1MD3A

A folding mutant of human class pi glutathione transferase, created by mutating glycine 146 of the wild-type protein to alanine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
208
structure length
208
Chain Sequence
b'PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVADQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pi glutathione transferase
publication title Contribution of Glycine 146 to a Conserved Folding Module Affecting Stability and Refolding of Human Glutathione Transferase P1-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1md3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1md3A01
5F07A 2L57A 3HYPA 4MZCA 1GSEA 1GTIA 2HSHA 4Q5QA 4HU7A 1SENA 2K18A 1ZOFA 2FA4A 5CRHA 2A2RA 1XWAA 3IXRA 3TRPA 5L71A 5CP1A 4BA7A 2CQ9A 1URMA 4ZXGA 3IHQA 1M2AA 5IM9A 1Q98A 2R3XA 4LLRA 2L59A 1SKSB 5IIZA 4HJ2A 1XWKA 1Z5YE 2NTOA 2OE3A 2RUEA 1T1VA 2H0GA 3C7MA 3GKKA 2C0FA 2NBSA 2PPTA 2FY6A 1XWGA 4J56E 2B1LA 2V2GA 4USSA 1TRSA 4GXZA 1AAZA 4ISDA 2DJJA 4IS0A 1BJXA 3F6FA 4NHWA 5HFIA 4NWYA 3M3MA 2YWOA 5D9TA 3Q19A 5A4UA 5GAPD 5DQYA 4IVFA 1FOVA 1WWJA 2V1MA 1ZMAA 3UVHA 4FO5A 2QKEA 1HQOA 4KNDA 4G9HA 1KBNA 1LJRA 1WE0A 5BMUA 2V6KA 5KN1A 3H1NA 1T4YA 4KF9A 4JZQA 2V6OA 3ZMKA 3KD0A 3TKSE 2FLSA 1SK2A 2CAQA 2KUCA 4TN8A 5IMFA 4N10A 1T00A 5KEJA 5G2ZA 2G0FA 5ECSA 4ZBAA 1DUGA 3GTUA 3WGXA 3L9UA 1XIYA 1A24A 3HVXA 4PUFC 1ST9A 2P0GA 5B7CA 5IOXA 3UIWA 3VWUA 4PQHA 1WRYA 5C00A 4K7IA 2VCVA 1ZL9A 1OYJA 2H6ZA 2HSNB 1GSFA 2R5GA 3EURA 1JLVA 3RHCA 1X5CA 3FZ4A 1QMVA 2P31A 4WF5A 1FB0A 3TJFA 2YWNA 4FIWA 1W89A 2R6KA 4BPYA 5IPGA 1M99A 3IK7A 1YY7A 1GH2A 3L78A 2EIRA 3GNJA 1GUHA 4MF6A 2LRNA 2L6CA 3PGTA 5GAND 1BEDA 2LNTA 4F0BA 3KH7A 4AF2A 2AJQB 3P90A 3HVSA 1B4QA 3UMAA 1U88A 2DJKA 4KSMA 2MZCA 4ACSA 2WDUA 1QK8A 3J7Yb 1U6TA 4OWYA 1Z9HA 4JRRA 4I2UA 4HJMA 3QPMA 4CHSA 2ALBA 2H75A 5HR3A 2D2ZA 1VF4A 4F9ZA 1R26A 5D73A 3LYKA 4WKWA 4BVXA 2DSAA 2GTUA 1ERTA 3GV1A 3GRXA 3ZLPA 2IMKA 2XBIA 2BJXA 2C3NA 1MDJA 1XZOA 4G2EA 2O8VB 3GSSA 2QC7A 1ON4A 1S3CA 1SYRA 2NDOA 1XOAA 2HSMA 4OO5A 1EGOA 1TOFA 2GLRA 1VGLA 3EU4A 2CX4A 2P5QA 2DMLA 1X9WB 3LEFA 2JU5A 2LS5A 1PMTA 5J5NA 4KGIA 3TKPA 2R37A 2H72A 4TR1B 2GDRA 4MDCA 1TXXA 6GSSA 1UN2A 4OO4A 4AJ8A 3L4NA 1NHYA 3VK9A 5KN3A 5CNWA 4Q5FA 1SK1A 2WS2A 4MLYA 2X8GA 1GULA 3GL3A 5F05A 5AISA 1EWXA 4L5LA 1ZYQB 4GTUA 3C1SA 1GL8A 3U5RE 1ZGNA 3UL3A 3LWAA 4F82A 1U3AA 3TDGA 4X0XA 2HRKB 4KDUA 4PGTA 5DJLA 1JZOA 4OFTA 2HZEA 3CBUA 1A23A 5KN0A 7GSSA 4MJBA 3ZZXA 1MDIA 1AIUA 2WB9A 3ME7A 3FRCA 4MF5A 6GSWA 1XBSA 1TRVA 3HCZA 2H71A 4NHZA 4FH8A 4DSSA 3KGKA 3ED3A 1OC9A 3L9VA 3ZITA 3IC4A 2CA8A 1MD4A 1HNCA 2R2JA 5F0GA 1R5PA 2HXKA 1AUCA 1T7PB 4HOJA 1V9WA 2GVPA 5ECPB 2OJLA 4POBA 4O32A 4IELA 4JU5A 1OAZA 1ML6A 4FYBA 3KTBA 2GSRA 2LJRA 2YN1A 3TJGA 1M9BA 2IFQA 3VPQA 4TR1A 3EMXA 3I69A 1FAAA 2B5YA 2PBJA 6GSUA 11GSA 5ECLB 2GQMA 5ID2B 4KCEA 2PWJA 2H66A 4WXTA 4MA9A 2CT6A 2E7PA 3IAS2 4JEDA 2YV9A 2K8SA 1VRSD 5F06A 3GA4A 4TOPA 2BMXA 3F3QA 1THOA 5DAKB 4L0UA 2OBIA 6GSVA 4HQSA 4ECJA 1TJDA 4YAVA 4BL7A 5IO2A 4ZL7A 5EVOA 3D4TA 3DWVA 4L5OA 4GF0A 5INYA 1HNBA 1GSDA 3I43A 3LQ7A 4HZ4A 2KP1A 3UEMA 2E0QA 1K0AA 4O5RA 2CAIA 4P3YB 5EPFA 3ZVJA 4MP4A 4ILFA 1K0CA 1PQNA 3UBKA 2Z9SA 5IPHA 2GT6A 3TKSC 2F8FA 1JZWA 1X0RA 5D96A 3CSHA 2AAWA 5F8BA 4IJ3A 4OMVA 1E6BA 1Z7PA 4TW5A 2H1AA 1TDIA 2P5RA 1SL2B 1GTUA 2O89A 4L0WA 3KMNA 4KAEA 1GLPA 4O92A 3VFIA 1TW9A 2IMDA 4ZB9A 1I5GA 1PD21 3ISOA 5G5EA 1GSSA 3KP8A 4GRFA 5GZZB 1TK0B 2E2GA 3F4RA 4J2FA 5G1KA 1H4OA 1EP8A 4GCIA 2B7JA 1EV9A 2H73A 2PERA 5DALB 2VL2C 3FY7A 5IMZA 4WETA 3DRNA 3FW2A 4GQFA 3IRAA 2OE0A 3TRXA 1UA5A 5G31A 2L4QA 5IMDA 1YF1A 4MK3A 2WULA 2F3MA 2VLTA 1I9DA 3GKXA 2H1BA 2LRTA 2I81A 3NOFA 1RW1A 5JWRB 3I9V2 4G0KA 2GSSA 1OC3A 1ACVA 2GZPA 4OCEA 4ZBBA 3APSA 2MMZA 4TR0A 4MZBA 4HDEA 3TOTA 2WJUA 3W6GA 5B6NA 4D73B 4KB3A 4PQIA 5G1LA 1O81A 1OE8A 4XS4B 3KH9A 4TXVA 1NM3A 4KA0A 2VL3A 2C8UA 3QAGA 1THXA 3HHVA 3LXTA 2DJ3A 2IMFA 1JZRA 1BG5A 2DJ1A 3F0IA 2REMA 2I9HA 4ECIA 3FR3A 5DJMA 1DSBA 4RUVA 1SL0B 1PA3A 4NXIA 1TRUA 1DE1A 1B8XA 2VAFA 3RPPA 3EE2A 3W8SA 1Q4JA 4IQ1A 2HE3A 4TXOB 4I8BA 1FHEA 2OADA 2LEGA 2VCQA 1JZDA 1EZKA 2IJYA 3EYTA 2VCXA 1SYXA 3HKRA 4EVMA 3H4KA 2NVLA 4EKZA 3L0HA 2C0EA 1O85A 1O8WA 4V2NA 2I3YA 4MABA 4DSQA 3R3EA 5A5KA 1GSYA 2YWIA 1KTEA 4PX1A 2LJAA 3KJYA 4AGSA 3RAZA 4NV5A 3ZRDA 1JLWA 2CVDA 4IP6A 2H1GA 3DKSA 4MJEA 3BCKA 2F51A 1O8XA 