH 3KLSX 5EKLA 1UWVA 4FXGC 1IW7D 2RDHA 3FKIG 1PH7A 3KF8B 3UE1A 4DNTB 2IY5B 3NE5B 1XMOL 1ONLA 2NZOA 3W1BA 2MP1A 2O5IC 2F0PA 1E1TA 4GNXA 3I4LA 1I3QH 1SAPA 5DNFA 3GTLB 4DAMA 4AQYL 3Q0AA 4RGTA 5K5PA 4BBSH 1SN8A 2A5HA 3A74A 4LJZC 2LKVA 1XNRL 5M5YB 3WDNA 1B1ZA 3D6CA 4IPGA 3CPFA 5M5WB 5C0XI 1F9PA 2IX3A 1EY7A 1SE2A 1VQ8A 3I4MB 2B2VA 1ENCA 1CA6A 1BXTA 2JA6H 5LL6S 3HOZB 4OO1H 3F8TA 4HCEA 5CV6A 4NW2A 1C4QA 1F9QA 1UEAB 4OXPA 4YWLA 2L12A 1PRTB 5JEAH 2SNSA 2JP1A 3BS1A 2EY1A 2I5MX 2ZTEA 1V1OA 2K75A 2EYMA 1NY4A 4KJNA 1MI2A 2OEOA 5C4XG 4WJ4A 2IHEA 3O13A 3NELA 2ICIA 1TWGB 2MHVA 5C44H 4B3SQ 3H15A 1L0WA 1QCBD 3K5LA 1EWCA 3BDLA 1ASYA 4LF6Q 3PUYA 1NMFA 2MJ8A 1VMPA 1HUNA 3FMCA 1GHJA 1W3SA 3K58A 2L11A 4HTHA 4IUQA 1K28A 1VQCA 1YNNC 1OTCA 1CM9A 1STAA 1D7QA 3SK8A 1STGA 3PIO3 3RN5A 1CK1A 1EY4A 2ZXPA 1K3BC 4N9PA 5C5MA 4N8X1 2VW9A 1H9SB 2H1EA 1G2SA 5I2YA 2HCCA 2LSSA 4YCUA 1I4QA 2B63G 1B8AA 2F0LA 1SYCA 2WACA 1Z47A 1PYBA 3PSIA 1CA5A 4X64Q 4DV4L 4YCWA 1PZKD 5FJ8G 3I70A 3MEFA 4HMIA 4KKUA 4NXML 4L6TB 2F3IA 4BXXH 2K03A 1E1OA 3M9BA 1JJCB 1NR4A 3GTMB 3E9IA 3SHLA 4DN4M 1MHWC 4KTAA 2VY3A 3SEBA 4L5SA 4LFBQ 2K5DA 1E2ZA 2VB2X 3S1NB 3G6JB 1S5FD 1AH9A 4ZQ3A 1FYCA 2VXWA 3KYHC 2NN6I 4P74A 1VQMA 2KOLA 3T13A 1HPCA 1J5EL 1S4ZA 1Y1VG 4P75A 2BCOA 5CV5A 2R93G 4DR2Q 4JBJA 4K0KQ 1GUTA 3JAML 1IBLL 2E8GA 2KEDA 1HNZL 3NWSA 2HQEA 3MZ5A 2Z6BA 4Q0FA 1QE6A 2ID0A 1UE6A 4I65A 3CXCA 1WTHA 3CHBD 5J1ZA 3U9SA 2M00A 1JORA 1IBKL 3TN2A 1O7YA 1D5MC 3FHWA 5KEEA 3RZDB 2L4NA 2PCFB 4P72A 1Q8KA 1PZJD 5D3DA 5FLMH 3EVQA 3NBHB 3A8IE 5KYLA 3T51B 1X55A 3GTPH 3QG1A 2XWBB 2I46A 4X65Q 1QUQB 4BWGB 1J9OA 2IX1A 3J7AF 2B2UA 4NDXA 1BBWA 2XWJB 3EROA 3W1GA 1TWAB 5J22A 5ELOA 2Y0SE 2DN8A 5ELBA 2EQSA 2UUAL 1LLRD 1PV4A 1N8RC 3OIQA 5ELDA 4LF5Q 2E2HB 1ENFA 5CC4A 1YI2A 3JAME 5HURA 2JA9A 1CKNA 1OXTA 1U4RA 1SYBA 3PMFA 1Y1WB 5C0XG 2KJXA 1I94Q 3KBGA 2C5CA 1PTOH 3HOVH 2CQAA 1B7YB 1UE5A 1VF5C 4DUYL 4JI5L 1B2TA 3KF6A 2L5TA 2N3SA 1B53A 1Y1VB 1GJXA 1EEFD 2NN6G 4A3LG 2NTSA 2EYJA 1STEA 4RAUC 5D14A 5I2XA 5ISRA 3DLLA 3CRLC 2E2JH 2EYLA 2EJMA 2OCEA 4Y7NH 4IURA 1IBMQ 1IZ6A 2NVTB 4DV1Q 4LWCA 4GLXA 2RKSA 1TWGH 4I7ZC 3EA6A 1S3OA 4A3IB 2AQ1B 4DV2L 1MSGA 4KHVA 5M3FH 1K73C 4A3CG 1HZ9A 1DD2A 4L5TA 1I4HA 4X3SA 1I94L 3TRZA 3U50C 4GS3A 3MXGA 4XT3B 4KI0A 5NUCA 5CR3A 3PUWA 5IYDH 1RTNA 2F0NA 1NMGA 4X62L 1TY2A 1W6KA 1SYEA 2P5ZX 1TVXA 4A3EB 4DPGA 4FF4A 3HOUH 1HNWL 3D6WA 2JK8A 4O0AA 4UHVA 1SMYC 4JYAL 3V2TA 1D2BA 2YTVA 1QJOA 2CWPA 4GOPB 2EYHA 3J81c 5C4ZA 4DK1A 1VQ7A 3BZDB 2L55A 2KCNA 4NP5A 4LF9Q 1YITA 1KAAA 4CJ2C 1SNCA 2FJ2A 1LT6D 4JI4Q 3CF5A 4XYOA 1FD7D 1RTOA 1K9MC 1N36Q 4DF7A 3GO5A 2FHTA 3TMEA 3CU7A 5BN5A 1G8ZD 4GNXC 4R8NA 4QIWB 1Q7YC 4BBRH 3LNNA 4ILWA 4ME3A 4ABNA 5C3EB 3HOZH 4M8AA 1G51A 4I7AA 3M85A 3F1ZA 1WJJA 1BCPD 4C3HB 4IJLA 3C1FA 4OL7A 4QF4A 4A3BG 2R3ZA 3TDQA 1Z7TA 3F2DA 4A3IG 4BY7B 5FOBB 3CPWA 5M3FB 1PH1A 3VYSA 1XPRA 1PDQA 1EYDA 2UUBQ 2HDLA 5E7NA 3PF4A 1K8MA 4JV5Q 5CV7A 4OWTB 3K80C 2DGYA 1EIYB 4ZUIA 4HJAA 3GTJH 3A56A 2HHHQ 4DNRB 4F87A 4R4IA 3LGJA 2V1CC 1X3FA 3CCQA 1Q1BA 1O7LA 3DMUA 3DXJC 1A3UA 4DR6L 1ZYRC 4DR2L 2XSCA 4IN3A 2O4XA 2B2WC 2AUKA 1U4PA 3T4AC 3MFGA 5G3LF 4A3IH 1YZ6A 2QGQA 3K0YA 3A5ZB 5FO7B 4OWXB 4QL5A 1DOKA 5IWAQ 1K83H 1E0BA 1X9NA 1YNXA 2CFMA 3HEJA 4LFAL 3W2DA 4Z9CB 3AQQA 4FP5D 3HKSA 1SJHD 3M4OB 4CHTB 3K7AB 4QGUA 1R9TB 1VQ5A 4A93G 3HOWH 2F0IA 4JI6Q 3S24A 2CKZB 3OHXC 1QB5D 3J81j 1E22A 1EU3A 1B3AA 1NAPA 5DM63 3R8BA 2JA7G 3EJIA 1KLUD 5EPJA 4DA2A 1HHVA 2ATWA 1A2UA 1XWEA 2KHSA 1D1KA 3I7FA 1HA6A 3MXNB 2FFKB 2WV6D 4JG2A 3W5OA 4A4IA 3CD6A 1STHA 1EY0A 1E2WA 4XQNA 1YEZA 1NNXA 4ID6A 1AZQA 4HCSA 1RIPA 2Z6KA 1HZAA 4K14A 1PH3A 2R61A 3OWEB 2VZAA 3TBIB 4C1NK 5CBEE 1C9OA 3MXNA 1M1KC 1AW7A 5DEHA 3VR6A 4POFA 2ICEC 4A3FH 1G2TA 2KHIA 4FF3A 1ML0D 1VQNA 1S40A 3PIOA 5IIFA 4HMJA 2IJ0A 5GROA 1DOMA 1QNKA 3I90A 1N32L 4Q5VA 1ICFB 2HUGA 2CWAA 1IBML 3U4ZA 5DAUA 2K5WA 5EPLA 4RCNA 1K8AC 3S1RB 1BBXC 3T1HQ 4BBSG 4LMQD 1ET6A 4FDBA 3VYRA 4QUFA 1PH6A 1XNQL 3RMHA 4JI6L 1JR0D 3CMAA 3BYYB 1F9RA 1LACA 4RHRA 4AQYQ 3HKZE 1NCVA 1YIJA 2K52A 3BJUA 4YHHQ 4C3IG 1ZKOA 5FLXE 2R93B 3GTOB 5KIXA 4UP9A 4JI1Q 4JI1L 1LTAD 1N9WA 1PFBA 4KKTA 5GQOA 3ERSX 4OX9Q 1T9HA 3M4YA 1X3QA 4R1JA 4ZLTF 2VUMG 3VA5A 1HUMA 1L2FA 1TQOA 1SFOB 5C4HA 2EPBA 1JWSD 3H09A 5C5LA 1VQHA 2AKWB 1JWMD 1EFWA 1STNA 1CQVA 1WOCA 2F0UA 1GHKA 4BS9A 3KDFB 4DK6C 4C2MB 4CBVA 2SNMA 2ZXOA 3FDTA 4XQQA 2C35B 1XPOA 3CQZB 3ICEA 2KUMA 1PH4A 5IGGA 4C1NI 2D5DA 3UDXA 3SDZA 2ZM6Q 4X65L 2QA4A 3CQZH 1BCPC 2F4VQ 1VDZA 1TU2B 5EPKA 3VYTA 1J5EQ 2EYPA 4PG3A 1DZ1A 1PTOC 1SJED 4DAPA 1QZHA 2LXKA 5EKIA 2UXBQ 1EQRA 1HA5A 2NZHA 2F4IA 3H0GH 1SDFA 3SR1A 3T56B 1YNND 5C3EH 4GLAC 4BY1H 4KHPL 3KBXA 1HXYD 4JW0A 3R3OA 2B8GA 2UXDL 3BYTB 1HH2P 1SE3A 1TT2A 4DXFA 2AWOA 2M9VA 4A3BH 3RZOB 2WAQG 3Q8DA 4LK1C 4AIMA 3H3VC 3QWNA 2DNCA 2DJGC 3T1YL 3VR5A 1XX8A 1DCZA 3CCUA 4OIKA 3SK6A 4RH6A 3S15H 3DEOA 2CQOA 3SXHA 2JA6B 4JBMA 1H9SA 1GXDC 1TS2A 1WI5A 2BOSA 4IUUA 3F2UA 1TWHH 1KLGD 1NJIC 4ZKBB 4IQZA 1VQ6A 5J39A 2J7ZA 3BVGA 4DV3Q 4DV3L 1YJNA 4DR1Q 3ULPA 1IYUA 2RQXA 3GTKH 4OWWB 1KAWA 3AYHB 1X6OA 3GTOH 3SVMA 4X64L 4DV4Q 1V9PA 3S1MH 5EBDA 1XYIA 3CMEA 4NXMQ 5IYCH 1S5BD 1HR0W 3HOUG 1SMYD 3DUZA 1QNUA 5JEAJ 5IWAL 3MTSA 1KNEA 5IYDG 3HOYH 3ITPA 4XT1B 1H9KA 3CCVA 1A15A 2XN9C 3ND8A 4EQOA 1H9RA 4FXDA 1P16A 3D3RA 2F0VA 5LMUQ 3CAMA 1KRTA 1PTOF 2HQLA 3LWUA 4A76A 3OMCA 5I6YA 3R2TA 4JYAQ 1NUCA 1WTQA 1FGBD 1EWIA 2EXDA 3FEWX 4DR3L 4Y7NB 4IFDI 5C6AA 1K3RA 1VQEA 4FNFA 2PZWA 5ELFA 4A3LH 4Y52H 1UE7A 2K6AA 4IALA 3J81L 5C44G 1A0IA 1PMRA 4M1UB 2I07B 3QB3A 2A73B 4EGVA 2ZXRA 2Q2TA 3E0JA 3HOVG 2A1AA 1X3PA 4XDXA 1JMCA 2Y0SG 5KNBA 1AE2A 4A3EG 3RZOH 2Q2IA 5C0XH 4EVOA 4WFN3 1U4MA 4YWKA 4C3HG 5IY0A 5E1FA 4C3JG 3H6MA 3I73A 4PMBA 2A69C 3K57A 5C3EG 2EYOA 4ZAIA 5LMNQ 1AZPA 3I8ZA 1PFNA 3GTKB 1LTID 3PF5A 1C0AA 5JVG3 2UU9L 5IGEA 1I4PA 1SROA 4R4CA 3S1MB 1DOLA 3FVQA 1XNQQ 1TS4A 4BBRB 4B3ML 1HQRD 3GV6A 5GADC 1JB3A 4ZRZA 2WIIB 1KTKA 3RZDH 3TSSA 1CTMA 3DWAA 2CH4A 3G71A 3PV0A 1K0SA 3D4RA 1IL2A 1VQ9A 2EY6A 4IUTA 4KV6A 5FLMG 3UDGA 2O5JC 5HY6A 2FMCA 2I0QA 3HS0C 3MA2B 4FXKC 4XTCS 3WOEA 1CZGA 1N32Q 1F2YA 1S5CD 3CCJA 1PA6A 1PFMA 3KLSA 1A62A 1Q1EA 2YTYA 4PV1C 3NPPA 3X3MA 4A3EH 4DAVA 3HOXG 2R92B 3TQYA 3RN2A 3FKIH 2NUCA 3TREA 3GTGH 3PQIA 1YHAA 2Q8TA 3HOYB 3PCOB 4CKEA 2DJFC 2K1BA 3HKZB 5T1GA 4NKLA 3R93A 1VS0A 3F2CA 4K5XA 4UPAA 5KYIA 1TWCH 4R4TA 2NYZD 1N34Q 1LABA 4B3RL 2JA7B 1EOTA 4RWSC 2A6HD 3G7LA 2PPBC 2OQ0A 2R6GA 2F03A 2L9HA 1G6ZA 2EZVA 4DFAA 3B6YA 1Q8IA 1X3GA 1PLFA 1TS3A 1XNRQ 3JC66 2OXPA 2QDBA 1NE3A 1VQIA 1K8GA 1HRJA 3S2DH 1WD1A 1XTCD 1K0RA 3I4NG 2E2IB 3I55A 4J6HA 4LFCL 5CMDA 2I5HA 4X66Q 2QKIC 3SK4A 4ULLA 2NVQB 1PH8A 3A5UA 3AEVA 4DR5Q 3D31A 2IW3A 3K8AA 2K32A 3A55A 2F3WA 1A63A 3BZKA 3FPUB 1G91A 4JV5L 4LF5L 4DAYB 2XRSD 2IWHA 1WTXA 1GD7A 1OXSC 1LTTD 3TS2A 3C46A 4PMCA 1U5KA 2F0GA 1EYAA 1WTWA 4QQBX 1Q46A 1JOQA 3BVMA 1X3EA 3VA7A 3EQLC 4R9WA 3P75A 2XRQD 4EQPA 2VQEL 2DY8A 5CYUA 1V8QA 2B3GA 2MO0A 2D0OA 2F4VL 3U9OA 3S14H 2EE1A 2E2DC 1KRSA 2RF4A 4UAIA 2GA4B 1HR0L 2B2YA 4GN4B 4S3SA 1MKHA 2KEEA 4R4QA 4CGYB 1BF4A 5EBCA 5LMNW 4JPBW 1M8AA 2F0TA 2R7ZB 1V1PA 4H02A 3CCSA 3M4OH 4QCLA 2WB1B 1QVGA 1PH9A 4B3RQ 2ZTCA 4A3MH 4RCOA 1HTPA 2R92G 2G9HD 2Z6KC 1OXUA 1YHQA 5JJLA 3I4MG 1T5XD 4A3JB 3R2IA 2K4KA 1TKWB 4CDFC 1R9TH 1PYWD 1M4VA 4DK0A 1SRUA 2NVYH 1EYGA 1GUGA 4RMFA 3Q6SA 4BY1G 3S9WA 5C3XA 5IP7G 5KRUA 3H0GG 1L0YB 3BZCA 1NSNS 3K5NA 4L8JA 3P1HA 3GTPB 2XTIA 1GO3E 1QUQA 1Y1WG 4DV1L 3ONAB 1NTGA 3UDIA 4U68A 2BE5C 5IGFA 2RVLA 4JI8Q 3GDEA 4B3TL 5JVH3 1ZYRD 1RF2D 1IKMA 3GV3A 2F1MA 4NMZA 1CZWA 1DGSA 2G5DA 1XJVA 2B2TA 2PI2E 2ZM6L 2K05A 3CP0A 1PVOA 1VF7A 2N49A 2E2HH 2VUMH 5JOBA 3URYA 4HIOA 4P2CB 2H4OA 4GLVB 4CDDC 1H9MA 1NBWA 5IT9E 4YHHL 2WAQE 1LV9A 2JYOA 3BU2A 1OXXK 2JA8B 3C2PA 1BUVT 4OGQC 1XMQQ 2JSOA 5D65A 2HIXA 1I4XA 4P73A 1BVSA 3J80c 1IKLA 3HOXH 2UUCQ 2HCIA 1SYFA 2VS1A 1K8OA 2JA5B 2A8VA 2ENBA 2B8FA 3KJOA 5BR8Q 1SYDA 4DV7Q 2SEBD 3NK9A 1EQVA 1VQGA 5M3MB 1TWFH 2IX0A 1N36L 3NQIA 2B2TC 3ZYYX 3TP8A 