4WR4A 2YP6A 2VM1A 2LV3A 2FNOA 2CX3A 1T3BA 4ML6A 1PX7A 2C80A 1UC7A 2YCDA 4EC0A 1F9MA 1TTZA 5CRDA 5IMCA 3TJBA 4G0LA 2X99A 1JHBA 2RM6A 3MWHA 1GNWA 5G30A 22GSA 3LJRA 4G0IA 3SWLA 3RBTA 4OCFA 1EOGA 5FT3A 2VM2A 3D21A 2TIRA 4YQMA 1YZXA 1B9YC 4POLA 3H8QA 2YJHA 3E9JB 3H93A 1UVZA 1O6JA 3EVIA 1EOHA 2H0HA 1MTCA 5IQYA 4E8EA 3ZIVA 1GNEA 1M2DA 3ZFBA 4EO3A 3F6DA 1USBA 2PVQA 3GMFA 2LUSA 3P7XA 1ILOA 5H5RA 2VCWA 4G10A 3WT2A 2WCIA 2GQLA 4IP1A 1IYHA 3D6IA 1K0OA 5D93A 4K7OA 5AIVA 1SD9A 5AIXA 2GZYA 3PR8A 2AUVA 5FWGA 3LGCA 1XVWA 1Z7RA 4PQ1A 4BWSA 3QMXA 4MZWA 2HNLA 2HLSA 4GWRA 3LFLA 5AGYA 3DMLA 4IJIA 4ZIJA 1YKAA 3A2XA 4YQUA 3DVWA 4Z7XA 1AC1A 4I6XA 3Q18A 2ZCTA 4YH2A 1W4VA 3CSIA 1T8EB 4PNFA 3QFAC 3OR5A 4KDYA 2LNSA 1AQVA 5DVBA 4I97A 3EU3A 3KP9A 4ZL9A 3ZVJD 3QFBC 4XCSA 1M7TA 3TRQA 1GWCA 2XPEA 5HFGA 1PKZA 2B7KA 2H01A 3M9JA 1CQHA 2IIYA 1PRXA 1G7OA 2AV4A 1PL2A 4FQUA 3FZAA 5ECOB 3QDNA 3HXSA 1EV4A 1X9SB 1YJ6A 3GFKA 1C72A 3SBCA 1OE7A 5DBQA 2KP2A 1QXHA 3CSJA 2DLXA 3ZREA 3JCML 1DBYA 1EP7A 3AY8A 1SU9A 1GUMA 5E4WA 2IPAA 3TCOA 2K8VA 3UBLA 3KIJA 1V57A 1SD8A 1IYIA 4KSOA 1NHOA 2IMIA 3U6VA 1FVKA 2AYTA 3F9UA 2GSQA 4JBBA 1J9BA 1J08A 3NIVA 3F63A 5ECNB 1ERUA 4POKA 3WGEA 3WT1A 4I5QA 2JL4A 2J23A 4PNGA 3D0ZA 1TU7A 3UJ1A 3C73A 4HI7A 1TI1A 3EMPA 1B48A 3TUEA 4GSTA 2C3QA 1AQXA 4ECCA 3M0FA 3LSZA 2FWEA 4L8EA 3IA1A 2JSZA 3HY2A 4GQCA 5IOWA 2CV4A 5IMVA 3D5JA 4IBPA 2K9FA 2XC2A 4KCAA 1K3YA 2GQKA 3TKQA 3MAKA 2BTOT 2CZ3A 3PPUA 4IW9A 1WJKA 3A5WA 4J57E 1EEMA 13GSA 1EEJA 4MMMA 4K7NA 3DIEA 4GSSA 2IWTA 5JCUA 4V2LA 3P8WA 2M72A 1X9MB 4POMA 5ECRB 3DXBA 2C4JA 5HR1A 1GRXA 1PN9A 2XBQA 3DVXA 1K0BA 5JWOB 3L9SA 1ERWA 2VO4A 3IBHA 2HRKA 1ERVA 5COHA 4XTSA 2FCHA 3WGDA 3BBYA 2YOIA 2H1DA 1TP9A 3KMOA 3FHKA 18GSA 3FZ9A 4KW6A 4KUNA 6GSYA 4BVYB 3VWVA 4TRXA 4ULXA 2I1UA 1KNGA 3VI5A 2VUPA 3MDKA 1XPVA 4ECBA 1B4PA 4MH2A 4G19A 2JZRA 4LL1B 3ZYWA 1FW1A 4HUAA 2FWHA 2LSTA 3KCMA 3IC8A 3N9JA 3GIXA 4XRAA 1VF3A 2GSTA 1A0FA 2ON5A 3HD5A 4H86A 1LU4A 2QSIA 1GUKA 3D22A 2JZSA 3F4TA 3ERWA 2WRTA 2PMTA 1H75A 1SJZA 2VIMA 2YANA 5J3RA 1F3AA 5A4VA 5ID2A 5HR0A 4F03A 12GSA 9GSSA 3E0UA 1MD3A 3ZMLA 4QQ7A 3WD6A 3CRTA 4NV2A 4EDYA 3QAVA 1V2AA 3IAM2 3KM6A 5CRGA 4QL9A 2HSYA 1Z3EA 5C04A 1O7UA 5DAKA 1BAYA 4CDOA 3QR6A 1DE2A 4JR4A 4X1UA 3GX0A 1PSQA 2A4VA 5JCWA 3IPZA 1QQ2A 4K0GA 4IN0A 3W8JA 1AW9A 2IL3A 1Y25A 2B3SA 2HFDA 3TB2A 2LQOA 4CW9A 2H70A 5CRWA 2WZ9A 5GSSA 1NSWA 1V40A 1YEPA 5GSTA 3GHAA 2YV7A 3HZ8A 4N11A 5LD0A 1K0NA 3APQA 1U3IA 2L5LA 2YZUA 2DJ0A 2YPMA 4LMVA 2LJKA 1SJIA 2JSYA 2B5EA 4EL1A 5D8IA 4PXOA 1AXDA 1R4WA 3FEUA 3DYRA 3VWXA 4MCUA 4XIHA 2FA8A 2LTKA 3GN3A 1N2AA 4Q5NA 3BOAA 1WMJA 3FKFA 1Z6MA 2V32A 1OKDA 4WBRD 3GTUB 5DALA 1XCCA 2PGTA 5E59A 3O76A 1BQ7A 1MDKA 2OACA 5ELGA 1G0TA 5HQPA 3TKRA 2H6XA 5H5QA 3ZL5A 3KEBA 4WBJA 2PUKC 2YZHA 3KTLA 2OKAA 5FHIA 3UAPA 3NZNA 2XPDA 1Y6EA 2H30A 2TRCP 1EGRA 4ZBDA 4TKYA 2VLUA 2FUG2 2HI7A 2O85A 2KOKA 2FD3A 2VOCA 3F3RA 2VD0A 2OA7A 3US3A 3M1GA 2AB6A 1S3DA 1LBKA 4WF4A 1AQWA 1TI3A 5KN2A 2LKUA 2I4AA 4KE3A 5HFKA 1QGVA 4D73A 2VLVA 4K8MA 2JADA 4XS4A 4FYCA 3TJKA 1TRWA 3CMIA 2N5AA 5DDLA 5DCHA 1TK8B 1O73A 4ID0A 1YQ1A 4ML1A 1GP1A 2XHFA 2VD1A 2NPBA 2ES7A 3R2QA 3V1WA 3CTFA 1PGTA 2DIYA 4X43A 3UOMA 3HVVA 2YWMA 1YF0A 4FYUA 3IK9A 2GZZA 2N5FA 20GSA 5A4WA 3IR4A 2J9HA 2B5XA 5G5FA 4KDXA 2WFCA 4BVXB 17GSA 3VPTA 3TOUA 2CVBA 3FK8A 2K6VA 1SJ6A 2A2SA 2C0GA 3RDWA 2ON7A 5LNKe 1XFLA 1HYUA 3Q74A 3ME8A 6GSTA 4TXOA 1RK4A 5ECIB 3A3TA 2VL9A 4LMWA 2HSMB 1KEBA 1ZZYA 4MJAA 3FZ5A 3IE3A 4MH3A 5EY6A 1K0MA 3APOA 2OE1A 5J4UA 1U87A 2X8HA 4ZILA 14GSA 4OFMA 3A2VA 2FHEA 3F8UA 4N30A 4O7HA 3J7Yk 5B6MA 1R5AA 2MBSA 3CYNA 4IQAA 5CYYA 5D9XA 2L5OA 1OKTA 5DCGA 1FVJA 3D4MA 2H19A 1GSQA 5J9CA 1VF1A 4HS1A 2MYGA 2F8AA 1GTAA 5DQSA 1F3BA 3C8EA 4K9ZA 1A0RP 4E8HA 2RM5A 3CRUA 4RI6A 4EXJA 2H8LA 3E3EA 1XW6A 2C3TA 4KH7A 2PU9C 3FR6A 5CAXA 2TRXA 1GLQA 3M8NA 4K1FA 4RQXA 3ZFLA 3LXZA 4DVCA 4BWQA 1M2BA 3Q6OA 2MMAA 1S3AA 1GSUA 4V1Ag 4NAXA 2HZEB 4RI7A 4WR5A 5CO3A 4MJCA 1PL1A 2H76A 4DSSB 4XS1A 2HZFA 1CQGA 2DBCA 1OC9B 5CREA 2KHPA 1XW9A 3EINA 5ABRA 1J0FA 1WP0A 19GSA 2DC5A 3KXOA 3LYPA 3GURA 3HJOA 2EC4A 4YQVA 2HRAA 2EIQA 5JCGA 5AN1A 1SL1B 1PKWA 3HJPA 1WPIA 4ZB8A 1SK0A 3MNGA 1A2MA 1GTBA 3DGQA 3GH6A 1V58A 2VCZA 4OFNA 2IFQB 3O6TA 4JE1A 1HD2A 1RQMA 1X5EA 5B8BA 4HQZA 3UVTA 3DD3A 5EL8A 3RHBA 5ECMB 3UARA 3BD2A 1XOBA 1ABAA 3TJJA 3RPNA 2DIZA 1ZCPA 4Q5RA 2EIOA 3GH9A 5H5SA 1X5DA 1QFNA 3F4SA 4I2TA 4DEJA 5JWQB 2GT5A 1MEKA 2MBTA 4AJ7A 4TVEA 1QUWA 3GL5A 3KZQA 3GKNA 2MMNA 3EWLA 2FGXA 3PINA 2FWFA 3LORA 5B8AA 4BL7B 1OVNA 5HR2A 1BYEA 3M9KA 4F0CA 1PX6A 4MF7A 2O7KA 3ZTLA 3BCIA 4IKHA 4K0NA 2YNXA 1TU8A 2H74A 2PVOC 1K3OA 4EE0A 2IMEA 4K6XA 3GUSA 3K8NA 2GGTA 3TKSA 2ZUPA 1YKCA 3O3TA 4YAPA 2RLIA 3ERFA 3HA9A 2H0IA 4OD7A 4TR3A 4V2MA 1A8LA 4QL7A 2YJ7A 3VI7A 4TR4A 1T4ZA 1HNAA 3ZIJA 4V1Ap 2GS3A 1SKRB 3WYWA 1ZYEA 2B6MA 1TKDB 3I6AA 2IN3A 3A2WA 3H79A 3GKMA 4RQRA 2M80A 1G6YA 1K0DA 4IHUA 4LL4B 3G7JA 2AHEA 5ECKB 3PH9A 4HEA2 1XVQA 2VL2A 3VWWA 1M0UA 1NW2A 1M9AA 1F2EA 1FG4A 4EUYA 2LRCA 4XRDA 2QGVA 2DMMA 3C71A 2PN8A 3GX8A 1WIKA 3FR9A 3QAWA 3MSZA 2RIIA 3S9FA 1R7HA 3IOSA 5LCZA 2ZNMA 4JR6A 6GSXA 1E2YA 1XXUA 4DSRA 4ZB6A 2RUFA 4HU9A 4MPGA 4XS6A 4KX4A 1YDKA 1FO5A 3GSTA 2JACA 5J41A 4ZL8A 4IGJA 2X8CA 2H6YA 2E2MA 2L4CA 3LG6A 4HZ2A 4N0VA 1YEXA 3QOUA 5ELAA 2CZ2A 4PUAA 2M46A 3CTGA 2G2QA 2HQTA 1VF2A 10GSA 2V41A 2DJ2A 1OC8A 1WOUA 1N8JA 3FYGA 3C1RA 3GYKA 1G6WA 2C1YA 2HRNA 2FWGA 2KLXA 4AJ6A 4MPFA 4K2DA 1XWCA 5J9BA 3QCPA 3IV4A 3BJ5A 1B9XC 3IDVA 5IO0A 2JZTA 2HT9A 3HDCA 1A8YA 3N5OA 2F9SA 3ERGA 3TGZA 5ENUA 5D9WA 4NPBA 4PURA 4NMUA 1F6MC 4EDZA 3G7IA 2HRFA 2MMOA 1SKWB 16GSA 3DEXA 2X64A 4F2IA 5ECHB 1XW5A 2OBKA 1K3LA 3VLNA 3VURA 2C0DA 2VCTA 4LA1A 1XWBA 1F37A 2UZ8A 2WGRA 1BX9A 5ECQB 3EC3A 1Z6NA 1V98A 2CVKA 4N0ZA 4PTSA 4EF0A 4WEYA 3G9BA 3HJMA 2LQQA 1JFUA 1A2JA 4BVYA 1A2LA 2B1KA 4GLTA 3P2AA 4XHMA 3QD9A 2O87A 3CXGA 8GSSA 5D9VA 2HYXA 2L6DA 1TK5B 3HZ4A 2R4VA 5IMAA 2N5BA 4GSNA 1FB6A 1G7EA 3G7YA
chains in the Genus database with same CATH superfamily
5F07A 2L57A 3HYPA 4MZCA 1GSEA 1GTIA 2HSHA 4Q5QA 4HU7A 1SENA 5A1NB 2K18A 1ZOFA 2FA4A 5CRHA 2A2RA 1XWAA 3IXRA 3TRPA 5L71A 5CP1A 4BA7A 2CQ9A 1URMA 4ZXGA 3IHQA 1M2AA 5IM9A 1Q98A 2R3XA 4LLRA 2L59A 1SKSB 5IIZA 4HJ2A 1XWKA 1ZYNA 1Z5YE 2NTOA 2OE3A 2RUEA 1T1VA 2H0GA 3C7MA 3GKKA 2EFCA 2C0FA 2NBSA 2R0PA 2PPTA 2EFHA 2FY6A 1XWGA 4J56E 1XG8A 2B1LA 2V2GA 4USSA 1TRSA 4GXZA 1AAZA 4ISDA 2DJJA 4IS0A 1BJXA 3FMWA 3F6FA 4NHWA 5HFIA 4NWYA 3M3MA 2YWOA 5D9TA 3Q19A 5A4UA 5GAPD 5DQYA 4G01A 4IVFA 1FOVA 1WWJA 2V1MA 1ZMAA 3UVHA 4FO5A 2QKEA 1HQOA 4KNDA 4G9HA 1KBNA 1LJRA 1WE0A 5BMUA 2V6KA 5KN1A 3H1NA 1T4YA 4KF9A 4JZQA 2V6OA 3ZMKA 3KD0A 3TKSE 2FLSA 1SK2A 2CAQA 2KUCA 4TN8A 5IMFA 2R0CA 4N10A 1T00A 5KEJA 5G2ZA 2G0FA 5ECSA 4ZBAA 1DUGA 3GTUA 3WGXA 3L9UA 1XIYA 4EIPA 1A24A 4PI2C 3HVXA 4PUFC 1ST9A 2P0GA 5B7CA 5IOXA 3UIWA 3VWUA 4PQHA 1WRYA 5C00A 4K7IA 4Z2TA 2VCVA 1ZL9A 1OYJA 2H6ZA 2HSNB 1GSFA 2R5GA 3EURA 1JLVA 3RHCA 1X5CA 3FZ4A 1QMVA 2P31A 4WF5A 1FB0A 3TJFA 2YWNA 4FIWA 1W89A 2R6KA 4BPYA 5IPGA 1M99A 3IK7A 1YY7A 1GH2A 3L78A 2EIRA 3GNJA 1GUHA 4MF6A 2LRNA 2L6CA 3PGTA 5GAND 1BEDA 2WW1A 2LNTA 4F0BA 3KH7A 4AF2A 2AJQB 3P90A 3HVSA 1B4QA 3UMAA 1U88A 2DJKA 4KSMA 2MZCA 4ACSA 2WDUA 1QK8A 3J7Yb 1U6TA 4OWYA 4O5QA 1Z9HA 4JRRA 4I2UA 1FOHA 4HJMA 3QPMA 4CHSA 2ALBA 2H75A 5HR3A 2D2ZA 1VF4A 4F9ZA 1R26A 5D73A 3LYKA 4WKWA 4BVXA 5J4VA 2DSAA 2GTUA 1ERTA 3GV1A 3GRXA 3ZLPA 2IMKA 2XBIA 2BJXA 2C3NA 1MDJA 1XZOA 4G2EA 2O8VB 3GSSA 2QC7A 1ON4A 1S3CA 1SYRA 2NDOA 1XOAA 2HSMA 4OO5A 1EGOA 1TOFA 2GLRA 1VGLA 3EU4A 2CX4A 2P5QA 2DMLA 1X9WB 3LEFA 2JU5A 2LS5A 5BRTA 1PMTA 5J5NA 4KGIA 3TKPA 2R37A 2H72A 4TR1B 2GDRA 4MDCA 1TXXA 2EFDA 6GSSA 1UN2A 4OO4A 4K5SA 4AJ8A 3L4NA 1NHYA 3VK9A 5KN3A 5CNWA 4Q5FA 1SK1A 2WS2A 4MLYA 2X8GA 1GULA 3GL3A 4PI0C 5F05A 5AISA 1EWXA 4L5LA 1ZYQB 2X4AA 4GTUA 3C1SA 1GL8A 3U5RE 1ZGNA 2WVYA 3UL3A 3LWAA 4F82A 2UV8G 1U3AA 3TDGA 4X0XA 2HRKB 4KDUA 4PGTA 5DJLA 1JZOA 4OFTA 2HZEA 3CBUA 1A23A 5KN0A 7GSSA 4MJBA 3ZZXA 1MDIA 1AIUA 2WB9A 3ME7A 3FRCA 4MF5A 6GSWA 1XBSA 1TRVA 3HCZA 2H71A 4NHZA 4FH8A 4DSSA 2VKZG 2R0GA 3KGKA 3ED3A 1OC9A 3L9VA 3ZITA 3IC4A 2CA8A 1MD4A 1HNCA 2R2JA 5F0GA 4ICYA 1R5PA 2HXKA 1AUCA 1T7PB 4HOJA 1V9WA 2GVPA 5ECPB 2OJLA 4POBA 4O32A 4IELA 4JU5A 1OAZA 1ML6A 4FYBA 3KTBA 3RGBC 2GSRA 2LJRA 1I1IP 2YN1A 3TJGA 1M9BA 2IFQA 3VPQA 4TR1A 3EMXA 3I69A 4AKHA 1FAAA 2B5YA 2PBJA 6GSUA 11GSA 5ECLB 2GQMA 5ID2B 4KCEA 2PWJA 2H66A 4WXTA 4MA9A 2CT6A 2E7PA 1TXUA 3IAS2 4JEDA 2YV9A 2K8SA 1VRSD 5F06A 3GA4A 4TOPA 4W66A 2BMXA 3F3QA 1THOA 5DAKB 4L0UA 2OBIA 6GSVA 4HQSA 4ECJA 1TJDA 4YAVA 4BL7A 5IO2A 4ZL7A 5EVOA 4EIQA 3D4TA 3DWVA 4L5OA 4GF0A 5INYA 1HNBA 1GSDA 3I43A 3LQ7A 4HZ4A 2KP1A 3UEMA 2E0QA 5A5HA 1K0AA 4O5RA 2CAIA 4P3YB 5EPFA 3ZVJA 4MP4A 4ILFA 1K0CA 