3M7GA 2EDGA 4HEDA 4OONA 1JQYD 5IYBG 1N33Q 3MXUA 4KMUC 3P20A 1JT8A 4DV5Q 2HT1A 3L2PA 5K36G 2BE5D 3MFYA 1I50B 4ZYSA 4DR4Q 4A3DG 2IL8A 4K6DA 3PO2B 3V05A 5HGTA 1EY8A 3NBHA 3SK5A 2JN4A 3S16H 1VMCA 2IT1A 1IW7C 5FK9C 2UUAQ 4BA1I 3C1EA 5KGUA 1SR3A 4K5VA 4ZUJA 4KY7A 4L5QA 2PW5A 1BO0A 3IFTA 4A3KG 1GVPA 3D8GA 1F9SA 3MXPA 4H44C 2E2IH 4TRDA 4CDEC 3TP7A 1SNDA 4LF7L 2Z0SA 4A3BB 2NVYB 3J80L 4YCVA 3S16B 4AYBG 5A2QL 1IHZA 4C3HH 4A3GB 2D2CC 3H91A 4GKKL 5ELCA 3PO3H 2AHOB 2H5XA 2PNHA 2MO1A 1W2BA 1KDBA 1QVFA 3HG9A 4A3MG 2V4DA 3ND9A 1UUPA 1TY0A 3AU7A 3KLWA 1CSQA 2UU9Q 1EZ8A 4LUOA 3N52A 2JXMB 1SYGA 4DK3C 1VQDA 2D9UA 1RL2A 2LFNA 2RDGA 1Q81C 3UI2A 3K7UC 3D4DA 1SBBB 2FINB 1E24A 3ULLA 1LT3D 3ERQA 1C48A 3LWEA 4LFAQ 1YNJD 1DYQA 4B3TQ 4IFDJ 4OEMB 5C44B 1EQTA 4PQXA 2WKCA 3QO2A 1F2ZA 2E75C 1SEBD 4C3IB 1TS5A 2E76C 5KNDA 2X6GA 3SE0A 1CSPA 3UDFA 1LO5D 4C56C 3RLNA 1HNZQ 1FJGQ 3Q23A 1CFMA 5EGTA 1BR9A 4LFCQ 3K5OA 1HNXL 1SSOA 4APVA 3J80E 1DXMA 4LF6L 1TXYA 5JJIA 1O7ZA 3E3XA 4IOAA 4QB4A 3I4NH 5JJZA 4P71A 3OMGA 1EWHA 4LF8L 2RDFA 1G6PA 4AH6A 3TS0A 4KY5A 1WFQA 2XNAC 3DWQA 1TR5A 1I3QB 4GOPA 5IGBA 2X69A 4HIMA 5FLXc 4JI3Q 3PGZA 2PQAB 1EUJA 1HR0Q 5M5YH 2CW0C 1EY6A 4A3FB 4CDCC 2F0HA 2N8NA 3J81i 1Q82C 3TEHB 2J4XA 2VQEQ 1QVCA 4AYBB 4HR7B 3IFDA 2F0FA 3EFXD 1FJGL 3HOWB 4G7ZC 1AN8A 4BBRG 2QEJC 3E5SA 3G48A 4MN3A 4DR1L 1ASZA 1Y8PB 5CGKA 4GN5A 1I6HB 1UNSA 1PH5A 2UXDQ 3TP5A 4H13C 2N55A 3KLRA 4JI4L 1CI3M 3RNUA 3TP6A 2VB3X 1QZGA 2UUBL 1B9NA 1SNMA 5C4JB 1KABA 1TWAH 2HHHL 1I5FA 3PIPA 1SE8A 4LUVA 1FR3A 2KBNA 3K6OA 2OTJA 3KFUA 2XVSA 5FJ8H 1RD9D 1PH2A 4IZ8A 3S1RH 2F0DA 4FF2A 1VQPA 2EJFC 1WCMH 1KXLA 3T16A 1KL9A 4MZ9A 3D0FA 5IT9c 4IFDH 1WD0A 3HKZG 2KCMA 2KQ3A 3VDYA 4XYQA 4BA2I 2AMCB 1W6JA 2IPKD 5M3FG 2R7DA 1LTBD 1VCIA 4KN4C 4IO9A 2A69D 2QF7A 1X65A 1EEID 2D62A 5BR8L 4DV7L 2LMCB 2RSOA 2CH4W 1GM5A 3STBC 5JPNC 1STYA 1KIXA 3KUPA 2TSSA 2B63B 1A6XA 2NTTA 3JAMi 2SOBA 3U4VA 1HZCA 3NXWA 4OIJA 4PMWA 1KDCA 3JAMc 4JI2L 3KF8A 2VQFL 1KNAA 4ME5A 3NP8A 4YIJA 2GN5A 4DR4L 2KECA 1MD2D 1AEXA 4OX9L 1EU4A 1ICWA 5LMNL 1KHIA 1R4PB 3BVZA 2UUCL 1J8IA 1VQFA 2WAQB 4NXNL 1IBKQ 3GTGB 2F0WA 3CRKC 1BDOA 2VL6A 1VQOA 4EQ5A 3S17H 2PZUA 4A3KH 4DU9A 2YYZA 5JEAG 4KJOA 5T1IA 1B70B 3MAQA 4BY1B 1TWCB 1Y69U 2G9DA 3KDFA 4N9TA 2B39A 1MJEA 1SNPA 2WINB 4XXEA 4IUPA 3HFZB 2JA6G 5I9PA 2L15A 4DUZQ 4HJ5A 1BBUA 2Z1CA 5IP9H 3E0EA 1MSHA 1YVCA 3F2BA 5LMUL 3WWVA 5KNCA 1JOOA 1DONA 1RHPA 4A3JH 2C9OA 4MIUA 4NB3A 1RCVD 3E9HA 4X6AH 4A93B 4LFBL 3BDCA 1WTOA 2KHJA 3RLOA 4DR3Q 1O7IA 4GOPC 1LTSD 1JJGA 3TZUA 3HOUB 4WORA 3WOFA 1Q12A 3GTJB 3PUZA 2Q2HA 3K5MA 1KD1C 4GKJQ 3HZXA 3QJYA 4F8MA 3GTQB 3KJPA 1ESRA 5EAYA 1GOZA 4AYBE 1JICA 5J3BA 5LL6X 4UY8C 2BH2A 1U9RA 3CKIB 5E3FA 4X3TA 4IPCA 1FNVA 2JA8G 2QEXA 4A93H 2EIFA 1Y14B 1E7ZA 3NENA 3LX0A 2A74C 1IBLQ 1MJCA 2UXCL 4DR6Q 4PZ7A 1L0XB 3A8KE 2AQ3B 1YNJC 1WTPA 2I5LX 5LHY1 3J81E 5JPMC 2DNEA 3J7YW 4DR7Q 3L3OC 4DR7L 3FRPB 4X3UA 4LF4Q 4B08A 3IAYA 3J7AV 3KOJA 1AP0A 1CHQD 1G291 4JCVE 3J80i 2CW0D 3DM1A 4JI3L 1OO9B 3FPPA 2RCNA 3PO2H 1GUNA 3NWTA 2VUMB 5L37A 2JQOA 2QCPX 2D0PA 3U58A 2B2YC 1MBYA 1WTVA 2K33A 4HSPA 2F0KA 2HD3A 4PNYA 2BDOA 3ULJA 3I2ZA 3OTOL 2KENA 3K0XA 3NUCA 2YU9H 2HIVA 3GTLH 1PRTC 1TIID 4DXGA 1LTGD 2JA5H 4X66L 4LF4L 1Y8OB 3I4MH 1DJRD 1NR2A 3DM3A 4JOIC 2MFIA 4R8IA 4O42A 4LF9L 1CKOA 4LF8Q 1F77A 4RFBA 2WP8J 1XPUA 1S72A 3AFPA 3N6RA 4QIWE 1Q86C 1KC8C 4TQUS 1CKMA 2JE6I 2GVAA 2JA8H 1PYSB 3M7NA 3TZDA 1LUZA 2HDMA 3QOJA 1IYJB 5C0XJ 1CQFA 1MGSA 1QOHA 4XIGS 3VYUA 1WYDA 3DHQA 4LAAA 2NVXH 3S15B 3C3LA 2K5QA 4ALPA 1O78A 5AFWA 1F2LA 4DUYQ 1A3TA 5FO9B 4X62Q 1UEBA 1GKHA 1FNUA 2N88A 2UXCQ 1PRTD 2QILA 4UP8A 1FNWA 4X3KA 2EY5A 5F2DA 5EKKA 4O2DA 4FF1A 2MGSA 3I3CA 4A3JG 3VR2A 1L1OB 2YTXA 3MEHA 1X32A 3K7AH 3STBD 4DV2Q 4WJ3M 5IP9G 4DGZA 5GAHC 1HJPA 1M90C 5M5XH 2AUJD 3CW2C 1HNWQ 4UDUC 3KF6B 4OO1G 1SE4A 2RBMA 2ZTDA 2ES2A 4V0BA 4QJFA 2K50A 4DKAC 5AJ3L 1ET9A 5I6WA 2VQFQ 1B3QA 5D3IB 1H95A 4A3CH 3E6ZX 2MPMA 4ZCKA 4CKCA 1YBYA 2KCCA 5CORA 2LY7A 2PNRC 2K5HA 4DV0L 3T1HL 5C4XB 1S5DD 1EIGA 2EVBA 1D8LA 2F3VA 1BQQT 1HFGA 2F0MA 3PUVA 3CCEA 5IYBH 2M2LA 4WRDA 2BH8A 2RCFA 2IHFA 3OYYA 4V190 4FYDA 4GZYC 1ZEQX 2NN6H 3L7ZC 4K5WA 1JE5A 4POGA 5ELNA 3CC4A 2BA0A 4GN3B 5CV8A 4PZ6A 1WTRA 2KVMA 5I9OA 1PFSA 2K5VA 4JI2Q 4EX5A 1EY5A 4HAEA 3HOWG 2E5LQ 4J8QA 4DUZL 2F0EA 2WKDA 3SGIA 4JBKA 3OSOA 2O2LD 3PO3B 3A8JE 1QWYA 1I6HH 1GUOA 1LYLA 5CBAE 2E74C 4CJ0B 4TKOB 2QW7A 2GVBA 4LNQA 4QMGA 4MHEA 2JA5G 5ELEA 1S5ED 4CKBA 3EBEA 1RKNA 2Z8LA 1PXUA 1D5XC 4JI8L 1FVIA 4B3MQ 1ENAA 2XIWA 3FP9A 1YJ9A 4IFDG 4RGMA 2L0CA 2JEBI 1II3A 2ZT9C 4N8FA 1EY9A 2NVQH 2EOTA 1LT5D 3Q22A 4TSSA 5C3WA 3OWFA 2OF1A 1OXVA 2WFWA 1GUWA 4R4OA 1B50A 1SFOH 2AQ2B 2PQAA 2K5NA 2R7ZH 3BDOA 2PYKA 1Y1WH 3PO2G 4A3GH 3G6EA 1C8CA 2QDLA 4DV0Q 5BN4A 2A68C 2K04A 2Y0SB 2Q8IB 4C2MH 1Q90A 5IP7H 2NZ1D 4G7OC 1U4LA 2RSNA 4HIKA 4OO1I 2FXQA 5IODA 3L9AX 4DV6L 1EFID 1X54A 3MWYW 4RA8A 4A3KB 1P8LA 4IPHA 3I91A 5G3LD 2B2UC 4QUCA 2Q8RE 3I56A 2R92H 1PZID 3T53B 3FKIB 5FKAC 1Q3LA 3HOZG 3I72A 1D1IA 1KQSA 5IT9L 1PRTF 2L1BA 4K6LA 4B9XA 3CCMA 1LTLA 1V43A 2F52A 5A2QE 4JOIA 3M4PA 4IPDA 1HCZA 1ZXTA 1UE1A 5IGDA 1QG7A 5JAVA 1RJTA 4ZKCB 1RDPD 4B3SL 5JJKA 2BDNA 1KDAA 3GD7A 3I4OA 2R7FA 2PO4A 1VQLA 5COYA 2BA1A 1CUKA 4BXXG 2NWGA 2PMZE 1HNXQ 3MVVA 4K8IA 1YHBA 4JI7Q 3S1QH 3HOYG 4J15A 2VNUD 1JOKA 4G4KA 2CHBD 1V1PB 2B2VC 2MQHA 1U0LA 3MC0B 1SNQA 1Z6HA 2NVTH 1JC7A 1LT4D 4LW1A 1JE4A 2TMPA 1SNOA 1XTDA 2NBFA 4DAYA 3HOXB 2F0SA 4G7HC 2OWOA 5E4WC 1I50H 3ZJYC 3NEMA 5DLQE 4YWMA 3VR3A 3S17B 2RA4A 2NVXB 1I4GA 2NB0A 1I6VC 4MTKA 4U673 3G4SA 3GTMH 1R4QB 4DR5L 1WCMB 1BOSA 2JEAI 2A6EC 1MIUA 1VQBA 1YJWA 4IUNA 4OHJA 4B9WA 5TSSA 3PUXA 1EYCA 4L5RC 1T5EA 4BY7H 4MTNA 3RR5A 1I4RA 4NXNQ 4DV6Q 1H9JA 4XQJA 2FMMA 1CKNB 3GP7A 5C4JH 2Z9HA 1N34L 3I4NB 1XMOQ 2J0TD 1J6QA 2OT2A 3OW2A 3HGBA 5BN3A 2DUDA 2PI2A 2PQEA 1SXTA 4E6IA 4RG1A 5A35A 2YU9B 1AE3A 2MNAA 3H0GB 4FVMA 5AJ3Q 4MNOA 2A6ED 3V96A 3S1NH 1F2MA 4KK7A 1BCPF 2F0QA 4A3GG 4CJ1B 2Q2UA 1V1QA 4F7XA 3CCLA 1JB7A 2R7ZG 1CT1D 2WB1G 1WCMG 4A3MB 2DY7A 4A3DH 3HP3A 3IL8A 2KA7A 2ASBA 3S2DB 5K36H 1STBA 3CCRA 2Z4HA 4K8JA 5EQ0A 1IL8A 4H0LC 1B9MA 3AMUA 4DNIA 1B4OA 3AB9A 2AWNA 4DV5L 4GKKQ 4F88A 1XMQL 1A8VA 2E5LL 4JC0A 3BG3A 4KY6A 4O1NA 4NPSA 4JI5Q 3MHBA 4C3JH 2JJQA 3A7LA 1JCKB 4RHSA 4C3IH 1IXRA 5IOCA 3A0JA 4YY3Q 4YY3L 2OTLA 3RLFA 1XXGA 4KKSA 1JJ2A 1X56A 3L0OA 4OELB 4HIDA 4HJ8A 4KLKA 2N78A 3OW7A 3M3YH 1ESFA 3H94A 4JBWA 1VQ4A 5M3MG 3HRZC 1N33L 1Z9FA 3J7ZC 2ZJPA 4BY7G 2EJGC 1ILPA 2WB1E 3RUZA 3S1QB 2R93H 3IRBA 3OIPA 1HFNA 1HQMC 2PZTA 2LS01 1Y1VH 1EIHA 2F0OA 3S14B 5FO8B 1PTOB 2KCTA 3GTQH 2EXZA 2F0JA 4ODGA 1E3PA 3IKJA 2PMZB 2ALYB 5H1SE 4KD3A 3OOCA 3NTIA 2OQKA 3UE0A 1ILQA 4TVAB 4A75A 1QILA 4FO2A 4A3FG 4JK1C 3P7JA 1EIFA 4PZ8A 3CC2A 3S2HB 3EIVA 3QR8A 1DM0B 3HOVB 4G57A 4BBSB 1RODA 4IJHA 4QY7A 3NHHA 1SLJA 3K81C 2B63H 5IYCG 2X6LA 3K59A 3H3VH 4J1MA 1VQAA 3NQTA 1PTOD 1O80A 2B2WA 1FL0A 5I4DA 2K01A 4K0KL 1Y8NB 2RHSB 3D4WA 4WJWA 4C3JB 2K14A 1AFPA 4RGNA 3OTOQ 1A2TA 4A3DB 1WVLA 1LM0A 1GUSA 2JA7H 5GAGC 1EL0A 5FLXL 2A68D 2RHQB 3A54A 1BCPB 1E2VA 1TWFB 4IUVA 1CHPD 2K7VA 1L1OA 5DM73 5M5WH 5CV4A 4L63B 1D5ZC 3X3NA 5IE8A 3T1YQ 3EN2A 5GAEC 3QIAA 5C4XH 1B44D 4JI0Q 4JI0L
chains in the Genus database with same CATH topology
1BNZA 1EZ6A 1D6EC 3DWPA 4KHZA 3A7AB 3GQBA 4ZK9B 3M3YB 5CV9A 2CVRA 3DEPA 4EQNA 2MUYA 3NTKA 5M5XB 4KD4A 3NTHA 3NBIA 4RGOS 2Z4IA 4KN7C 1IYVA 1K83B 3W3AA 4K2KA 3PIP3 3Q24A 1UAPA 2SDFA 2A6HC 1TWHB 4HSVA 3KK7A 5EJWA 4K2LA 3QOLA 1JWUD 3VR4A 2E2JB 3RD4A 2EY2A 2K28A 3OPOA 5M9OA 4H7BA 4RKBA 2EYFA 1HTLD 5E4XA 5IGCA 1A3VA 4RKLA 1LTRD 2PW7A 3NSWA 4HN7A 3KLSX 5EKLA 4FXGC 1IW7D 2RDHA 4DNTB 3NE5B 1ONLA 2MP1A 2O5IC 2F0PA 3I4LA 1SAPA 5DNFA 3GTLB 3Q0AA 4RGTA 5K5PA 2A5HA 4LJZC 2LKVA 5M5YB 3WDNA 1B1ZA 3D6CA 5M5WB 5C0XI 1F9PA 2IX3A 1EY7A 1SE2A 3I4MB 2B2VA 1ENCA 1CA6A 1BXTA 5LL6S 3HOZB 4OO1H 4HCEA 5CV6A 4NW2A 1C4QA 1F9QA 1UEAB 2L12A 1PRTB 5JEAH 2SNSA 2JP1A 3BS1A 2EY1A 1V1OA 2EYMA 4KJNA 1MI2A 2OEOA 3O13A 2ICIA 1TWGB 2MHVA 1QCBD 3K5LA 1EWCA 3BDLA 3PUYA 2MJ8A 1VMPA 1HUNA 3FMCA 1GHJA 3K58A 2L11A 4HTHA 4IUQA 1YNNC 1CM9A 1STAA 3SK8A 1STGA 3PIO3 1CK1A 1EY4A 2ZXPA 4N9PA 5C5MA 1H9SB 2H1EA 1G2SA 5I2YA 2HCCA 1I4QA 2F0LA 1SYCA 2WACA 1Z47A 1CA5A 1PZKD 3I70A 4HMIA 4KKUA 4L6TB 2K03A 1NR4A 3GTMB 3SHLA 4DN4M 4KTAA 3SEBA 2K5DA 1E2ZA 2VB2X 3S1NB 3G6JB 1S5FD 4ZQ3A 1FYCA 2VXWA 2NN6I 2KOLA 3T13A 1HPCA 1S4ZA 2BCOA 5CV5A 1GUTA 3JAML 2KEDA 3NWSA 2HQEA 3MZ5A 4Q0FA 1QE6A 2ID0A 4I65A 3CHBD 5J1ZA 3U9SA 2M00A 1JORA 3TN2A 1O7YA 1D5MC 5KEEA 3RZDB 2L4NA 2PCFB 1PZJD 5D3DA 3EVQA 3A8IE 5KYLA 3T51B 3QG1A 2XWBB 2I46A 4BWGB 1J9OA 2IX1A 3J7AF 2B2UA 3EROA 2XWJB 4NDXA 1TWAB 5J22A 2DN8A 5ELBA 1LLRD 3OIQA 5ELDA 2E2HB 1ENFA 5CC4A 3JAME 5HURA 1OXTA 1U4RA 1SYBA 3PMFA 1Y1WB 5C0XG 2KJXA 3KBGA 2C5CA 1PTOH 2CQAA 1VF5C 1B2TA 2L5TA 1B53A 1Y1VB 1GJXA 1EEFD 2NN6G 2NTSA 2EYJA 1STEA 4RAUC 5D14A 5I2XA 5ISRA 3CRLC 2EYLA 2EJMA 4IURA 2NVTB 2RKSA 3EA6A 4I7ZC 4A3IB 2AQ1B 1MSGA 4KHVA 1DD2A 1I4HA 4X3SA 3MXGA 4XT3B 4KI0A 5NUCA 5CR3A 3PUWA 1RTNA 2F0NA 1TY2A 1W6KA 1SYEA 1TVXA 4A3EB 4FF4A 3D6WA 1SMYC 3V2TA 1D2BA 1QJOA 2EYHA 5C4ZA 4DK1A 3BZDB 2L55A 2KCNA 4NP5A 1KAAA 4CJ2C 1SNCA 2FJ2A 1LT6D 4XYOA 1FD7D 1RTOA 4DF7A 3GO5A 2FHTA 3TMEA 3CU7A 5BN5A 1G8ZD 4R8NA 4QIWB 3LNNA 4ILWA 4ABNA 5C3EB 4M8AA 3M85A 1BCPD 4C3HB 3C1FA 4OL7A 4QF4A 2R3ZA 3TDQA 1Z7TA 4BY7B 5FOBB 5M3FB 3VYSA 1PDQA 1EYDA 2HDLA 1K8MA 5CV7A 4ZUIA 3A56A 4DNRB 4F87A 1Q1BA 1O7LA 3DMUA 3DXJC 1A3UA 1ZYRC 2XSCA 4IN3A 2O4XA 2B2WC 2AUKA 1U4PA 3T4AC 3MFGA 5G3LF 3K0YA 5FO7B 1DOKA 1E0BA 3HEJA 3W2DA 4Z9CB 4FP5D 1SJHD 3M4OB 4CHTB 3K7AB 1R9TB 2F0IA 3OHXC 1QB5D 1EU3A 1B3AA 1NAPA 5DM63 3R8BA 3EJIA 1KLUD 5EPJA 4DA2A 1HHVA 1A2UA 1XWEA 2KHSA 1D1KA 1HA6A 2FFKB 2WV6D 1STHA 1EY0A 1E2WA 4XQNA 4ID6A 1AZQA 4HCSA 4K14A 2R61A 3OWEB 3TBIB 4C1NK 5CBEE 3MXNA 1AW7A 5DEHA 3VR6A 2ICEC 1G2TA 4FF3A 1ML0D 5IIFA 4HMJA 2IJ0A 1DOMA 1QNKA 3I90A 4Q5VA 2HUGA 5DAUA 2K5WA 5EPLA 4RCNA 3S1RB 1BBXC 4LMQD 1ET6A 3VYRA 4QUFA 3RMHA 1JR0D 3BYYB 1F9RA 1LACA 4RHRA 1NCVA 4C3IG 1ZKOA 5FLXE 2R93B 3GTOB 5KIXA 1LTAD 1PFBA 4KKTA 3M4YA 1X3QA 4ZLTF 3VA5A 1HUMA 1TQOA 1SFOB 5C4HA 2EPBA 1JWSD 3H09A 5C5LA 1JWMD 1STNA 1CQVA 2F0UA 1GHKA 4BS9A 4C2MB 4CBVA 2SNMA 2ZXOA 3FDTA 4XQQA 3CQZB 2KUMA 5IGGA 4C1NI 2D5DA 3SDZA 1BCPC 1VDZA 1TU2B 5EPKA 3VYTA 2EYPA 1DZ1A 1PTOC 1SJED 4DAPA 5EKIA 1HA5A 2F4IA 1SDFA 3SR1A 3T56B 1YNND 3KBXA 1HXYD 3R3OA 2B8GA 3BYTB 1SE3A 1TT2A 4DXFA 2AWOA 2M9VA 3RZOB 4LK1C 3H3VC 3QWNA 2DNCA 3VR5A 1XX8A 1DCZA 4OIKA 3SK6A 4RH6A 3DEOA 3SXHA 2JA6B 1H9SA 1GXDC 1TS2A 2BOSA 4IUUA 3F2UA 1KLGD 4ZKBB 4IQZA 5J39A 2J7ZA 3BVGA 1IYUA 2RQXA 3SVMA 5EBDA 1XYIA 1S5BD 1SMYD 3DUZA 1QNUA 5JEAJ 3MTSA 1KNEA 3ITPA 4XT1B 1H9KA 1A15A 2XN9C 3ND8A 4EQOA 1H9RA 4FXDA 3D3RA 2F0VA 1PTOF 3LWUA 3OMCA 5I6YA 3R2TA 1NUCA 1WTQA 1FGBD 3FEWX 4Y7NB 4IFDI 5C6AA 4FNFA 2PZWA 5ELFA 2K6AA 4IALA 3J81L 1PMRA 4M1UB 2I07B 3QB3A 2A73B 4EGVA 2ZXRA 3E0JA 1X3PA 4XDXA 5KNBA 5C0XH 4EVOA 4WFN3 1U4MA 4C3HG 5E1FA 4C3JG 3H6MA 3I73A 4PMBA 2A69C 3K57A 2EYOA 4ZAIA 1AZPA 3I8ZA 1PFNA 3GTKB 1LTID 5JVG3 5IGEA 1I4PA 3S1MB 1DOLA 3FVQA 1TS4A 4BBRB 1HQRD 3GV6A 1JB3A 4ZRZA 2WIIB 1KTKA 3TSSA 1CTMA 3DWAA 3PV0A 3D4RA 2EY6A 4IUTA 4KV6A 2O5JC 2FMCA 3HS0C 3MA2B 4FXKC 4XTCS 3WOEA 1CZGA 1F2YA 1S5CD 1PFMA 3KLSA 1Q1EA 4PV1C 3X3MA 3NPPA 2R92B 4DAVA 2NUCA 2Q8TA 3HOYB 4CKEA 2K1BA 3HKZB 5T1GA 4NKLA 3R93A 4K5XA 5KYIA 2NYZD 1LABA 2JA7B 1EOTA 4RWSC 2A6HD 3G7LA 2PPBC 2R6GA 2F03A 2L9HA 1G6ZA 2EZVA 4DFAA 1Q8IA 1PLFA 1TS3A 2OXPA 2QDBA 1HRJA 1WD1A 1XTCD 2E2IB 4J6HA 5CMDA 2QKIC 3SK4A 4ULLA 2NVQB 3D31A 2IW3A 2K32A 3A55A 2F3WA 3FPUB 1G91A 2XRSD 2IWHA 1WTXA 1OXSC 1LTTD 3C46A 4PMCA 2F0GA 1EYAA 1WTWA 1JOQA 3BVMA 3VA7A 3EQLC 4R9WA 3P75A 2XRQD 4EQPA 2DY8A 5CYUA 1V8QA 3U9OA 2EE1A 2E2DC 4UAIA 2GA4B 2B2YA 4S3SA 2KEEA 4CGYB 1BF4A 5EBCA 1M8AA 2F0TA 2R7ZB 1V1PA 4QCLA 2WB1B 4RCOA 1HTPA 2G9HD 1OXUA 1T5XD 4A3JB 3R2IA 1TKWB 1PYWD 1M4VA 4DK0A 1GUGA 3Q6SA 3S9WA 5C3XA 5KRUA 1L0YB 1NSNS 3K5NA 4L8JA 3P1HA 3GTPB 3ONAB 4U68A 2BE5C 5IGFA 2RVLA 5JVH3 1ZYRD 1RF2D 1IKMA 3GV3A 2F1MA 4NMZA 1CZWA 2B2TA 2K05A 1VF7A 5JOBA 3URYA 4P2CB 2H4OA 1H9MA 5IT9E 1LV9A 2JYOA 1OXXK 2JA8B 3C2PA 1BUVT 4OGQC 2JSOA 5D65A 1I4XA 1IKLA 2HCIA 1SYFA 1K8OA 2JA5B 2ENBA 2B8FA 1SYDA 2SEBD 3NK9A 1EQVA 5M3MB 2IX0A 3NQIA 2B2TC 3ZYYX 3TP8A 3M7GA 2EDGA 4HEDA 1JQYD 3MXUA 4KMUC 3P20A 5K36G 2BE5D 3MFYA 1I50B 4ZYSA 2IL8A 4K6DA 3PO2B 3V05A 5HGTA 1EY8A 3NBHA 3SK5A 1VMCA 2IT1A 1IW7C 5FK9C 4BA1I 3C1EA 5KGUA 4K5VA 4ZUJA 4KY7A 2PW5A 1BO0A 3IFTA 3D8GA 1F9SA 3MXPA 4H44C 4TRDA 3TP7A 1SNDA 4A3BB 2NVYB 3J80L 3S16B 5A2QL 1IHZA 4A3GB 2D2CC 3H91A 5ELCA 1KDBA 3HG9A 2V4DA 3ND9A 1UUPA 1TY0A 3AU7A 1EZ8A 3N52A 2JXMB 1SYGA 2D9UA 2LFNA 2RDGA 3UI2A 3D4DA 1SBBB 2FINB 1LT3D 3ERQA 1C48A 3LWEA 1YNJD 1DYQA 4IFDJ 5C44B 1EQTA 4PQXA 2WKCA 3QO2A 1F2ZA 2E75C 1SEBD 4C3IB 1TS5A 2E76C 5KNDA 2X6GA 3SE0A 1LO5D 4C56C 3Q23A 1CFMA 5EGTA 1BR9A 3K5OA 1SSOA 3J80E 1DXMA 1O7ZA 4QB4A 5JJZA 3OMGA 1EWHA 2RDFA 4KY5A 2XNAC 3DWQA 1TR5A 1I3QB 5IGBA 2X69A 2CW0C 1EY6A 4A3FB 2F0HA 2J4XA 4AYBB 4HR7B 3IFDA 2F0FA 3EFXD 3HOWB 4G7ZC 1AN8A 2QEJC 3E5SA 4MN3A 1Y8PB 5CGKA 1I6HB 1UNSA 3TP5A 4H13C 2N55A 3KLRA 1CI3M 3TP6A 2VB3X 1B9NA 1SNMA 5C4JB 1KABA 1FR3A 3K6OA 2XVSA 1RD9D 4IZ8A 2F0DA 4FF2A 2EJFC 3T16A 4IFDH 1WD0A 2KQ3A 4XYQA 4BA2I 1W6JA 2IPKD 1LTBD 1VCIA 4KN4C 2A69D 2QF7A 1EEID 2D62A 2LMCB 2RSOA 5JPNC 1STYA 3KUPA 2TSSA 2B63B 1A6XA 2NTTA 2SOBA 3NXWA 4OIJA 4PMWA 1KDCA 3KF8A 1KNAA 4ME5A 3NP8A 4YIJA 2KECA 1MD2D 1AEXA 1EU4A 1ICWA 1R4PB 3BVZA 1J8IA 2WAQB 3GTGB 2F0WA 3CRKC 1BDOA 2PZUA 4DU9A 2YYZA 5JEAG 4KJOA 5T1IA 3MAQA 4BY1B 1TWCB 1Y69U 2G9DA 4N9TA 2B39A 1SNPA 2WINB 4XXEA 4IUPA 5I9PA 2Z1CA 1MSHA 5KNCA 1JOOA 1DONA 1RHPA 2C9OA 4MIUA 1RCVD 4A93B 3BDCA 1WTOA 1LTSD 3TZUA 3HOUB 4WORA 3WOFA 1Q12A 3GTJB 3PUZA 3K5MA 3HZXA 3QJYA 4F8MA 3GTQB 1ESRA 1GOZA 1JICA 5LL6X 1U9RA 3CKIB 5E3FA 4X3TA 1FNVA 3LX0A 2A74C 1L0XB 3A8KE 1WTPA 2AQ3B 1YNJC 5LHY1 3J81E 5JPMC 2DNEA 3J7YW 3L3OC 3FRPB 4X3UA 4B08A 3IAYA 3J7AV 1AP0A 1CHQD 1G291 2CW0D 3DM1A 1OO9B 3FPPA 1GUNA 3NWTA 2VUMB 2QCPX 2B2YC 1MBYA 1WTVA 2K33A 4HSPA 2F0KA 4PNYA 2BDOA 3NUCA 1PRTC 1TIID 4DXGA 1LTGD 1Y8OB 1DJRD 1NR2A 4R8IA 4O42A 1F77A 4RFBA 2WP8J 3N6RA 4TQUS 2JE6I 3M7NA 3TZDA 2HDMA 3QOJA 5C0XJ 1CQFA 1MGSA 1QOHA 4XIGS 3VYUA 3DHQA 4LAAA 3S15B 3C3LA 2K5QA 1O78A 5AFWA 1F2LA 1A3TA 5FO9B 1FNUA 2N88A 1PRTD 2QILA 4X3KA 1FNWA 2EY5A 5F2DA 5EKKA 4FF1A 2MGSA 3I3CA 3VR2A 3MEHA 1X32A 4DGZA 2AUJD 4UDUC 4OO1G 1SE4A 2RBMA 4V0BA 1ET9A 5I6WA 5D3IB 3E6ZX 2MPMA 4CKCA 2KCCA 5CORA 2LY7A 2PNRC 5C4XB 1S5DD 1EIGA 2EVBA 2F3VA 1BQQT 1HFGA 2F0MA 3PUVA 2M2LA 4WRDA 4V190 4FYDA 4GZYC 1ZEQX 2NN6H 3L7ZC 4K5WA 2BA0A 5CV8A 1WTRA 2KVMA 5I9OA 1EY5A 4HAEA 4J8QA 2F0EA 2WKDA 3OSOA 2O2LD 3PO3B 3A8JE 1QWYA 1GUOA 5CBAE 2E74C 4CJ0B 4TKOB 4QMGA 4MHEA 5ELEA 1S5ED 4CKBA 1RKNA 2Z8LA 1PXUA 1D5XC 1ENAA 2XIWA 4IFDG 4RGMA 2L0CA 2JEBI 1II3A 2ZT9C 1EY9A 2EOTA 1LT5D 3Q22A 4TSSA 5C3WA 3OWFA 2OF1A 1OXVA 1GUWA 1B50A 2AQ2B 3BDOA 2PYKA 1C8CA 5BN4A 2A68C 2K04A 2Y0SB 2Q8IB 1Q90A 2NZ1D 4G7OC 1U4LA 2RSNA 4OO1I 5IODA 3L9AX 1EFID 4RA8A 3MWYW 4A3KB 3I91A 5G3LD 2B2UC 4QUCA 2Q8RE 1PZID 3T53B 3FKIB 5FKAC 1Q3LA 3I72A 1D1IA 5IT9L 1PRTF 2L1BA 4K6LA 4B9XA 1V43A 5A2QE 1HCZA 1ZXTA 5IGDA 1QG7A 5JAVA 1RJTA 4ZKCB 1RDPD 2BDNA 1KDAA 3GD7A 2PO4A 5COYA 2BA1A 2NWGA 3MVVA 4K8IA 2VNUD 1JOKA 4G4KA 2CHBD 1V1PB 2B2VC 3MC0B 1SNQA 1Z6HA 1JC7A 1LT4D 1JE4A 2TMPA 1SNOA 2NBFA 4DAYA 3HOXB 2F0SA 4G7HC 5E4WC 3VR3A 3S17B 2RA4A 2NVXB 1I4GA 2NB0A 1I6VC 4U673 1R4QB 1WCMB 1BOSA 2JEAI 2A6EC 4IUNA 4OHJA 4B9WA 5TSSA 3PUXA 1EYCA 1T5EA 1I4RA 1H9JA 4XQJA 2FMMA 3GP7A 3I4NB 2J0TD 2OT2A 3HGBA 5BN3A 2PQEA 1SXTA 4E6IA 5A35A 2YU9B 3H0GB 4FVMA 2A6ED 3V96A 1F2MA 4KK7A 1BCPF 2F0QA 4CJ1B 4F7XA 1CT1D 4A3MB 2DY7A 3HP3A 3IL8A 2KA7A 5K36H 3S2DB 1STBA 2Z4HA 4K8JA 5EQ0A 1IL8A 4H0LC 1B9MA 3AMUA 1B4OA 3AB9A 2AWNA 4F88A 3BG3A 4KY6A 4O1NA 3MHBA 3A7LA 1JCKB 4RHSA 5IOCA 3RLFA 1XXGA 4KKSA 3OW7A 1ESFA 3H94A 4JBWA 3HRZC 2EJGC 1ILPA 3RUZA 3S1QB 3OIPA 1HFNA 1HQMC 