1PQNA 3UBKA 2Z9SA 5IPHA 2GT6A 3TKSC 2F8FA 1JZWA 1X0RA 5D96A 3CSHA 2AAWA 5F8BA 4IJ3A 4OMVA 1E6BA 1Z7PA 4TW5A 2H1AA 2WVXA 1TDIA 2P5RA 1SL2B 1GTUA 2O89A 4L0WA 2EFEA 3KMNA 4MNNA 4KAEA 1GLPA 4O92A 3VFIA 1TW9A 2IMDA 4ZB9A 1I5GA 1PD21 3ISOA 5G5EA 1GSSA 3KP8A 4GRFA 5GZZB 1TK0B 2E2GA 3F4RA 4J2FA 5G1KA 1H4OA 1EP8A 4GCIA 2B7JA 1EV9A 2H73A 2PERA 5DALB 2VL2C 3FY7A 5IMZA 4WETA 3DRNA 3FW2A 4GQFA 3IRAA 2OE0A 3TRXA 1UA5A 5G31A 2L4QA 5IMDA 4YKGA 1YF1A 4MK3A 5A34B 2WULA 2F3MA 2VLTA 1I9DA 4Z2UA 3GKXA 2H1BA 2LRTA 2I81A 3NOFA 1RW1A 5JWRB 3I9V2 4G0KA 2GSSA 1OC3A 1ACVA 1PFOA 2GZPA 4OCEA 4ZBBA 3APSA 5J4YA 2MMZA 4TR0A 4MZBA 4HDEA 3TOTA 2WJUA 3W6GA 5B6NA 4D73B 4KB3A 4PQIA 5G1LA 1O81A 1OE8A 4XS4B 3KH9A 2WZSA 4TXVA 1NM3A 4KA0A 2VL3A 2C8UA 3QAGA 1THXA 3HHVA 5J40A 3LXTA 2DJ3A 2O36A 2IMFA 1JZRA 1BG5A 2DJ1A 3MIXA 3F0IA 2REMA 2I9HA 4ECIA 3FR3A 5DJMA 1DSBA 4RUVA 1SL0B 3A5IA 1PA3A 4NXIA 1TRUA 1DE1A 1B8XA 2VAFA 3RPPA 3EE2A 3W8SA 1Q4JA 4ZB7A 4IQ1A 2HE3A 4TXOB 4I8BA 1FHEA 2OADA 2LEGA 2VCQA 1JZDA 1EZKA 2IJYA 3EYTA 2VCXA 1SYXA 3HKRA 4EVMA 3H4KA 2NVLA 4EKZA 3L0HA 2C0EA 1O85A 1O8WA 4V2NA 2I3YA 4MABA 4DSQA 3R3EA 5KOXA 5A5KA 1GSYA 2YWIA 1KTEA 4PX1A 2LJAA 3KJYA 4AGSA 3RAZA 4NV5A 3ZRDA 2WW3A 1JLWA 2CVDA 4IP6A 2H1GA 1M3JA 3DKSA 4MJEA 3BCKA 2F51A 1ZYPA 1O8XA 4WR4A 2YP6A 2VM1A 2LV3A 2FNOA 2CX3A 1T3BA 4ML6A 1PX7A 2C80A 1UC7A 2YCDA 3HVNA 4EC0A 1F9MA 1TTZA 5CRDA 5IMCA 5A1NA 3TJBA 4G0LA 2X99A 1JHBA 2RM6A 3MWHA 1GNWA 5G30A 22GSA 3LJRA 2X49A 4G0IA 3SWLA 3RBTA 4OCFA 1EOGA 5FT3A 2VM2A 3D21A 2TIRA 4YQMA 1YZXA 1B9YC 4POLA 4AKGA 3H8QA 2YJHA 3E9JB 3H93A 1UVZA 1O6JA 3EVIA 1EOHA 2H0HA 1MTCA 4CY6A 5IQYA 4E8EA 3ZIVA 1GNEA 1M2DA 3ZFBA 4EO3A 3F6DA 1USBA 2PVQA 3GMFA 2LUSA 3P7XA 1ILOA 5H5RA 2VCWA 4G10A 3WT2A 2WCIA 2GQLA 4IP1A 1IYHA 3D6IA 1K0OA 5D93A 4K7OA 5AIVA 1SD9A 5AIXA 2GZYA 3PR8A 2AUVA 5FWGA 3LGCA 1XVWA 1Z7RA 5KOWA 4PQ1A 3HMJG 4BWSA 3QMXA 4MZWA 2HNLA 2HLSA 4GWRA 3LFLA 5AGYA 3DMLA 4IJIA 4ZIJA 1YKAA 3A2XA 4YQUA 3DVWA 4Z7XA 1AC1A 4I6XA 3Q18A 2ZCTA 4YH2A 1W4VA 3CSIA 4X4JA 1T8EB 4PNFA 3QFAC 3OR5A 4KDYA 2LNSA 1AQVA 5DVBA 4BIKA 4I97A 3EU3A 3KP9A 4ZL9A 3ZVJD 3QFBC 4XCSA 4QMKA 1M7TA 3TRQA 1GWCA 2XPEA 5HFGA 1PKZA 2B7KA 2H01A 3M9JA 1CQHA 2IIYA 1PRXA 2HSNA 1G7OA 2AV4A 1PL2A 4FQUA 3FZAA 5ECOB 3QDNA 3HXSA 2WW2A 1EV4A 1X9SB 1YJ6A 3GFKA 1C72A 3SBCA 1OE7A 1M3IA 5DBQA 2KP2A 1QXHA 3CSJA 2DLXA 3ZREA 3JCML 1DBYA 1EP7A 3AY8A 1SU9A 1GUMA 5E4WA 2IPAA 3TCOA 2K8VA 3UBLA 3KIJA 4AI6A 4O5UA 1V57A 1SD8A 1IYIA 4KSOA 1NHOA 2IMIA 3U6VA 1FVKA 2AYTA 3F9UA 2GSQA 4JBBA 1J9BA 1J08A 3NIVA 3F63A 5ECNB 1ERUA 4POKA 3WGEA 3WT1A 4I5QA 2JL4A 2J23A 4PNGA 3D0ZA 1TU7A 3UJ1A 3C73A 4HI7A 1TI1A 3EMPA 1B48A 3TUEA 4GSTA 2C3QA 1AQXA 4E68A 4ECCA 3M0FA 3LSZA 2FWEA 4L8EA 3IA1A 2JSZA 3HY2A 4GQCA 5IOWA 2CV4A 5IMVA 3D5JA 4IBPA 2K9FA 2XC2A 4KCAA 1K3YA 2GQKA 3TKQA 3MAKA 2BTOT 2CZ3A 3PPUA 4IW9A 1WJKA 3A5WA 4J57E 2DKHA 4Z2RA 1EEMA 13GSA 1EEJA 4MMMA 4K7NA 3DIEA 4GSSA 2IWTA 5JCUA 4V2LA 3P8WA 2M72A 1X9MB 4POMA 5ECRB 3DXBA 2C4JA 5HR1A 1GRXA 1PN9A 2XBQA 3DVXA 1K0BA 1SVLA 5JWOB 3L9SA 1ERWA 2VO4A 3IBHA 2HRKA 1ERVA 5COHA 4XTSA 2FCHA 3WGDA 3BBYA 2YOIA 2H1DA 1TP9A 3KMOA 3FHKA 18GSA 3FZ9A 4KW6A 4KUNA 6GSYA 4BVYB 3VWVA 4TRXA 4ULXA 2I1UA 1KNGA 3VI5A 2VUPA 3MDKA 1XPVA 4ECBA 1B4PA 4MH2A 4G19A 2JZRA 4LL1B 3ZYWA 1FW1A 4HUAA 2FWHA 2LSTA 3KCMA 3IC8A 3N9JA 3GIXA 4XRAA 1VF3A 2GSTA 1A0FA 2ON5A 2O3EA 3HD5A 4H86A 1LU4A 2QSIA 1GUKA 3D22A 2JZSA 3F4TA 3ERWA 2WRTA 2PMTA 1H75A 1SJZA 2VIMA 2YANA 1PN0A 5J3RA 1F3AA 5A4VA 5ID2A 5HR0A 4F03A 12GSA 9GSSA 3E0UA 4N3ZA 1MD3A 3ZMLA 4A5PA 4QQ7A 3WD6A 3CRTA 4NV2A 4EDYA 3QAVA 1V2AA 3IAM2 3KM6A 5CRGA 4QL9A 2HSYA 1Z3EA 4K2XA 5C04A 1O7UA 5DAKA 1BAYA 4CDOA 2A4HA 3QR6A 2H1LA 1DE2A 4JR4A 4X1UA 3GX0A 1PSQA 2A4VA 5JCWA 3IPZA 1QQ2A 4K0GA 4IN0A 3W8JA 1AW9A 2IL3A 1Y25A 2B3SA 1SVOA 2WVZA 2HFDA 3TB2A 2LQOA 4CW9A 2H70A 5CRWA 2WZ9A 5GSSA 1NSWA 1V40A 1YEPA 5GSTA 3GHAA 2YV7A 3HZ8A 4N11A 5LD0A 1K0NA 3APQA 1U3IA 2L5LA 2YZUA 2DJ0A 2YPMA 4LMVA 2LJKA 1SJIA 1N25A 5BMUB 2JSYA 2B5EA 4EL1A 1SVMA 5D8IA 3IHGA 4PXOA 1AXDA 1R4WA 3FEUA 3DYRA 3VWXA 4MCUA 4XIHA 2FA8A 2LTKA 3GN3A 1N2AA 4Q5NA 3BOAA 1WMJA 2OT3A 3FKFA 1Z6MA 2V32A 1OKDA 4WBRD 3GTUB 5DALA 1XCCA 2PGTA 5E59A 3O76A 1BQ7A 1MDKA 2OACA 5ELGA 1G0TA 5HQPA 3TKRA 2H6XA 5H5QA 3ZL5A 3KEBA 4WBJA 2PUKC 2YZHA 3KTLA 2OKAA 5FHIA 3UAPA 3NZNA 5A34A 2XPDA 1Y6EA 2H30A 2TRCP 1EGRA 4ZBDA 4TKYA 