2PZTA 2LS01 1EIHA 2F0OA 3S14B 5FO8B 1PTOB 2EXZA 2F0JA 4ODGA 3IKJA 2PMZB 4KD3A 3OOCA 3NTIA 1ILQA 1QILA 4FO2A 4JK1C 3P7JA 3S2HB 3HOVB 1DM0B 4G57A 4BBSB 1RODA 3NHHA 2X6LA 3K59A 4J1MA 3NQTA 1PTOD 1O80A 2B2WA 5I4DA 2K01A 1Y8NB 3D4WA 4WJWA 4C3JB 1AFPA 4RGNA 1A2TA 4A3DB 1WVLA 1GUSA 1EL0A 5FLXL 2A68D 3A54A 1BCPB 1E2VA 1TWFB 4IUVA 1CHPD 2K7VA 5DM73 5CV4A 4L63B 1D5ZC 3X3NA 3QIAA 1B44D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQ1 B;  2J4X A;  4O1N A;  1T5X D;  1D6E C;  3DWP A;  1S5B D;  3R2I A;  3EFX D;  1S5C D;  1JCK B;  2CHB D;  1PRT C;  1V1P B;  3MFG A;  1I4H A;  1PRT B;  2O2L D;  1PYW D;  4RHS A;  1LTG D;  1AN8 A;  4DXG A;  1M4V A;  2QEJ C;  1LTA D;  1XXG A;  3MC0 B;  1DJR D;  1LT4 D;  2XN9 C;  1TY2 A;  1L0Y B;  1V1O A;  1ESF A;  1UNS A;  1F77 A;  4RGO S;  3CHB D;  4RFB A;  5ELE A;  1S5E D;  4Z9C B;  3W2D A;  2Z8L A;  1SJH D;  1JWS D;  1PTO F;  1D5X C;  5ELC A;  1D5M C;  1JWM D;  1RCV D;  1I4G A;  4RGM A;  1CQV A;  3R2T A;  3O13 A;  2ICI A;  1EU3 A;  1UUP A;  1FGB D;  1TY0 A;  1PZJ D;  1LT5 D;  1LTS D;  5D3D A;  1JWU D;  4TSS A;  1KLU D;  3R8B A;  1RF2 D;  4OHJ A;  1PTO B;  5TSS A;  2AQ2 B;  1EWC A;  1RD9 D;  2RDG A;  3BZD B;  5ELF A;  1TS3 A;  1SBB B;  1FNU A;  1I4R A;  1BCP C;  4BWG B;  1LT6 D;  1PRT D;  2QIL A;  1FNW A;  1HTL D;  1LT3 D;  1XTC D;  2WV6 D;  1PTO C;  1SJE D;  1FD7 D;  1GOZ A;  1QIL A;  3URY A;  1DYQ A;  1HA5 A;  3GP7 A;  1LTR D;  1G8Z D;  1FNV A;  1HXY D;  1SEB D;  5ELB A;  1CK1 A;  1SXT A;  3BYT B;  2IPK D;  2R61 A;  1SE3 A;  4DXF A;  1TS5 A;  3OWE B;  1EFI D;  1LLR D;  2XRS D;  1I4X A;  3KLS X;  1L0X B;  5ELD A;  1LTT D;  1LTB D;  1AW7 A;  1BCP D;  2RDH A;  4UDU C;  1SE4 A;  2AQ3 B;  1ENF A;  1PTO D;  1LO5 D;  1EEI D;  1PZI D;  1LTI D;  4C56 C;  1I4Q A;  3BVM A;  5FKA C;  5I4D A;  1BCP F;  1I4P A;  2SEB D;  1ET9 A;  5D3I B;  2XRQ D;  1PRT F;  2TSS A;  4K6L A;  2NTT A;  4RH6 A;  4RGN A;  1PZK D;  1TS4 A;  2IJ0 A;  1CHQ D;  1CT1 D;  1PTO H;  4RGT A;  1HQR D;  1S5D D;  4L6T B;  1JQY D;  1KTK A;  3TSS A;  1TS2 A;  1B1Z A;  3DWA A;  1KLG D;  1RDP D;  1EEF D;  2NTS A;  1V1P A;  2XNA C;  3BVG A;  3DWQ A;  1ET6 A;  1BCP B;  1MD2 D;  1EU4 A;  1STE A;  3SEB A;  4ZYS A;  1S5F D;  3BVZ A;  3V05 A;  1CHP D;  1SE2 A;  4L63 B;  1D5Z C;  1JR0 D;  3BYY B;  4RCO A;  1BXT A;  2G9H D;  5FK9 C;  4RHR A;  3EA6 A;  1B44 D; 
#chains in the Genus database with same CATH topology
 1VQK A;  1BNZ A;  1EZ6 A;  3PO3 G;  1D6E C;  4LF7 Q;  3DWP A;  4KHZ A;  2B29 A;  3A7A B;  3GQB A;  4ZK9 B;  3H3V I;  3J7A 5;  3M3Y B;  5CV9 A;  2CVR A;  4HJ9 A;  1EOV A;  3DEP A;  4EQN A;  2MUY A;  3NTK A;  1L1O C;  1EQQ A;  2CCZ A;  5M5X B;  4KD4 A;  3NTH A;  4JI7 L;  3NBI A;  4RGO S;  2Z4I A;  4KN7 C;  3CC7 A;  1IYV A;  1K83 B;  3W3A A;  4K2K A;  3PIP 3;  3Q24 A;  1UAP A;  4KHP Q;  2SDF A;  2A6H C;  1TWH B;  4HSV A;  1PHJ A;  2LXJ A;  3KK7 A;  5EJW A;  3ER0 A;  4HJ7 A;  4K2L A;  3QOL A;  4GKJ L;  2A19 A;  1FGU A;  1JWU D;  5HGQ A;  3VR4 A;  2ZJQ A;  2E2J B;  3RD4 A;  3AFQ A;  2XGT A;  2EY2 A;  2K28 A;  3OPO A;  5M9O A;  4H7B A;  2ZJR A;  4RKB A;  2EYF A;  1HTL D;  1BKB A;  5E4X A;  4JVZ A;  5IGC A;  1A3V A;  4RKL A;  1LTR D;  2PW7 A;  1SMX A;  1HZB A;  4GNX B;  2YV5 A;  3NSW A;  5M3M H;  1VQJ A;  2UXB L;  4UP7 A;  4HN7 A;  1C7Y A;  4IOC A;  3M4Q A;  4LUZ A;  3S2H H;  3KLS X;  5EKL A;  1UWV A;  4FXG C;  1IW7 D;  2RDH A;  3FKI G;  1PH7 A;  3KF8 B;  3UE1 A;  4DNT B;  2IY5 B;  3NE5 B;  1XMO L;  1ONL A;  2NZO A;  3W1B A;  2MP1 A;  2O5I C;  2F0P A;  1E1T A;  4GNX A;  3I4L A;  1I3Q H;  1SAP A;  5DNF A;  3GTL B;  4DAM A;  4AQY L;  3Q0A A;  4RGT A;  5K5P A;  4BBS H;  1SN8 A;  2A5H A;  3A74 A;  4LJZ C;  2LKV A;  1XNR L;  5M5Y B;  3WDN A;  1B1Z A;  3D6C A;  4IPG A;  3CPF A;  5M5W B;  5C0X I;  1F9P A;  2IX3 A;  1EY7 A;  1SE2 A;  1VQ8 A;  3I4M B;  2B2V A;  1ENC A;  1CA6 A;  1BXT A;  2JA6 H;  5LL6 S;  3HOZ B;  4OO1 H;  3F8T A;  4HCE A;  5CV6 A;  4NW2 A;  1C4Q A;  1F9Q A;  1UEA B;  4OXP A;  4YWL A;  2L12 A;  1PRT B;  5JEA H;  2SNS A;  2JP1 A;  3BS1 A;  2EY1 A;  2I5M X;  2ZTE A;  1V1O A;  2K75 A;  2EYM A;  1NY4 A;  4KJN A;  1MI2 A;  2OEO A;  5C4X G;  4WJ4 A;  2IHE A;  3O13 A;  3NEL A;  2ICI A;  1TWG B;  2MHV A;  5C44 H;  4B3S Q;  3H15 A;  1L0W A;  1QCB D;  3K5L A;  1EWC A;  3BDL A;  1ASY A;  4LF6 Q;  3PUY A;  1NMF A;  2MJ8 A;  1VMP A;  1HUN A;  3FMC A;  1GHJ A;  1W3S A;  3K58 A;  2L11 A;  4HTH A;  4IUQ A;  1K28 A;  1VQC A;  1YNN C;  1OTC A;  1CM9 A;  1STA A;  1D7Q A;  3SK8 A;  1STG A;  3PIO 3;  3RN5 A;  1CK1 A;  1EY4 A;  2ZXP A;  1K3B C;  4N9P A;  5C5M A;  4N8X 1;  2VW9 A;  1H9S B;  2H1E A;  1G2S A;  5I2Y A;  2HCC A;  2LSS A;  4YCU A;  1I4Q A;  2B63 G;  1B8A A;  2F0L A;  1SYC A;  2WAC A;  1Z47 A;  1PYB A;  3PSI A;  1CA5 A;  4X64 Q;  4DV4 L;  4YCW A;  1PZK D;  5FJ8 G;  3I70 A;  3MEF A;  4HMI A;  4KKU A;  4NXM L;  4L6T B;  2F3I A;  4BXX H;  2K03 A;  1E1O A;  3M9B A;  1JJC B;  1NR4 A;  3GTM B;  3E9I A;  3SHL A;  4DN4 M;  1MHW C;  4KTA A;  2VY3 A;  3SEB A;  4L5S A;  4LFB Q;  2K5D A;  1E2Z A;  2VB2 X;  3S1N B;  3G6J B;  1S5F D;  1AH9 A;  4ZQ3 A;  1FYC A;  2VXW A;  3KYH C;  2NN6 I;  4P74 A;  1VQM A;  2KOL A;  3T13 A;  1HPC A;  1J5E L;  1S4Z A;  1Y1V G;  4P75 A;  2BCO A;  5CV5 A;  2R93 G;  4DR2 Q;  4JBJ A;  4K0K Q;  1GUT A;  3JAM L;  1IBL L;  2E8G A;  2KED A;  1HNZ L;  3NWS A;  2HQE A;  3MZ5 A;  2Z6B A;  4Q0F A;  1QE6 A;  2ID0 A;  1UE6 A;  4I65 A;  3CXC A;  1WTH A;  3CHB D;  5J1Z A;  3U9S A;  2M00 A;  1JOR A;  1IBK L;  3TN2 A;  1O7Y A;  1D5M C;  3FHW A;  5KEE A;  3RZD B;  2L4N A;  2PCF B;  4P72 A;  1Q8K A;  1PZJ D;  5D3D A;  5FLM H;  3EVQ A;  3NBH B;  3A8I E;  5KYL A;  3T51 B;  1X55 A;  3GTP H;  3QG1 A;  2XWB B;  2I46 A;  4X65 Q;  1QUQ B;  4BWG B;  1J9O A;  2IX1 A;  3J7A F;  2B2U A;  4NDX A;  1BBW A;  2XWJ B;  3ERO A;  3W1G A;  1TWA B;  5J22 A;  5ELO A;  2Y0S E;  2DN8 A;  5ELB A;  2EQS A;  2UUA L;  1LLR D;  1PV4 A;  1N8R C;  3OIQ A;  5ELD A;  4LF5 Q;  2E2H B;  1ENF A;  5CC4 A;  1YI2 A;  3JAM E;  5HUR A;  2JA9 A;  1CKN A;  1OXT A;  1U4R A;  1SYB A;  3PMF A;  1Y1W B;  5C0X G;  2KJX A;  1I94 Q;  3KBG A;  2C5C A;  1PTO H;  3HOV H;  2CQA A;  1B7Y B;  1UE5 A;  1VF5 C;  4DUY L;  4JI5 L;  1B2T A;  3KF6 A;  2L5T A;  2N3S A;  1B53 A;  1Y1V B;  1GJX A;  1EEF D;  2NN6 G;  4A3L G;  2NTS A;  2EYJ A;  1STE A;  4RAU C;  5D14 A;  5I2X A;  5ISR A;  3DLL A;  3CRL C;  2E2J H;  2EYL A;  2EJM A;  2OCE A;  4Y7N H;  4IUR A;  1IBM Q;  1IZ6 A;  2NVT B;  4DV1 Q;  4LWC A;  4GLX A;  2RKS A;  1TWG H;  4I7Z C;  3EA6 A;  1S3O A;  4A3I B;  2AQ1 B;  4DV2 L;  1MSG A;  4KHV A;  5M3F H;  1K73 C;  4A3C G;  1HZ9 A;  1DD2 A;  4L5T A;  1I4H A;  4X3S A;  1I94 L;  3TRZ A;  3U50 C;  4GS3 A;  3MXG A;  4XT3 B;  4KI0 A;  5NUC A;  5CR3 A;  3PUW A;  5IYD H;  1RTN A;  2F0N A;  1NMG A;  4X62 L;  1TY2 A;  1W6K A;  1SYE A;  2P5Z X;  1TVX A;  4A3E B;  4DPG A;  4FF4 A;  3HOU H;  1HNW L;  3D6W A;  2JK8 A;  4O0A A;  4UHV A;  1SMY C;  4JYA L;  3V2T A;  1D2B A;  2YTV A;  1QJO A;  2CWP A;  4GOP B;  2EYH A;  3J81 c;  5C4Z A;  4DK1 A;  1VQ7 A;  3BZD B;  2L55 A;  2KCN A;  4NP5 A;  4LF9 Q;  1YIT A;  1KAA A;  4CJ2 C;  1SNC A;  2FJ2 A;  1LT6 D;  4JI4 Q;  3CF5 A;  4XYO A;  1FD7 D;  1RTO A;  1K9M C;  1N36 Q;  4DF7 A;  3GO5 A;  2FHT A;  3TME A;  3CU7 A;  5BN5 A;  1G8Z D;  4GNX C;  4R8N A;  4QIW B;  1Q7Y C;  4BBR H;  3LNN A;  4ILW A;  4ME3 A;  4ABN A;  5C3E B;  3HOZ H;  4M8A A;  1G51 A;  4I7A A;  3M85 A;  3F1Z A;  1WJJ A;  1BCP D;  4C3H B;  4IJL A;  3C1F A;  4OL7 A;  4QF4 A;  4A3B G;  2R3Z A;  3TDQ A;  1Z7T A;  3F2D A;  4A3I G;  4BY7 B;  5FOB B;  3CPW A;  5M3F B;  1PH1 A;  3VYS A;  1XPR A;  1PDQ A;  1EYD A;  2UUB Q;  2HDL A;  5E7N A;  3PF4 A;  1K8M A;  4JV5 Q;  5CV7 A;  4OWT B;  3K80 C;  2DGY A;  1EIY B;  4ZUI A;  4HJA A;  3GTJ H;  3A56 A;  2HHH Q;  4DNR B;  4F87 A;  4R4I A;  3LGJ A;  2V1C C;  1X3F A;  3CCQ A;  1Q1B A;  1O7L A;  3DMU A;  3DXJ C;  1A3U A;  4DR6 L;  1ZYR C;  4DR2 L;  2XSC A;  4IN3 A;  2O4X A;  2B2W C;  2AUK A;  1U4P A;  3T4A C;  3MFG A;  5G3L F;  4A3I H;  1YZ6 A;  2QGQ A;  3K0Y A;  3A5Z B;  5FO7 B;  4OWX B;  4QL5 A;  1DOK A;  5IWA Q;  1K83 H;  1E0B A;  1X9N A;  1YNX A;  2CFM A;  3HEJ A;  4LFA L;  3W2D A;  4Z9C B;  3AQQ A;  4FP5 D;  3HKS A;  1SJH D;  3M4O B;  4CHT B;  3K7A B;  4QGU A;  1R9T B;  1VQ5 A;  4A93 G;  3HOW H;  2F0I A;  4JI6 Q;  3S24 A;  2CKZ B;  3OHX C;  1QB5 D;  3J81 j;  1E22 A;  1EU3 A;  1B3A A;  1NAP A;  5DM6 3;  3R8B A;  2JA7 G;  3EJI A;  1KLU D;  5EPJ A;  4DA2 A;  1HHV A;  2ATW A;  1A2U A;  1XWE A;  2KHS A;  1D1K A;  3I7F A;  1HA6 A;  3MXN B;  2FFK B;  2WV6 D;  4JG2 A;  3W5O A;  4A4I A;  3CD6 A;  1STH A;  1EY0 A;  1E2W A;  4XQN A;  1YEZ A;  1NNX A;  4ID6 A;  1AZQ A;  4HCS A;  1RIP A;  2Z6K A;  1HZA A;  4K14 A;  1PH3 A;  2R61 A;  3OWE B;  2VZA A;  3TBI B;  4C1N K;  5CBE E;  1C9O A;  3MXN A;  1M1K C;  1AW7 A;  5DEH A;  3VR6 A;  4POF A;  2ICE C;  4A3F H;  1G2T A;  2KHI A;  4FF3 A;  1ML0 D;  1VQN A;  1S40 A;  3PIO A;  5IIF A;  4HMJ A;  2IJ0 A;  5GRO A;  1DOM A;  1QNK A;  3I90 A;  1N32 L;  4Q5V A;  1ICF B;  2HUG A;  2CWA A;  1IBM L;  3U4Z A;  5DAU A;  2K5W A;  5EPL A;  4RCN A;  1K8A C;  3S1R B;  1BBX C;  3T1H Q;  4BBS G;  4LMQ D;  1ET6 A;  4FDB A;  3VYR A;  4QUF A;  1PH6 A;  1XNQ L;  3RMH A;  4JI6 L;  1JR0 D;  3CMA A;  3BYY B;  1F9R A;  1LAC A;  4RHR A;  4AQY Q;  3HKZ E;  1NCV A;  1YIJ A;  2K52 A;  3BJU A;  4YHH Q;  4C3I G;  1ZKO A;  5FLX E;  2R93 B;  3GTO B;  5KIX A;  4UP9 A;  4JI1 Q;  4JI1 L;  1LTA D;  1N9W A;  1PFB A;  4KKT A;  5GQO A;  3ERS X;  4OX9 Q;  1T9H A;  3M4Y A;  1X3Q A;  4R1J A;  4ZLT F;  2VUM G;  3VA5 A;  1HUM A;  1L2F A;  1TQO A;  1SFO B;  5C4H A;  2EPB A;  1JWS D;  3H09 A;  5C5L A;  1VQH A;  2AKW B;  1JWM D;  1EFW A;  1STN A;  1CQV A;  1WOC A;  2F0U A;  1GHK A;  4BS9 A;  3KDF B;  4DK6 C;  4C2M B;  4CBV A;  2SNM A;  2ZXO A;  3FDT A;  4XQQ A;  2C35 B;  1XPO A;  3CQZ B;  3ICE A;  2KUM A;  1PH4 A;  5IGG A;  4C1N I;  2D5D A;  3UDX A;  3SDZ A;  2ZM6 Q;  4X65 L;  2QA4 A;  3CQZ H;  1BCP C;  2F4V Q;  1VDZ A;  1TU2 B;  5EPK A;  3VYT A;  1J5E Q;  2EYP A;  4PG3 A;  1DZ1 A;  1PTO C;  1SJE D;  4DAP A;  1QZH A;  2LXK A;  5EKI A;  2UXB Q;  1EQR A;  1HA5 A;  2NZH A;  2F4I A;  3H0G H;  1SDF A;  3SR1 A;  3T56 B;  1YNN D;  5C3E H;  4GLA C;  4BY1 H;  4KHP L;  3KBX A;  1HXY D;  4JW0 A;  3R3O A;  2B8G A;  2UXD L;  3BYT B;  1HH2 P;  1SE3 A;  1TT2 A;  4DXF A;  2AWO A;  2M9V A;  4A3B H;  3RZO B;  2WAQ G;  3Q8D A;  4LK1 C;  4AIM A;  3H3V C;  3QWN A;  2DNC A;  2DJG C;  3T1Y L;  3VR5 A;  1XX8 A;  1DCZ A;  3CCU A;  4OIK A;  3SK6 A;  4RH6 A;  3S15 H;  3DEO A;  2CQO A;  3SXH A;  2JA6 B;  4JBM A;  1H9S A;  1GXD C;  1TS2 A;  1WI5 A;  2BOS A;  4IUU A;  3F2U A;  1TWH H;  1KLG D;  1NJI C;  4ZKB B;  4IQZ A;  1VQ6 A;  5J39 A;  2J7Z A;  3BVG A;  4DV3 Q;  4DV3 L;  1YJN A;  4DR1 Q;  3ULP A;  1IYU A;  2RQX A;  3GTK H;  4OWW B;  1KAW A;  3AYH B;  1X6O A;  3GTO H;  3SVM A;  4X64 L;  4DV4 Q;  1V9P A;  3S1M H;  5EBD A;  1XYI A;  3CME A;  4NXM Q;  5IYC H;  1S5B D;  1HR0 W;  3HOU G;  1SMY D;  3DUZ A;  1QNU A;  5JEA J;  5IWA L;  3MTS A;  1KNE A;  5IYD G;  3HOY H;  3ITP A;  4XT1 B;  1H9K A;  3CCV A;  1A15 A;  2XN9 C;  3ND8 A;  4EQO A;  1H9R A;  4FXD A;  1P16 A;  3D3R A;  2F0V A;  5LMU Q;  3CAM A;  1KRT A;  1PTO F;  2HQL A;  3LWU A;  4A76 A;  3OMC A;  5I6Y A;  3R2T A;  4JYA Q;  1NUC A;  1WTQ A;  1FGB D;  1EWI A;  2EXD A;  3FEW X;  4DR3 L;  4Y7N B;  4IFD I;  5C6A A;  1K3R A;  1VQE A;  4FNF A;  2PZW A;  5ELF A;  4A3L H;  4Y52 H;  1UE7 A;  2K6A A;  4IAL A;  3J81 L;  5C44 G;  1A0I A;  1PMR A;  4M1U B;  2I07 B;  3QB3 A;  2A73 B;  4EGV A;  2ZXR A;  2Q2T A;  3E0J A;  3HOV G;  2A1A A;  1X3P A;  4XDX A;  1JMC A;  2Y0S G;  5KNB A;  1AE2 A;  4A3E G;  3RZO H;  2Q2I A;  5C0X H;  4EVO A;  4WFN 3;  1U4M A;  4YWK A;  4C3H G;  5IY0 A;  5E1F A;  4C3J G;  3H6M A;  3I73 A;  4PMB A;  2A69 C;  3K57 A;  5C3E G;  2EYO A;  4ZAI A;  5LMN Q;  1AZP A;  3I8Z A;  1PFN A;  3GTK B;  1LTI D;  3PF5 A;  1C0A A;  5JVG 3;  2UU9 L;  5IGE A;  1I4P A;  1SRO A;  4R4C A;  3S1M B;  1DOL A;  3FVQ A;  1XNQ Q;  1TS4 A;  4BBR B;  4B3M L;  1HQR D;  3GV6 A;  5GAD C;  1JB3 A;  4ZRZ A;  2WII B;  1KTK A;  3RZD H;  3TSS A;  1CTM A;  3DWA A;  2CH4 A;  3G71 A;  3PV0 A;  1K0S A;  3D4R A;  1IL2 A;  1VQ9 A;  2EY6 A;  4IUT A;  4KV6 A;  5FLM G;  3UDG A;  2O5J C;  5HY6 A;  2FMC A;  2I0Q A;  3HS0 C;  3MA2 B;  4FXK C;  4XTC S;  3WOE A;  1CZG A;  1N32 Q;  1F2Y A;  1S5C D;  3CCJ A;  1PA6 A;  1PFM A;  3KLS A;  1A62 A;  1Q1E A;  2YTY A;  4PV1 C;  3NPP A;  3X3M A;  4A3E H;  4DAV A;  3HOX G;  2R92 B;  3TQY A;  3RN2 A;  3FKI H;  2NUC A;  3TRE A;  3GTG H;  3PQI A;  1YHA A;  2Q8T A;  3HOY B;  3PCO B;  4CKE A;  2DJF C;  2K1B A;  3HKZ B;  5T1G A;  4NKL A;  3R93 A;  1VS0 A;  3F2C A;  4K5X A;  4UPA A;  5KYI A;  1TWC H;  4R4T A;  2NYZ D;  1N34 Q;  1LAB A;  4B3R L;  2JA7 B;  1EOT A;  4RWS C;  2A6H D;  3G7L A;  2PPB C;  2OQ0 A;  2R6G A;  2F03 A;  2L9H A;  1G6Z A;  2EZV A;  4DFA A;  3B6Y A;  1Q8I A;  1X3G A;  1PLF A;  1TS3 A;  1XNR Q;  3JC6 6;  2OXP A;  2QDB A;  1NE3 A;  1VQI A;  1K8G A;  1HRJ A;  3S2D H;  1WD1 A;  1XTC D;  1K0R A;  3I4N G;  2E2I B;  3I55 A;  4J6H A;  4LFC L;  5CMD A;  2I5H A;  4X66 Q;  2QKI C;  3SK4 A;  4ULL A;  2NVQ B;  1PH8 A;  3A5U A;  3AEV A;  4DR5 Q;  3D31 A;  2IW3 A;  3K8A A;  2K32 A;  3A55 A;  2F3W A;  1A63 A;  3BZK A;  3FPU B;  1G91 A;  4JV5 L;  4LF5 L;  4DAY B;  2XRS D;  2IWH A;  1WTX A;  1GD7 A;  1OXS C;  1LTT D;  3TS2 A;  3C46 A;  4PMC A;  1U5K A;  2F0G A;  1EYA A;  1WTW A;  4QQB X;  1Q46 A;  1JOQ A;  3BVM A;  1X3E A;  3VA7 A;  3EQL C;  4R9W A;  3P75 A;  2XRQ D;  4EQP A;  2VQE L;  2DY8 A;  5CYU A;  1V8Q A;  2B3G A;  2MO0 A;  2D0O A;  2F4V L;  3U9O A;  3S14 H;  2EE1 A;  2E2D C;  1KRS A;  2RF4 A;  4UAI A;  2GA4 B;  1HR0 L;  2B2Y A;  4GN4 B;  4S3S A;  1MKH A;  2KEE A;  4R4Q A;  4CGY B;  1BF4 A;  5EBC A;  5LMN W;  4JPB W;  1M8A A;  2F0T A;  2R7Z B;  1V1P A;  4H02 A;  3CCS A;  3M4O H;  4QCL A;  2WB1 B;  1QVG A;  1PH9 A;  4B3R Q;  2ZTC A;  4A3M H;  4RCO A;  1HTP A;  2R92 G;  2G9H D;  2Z6K C;  1OXU A;  1YHQ A;  5JJL A;  3I4M G;  1T5X D;  4A3J B;  3R2I A;  2K4K A;  1TKW B;  4CDF C;  1R9T H;  1PYW D;  1M4V A;  4DK0 A;  1SRU A;  2NVY H;  1EYG A;  1GUG A;  4RMF A;  3Q6S A;  4BY1 G;  3S9W A;  5C3X A;  5IP7 G;  5KRU A;  3H0G G;  1L0Y B;  3BZC A;  1NSN S;  3K5N A;  4L8J A;  3P1H A;  3GTP B;  2XTI A;  1GO3 E;  1QUQ A;  1Y1W G;  4DV1 L;  3ONA B;  1NTG A;  3UDI A;  4U68 A;  2BE5 C;  5IGF A;  2RVL A;  4JI8 Q;  3GDE A;  4B3T L;  5JVH 3;  1ZYR D;  1RF2 D;  1IKM A;  3GV3 A;  2F1M A;  4NMZ A;  1CZW A;  1DGS A;  2G5D A;  1XJV A;  2B2T A;  2PI2 E;  2ZM6 L;  2K05 A;  3CP0 A;  1PVO A;  1VF7 A;  2N49 A;  2E2H H;  2VUM H;  5JOB A;  3URY A;  4HIO A;  4P2C B;  2H4O A;  4GLV B;  4CDD C;  1H9M A;  1NBW A;  5IT9 E;  4YHH L;  2WAQ E;  1LV9 A;  2JYO A;  3BU2 A;  1OXX K;  2JA8 B;  3C2P A;  1BUV T;  4OGQ C;  1XMQ Q;  2JSO A;  5D65 A;  2HIX A;  1I4X A;  4P73 A;  1BVS A;  3J80 c;  1IKL A;  3HOX H;  2UUC Q;  2HCI A;  1SYF A;  2VS1 A;  1K8O A;  2JA5 B;  2A8V A;  2ENB A;  2B8F A;  3KJO A;  5BR8 Q;  1SYD A;  4DV7 Q;  2SEB D;  3NK9 A;  1EQV A;  1VQG A;  5M3M B;  1TWF H;  2IX0 A;  1N36 L;  3NQI A;  2B2T C;  3ZYY X;  3TP8 A;  3M7G A;  2EDG A;  4HED A;  4OON A;  1JQY D;  5IYB G;  1N33 Q;  3MXU A;  4KMU C;  3P20 A;  1JT8 A;  4DV5 Q;  2HT1 A;  3L2P A;  5K36 G;  2BE5 D;  3MFY A;  1I50 B;  4ZYS A;  4DR4 Q;  4A3D G;  2IL8 A;  4K6D A;  3PO2 B;  3V05 A;  5HGT A;  1EY8 A;  3NBH A;  3SK5 A;  2JN4 A;  3S16 H;  1VMC A;  2IT1 A;  1IW7 C;  5FK9 C;  2UUA Q;  4BA1 I;  3C1E A;  5KGU A;  1SR3 A;  4K5V A;  4ZUJ A;  4KY7 A;  4L5Q A;  2PW5 A;  1BO0 A;  3IFT A;  4A3K G;  1GVP A;  3D8G A;  1F9S A;  3MXP A;  4H44 C;  2E2I H;  4TRD A;  4CDE C;  3TP7 A;  1SND A;  4LF7 L;  2Z0S A;  4A3B B;  2NVY B;  3J80 L;  4YCV A;  3S16 B;  4AYB G;  