2VLUA 2FUG2 2HI7A 2O85A 2KOKA 2FD3A 2VOCA 3F3RA 2VD0A 2OA7A 3US3A 3M1GA 2AB6A 1S3DA 1LBKA 4WF4A 1AQWA 1TI3A 5KN2A 2LKUA 2I4AA 4KE3A 5HFKA 1QGVA 4D73A 2VLVA 4K8MA 2JADA 3LW9A 4XS4A 4FYCA 3TJKA 1TRWA 3CMIA 2N5AA 5DDLA 5DCHA 1TK8B 1O73A 4ID0A 1YQ1A 4ML1A 1GP1A 2XHFA 2QA2A 3MYDA 2VD1A 2NPBA 2ES7A 3R2QA 3V1WA 3CTFA 1PGTA 2DIYA 4X43A 3UOMA 3HVVA 3CWGA 2YWMA 1YF0A 4FYUA 4HSCX 3IK9A 2GZZA 2WW0A 2N5FA 20GSA 5A4WA 3IR4A 2J9HA 2B5XA 5G5FA 4KDXA 2WFCA 4BVXB 17GSA 3VPTA 3TOUA 2CVBA 3FK8A 4YKFA 2K6VA 1SJ6A 2A2SA 2C0GA 3RDWA 2ON7A 5LNKe 1XFLA 3CHXC 1HYUA 3Q74A 6GSTA 3ME8A 4TXOA 1RK4A 5ECIB 3A3TA 2VL9A 4LMWA 2HSMB 1KEBA 1ZZYA 4MJAA 3FZ5A 3EPTA 3IE3A 4MH3A 5EY6A 1K0MA 3APOA 2OE1A 5J4UA 1U87A 2X8HA 4ZILA 14GSA 1YEWC 4OFMA 2A2PA 3A2VA 2FHEA 3F8UA 4N30A 4O7HA 3J7Yk 5B6MA 1R5AA 2MBSA 3CYNA 4FXYP 4IQAA 5CYYA 5D9XA 2L5OA 1OKTA 5DCGA 1FVJA 3D4MA 2H19A 1GSQA 5J9CA 1VF1A 4HS1A 2MYGA 2F8AA 2DKIA 1GTAA 5DQSA 1F3BA 4K5RA 3C8EA 4K9ZA 1A0RP 4E8HA 2RM5A 3CRUA 4RI6A 4EXJA 2H8LA 3E3EA 1XW6A 2C3TA 4KH7A 2PU9C 3FR6A 5CAXA 2TRXA 1GLQA 3M8NA 4K1FA 4RQXA 3ZFLA 3LXZA 4DVCA 4BWQA 1M2BA 3Q6OA 2MMAA 1S3AA 1GSUA 4V1Ag 4NAXA 2HZEB 4RI7A 4WR5A 5CO3A 4MJCA 1PL1A 2H76A 4DSSB 4XS1A 2HZFA 1CQGA 2DBCA 1OC9B 5CREA 2KHPA 1XW9A 3EINA 5ABRA 4PHZC 1J0FA 1WP0A 19GSA 2DC5A 3KXOA 3LYPA 3GURA 3HJOA 2EC4A 4YQVA 2HRAA 2EIQA 5JCGA 5AN1A 1SL1B 1PKWA 3HJPA 1WPIA 4ZB8A 1SK0A 3MNGA 1A2MA 1GTBA 3DGQA 3GH6A 1V58A 2VCZA 4OFNA 2IFQB 3O6TA 4JE1A 1HD2A 1RQMA 1X5EA 5B8BA 4HQZA 3UVTA 3DD3A 5EL8A 3RHBA 5ECMB 1S4BP 3UARA 3BD2A 1XOBA 1ABAA 1S3RA 3TJJA 3RPNA 2DIZA 1ZCPA 4Q5RA 2EIOA 3GH9A 5H5SA 1X5DA 1QFNA 3F4SA 4I2TA 4DEJA 5JWQB 2GT5A 1MEKA 2MBTA 4AJ7A 4TVEA 1QUWA 3GL5A 3KZQA 3GKNA 2MMNA 3EWLA 2FGXA 3PINA 2FWFA 3LORA 5B8AA 4BL7B 1YVLA 1OVNA 5HR2A 1BYEA 3M9KA 4F0CA 1PX6A 4MF7A 2O7KA 3ZTLA 3BCIA 4IKHA 4K0NA 2YNXA 1TU8A 2H74A 2PVOC 1K3OA 4EE0A 2IMEA 5A5HB 4K6XA 3GUSA 3K8NA 2GGTA 3TKSA 2ZUPA 1YKCA 3O3TA 4YAPA 2RLIA 3ERFA 3HA9A 2H0IA 1BF5A 4OD7A 4TR3A 4V2MA 1Y1UA 1A8LA 4QL7A 2YJ7A 3VI7A 4TR4A 1T4ZA 1HNAA 3ZIJA 4V1Ap 2GS3A 1SKRB 3WYWA 1ZYEA 2B6MA 2WVXB 1TKDB 3I6AA 2IN3A 3A2WA 3H79A 3GKMA 4RQRA 2M80A 1G6YA 1K0DA 4IHUA 4LL4B 3G7JA 2AHEA 5ECKB 3PH9A 4HEA2 1XVQA 2VL2A 3VWWA 1M0UA 1NW2A 2QA1A 1M9AA 1F2EA 1FG4A 4EUYA 2LRCA 4XRDA 2QGVA 2DMMA 3C71A 2PN8A 3GX8A 1WIKA 3FR9A 3QAWA 3MSZA 2RIIA 3S9FA 1R7HA 3IOSA 5LCZA 2ZNMA 4JR6A 6GSXA 1E2YA 1XXUA 4DSRA 3RFRC 4ZB6A 2RUFA 4HU9A 4MPGA 4XS6A 4KX4A 1YDKA 1FO5A 5J47A 3GSTA 2JACA 5J41A 4ZL8A 4IGJA 2X8CA 2H6YA 2E2MA 2L4CA 3LG6A 4HZ2A 4N0VA 1YEXA 3QOUA 5ELAA 2CZ2A 4PUAA 2M46A 3CTGA 2G2QA 2HQTA 1VF2A 10GSA 2V41A 2DJ2A 1OC8A 1WOUA 1N8JA 3FYGA 3C1RA 3GYKA 1G6WA 2C1YA 2HRNA 2FWGA 2KLXA 4AJ6A 4MPFA 4K2DA 1XWCA 5J9BA 3TU3B 3QCPA 3IV4A 3BJ5A 1B9XC 3IDVA 2O5VA 5IO0A 2JZTA 2HT9A 3HDCA 1A8YA 3N5OA 2F9SA 3ERGA 3TGZA 5ENUA 5D9WA 4NPBA 4PURA 4NMUA 1F6MC 4EDZA 3G7IA 2HRFA 2MMOA 1SKWB 16GSA 4CY8A 3DEXA 2X64A 4F2IA 5ECHB 1XW5A 2OBKA 4AKXB 1K3LA 3VLNA 3VURA 2C0DA 2VCTA 4LA1A 1XWBA 1F37A 2UZ8A 2WGRA 1BX9A 5ECQB 4AKIA 3EC3A 1Z6NA 1V98A 2CVKA 4N0ZA 4PTSA 4EF0A 4WEYA 3G9BA 3HJMA 2LQQA 1JFUA 1A2JA 4BVYA 1A2LA 2B1KA 4GLTA 3P2AA 4XHMA 4GDFA 3QD9A 2O87A 3CQFA 3CXGA 8GSSA 5D9VA 2HYXA 2L6DA 1TK5B 3HZ4A 2R4VA 5IMAA 2N5BA 4GSNA 1FB6A 1BG1A 1G7EA 3G7YA
chains in the Genus database with same CATH topology
5F07A 2L57A 3HYPA 4MZCA 1GSEA 1GTIA 2HSHA 4Q5QA 4HU7A 1SENA 5A1NB 2K18A 1ZOFA 2FA4A 5CRHA 2A2RA 1XWAA 3IXRA 3TRPA 5L71A 5CP1A 4BA7A 2CQ9A 1URMA 4ZXGA 3IHQA 1M2AA 5IM9A 1Q98A 2R3XA 4LLRA 2L59A 1SKSB 5IIZA 4HJ2A 1XWKA 1ZYNA 1Z5YE 2NTOA 2OE3A 2RUEA 1T1VA 2H0GA 3C7MA 3GKKA 2EFCA 2C0FA 2NBSA 2R0PA 2PPTA 2EFHA 2FY6A 1XWGA 4J56E 2B1LA 2V2GA 4USSA 1TRSA 4GXZA 1AAZA 4ISDA 2DJJA 4IS0A 1BJXA 3FMWA 3F6FA 4NHWA 5HFIA 4NWYA 3M3MA 2YWOA 5D9TA 3Q19A 5A4UA 5GAPD 5DQYA 4G01A 4IVFA 1FOVA 1WWJA 2V1MA 1ZMAA 3UVHA 4FO5A 2QKEA 1HQOA 4KNDA 4G9HA 1KBNA 1LJRA 1WE0A 5BMUA 2V6KA 5KN1A 3H1NA 1T4YA 4KF9A 4JZQA 2V6OA 3ZMKA 3KD0A 3TKSE 2FLSA 1SK2A 2CAQA 2KUCA 4TN8A 5IMFA 2R0CA 4N10A 1T00A 5KEJA 5G2ZA 2G0FA 5ECSA 4ZBAA 1DUGA 3GTUA 3WGXA 3L9UA 1XIYA 4EIPA 1A24A 3HVXA 4PUFC 1ST9A 2P0GA 5B7CA 5IOXA 3UIWA 3VWUA 4PQHA 1WRYA 5C00A 4K7IA 4Z2TA 2VCVA 1ZL9A 1OYJA 2H6ZA 2HSNB 1GSFA 2R5GA 3EURA 1JLVA 3RHCA 1X5CA 3FZ4A 1QMVA 2P31A 4WF5A 1FB0A 3TJFA 2YWNA 4FIWA 1W89A 2R6KA 4BPYA 5IPGA 1M99A 3IK7A 1YY7A 1GH2A 