5A2Q L;  1IHZ A;  4C3H H;  4A3G B;  2D2C C;  3H91 A;  4GKK L;  5ELC A;  3PO3 H;  2AHO B;  2H5X A;  2PNH A;  2MO1 A;  1W2B A;  1KDB A;  1QVF A;  3HG9 A;  4A3M G;  2V4D A;  3ND9 A;  1UUP A;  1TY0 A;  3AU7 A;  3KLW A;  1CSQ A;  2UU9 Q;  1EZ8 A;  4LUO A;  3N52 A;  2JXM B;  1SYG A;  4DK3 C;  1VQD A;  2D9U A;  1RL2 A;  2LFN A;  2RDG A;  1Q81 C;  3UI2 A;  3K7U C;  3D4D A;  1SBB B;  2FIN B;  1E24 A;  3ULL A;  1LT3 D;  3ERQ A;  1C48 A;  3LWE A;  4LFA Q;  1YNJ D;  1DYQ A;  4B3T Q;  4IFD J;  4OEM B;  5C44 B;  1EQT A;  4PQX A;  2WKC A;  3QO2 A;  1F2Z A;  2E75 C;  1SEB D;  4C3I B;  1TS5 A;  2E76 C;  5KND A;  2X6G A;  3SE0 A;  1CSP A;  3UDF A;  1LO5 D;  4C56 C;  3RLN A;  1HNZ Q;  1FJG Q;  3Q23 A;  1CFM A;  5EGT A;  1BR9 A;  4LFC Q;  3K5O A;  1HNX L;  1SSO A;  4APV A;  3J80 E;  1DXM A;  4LF6 L;  1TXY A;  5JJI A;  1O7Z A;  3E3X A;  4IOA A;  4QB4 A;  3I4N H;  5JJZ A;  4P71 A;  3OMG A;  1EWH A;  4LF8 L;  2RDF A;  1G6P A;  4AH6 A;  3TS0 A;  4KY5 A;  1WFQ A;  2XNA C;  3DWQ A;  1TR5 A;  1I3Q B;  4GOP A;  5IGB A;  2X69 A;  4HIM A;  5FLX c;  4JI3 Q;  3PGZ A;  2PQA B;  1EUJ A;  1HR0 Q;  5M5Y H;  2CW0 C;  1EY6 A;  4A3F B;  4CDC C;  2F0H A;  2N8N A;  3J81 i;  1Q82 C;  3TEH B;  2J4X A;  2VQE Q;  1QVC A;  4AYB B;  4HR7 B;  3IFD A;  2F0F A;  3EFX D;  1FJG L;  3HOW B;  4G7Z C;  1AN8 A;  4BBR G;  2QEJ C;  3E5S A;  3G48 A;  4MN3 A;  4DR1 L;  1ASZ A;  1Y8P B;  5CGK A;  4GN5 A;  1I6H B;  1UNS A;  1PH5 A;  2UXD Q;  3TP5 A;  4H13 C;  2N55 A;  3KLR A;  4JI4 L;  1CI3 M;  3RNU A;  3TP6 A;  2VB3 X;  1QZG A;  2UUB L;  1B9N A;  1SNM A;  5C4J B;  1KAB A;  1TWA H;  2HHH L;  1I5F A;  3PIP A;  1SE8 A;  4LUV A;  1FR3 A;  2KBN A;  3K6O A;  2OTJ A;  3KFU A;  2XVS A;  5FJ8 H;  1RD9 D;  1PH2 A;  4IZ8 A;  3S1R H;  2F0D A;  4FF2 A;  1VQP A;  2EJF C;  1WCM H;  1KXL A;  3T16 A;  1KL9 A;  4MZ9 A;  3D0F A;  5IT9 c;  4IFD H;  1WD0 A;  3HKZ G;  2KCM A;  2KQ3 A;  3VDY A;  4XYQ A;  4BA2 I;  2AMC B;  1W6J A;  2IPK D;  5M3F G;  2R7D A;  1LTB D;  1VCI A;  4KN4 C;  4IO9 A;  2A69 D;  2QF7 A;  1X65 A;  1EEI D;  2D62 A;  5BR8 L;  4DV7 L;  2LMC B;  2RSO A;  2CH4 W;  1GM5 A;  3STB C;  5JPN C;  1STY A;  1KIX A;  3KUP A;  2TSS A;  2B63 B;  1A6X A;  2NTT A;  3JAM i;  2SOB A;  3U4V A;  1HZC A;  3NXW A;  4OIJ A;  4PMW A;  1KDC A;  3JAM c;  4JI2 L;  3KF8 A;  2VQF L;  1KNA A;  4ME5 A;  3NP8 A;  4YIJ A;  2GN5 A;  4DR4 L;  2KEC A;  1MD2 D;  1AEX A;  4OX9 L;  1EU4 A;  1ICW A;  5LMN L;  1KHI A;  1R4P B;  3BVZ A;  2UUC L;  1J8I A;  1VQF A;  2WAQ B;  4NXN L;  1IBK Q;  3GTG B;  2F0W A;  3CRK C;  1BDO A;  2VL6 A;  1VQO A;  4EQ5 A;  3S17 H;  2PZU A;  4A3K H;  4DU9 A;  2YYZ A;  5JEA G;  4KJO A;  5T1I A;  1B70 B;  3MAQ A;  4BY1 B;  1TWC B;  1Y69 U;  2G9D A;  3KDF A;  4N9T A;  2B39 A;  1MJE A;  1SNP A;  2WIN B;  4XXE A;  4IUP A;  3HFZ B;  2JA6 G;  5I9P A;  2L15 A;  4DUZ Q;  4HJ5 A;  1BBU A;  2Z1C A;  5IP9 H;  3E0E A;  1MSH A;  1YVC A;  3F2B A;  5LMU L;  3WWV A;  5KNC A;  1JOO A;  1DON A;  1RHP A;  4A3J H;  2C9O A;  4MIU A;  4NB3 A;  1RCV D;  3E9H A;  4X6A H;  4A93 B;  4LFB L;  3BDC A;  1WTO A;  2KHJ A;  3RLO A;  4DR3 Q;  1O7I A;  4GOP C;  1LTS D;  1JJG A;  3TZU A;  3HOU B;  4WOR A;  3WOF A;  1Q12 A;  3GTJ B;  3PUZ A;  2Q2H A;  3K5M A;  1KD1 C;  4GKJ Q;  3HZX A;  3QJY A;  4F8M A;  3GTQ B;  3KJP A;  1ESR A;  5EAY A;  1GOZ A;  4AYB E;  1JIC A;  5J3B A;  5LL6 X;  4UY8 C;  2BH2 A;  1U9R A;  3CKI B;  5E3F A;  4X3T A;  4IPC A;  1FNV A;  2JA8 G;  2QEX A;  4A93 H;  2EIF A;  1Y14 B;  1E7Z A;  3NEN A;  3LX0 A;  2A74 C;  1IBL Q;  1MJC A;  2UXC L;  4DR6 Q;  4PZ7 A;  1L0X B;  3A8K E;  2AQ3 B;  1YNJ C;  1WTP A;  2I5L X;  5LHY 1;  3J81 E;  5JPM C;  2DNE A;  3J7Y W;  4DR7 Q;  3L3O C;  4DR7 L;  3FRP B;  4X3U A;  4LF4 Q;  4B08 A;  3IAY A;  3J7A V;  3KOJ A;  1AP0 A;  1CHQ D;  1G29 1;  4JCV E;  3J80 i;  2CW0 D;  3DM1 A;  4JI3 L;  1OO9 B;  3FPP A;  2RCN A;  3PO2 H;  1GUN A;  3NWT A;  2VUM B;  5L37 A;  2JQO A;  2QCP X;  2D0P A;  3U58 A;  2B2Y C;  1MBY A;  1WTV A;  2K33 A;  4HSP A;  2F0K A;  2HD3 A;  4PNY A;  2BDO A;  3ULJ A;  3I2Z A;  3OTO L;  2KEN A;  3K0X A;  3NUC A;  2YU9 H;  2HIV A;  3GTL H;  1PRT C;  1TII D;  4DXG A;  1LTG D;  2JA5 H;  4X66 L;  4LF4 L;  1Y8O B;  3I4M H;  1DJR D;  1NR2 A;  3DM3 A;  4JOI C;  2MFI A;  4R8I A;  4O42 A;  4LF9 L;  1CKO A;  4LF8 Q;  1F77 A;  4RFB A;  2WP8 J;  1XPU A;  1S72 A;  3AFP A;  3N6R A;  4QIW E;  1Q86 C;  1KC8 C;  4TQU S;  1CKM A;  2JE6 I;  2GVA A;  2JA8 H;  1PYS B;  3M7N A;  3TZD A;  1LUZ A;  2HDM A;  3QOJ A;  1IYJ B;  5C0X J;  1CQF A;  1MGS A;  1QOH A;  4XIG S;  3VYU A;  1WYD A;  3DHQ A;  4LAA A;  2NVX H;  3S15 B;  3C3L A;  2K5Q A;  4ALP A;  1O78 A;  5AFW A;  1F2L A;  4DUY Q;  1A3T A;  5FO9 B;  4X62 Q;  1UEB A;  1GKH A;  1FNU A;  2N88 A;  2UXC Q;  1PRT D;  2QIL A;  4UP8 A;  1FNW A;  4X3K A;  2EY5 A;  5F2D A;  5EKK A;  4O2D A;  4FF1 A;  2MGS A;  3I3C A;  4A3J G;  3VR2 A;  1L1O B;  2YTX A;  3MEH A;  1X32 A;  3K7A H;  3STB D;  4DV2 Q;  4WJ3 M;  5IP9 G;  4DGZ A;  5GAH C;  1HJP A;  1M90 C;  5M5X H;  2AUJ D;  3CW2 C;  1HNW Q;  4UDU C;  3KF6 B;  4OO1 G;  1SE4 A;  2RBM A;  2ZTD A;  2ES2 A;  4V0B A;  4QJF A;  2K50 A;  4DKA C;  5AJ3 L;  1ET9 A;  5I6W A;  2VQF Q;  1B3Q A;  5D3I B;  1H95 A;  4A3C H;  3E6Z X;  2MPM A;  4ZCK A;  4CKC A;  1YBY A;  2KCC A;  5COR A;  2LY7 A;  2PNR C;  2K5H A;  4DV0 L;  3T1H L;  5C4X B;  1S5D D;  1EIG A;  2EVB A;  1D8L A;  2F3V A;  1BQQ T;  1HFG A;  2F0M A;  3PUV A;  3CCE A;  5IYB H;  2M2L A;  4WRD A;  2BH8 A;  2RCF A;  2IHF A;  3OYY A;  4V19 0;  4FYD A;  4GZY C;  1ZEQ X;  2NN6 H;  3L7Z C;  4K5W A;  1JE5 A;  4POG A;  5ELN A;  3CC4 A;  2BA0 A;  4GN3 B;  5CV8 A;  4PZ6 A;  1WTR A;  2KVM A;  5I9O A;  1PFS A;  2K5V A;  4JI2 Q;  4EX5 A;  1EY5 A;  4HAE A;  3HOW G;  2E5L Q;  4J8Q A;  4DUZ L;  2F0E A;  2WKD A;  3SGI A;  4JBK A;  3OSO A;  2O2L D;  3PO3 B;  3A8J E;  1QWY A;  1I6H H;  1GUO A;  1LYL A;  5CBA E;  2E74 C;  4CJ0 B;  4TKO B;  2QW7 A;  2GVB A;  4LNQ A;  4QMG A;  4MHE A;  2JA5 G;  5ELE A;  1S5E D;  4CKB A;  3EBE A;  1RKN A;  2Z8L A;  1PXU A;  1D5X C;  4JI8 L;  1FVI A;  4B3M Q;  1ENA A;  2XIW A;  3FP9 A;  1YJ9 A;  4IFD G;  4RGM A;  2L0C A;  2JEB I;  1II3 A;  2ZT9 C;  4N8F A;  1EY9 A;  2NVQ H;  2EOT A;  1LT5 D;  3Q22 A;  4TSS A;  5C3W A;  3OWF A;  2OF1 A;  1OXV A;  2WFW A;  1GUW A;  4R4O A;  1B50 A;  1SFO H;  2AQ2 B;  2PQA A;  2K5N A;  2R7Z H;  3BDO A;  2PYK A;  1Y1W H;  3PO2 G;  4A3G H;  3G6E A;  1C8C A;  2QDL A;  4DV0 Q;  5BN4 A;  2A68 C;  2K04 A;  2Y0S B;  2Q8I B;  4C2M H;  1Q90 A;  5IP7 H;  2NZ1 D;  4G7O C;  1U4L A;  2RSN A;  4HIK A;  4OO1 I;  2FXQ A;  5IOD A;  3L9A X;  4DV6 L;  1EFI D;  1X54 A;  3MWY W;  4RA8 A;  4A3K B;  1P8L A;  4IPH A;  3I91 A;  5G3L D;  2B2U C;  4QUC A;  2Q8R E;  3I56 A;  2R92 H;  1PZI D;  3T53 B;  3FKI B;  5FKA C;  1Q3L A;  3HOZ G;  3I72 A;  1D1I A;  1KQS A;  5IT9 L;  1PRT F;  2L1B A;  4K6L A;  4B9X A;  3CCM A;  1LTL A;  1V43 A;  2F52 A;  5A2Q E;  4JOI A;  3M4P A;  4IPD A;  1HCZ A;  1ZXT A;  1UE1 A;  5IGD A;  1QG7 A;  5JAV A;  1RJT A;  4ZKC B;  1RDP D;  4B3S L;  5JJK A;  2BDN A;  1KDA A;  3GD7 A;  3I4O A;  2R7F A;  2PO4 A;  1VQL A;  5COY A;  2BA1 A;  1CUK A;  4BXX G;  2NWG A;  2PMZ E;  1HNX Q;  3MVV A;  4K8I A;  1YHB A;  4JI7 Q;  3S1Q H;  3HOY G;  4J15 A;  2VNU D;  1JOK A;  4G4K A;  2CHB D;  1V1P B;  2B2V C;  2MQH A;  1U0L A;  3MC0 B;  1SNQ A;  1Z6H A;  2NVT H;  1JC7 A;  1LT4 D;  4LW1 A;  1JE4 A;  2TMP A;  1SNO A;  1XTD A;  2NBF A;  4DAY A;  3HOX B;  2F0S A;  4G7H C;  2OWO A;  5E4W C;  1I50 H;  3ZJY C;  3NEM A;  5DLQ E;  4YWM A;  3VR3 A;  3S17 B;  2RA4 A;  2NVX B;  1I4G A;  2NB0 A;  1I6V C;  4MTK A;  4U67 3;  3G4S A;  3GTM H;  1R4Q B;  4DR5 L;  1WCM B;  1BOS A;  2JEA I;  2A6E C;  1MIU A;  1VQB A;  1YJW A;  4IUN A;  4OHJ A;  4B9W A;  5TSS A;  3PUX A;  1EYC A;  4L5R C;  1T5E A;  4BY7 H;  4MTN A;  3RR5 A;  1I4R A;  4NXN Q;  4DV6 Q;  1H9J A;  4XQJ A;  2FMM A;  1CKN B;  3GP7 A;  5C4J H;  2Z9H A;  1N34 L;  3I4N B;  1XMO Q;  2J0T D;  1J6Q A;  2OT2 A;  3OW2 A;  3HGB A;  5BN3 A;  2DUD A;  2PI2 A;  2PQE A;  1SXT A;  4E6I A;  4RG1 A;  5A35 A;  2YU9 B;  1AE3 A;  2MNA A;  3H0G B;  4FVM A;  5AJ3 Q;  4MNO A;  2A6E D;  3V96 A;  3S1N H;  1F2M A;  4KK7 A;  1BCP F;  2F0Q A;  4A3G G;  4CJ1 B;  2Q2U A;  1V1Q A;  4F7X A;  3CCL A;  1JB7 A;  2R7Z G;  1CT1 D;  2WB1 G;  1WCM G;  4A3M B;  2DY7 A;  4A3D H;  3HP3 A;  3IL8 A;  2KA7 A;  2ASB A;  3S2D B;  5K36 H;  1STB A;  3CCR A;  2Z4H A;  4K8J A;  5EQ0 A;  1IL8 A;  4H0L C;  1B9M A;  3AMU A;  4DNI A;  1B4O A;  3AB9 A;  2AWN A;  4DV5 L;  4GKK Q;  4F88 A;  1XMQ L;  1A8V A;  2E5L L;  4JC0 A;  3BG3 A;  4KY6 A;  4O1N A;  4NPS A;  4JI5 Q;  3MHB A;  4C3J H;  2JJQ A;  3A7L A;  1JCK B;  4RHS A;  4C3I H;  1IXR A;  5IOC A;  3A0J A;  4YY3 Q;  4YY3 L;  2OTL A;  3RLF A;  1XXG A;  4KKS A;  1JJ2 A;  1X56 A;  3L0O A;  4OEL B;  4HID A;  4HJ8 A;  4KLK A;  2N78 A;  3OW7 A;  3M3Y H;  1ESF A;  3H94 A;  4JBW A;  1VQ4 A;  5M3M G;  3HRZ C;  1N33 L;  1Z9F A;  3J7Z C;  2ZJP A;  4BY7 G;  2EJG C;  1ILP A;  2WB1 E;  3RUZ A;  3S1Q B;  2R93 H;  3IRB A;  3OIP A;  1HFN A;  1HQM C;  2PZT A;  2LS0 1;  1Y1V H;  1EIH A;  2F0O A;  3S14 B;  5FO8 B;  1PTO B;  2KCT A;  3GTQ H;  2EXZ A;  2F0J A;  4ODG A;  1E3P A;  3IKJ A;  2PMZ B;  2ALY B;  5H1S E;  4KD3 A;  3OOC A;  3NTI A;  2OQK A;  3UE0 A;  1ILQ A;  4TVA B;  4A75 A;  1QIL A;  4FO2 A;  4A3F G;  4JK1 C;  3P7J A;  1EIF A;  4PZ8 A;  3CC2 A;  3S2H B;  3EIV A;  3QR8 A;  1DM0 B;  3HOV B;  4G57 A;  4BBS B;  1ROD A;  4IJH A;  4QY7 A;  3NHH A;  1SLJ A;  3K81 C;  2B63 H;  5IYC G;  2X6L A;  3K59 A;  3H3V H;  4J1M A;  1VQA A;  3NQT A;  1PTO D;  1O80 A;  2B2W A;  1FL0 A;  5I4D A;  2K01 A;  4K0K L;  1Y8N B;  2RHS B;  3D4W A;  4WJW A;  4C3J B;  2K14 A;  1AFP A;  4RGN A;  3OTO Q;  1A2T A;  4A3D B;  1WVL A;  1LM0 A;  1GUS A;  2JA7 H;  5GAG C;  1EL0 A;  5FLX L;  2A68 D;  2RHQ B;  3A54 A;  1BCP B;  1E2V A;  1TWF B;  4IUV A;  1CHP D;  2K7V A;  1L1O A;  5DM7 3;  5M5W H;  5CV4 A;  4L63 B;  1D5Z C;  3X3N A;  5IE8 A;  3T1Y Q;  3EN2 A;  5GAE C;  3QIA A;  5C4X H;  1B44 D;  4JI0 Q;  4JI0 L; 
#chains in the Genus database with same CATH homology
 1BNZ A;  1EZ6 A;  1D6E C;  3DWP A;  4KHZ A;  3A7A B;  3GQB A;  4ZK9 B;  3M3Y B;  5CV9 A;  2CVR A;  3DEP A;  4EQN A;  2MUY A;  3NTK A;  5M5X B;  4KD4 A;  3NTH A;  3NBI A;  4RGO S;  2Z4I A;  4KN7 C;  1IYV A;  1K83 B;  3W3A A;  4K2K A;  3PIP 3;  3Q24 A;  1UAP A;  2SDF A;  2A6H C;  1TWH B;  4HSV A;  3KK7 A;  5EJW A;  4K2L A;  3QOL A;  1JWU D;  3VR4 A;  2E2J B;  3RD4 A;  2EY2 A;  2K28 A;  3OPO A;  5M9O A;  4H7B A;  4RKB A;  2EYF A;  1HTL D;  5E4X A;  5IGC A;  1A3V A;  4RKL A;  1LTR D;  2PW7 A;  3NSW A;  4HN7 A;  3KLS X;  5EKL A;  4FXG C;  1IW7 D;  2RDH A;  4DNT B;  3NE5 B;  1ONL A;  2MP1 A;  2O5I C;  2F0P A;  3I4L A;  1SAP A;  5DNF A;  3GTL B;  3Q0A A;  4RGT A;  5K5P A;  2A5H A;  4LJZ C;  2LKV A;  5M5Y B;  3WDN A;  1B1Z A;  3D6C A;  5M5W B;  5C0X I;  1F9P A;  2IX3 A;  1EY7 A;  1SE2 A;  3I4M B;  2B2V A;  1ENC A;  1CA6 A;  1BXT A;  5LL6 S;  3HOZ B;  4OO1 H;  4HCE A;  5CV6 A;  4NW2 A;  1C4Q A;  1F9Q A;  1UEA B;  2L12 A;  1PRT B;  5JEA H;  2SNS A;  2JP1 A;  3BS1 A;  2EY1 A;  1V1O A;  2EYM A;  4KJN A;  1MI2 A;  2OEO A;  3O13 A;  2ICI A;  1TWG B;  2MHV A;  1QCB D;  3K5L A;  1EWC A;  3BDL A;  3PUY A;  2MJ8 A;  1VMP A;  1HUN A;  3FMC A;  1GHJ A;  3K58 A;  2L11 A;  4HTH A;  4IUQ A;  1YNN C;  1CM9 A;  1STA A;  3SK8 A;  1STG A;  3PIO 3;  1CK1 A;  1EY4 A;  2ZXP A;  4N9P A;  5C5M A;  1H9S B;  2H1E A;  1G2S A;  5I2Y A;  2HCC A;  1I4Q A;  2F0L A;  1SYC A;  2WAC A;  1Z47 A;  1CA5 A;  1PZK D;  3I70 A;  4HMI A;  4KKU A;  4L6T B;  2K03 A;  1NR4 A;  3GTM B;  3SHL A;  4DN4 M;  4KTA A;  3SEB A;  2K5D A;  1E2Z A;  2VB2 X;  3S1N B;  3G6J B;  1S5F D;  4ZQ3 A;  1FYC A;  2VXW A;  2NN6 I;  2KOL A;  3T13 A;  1HPC A;  1S4Z A;  2BCO A;  5CV5 A;  1GUT A;  3JAM L;  2KED A;  3NWS A;  2HQE A;  3MZ5 A;  4Q0F A;  1QE6 A;  2ID0 A;  4I65 A;  3CHB D;  5J1Z A;  3U9S A;  2M00 A;  1JOR A;  3TN2 A;  1O7Y A;  1D5M C;  5KEE A;  3RZD B;  2L4N A;  2PCF B;  1PZJ D;  5D3D A;  3EVQ A;  3A8I E;  5KYL A;  3T51 B;  3QG1 A;  2XWB B;  2I46 A;  4BWG B;  1J9O A;  2IX1 A;  3J7A F;  2B2U A;  3ERO A;  2XWJ B;  4NDX A;  1TWA B;  5J22 A;  2DN8 A;  5ELB A;  1LLR D;  3OIQ A;  5ELD A;  2E2H B;  1ENF A;  5CC4 A;  3JAM E;  5HUR A;  1OXT A;  1U4R A;  1SYB A;  3PMF A;  1Y1W B;  5C0X G;  2KJX A;  3KBG A;  2C5C A;  1PTO H;  2CQA A;  1VF5 C;  1B2T A;  2L5T A;  1B53 A;  1Y1V B;  1GJX A;  1EEF D;  2NN6 G;  2NTS A;  2EYJ A;  1STE A;  4RAU C;  5D14 A;  5I2X A;  5ISR A;  3CRL C;  2EYL A;  2EJM A;  4IUR A;  2NVT B;  2RKS A;  3EA6 A;  4I7Z C;  4A3I B;  2AQ1 B;  1MSG A;  4KHV A;  1DD2 A;  1I4H A;  4X3S A;  3MXG A;  4XT3 B;  4KI0 A;  5NUC A;  5CR3 A;  3PUW A;  1RTN A;  2F0N A;  1TY2 A;  1W6K A;  1SYE A;  1TVX A;  4A3E B;  4FF4 A;  3D6W A;  1SMY C;  3V2T A;  1D2B A;  1QJO A;  2EYH A;  5C4Z A;  4DK1 A;  3BZD B;  2L55 A;  2KCN A;  4NP5 A;  1KAA A;  4CJ2 C;  1SNC A;  2FJ2 A;  1LT6 D;  4XYO A;  1FD7 D;  1RTO A;  4DF7 A;  3GO5 A;  2FHT A;  3TME A;  3CU7 A;  5BN5 A;  1G8Z D;  4R8N A;  4QIW B;  3LNN A;  4ILW A;  4ABN A;  5C3E B;  4M8A A;  3M85 A;  1BCP D;  4C3H B;  3C1F A;  4OL7 A;  4QF4 A;  2R3Z A;  3TDQ A;  1Z7T A;  4BY7 B;  5FOB B;  5M3F B;  3VYS A;  1PDQ A;  1EYD A;  2HDL A;  1K8M A;  5CV7 A;  4ZUI A;  3A56 A;  4DNR B;  4F87 A;  1Q1B A;  1O7L A;  3DMU A;  3DXJ C;  1A3U A;  1ZYR C;  2XSC A;  4IN3 A;  2O4X A;  2B2W C;  2AUK A;  1U4P A;  3T4A C;  3MFG A;  5G3L F;  3K0Y A;  5FO7 B;  1DOK A;  1E0B A;  3HEJ A;  3W2D A;  4Z9C B;  4FP5 D;  1SJH D;  3M4O B;  4CHT B;  3K7A B;  1R9T B;  2F0I A;  3OHX C;  1QB5 D;  1EU3 A;  1B3A A;  1NAP A;  5DM6 3;  3R8B A;  3EJI A;  1KLU D;  5EPJ A;  4DA2 A;  1HHV A;  1A2U A;  1XWE A;  2KHS A;  1D1K A;  1HA6 A;  2FFK B;  2WV6 D;  1STH A;  1EY0 A;  1E2W A;  4XQN A;  4ID6 A;  1AZQ A;  4HCS A;  4K14 A;  2R61 A;  3OWE B;  3TBI B;  4C1N K;  5CBE E;  3MXN A;  1AW7 A;  5DEH A;  3VR6 A;  2ICE C;  1G2T A;  4FF3 A;  1ML0 D;  5IIF A;  4HMJ A;  2IJ0 A;  1DOM A;  1QNK A;  3I90 A;  4Q5V A;  2HUG A;  5DAU A;  2K5W A;  5EPL A;  4RCN A;  3S1R B;  1BBX C;  4LMQ D;  1ET6 A;  3VYR A;  4QUF A;  3RMH A;  1JR0 D;  3BYY B;  1F9R A;  1LAC A;  4RHR A;  1NCV A;  4C3I G;  1ZKO A;  5FLX E;  2R93 B;  3GTO B;  5KIX A;  1LTA D;  1PFB A;  4KKT A;  3M4Y A;  1X3Q A;  4ZLT F;  3VA5 A;  1HUM A;  1TQO A;  1SFO B;  5C4H A;  2EPB A;  1JWS D;  3H09 A;  5C5L A;  1JWM D;  1STN A;  1CQV A;  2F0U A;  1GHK A;  4BS9 A;  4C2M B;  4CBV A;  2SNM A;  2ZXO A;  3FDT A;  4XQQ A;  3CQZ B;  2KUM A;  5IGG A;  4C1N I;  2D5D A;  3SDZ A;  1BCP C;  1VDZ A;  1TU2 B;  5EPK A;  3VYT A;  2EYP A;  1DZ1 A;  1PTO C;  1SJE D;  4DAP A;  5EKI A;  1HA5 A;  2F4I A;  1SDF A;  3SR1 A;  3T56 B;  1YNN D;  3KBX A;  1HXY D;  3R3O A;  2B8G A;  3BYT B;  1SE3 A;  1TT2 A;  4DXF A;  2AWO A;  2M9V A;  3RZO B;  4LK1 C;  3H3V C;  3QWN A;  2DNC A;  3VR5 A;  1XX8 A;  1DCZ A;  4OIK A;  3SK6 A;  4RH6 A;  3DEO A;  3SXH A;  2JA6 B;  1H9S A;  1GXD C;  1TS2 A;  2BOS A;  4IUU A;  3F2U A;  1KLG D;  4ZKB B;  4IQZ A;  5J39 A;  2J7Z A;  3BVG A;  1IYU A;  2RQX A;  3SVM A;  5EBD A;  1XYI A;  1S5B D;  1SMY D;  3DUZ A;  1QNU A;  5JEA J;  3MTS A;  1KNE A;  3ITP A;  4XT1 B;  1H9K A;  1A15 A;  2XN9 C;  3ND8 A;  4EQO A;  1H9R A;  4FXD A;  3D3R A;  2F0V A;  1PTO F;  3LWU A;  3OMC A;  5I6Y A;  3R2T A;  1NUC A;  1WTQ A;  1FGB D;  3FEW X;  4Y7N B;  4IFD I;  5C6A A;  4FNF A;  2PZW A;  5ELF A;  2K6A A;  4IAL A;  3J81 L;  1PMR A;  4M1U B;  2I07 B;  3QB3 A;  2A73 B;  4EGV A;  2ZXR A;  3E0J A;  1X3P A;  4XDX A;  5KNB A;  5C0X H;  4EVO A;  4WFN 3;  1U4M A;  4C3H G;  5E1F A;  4C3J G;  3H6M A;  3I73 A;  4PMB A;  2A69 C;  3K57 A;  2EYO A;  4ZAI A;  1AZP A;  3I8Z A;  1PFN A;  3GTK B;  1LTI D;  5JVG 3;  5IGE A;  1I4P A;  3S1M B;  1DOL A;  3FVQ A;  1TS4 A;  4BBR