3L78A 2EIRA 3GNJA 1GUHA 4MF6A 2LRNA 2L6CA 3PGTA 5GAND 1BEDA 2LNTA 4F0BA 3KH7A 4AF2A 2AJQB 3P90A 3HVSA 1B4QA 3UMAA 1U88A 2DJKA 4KSMA 2MZCA 4ACSA 2WDUA 1QK8A 3J7Yb 1U6TA 4OWYA 4O5QA 1Z9HA 4JRRA 4I2UA 1FOHA 4HJMA 3QPMA 4CHSA 2ALBA 2H75A 5HR3A 2D2ZA 1VF4A 4F9ZA 1R26A 5D73A 3LYKA 4WKWA 4BVXA 5J4VA 2DSAA 2GTUA 1ERTA 3GV1A 3GRXA 3ZLPA 2IMKA 2XBIA 2BJXA 2C3NA 1MDJA 1XZOA 4G2EA 2O8VB 3GSSA 2QC7A 1ON4A 1S3CA 1SYRA 2NDOA 1XOAA 2HSMA 4OO5A 1EGOA 1TOFA 2GLRA 1VGLA 3EU4A 2CX4A 2P5QA 2DMLA 1X9WB 3LEFA 2JU5A 2LS5A 5BRTA 1PMTA 5J5NA 4KGIA 3TKPA 2R37A 2H72A 4TR1B 2GDRA 4MDCA 1TXXA 2EFDA 6GSSA 1UN2A 4OO4A 4K5SA 4AJ8A 3L4NA 1NHYA 3VK9A 5KN3A 5CNWA 4Q5FA 1SK1A 2WS2A 4MLYA 2X8GA 1GULA 3GL3A 5F05A 5AISA 1EWXA 4L5LA 1ZYQB 2X4AA 4GTUA 3C1SA 1GL8A 3U5RE 1ZGNA 3UL3A 3LWAA 4F82A 2UV8G 1U3AA 3TDGA 4X0XA 2HRKB 4KDUA 4PGTA 5DJLA 1JZOA 4OFTA 2HZEA 3CBUA 1A23A 5KN0A 7GSSA 4MJBA 3ZZXA 1MDIA 1AIUA 2WB9A 3ME7A 3FRCA 4MF5A 6GSWA 1XBSA 1TRVA 3HCZA 2H71A 4NHZA 4FH8A 4DSSA 2VKZG 2R0GA 3KGKA 3ED3A 1OC9A 3L9VA 3ZITA 3IC4A 2CA8A 1MD4A 1HNCA 2R2JA 5F0GA 4ICYA 1R5PA 2HXKA 1AUCA 1T7PB 4HOJA 1V9WA 2GVPA 5ECPB 2OJLA 4POBA 4O32A 4IELA 4JU5A 1OAZA 1ML6A 4FYBA 3KTBA 2GSRA 2LJRA 2YN1A 3TJGA 1M9BA 2IFQA 3VPQA 4TR1A 3EMXA 3I69A 4AKHA 1FAAA 2B5YA 2PBJA 6GSUA 11GSA 5ECLB 2GQMA 5ID2B 4KCEA 2PWJA 2H66A 4WXTA 4MA9A 2CT6A 2E7PA 1TXUA 3IAS2 4JEDA 2YV9A 2K8SA 1VRSD 5F06A 3GA4A 4TOPA 4W66A 2BMXA 3F3QA 1THOA 5DAKB 4L0UA 2OBIA 6GSVA 4HQSA 4ECJA 1TJDA 4YAVA 4BL7A 5IO2A 4ZL7A 5EVOA 4EIQA 3D4TA 3DWVA 4L5OA 4GF0A 5INYA 1HNBA 1GSDA 3I43A 3LQ7A 4HZ4A 2KP1A 3UEMA 2E0QA 5A5HA 1K0AA 4O5RA 2CAIA 4P3YB 5EPFA 3ZVJA 4MP4A 4ILFA 1K0CA 1PQNA 3UBKA 2Z9SA 5IPHA 2GT6A 3TKSC 2F8FA 1JZWA 1X0RA 5D96A 3CSHA 2AAWA 5F8BA 4IJ3A 4OMVA 1E6BA 1Z7PA 4TW5A 2H1AA 1TDIA 2P5RA 1SL2B 1GTUA 2O89A 4L0WA 2EFEA 3KMNA 4MNNA 4KAEA 1GLPA 4O92A 3VFIA 1TW9A 2IMDA 4ZB9A 1I5GA 1PD21 3ISOA 5G5EA 1GSSA 3KP8A 4GRFA 5GZZB 1TK0B 2E2GA 3F4RA 4J2FA 5G1KA 1H4OA 1EP8A 4GCIA 2B7JA 1EV9A 2H73A 2PERA 5DALB 2VL2C 3FY7A 5IMZA 4WETA 3DRNA 3FW2A 4GQFA 3IRAA 2OE0A 3TRXA 1UA5A 5G31A 2L4QA 5IMDA 4YKGA 1YF1A 4MK3A 5A34B 2WULA 2F3MA 2VLTA 1I9DA 4Z2UA 3GKXA 2H1BA 2LRTA 2I81A 3NOFA 1RW1A 5JWRB 3I9V2 4G0KA 2GSSA 1OC3A 1ACVA 2GZPA 4OCEA 4ZBBA 3APSA 5J4YA 2MMZA 4TR0A 4MZBA 4HDEA 3TOTA 2WJUA 3W6GA 5B6NA 4D73B 4KB3A 4PQIA 5G1LA 1O81A 1OE8A 4XS4B 3KH9A 4TXVA 1NM3A 4KA0A 2VL3A 2C8UA 3QAGA 1THXA 3HHVA 5J40A 3LXTA 2DJ3A 2IMFA 1JZRA 1BG5A 2DJ1A 3MIXA 3F0IA 2REMA 2I9HA 4ECIA 3FR3A 5DJMA 1DSBA 4RUVA 1SL0B 3A5IA 1PA3A 4NXIA 1TRUA 1DE1A 1B8XA 2VAFA 3RPPA 3EE2A 3W8SA 1Q4JA 4ZB7A 4IQ1A 2HE3A 4TXOB 4I8BA 1FHEA 2OADA 2LEGA 2VCQA 1JZDA 1EZKA 2IJYA 3EYTA 2VCXA 1SYXA 3HKRA 4EVMA 3H4KA 2NVLA 4EKZA 3L0HA 2C0EA 1O85A 1O8WA 4V2NA 2I3YA 4MABA 4DSQA 3R3EA 5KOXA 5A5KA 1GSYA 2YWIA 1KTEA 4PX1A 2LJAA 3KJYA 4AGSA 3RAZA 4NV5A 3ZRDA 1JLWA 2CVDA 4IP6A 2H1GA 3DKSA 4MJEA 3BCKA 2F51A 1ZYPA 1O8XA 4WR4A 2YP6A 2VM1A 2LV3A 2FNOA 2CX3A 1T3BA 4ML6A 1PX7A 2C80A 1UC7A 2YCDA 4EC0A 1F9MA 1TTZA 5CRDA 5IMCA 5A1NA 3TJBA 4G0LA 2X99A 1JHBA 2RM6A 3MWHA 1GNWA 5G30A 22GSA 3LJRA 2X49A 4G0IA 3SWLA 3RBTA 4OCFA 1EOGA 5FT3A 2VM2A 3D21A 2TIRA 4YQMA 1YZXA 1B9YC 4POLA 4AKGA 3H8QA 2YJHA 3E9JB 3H93A 1UVZA 1O6JA 3EVIA 1EOHA 2H0HA 1MTCA 4CY6A 5IQYA 4E8EA 3ZIVA 1GNEA 1M2DA 3ZFBA 4EO3A 3F6DA 1USBA 2PVQA 3GMFA 2LUSA 3P7XA 1ILOA 5H5RA 2VCWA 4G10A 3WT2A 2WCIA 2GQLA 4IP1A 1IYHA 3D6IA 1K0OA 5D93A 4K7OA 5AIVA 1SD9A 5AIXA 2GZYA 3PR8A 2AUVA 5FWGA 3LGCA 1XVWA 1Z7RA 5KOWA 4PQ1A 3HMJG 4BWSA 3QMXA 4MZWA 2HNLA 2HLSA 4GWRA 3LFLA 5AGYA 3DMLA 4IJIA 4ZIJA 1YKAA 3A2XA 4YQUA 3DVWA 4Z7XA 1AC1A 4I6XA 3Q18A 2ZCTA 4YH2A 1W4VA 3CSIA 4X4JA 1T8EB 4PNFA 3QFAC 3OR5A 4KDYA 2LNSA 1AQVA 5DVBA 4I97A 3EU3A 3KP9A 4ZL9A 3ZVJD 3QFBC 4XCSA 4QMKA 1M7TA 3TRQA 1GWCA 2XPEA 5HFGA 1PKZA 2B7KA 2H01A 3M9JA 1CQHA 2IIYA 1PRXA 2HSNA 1G7OA 2AV4A 1PL2A 4FQUA 3FZAA 5ECOB 3QDNA 3HXSA 1EV4A 1X9SB 1YJ6A 3GFKA 1C72A 3SBCA 1OE7A 5DBQA 2KP2A 1QXHA 3CSJA 2DLXA 3ZREA 3JCML 1DBYA 1EP7A 3AY8A 1SU9A 1GUMA 5E4WA 2IPAA 3TCOA 2K8VA 3UBLA 3KIJA 4AI6A 4O5UA 1V57A 1SD8A 1IYIA 4KSOA 1NHOA 2IMIA 3U6VA 1FVKA 2AYTA 3F9UA 2GSQA 4JBBA 1J9BA 1J08A 3NIVA 3F63A 5ECNB 1ERUA 4POKA 3WGEA 3WT1A 4I5QA 2JL4A 2J23A 4PNGA 3D0ZA 1TU7A 3UJ1A 3C73A 4HI7A 1TI1A 3EMPA 1B48A 3TUEA 4GSTA 2C3QA 1AQXA 4E68A 4ECCA 3M0FA 3LSZA 2FWEA 4L8EA 3IA1A 2JSZA 3HY2A 4GQCA 5IOWA 2CV4A 5IMVA 3D5JA 4IBPA 2K9FA 2XC2A 4KCAA 1K3YA 2GQKA 3TKQA 3MAKA 2BTOT 2CZ3A 3PPUA 4IW9A 1WJKA 3A5WA 4J57E 2DKHA 4Z2RA 1EEMA 13GSA 1EEJA 4MMMA 4K7NA 3DIEA 4GSSA 2IWTA 5JCUA 4V2LA 3P8WA 2M72A 1X9MB 4POMA 5ECRB 3DXBA 2C4JA 5HR1A 1GRXA 1PN9A 2XBQA 3DVXA 1K0BA 1SVLA 5JWOB 3L9SA 1ERWA 2VO4A 3IBHA 2HRKA 1ERVA 5COHA 4XTSA 2FCHA 3WGDA 3BBYA 2YOIA 2H1DA 1TP9A 3KMOA 3FHKA 18GSA 3FZ9A 4KW6A 4KUNA 6GSYA 4BVYB 3VWVA 4TRXA 4ULXA 2I1UA 1KNGA 3VI5A 2VUPA 3MDKA 1XPVA 4ECBA 1B4PA 4MH2A 4G19A 2JZRA 4LL1B 3ZYWA 1FW1A 4HUAA 2FWHA 2LSTA 3KCMA 3IC8A 3N9JA 3GIXA 4XRAA 1VF3A 2GSTA 1A0FA 2ON5A 3HD5A 4H86A 1LU4A 2QSIA 1GUKA 3D22A 2JZSA 3F4TA 3ERWA 2WRTA 2PMTA 1H75A 1SJZA 2VIMA 2YANA 1PN0A 5J3RA 1F3AA 5A4VA 5ID2A 5HR0A 4F03A 12GSA 9GSSA 3E0UA 4N3ZA 1MD3A 3ZMLA 4A5PA 4QQ7A 3WD6A 3CRTA 4NV2A 4EDYA 3QAVA 1V2AA 3IAM2 3KM6A 5CRGA 4QL9A 2HSYA 1Z3EA 4K2XA 5C04A 1O7UA 5DAKA 1BAYA 4CDOA 2A4HA 3QR6A 2H1LA 1DE2A 4JR4A 4X1UA 3GX0A 1PSQA 2A4VA 5JCWA 3IPZA 1QQ2A 4K0GA 4IN0A 3W8JA 1AW9A 2IL3A 1Y25A 2B3SA 1SVOA 2HFDA 3TB2A 2LQOA 4CW9A 2H70A 5CRWA 2WZ9A 5GSSA 1NSWA 1V40A 1YEPA 5GSTA 3GHAA 2YV7A 3HZ8A 4N11A 5LD0A 1K0NA 3APQA 1U3IA 2L5LA 2YZUA 2DJ0A 2YPMA 4LMVA 2LJKA 1SJIA 1N25A 5BMUB 2JSYA 2B5EA 4EL1A 1SVMA 5D8IA 3IHGA 4PXOA 1AXDA 1R4WA 3FEUA 3DYRA 3VWXA 4MCUA 4XIHA 2FA8A 2LTKA 3GN3A 1N2AA 4Q5NA 3BOAA 1WMJA 2OT3A 3FKFA 1Z6MA 2V32A 1OKDA 4WBRD 3GTUB 5DALA 1XCCA 2PGTA 5E59A 3O76A 1BQ7A 1MDKA 2OACA 5ELGA 1G0TA 5HQPA 3TKRA 2H6XA 5H5QA 3ZL5A 3KEBA 4WBJA 2PUKC 2YZHA 3KTLA 2OKAA 5FHIA 3UAPA 3NZNA 5A34A 2XPDA 1Y6EA 2H30A 2TRCP 1EGRA 4ZBDA 4TKYA 2VLUA 2FUG2 2HI7A 2O85A 2KOKA 2FD3A 2VOCA 3F3RA 2VD0A 2OA7A 3US3A 3M1GA 2AB6A 1S3DA 1LBKA 4WF4A 1AQWA 1TI3A 5KN2A 2LKUA 2I4AA 4KE3A 5HFKA 1QGVA 4D73A 2VLVA 4K8MA 2JADA 3LW9A 4XS4A 4FYCA 3TJKA 1TRWA 3CMIA 2N5AA 5DDLA 5DCHA 1TK8B 1O73A 4ID0A 1YQ1A 4ML1A 1GP1A 2XHFA 2QA2A 3MYDA 2VD1A 2NPBA 2ES7A 3R2QA 3V1WA 3CTFA 1PGTA 2DIYA 4X43A 3UOMA 3HVVA 3CWGA 2YWMA 1YF0A 4FYUA 3IK9A 2GZZA 2N5FA 20GSA 5A4WA 3IR4A 2J9HA 2B5XA 5G5FA 4KDXA 2WFCA 4BVXB 17GSA 3VPTA 3TOUA 2CVBA 3FK8A 4YKFA 2K6VA 1SJ6A 2A2SA 2C0GA 3RDWA 2ON7A 5LNKe 1XFLA 1HYUA 3Q74A 3ME8A 6GSTA 4TXOA 1RK4A 5ECIB 3A3TA 2VL9A 4LMWA 2HSMB 1KEBA 1ZZYA 4MJAA 3FZ5A 3EPTA 3IE3A 4MH3A 5EY6A 1K0MA 3APOA 2OE1A 5J4UA 1U87A 2X8HA 4ZILA 14GSA 4OFMA 2A2PA 3A2VA 2FHEA 3F8UA 4N30A 4O7HA 3J7Yk 5B6MA 1R5AA 2MBSA 3CYNA 4IQAA 5CYYA 5D9XA 2L5OA 1OKTA 5DCGA 1FVJA 3D4MA 2H19A 1GSQA 5J9CA 1VF1A 4HS1A 2MYGA 2F8AA 2DKIA 1GTAA 5DQSA 1F3BA 4K5RA 3C8EA 4K9ZA 1A0RP 4E8HA 2RM5A 3CRUA 4RI6A 4EXJA 2H8LA 3E3EA 1XW6A 2C3TA 4KH7A 2PU9C 3FR6A 5CAXA 2TRXA 1GLQA 3M8NA 4K1FA 4RQXA 3ZFLA 3LXZA 4DVCA 4BWQA 1M2BA 3Q6OA 2MMAA 1S3AA 1GSUA 4V1Ag 4NAXA 2HZEB 4RI7A 4WR5A 5CO3A 4MJCA 1PL1A 2H76A 4DSSB 4XS1A 2HZFA 1CQGA 2DBCA 1OC9B 5CREA 2KHPA 1XW9A 3EINA 5ABRA 1J0FA 1WP0A 19GSA 2DC5A 3KXOA 3LYPA 3GURA 3HJOA 2EC4A 4YQVA 2HRAA 2EIQA 5JCGA 5AN1A 1SL1B 1PKWA 3HJPA 1WPIA 4ZB8A 1SK0A 3MNGA 1A2MA 1GTBA 3DGQA 3GH6A 1V58A 2VCZA 4OFNA 2IFQB 3O6TA 4JE1A 1HD2A 1RQMA 1X5EA 5B8BA 4HQZA 3UVTA 3DD3A 5EL8A 3RHBA 5ECMB 3UARA 3BD2A 1XOBA 1ABAA 3TJJA 3RPNA 2DIZA 1ZCPA 4Q5RA 2EIOA 3GH9A 5H5SA 1X5DA 1QFNA 3F4SA 4I2TA 4DEJA 5JWQB 2GT5A 1MEKA 2MBTA 4AJ7A 4TVEA 1QUWA 3GL5A 3KZQA 3GKNA 2MMNA 3EWLA 2FGXA 3PINA 2FWFA 3LORA 5B8AA 4BL7B 1YVLA 1OVNA 5HR2A 1BYEA 3M9KA 4F0CA 1PX6A 4MF7A 2O7KA 3ZTLA 3BCIA 4IKHA 4K0NA 2YNXA 1TU8A 2H74A 2PVOC 1K3OA 4EE0A 2IMEA 5A5HB 4K6XA 3GUSA 3K8NA 2GGTA 3TKSA 2ZUPA 1YKCA 3O3TA 4YAPA 2RLIA 3ERFA 3HA9A 2H0IA 1BF5A 4OD7A 4TR3A 4V2MA 1Y1UA 1A8LA 4QL7A 2YJ7A 3VI7A 4TR4A 1T4ZA 1HNAA 3ZIJA 4V1Ap 2GS3A 1SKRB 3WYWA 1ZYEA 2B6MA 1TKDB 3I6AA 2IN3A 3A2WA 3H79A 3GKMA 4RQRA 2M80A 1G6YA 1K0DA 4IHUA 4LL4B 3G7JA 2AHEA 5ECKB 3PH9A 4HEA2 1XVQA 2VL2A 3VWWA 1M0UA 1NW2A 2QA1A 1M9AA 1F2EA 1FG4A 4EUYA 2LRCA 4XRDA 2QGVA 2DMMA 3C71A 2PN8A 3GX8A 1WIKA 3FR9A 3QAWA 3MSZA 2RIIA 3S9FA 1R7HA 3IOSA 5LCZA 2ZNMA 4JR6A 6GSXA 1E2YA 1XXUA 4DSRA 4ZB6A 2RUFA 4HU9A 4MPGA 4XS6A 4KX4A 1YDKA 1FO5A 5J47A 3GSTA 2JACA 5J41A 4ZL8A 4IGJA 2X8CA 2H6YA 2E2MA 2L4CA 3LG6A 4HZ2A 4N0VA 1YEXA 3QOUA 5ELAA 2CZ2A 4PUAA 2M46A 3CTGA 2G2QA 2HQTA 1VF2A 10GSA 2V41A 2DJ2A 1OC8A 1WOUA 1N8JA 3FYGA 3C1RA 3GYKA 1G6WA 2C1YA 2HRNA 2FWGA 2KLXA 4AJ6A 4MPFA 4K2DA 1XWCA 5J9BA 3TU3B 3QCPA 3IV4A 3BJ5A 1B9XC 3IDVA 2O5VA 5IO0A 2JZTA 2HT9A 3HDCA 1A8YA 3N5OA 2F9SA 3ERGA 3TGZA 5ENUA 