B;  1HQR D;  3GV6 A;  1JB3 A;  4ZRZ A;  2WII B;  1KTK A;  3TSS A;  1CTM A;  3DWA A;  3PV0 A;  3D4R A;  2EY6 A;  4IUT A;  4KV6 A;  2O5J C;  2FMC A;  3HS0 C;  3MA2 B;  4FXK C;  4XTC S;  3WOE A;  1CZG A;  1F2Y A;  1S5C D;  1PFM A;  3KLS A;  1Q1E A;  4PV1 C;  3X3M A;  3NPP A;  2R92 B;  4DAV A;  2NUC A;  2Q8T A;  3HOY B;  4CKE A;  2K1B A;  3HKZ B;  5T1G A;  4NKL A;  3R93 A;  4K5X A;  5KYI A;  2NYZ D;  1LAB A;  2JA7 B;  1EOT A;  4RWS C;  2A6H D;  3G7L A;  2PPB C;  2R6G A;  2F03 A;  2L9H A;  1G6Z A;  2EZV A;  4DFA A;  1Q8I A;  1PLF A;  1TS3 A;  2OXP A;  2QDB A;  1HRJ A;  1WD1 A;  1XTC D;  2E2I B;  4J6H A;  5CMD A;  2QKI C;  3SK4 A;  4ULL A;  2NVQ B;  3D31 A;  2IW3 A;  2K32 A;  3A55 A;  2F3W A;  3FPU B;  1G91 A;  2XRS D;  2IWH A;  1WTX A;  1OXS C;  1LTT D;  3C46 A;  4PMC A;  2F0G A;  1EYA A;  1WTW A;  1JOQ A;  3BVM A;  3VA7 A;  3EQL C;  4R9W A;  3P75 A;  2XRQ D;  4EQP A;  2DY8 A;  5CYU A;  1V8Q A;  3U9O A;  2EE1 A;  2E2D C;  4UAI A;  2GA4 B;  2B2Y A;  4S3S A;  2KEE A;  4CGY B;  1BF4 A;  5EBC A;  1M8A A;  2F0T A;  2R7Z B;  1V1P A;  4QCL A;  2WB1 B;  4RCO A;  1HTP A;  2G9H D;  1OXU A;  1T5X D;  4A3J B;  3R2I A;  1TKW B;  1PYW D;  1M4V A;  4DK0 A;  1GUG A;  3Q6S A;  3S9W A;  5C3X A;  5KRU A;  1L0Y B;  1NSN S;  3K5N A;  4L8J A;  3P1H A;  3GTP B;  3ONA B;  4U68 A;  2BE5 C;  5IGF A;  2RVL A;  5JVH 3;  1ZYR D;  1RF2 D;  1IKM A;  3GV3 A;  2F1M A;  4NMZ A;  1CZW A;  2B2T A;  2K05 A;  1VF7 A;  5JOB A;  3URY A;  4P2C B;  2H4O A;  1H9M A;  5IT9 E;  1LV9 A;  2JYO A;  1OXX K;  2JA8 B;  3C2P A;  1BUV T;  4OGQ C;  2JSO A;  5D65 A;  1I4X A;  1IKL A;  2HCI A;  1SYF A;  1K8O A;  2JA5 B;  2ENB A;  2B8F A;  1SYD A;  2SEB D;  3NK9 A;  1EQV A;  5M3M B;  2IX0 A;  3NQI A;  2B2T C;  3ZYY X;  3TP8 A;  3M7G A;  2EDG A;  4HED A;  1JQY D;  3MXU A;  4KMU C;  3P20 A;  5K36 G;  2BE5 D;  3MFY A;  1I50 B;  4ZYS A;  2IL8 A;  4K6D A;  3PO2 B;  3V05 A;  5HGT A;  1EY8 A;  3NBH A;  3SK5 A;  1VMC A;  2IT1 A;  1IW7 C;  5FK9 C;  4BA1 I;  3C1E A;  5KGU A;  4K5V A;  4ZUJ A;  4KY7 A;  2PW5 A;  1BO0 A;  3IFT A;  3D8G A;  1F9S A;  3MXP A;  4H44 C;  4TRD A;  3TP7 A;  1SND A;  4A3B B;  2NVY B;  3J80 L;  3S16 B;  5A2Q L;  1IHZ A;  4A3G B;  2D2C C;  3H91 A;  5ELC A;  1KDB A;  3HG9 A;  2V4D A;  3ND9 A;  1UUP A;  1TY0 A;  3AU7 A;  1EZ8 A;  3N52 A;  2JXM B;  1SYG A;  2D9U A;  2LFN A;  2RDG A;  3UI2 A;  3D4D A;  1SBB B;  2FIN B;  1LT3 D;  3ERQ A;  1C48 A;  3LWE A;  1YNJ D;  1DYQ A;  4IFD J;  5C44 B;  1EQT A;  4PQX A;  2WKC A;  3QO2 A;  1F2Z A;  2E75 C;  1SEB D;  4C3I B;  1TS5 A;  2E76 C;  5KND A;  2X6G A;  3SE0 A;  1LO5 D;  4C56 C;  3Q23 A;  1CFM A;  5EGT A;  1BR9 A;  3K5O A;  1SSO A;  3J80 E;  1DXM A;  1O7Z A;  4QB4 A;  5JJZ A;  3OMG A;  1EWH A;  2RDF A;  4KY5 A;  2XNA C;  3DWQ A;  1TR5 A;  1I3Q B;  5IGB A;  2X69 A;  2CW0 C;  1EY6 A;  4A3F B;  2F0H A;  2J4X A;  4AYB B;  4HR7 B;  3IFD A;  2F0F A;  3EFX D;  3HOW B;  4G7Z C;  1AN8 A;  2QEJ C;  3E5S A;  4MN3 A;  1Y8P B;  5CGK A;  1I6H B;  1UNS A;  3TP5 A;  4H13 C;  2N55 A;  3KLR A;  1CI3 M;  3TP6 A;  2VB3 X;  1B9N A;  1SNM A;  5C4J B;  1KAB A;  1FR3 A;  3K6O A;  2XVS A;  1RD9 D;  4IZ8 A;  2F0D A;  4FF2 A;  2EJF C;  3T16 A;  4IFD H;  1WD0 A;  2KQ3 A;  4XYQ A;  4BA2 I;  1W6J A;  2IPK D;  1LTB D;  1VCI A;  4KN4 C;  2A69 D;  2QF7 A;  1EEI D;  2D62 A;  2LMC B;  2RSO A;  5JPN C;  1STY A;  3KUP A;  2TSS A;  2B63 B;  1A6X A;  2NTT A;  2SOB A;  3NXW A;  4OIJ A;  4PMW A;  1KDC A;  3KF8 A;  1KNA A;  4ME5 A;  3NP8 A;  4YIJ A;  2KEC A;  1MD2 D;  1AEX A;  1EU4 A;  1ICW A;  1R4P B;  3BVZ A;  1J8I A;  2WAQ B;  3GTG B;  2F0W A;  3CRK C;  1BDO A;  2PZU A;  4DU9 A;  2YYZ A;  5JEA G;  4KJO A;  5T1I A;  3MAQ A;  4BY1 B;  1TWC B;  1Y69 U;  2G9D A;  4N9T A;  2B39 A;  1SNP A;  2WIN B;  4XXE A;  4IUP A;  5I9P A;  2Z1C A;  1MSH A;  5KNC A;  1JOO A;  1DON A;  1RHP A;  2C9O A;  4MIU A;  1RCV D;  4A93 B;  3BDC A;  1WTO A;  1LTS D;  3TZU A;  3HOU B;  4WOR A;  3WOF A;  1Q12 A;  3GTJ B;  3PUZ A;  3K5M A;  3HZX A;  3QJY A;  4F8M A;  3GTQ B;  1ESR A;  1GOZ A;  1JIC A;  5LL6 X;  1U9R A;  3CKI B;  5E3F A;  4X3T A;  1FNV A;  3LX0 A;  2A74 C;  1L0X B;  3A8K E;  1WTP A;  2AQ3 B;  1YNJ C;  5LHY 1;  3J81 E;  5JPM C;  2DNE A;  3J7Y W;  3L3O C;  3FRP B;  4X3U A;  4B08 A;  3IAY A;  3J7A V;  1AP0 A;  1CHQ D;  1G29 1;  2CW0 D;  3DM1 A;  1OO9 B;  3FPP A;  1GUN A;  3NWT A;  2VUM B;  2QCP X;  2B2Y C;  1MBY A;  1WTV A;  2K33 A;  4HSP A;  2F0K A;  4PNY A;  2BDO A;  3NUC A;  1PRT C;  1TII D;  4DXG A;  1LTG D;  1Y8O B;  1DJR D;  1NR2 A;  4R8I A;  4O42 A;  1F77 A;  4RFB A;  2WP8 J;  3N6R A;  4TQU S;  2JE6 I;  3M7N A;  3TZD A;  2HDM A;  3QOJ A;  5C0X J;  1CQF A;  1MGS A;  1QOH A;  4XIG S;  3VYU A;  3DHQ A;  4LAA A;  3S15 B;  3C3L A;  2K5Q A;  1O78 A;  5AFW A;  1F2L A;  1A3T A;  5FO9 B;  1FNU A;  2N88 A;  1PRT D;  2QIL A;  4X3K A;  1FNW A;  2EY5 A;  5F2D A;  5EKK A;  4FF1 A;  2MGS A;  3I3C A;  3VR2 A;  3MEH A;  1X32 A;  4DGZ A;  2AUJ D;  4UDU C;  4OO1 G;  1SE4 A;  2RBM A;  4V0B A;  1ET9 A;  5I6W A;  5D3I B;  3E6Z X;  2MPM A;  4CKC A;  2KCC A;  5COR A;  2LY7 A;  2PNR C;  5C4X B;  1S5D D;  1EIG A;  2EVB A;  2F3V A;  1BQQ T;  1HFG A;  2F0M A;  3PUV A;  2M2L A;  4WRD A;  4V19 0;  4FYD A;  4GZY C;  1ZEQ X;  2NN6 H;  3L7Z C;  4K5W A;  2BA0 A;  5CV8 A;  1WTR A;  2KVM A;  5I9O A;  1EY5 A;  4HAE A;  4J8Q A;  2F0E A;  2WKD A;  3OSO A;  2O2L D;  3PO3 B;  3A8J E;  1QWY A;  1GUO A;  5CBA E;  2E74 C;  4CJ0 B;  4TKO B;  4QMG A;  4MHE A;  5ELE A;  1S5E D;  4CKB A;  1RKN A;  2Z8L A;  1PXU A;  1D5X C;  1ENA A;  2XIW A;  4IFD G;  4RGM A;  2L0C A;  2JEB I;  1II3 A;  2ZT9 C;  1EY9 A;  2EOT A;  1LT5 D;  3Q22 A;  4TSS A;  5C3W A;  3OWF A;  2OF1 A;  1OXV A;  1GUW A;  1B50 A;  2AQ2 B;  3BDO A;  2PYK A;  1C8C A;  5BN4 A;  2A68 C;  2K04 A;  2Y0S B;  2Q8I B;  1Q90 A;  2NZ1 D;  4G7O C;  1U4L A;  2RSN A;  4OO1 I;  5IOD A;  3L9A X;  1EFI D;  4RA8 A;  3MWY W;  4A3K B;  3I91 A;  5G3L D;  2B2U C;  4QUC A;  2Q8R E;  1PZI D;  3T53 B;  3FKI B;  5FKA C;  1Q3L A;  3I72 A;  1D1I A;  5IT9 L;  1PRT F;  2L1B A;  4K6L A;  4B9X A;  1V43 A;  5A2Q E;  1HCZ A;  1ZXT A;  5IGD A;  1QG7 A;  5JAV A;  1RJT A;  4ZKC B;  1RDP D;  2BDN A;  1KDA A;  3GD7 A;  2PO4 A;  5COY A;  2BA1 A;  2NWG A;  3MVV A;  4K8I A;  2VNU D;  1JOK A;  4G4K A;  2CHB D;  1V1P B;  2B2V C;  3MC0 B;  1SNQ A;  1Z6H A;  1JC7 A;  1LT4 D;  1JE4 A;  2TMP A;  1SNO A;  2NBF A;  4DAY A;  3HOX B;  2F0S A;  4G7H C;  5E4W C;  3VR3 A;  3S17 B;  2RA4 A;  2NVX B;  1I4G A;  2NB0 A;  1I6V C;  4U67 3;  1R4Q B;  1WCM B;  1BOS A;  2JEA I;  2A6E C;  4IUN A;  4OHJ A;  4B9W A;  5TSS A;  3PUX A;  1EYC A;  1T5E A;  1I4R A;  1H9J A;  4XQJ A;  2FMM A;  3GP7 A;  3I4N B;  2J0T D;  2OT2 A;  3HGB A;  5BN3 A;  2PQE A;  1SXT A;  4E6I A;  5A35 A;  2YU9 B;  3H0G B;  4FVM A;  2A6E D;  3V96 A;  1F2M A;  4KK7 A;  1BCP F;  2F0Q A;  4CJ1 B;  4F7X A;  1CT1 D;  4A3M B;  2DY7 A;  3HP3 A;  3IL8 A;  2KA7 A;  5K36 H;  3S2D B;  1STB A;  2Z4H A;  4K8J A;  5EQ0 A;  1IL8 A;  4H0L C;  1B9M A;  3AMU A;  1B4O A;  3AB9 A;  2AWN A;  4F88 A;  3BG3 A;  4KY6 A;  4O1N A;  3MHB A;  3A7L A;  1JCK B;  4RHS A;  5IOC A;  3RLF A;  1XXG A;  4KKS A;  3OW7 A;  1ESF A;  3H94 A;  4JBW A;  3HRZ C;  2EJG C;  1ILP A;  3RUZ A;  3S1Q B;  3OIP A;  1HFN A;  1HQM C;  2PZT A;  2LS0 1;  1EIH A;  2F0O A;  3S14 B;  5FO8 B;  1PTO B;  2EXZ A;  2F0J A;  4ODG A;  3IKJ A;  2PMZ B;  4KD3 A;  3OOC A;  3NTI A;  1ILQ A;  1QIL A;  4FO2 A;  4JK1 C;  3P7J A;  3S2H B;  3HOV B;  1DM0 B;  4G57 A;  4BBS B;  1ROD A;  3NHH A;  2X6L A;  3K59 A;  4J1M A;  3NQT A;  1PTO D;  1O80 A;  2B2W A;  5I4D A;  2K01 A;  1Y8N B;  3D4W A;  4WJW A;  4C3J B;  1AFP A;  4RGN A;  1A2T A;  4A3D B;  1WVL A;  1GUS A;  1EL0 A;  5FLX L;  2A68 D;  3A54 A;  1BCP B;  1E2V A;  1TWF B;  4IUV A;  1CHP D;  2K7V A;  5DM7 3;  5CV4 A;  4L63 B;  1D5Z C;  3X3N A;  3QIA A;  1B44 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...