5D9WA 4NPBA 4PURA 4NMUA 1F6MC 4EDZA 3G7IA 2HRFA 2MMOA 1SKWB 16GSA 4CY8A 3DEXA 2X64A 4F2IA 5ECHB 1XW5A 2OBKA 4AKXB 1K3LA 3VLNA 3VURA 2C0DA 2VCTA 4LA1A 1XWBA 1F37A 2UZ8A 2WGRA 1BX9A 5ECQB 4AKIA 3EC3A 1Z6NA 1V98A 2CVKA 4N0ZA 4PTSA 4EF0A 4WEYA 3G9BA 3HJMA 2LQQA 1JFUA 1A2JA 4BVYA 1A2LA 2B1KA 4GLTA 3P2AA 4XHMA 4GDFA 3QD9A 2O87A 3CXGA 8GSSA 5D9VA 2HYXA 2L6DA 1TK5B 3HZ4A 2R4VA 5IMAA 2N5BA 4GSNA 1FB6A 1BG1A 1G7EA 3G7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F07 A;  2L57 A;  3HYP A;  4MZC A;  1GSE A;  1GTI A;  2HSH A;  4Q5Q A;  4HU7 A;  1SEN A;  2K18 A;  1ZOF A;  2FA4 A;  5CRH A;  2A2R A;  1XWA A;  3IXR A;  3TRP A;  5L71 A;  5CP1 A;  4BA7 A;  2CQ9 A;  1URM A;  4ZXG A;  3IHQ A;  1M2A A;  5IM9 A;  1Q98 A;  2R3X A;  4LLR A;  2L59 A;  1SKS B;  5IIZ A;  4HJ2 A;  1XWK A;  1Z5Y E;  2NTO A;  2OE3 A;  2RUE A;  1T1V A;  2H0G A;  3C7M A;  3GKK A;  2C0F A;  2NBS A;  2PPT A;  2FY6 A;  1XWG A;  4J56 E;  2B1L A;  2V2G A;  4USS A;  1TRS A;  4GXZ A;  1AAZ A;  4ISD A;  2DJJ A;  4IS0 A;  1BJX A;  3F6F A;  4NHW A;  5HFI A;  4NWY A;  3M3M A;  2YWO A;  5D9T A;  3Q19 A;  5A4U A;  5GAP D;  5DQY A;  4IVF A;  1FOV A;  1WWJ A;  2V1M A;  1ZMA A;  3UVH A;  4FO5 A;  2QKE A;  1HQO A;  4KND A;  4G9H A;  1KBN A;  1LJR A;  1WE0 A;  5BMU A;  2V6K A;  5KN1 A;  3H1N A;  1T4Y A;  4KF9 A;  4JZQ A;  2V6O A;  3ZMK A;  3KD0 A;  3TKS E;  2FLS A;  1SK2 A;  2CAQ A;  2KUC A;  4TN8 A;  5IMF A;  4N10 A;  1T00 A;  5KEJ A;  5G2Z A;  2G0F A;  5ECS A;  4ZBA A;  1DUG A;  3GTU A;  3WGX A;  3L9U A;  1XIY A;  1A24 A;  3HVX A;  4PUF C;  1ST9 A;  2P0G A;  5B7C A;  5IOX A;  3UIW A;  3VWU A;  4PQH A;  1WRY A;  5C00 A;  4K7I A;  2VCV A;  1ZL9 A;  1OYJ A;  2H6Z A;  2HSN B;  1GSF A;  2R5G A;  3EUR A;  1JLV A;  3RHC A;  1X5C A;  3FZ4 A;  1QMV A;  2P31 A;  4WF5 A;  1FB0 A;  3TJF A;  2YWN A;  4FIW A;  1W89 A;  2R6K A;  4BPY A;  5IPG A;  1M99 A;  3IK7 A;  1YY7 A;  1GH2 A;  3L78 A;  2EIR A;  3GNJ A;  1GUH A;  4MF6 A;  2LRN A;  2L6C A;  3PGT A;  5GAN D;  1BED A;  2LNT A;  4F0B A;  3KH7 A;  4AF2 A;  2AJQ B;  3P90 A;  3HVS A;  1B4Q A;  3UMA A;  1U88 A;  2DJK A;  4KSM A;  2MZC A;  4ACS A;  2WDU A;  1QK8 A;  3J7Y b;  1U6T A;  4OWY A;  1Z9H A;  4JRR A;  4I2U A;  4HJM A;  3QPM A;  4CHS A;  2ALB A;  2H75 A;  5HR3 A;  2D2Z A;  1VF4 A;  4F9Z A;  1R26 A;  5D73 A;  3LYK A;  4WKW A;  4BVX A;  2DSA A;  2GTU A;  1ERT A;  3GV1 A;  3GRX A;  3ZLP A;  2IMK A;  2XBI A;  2BJX A;  2C3N A;  1MDJ A;  1XZO A;  4G2E A;  2O8V B;  3GSS A;  2QC7 A;  1ON4 A;  1S3C A;  1SYR A;  2NDO A;  1XOA A;  2HSM A;  4OO5 A;  1EGO A;  1TOF A;  2GLR A;  1VGL A;  3EU4 A;  2CX4 A;  2P5Q A;  2DML A;  1X9W B;  3LEF A;  2JU5 A;  2LS5 A;  1PMT A;  5J5N A;  4KGI A;  3TKP A;  2R37 A;  2H72 A;  4TR1 B;  2GDR A;  4MDC A;  1TXX A;  6GSS A;  1UN2 A;  4OO4 A;  4AJ8 A;  3L4N A;  1NHY A;  3VK9 A;  5KN3 A;  5CNW A;  4Q5F A;  1SK1 A;  2WS2 A;  4MLY A;  2X8G A;  1GUL A;  3GL3 A;  5F05 A;  5AIS A;  1EWX A;  4L5L A;  1ZYQ B;  4GTU A;  3C1S A;  1GL8 A;  3U5R E;  1ZGN A;  3UL3 A;  3LWA A;  4F82 A;  1U3A A;  3TDG A;  4X0X A;  2HRK B;  4KDU A;  4PGT A;  5DJL A;  1JZO A;  4OFT A;  2HZE A;  3CBU A;  1A23 A;  5KN0 A;  7GSS A;  4MJB A;  3ZZX A;  1MDI A;  1AIU A;  2WB9 A;  3ME7 A;  3FRC A;  4MF5 A;  6GSW A;  1XBS A;  1TRV A;  3HCZ A;  2H71 A;  4NHZ A;  4FH8 A;  4DSS A;  3KGK A;  3ED3 A;  1OC9 A;  3L9V A;  3ZIT A;  3IC4 A;  2CA8 A;  1MD4 A;  1HNC A;  2R2J A;  5F0G A;  1R5P A;  2HXK A;  1AUC A;  1T7P B;  4HOJ A;  1V9W A;  2GVP A;  5ECP B;  2OJL A;  4POB A;  4O32 A;  4IEL A;  4JU5 A;  1OAZ A;  1ML6 A;  4FYB A;  3KTB A;  2GSR A;  2LJR A;  2YN1 A;  3TJG A;  1M9B A;  2IFQ A;  3VPQ A;  4TR1 A;  3EMX A;  3I69 A;  1FAA A;  2B5Y A;  2PBJ A;  6GSU A;  11GS A;  5ECL B;  2GQM A;  5ID2 B;  4KCE A;  2PWJ A;  2H66 A;  4WXT A;  4MA9 A;  2CT6 A;  2E7P A;  3IAS 2;  4JED A;  2YV9 A;  2K8S A;  1VRS D;  5F06 A;  3GA4 A;  4TOP A;  2BMX A;  3F3Q A;  1THO A;  5DAK B;  4L0U A;  2OBI A;  6GSV A;  4HQS A;  4ECJ A;  1TJD A;  4YAV A;  4BL7 A;  5IO2 A;  4ZL7 A;  5EVO A;  3D4T A;  3DWV A;  4L5O A;  4GF0 A;  5INY A;  1HNB A;  1GSD A;  3I43 A;  3LQ7 A;  4HZ4 A;  2KP1 A;  3UEM A;  2E0Q A;  1K0A A;  4O5R A;  2CAI A;  4P3Y B;  5EPF A;  3ZVJ A;  4MP4 A;  4ILF A;  1K0C A;  1PQN A;  3UBK A;  2Z9S A;  5IPH A;  2GT6 A;  3TKS C;  2F8F A;  1JZW A;  1X0R A;  5D96 A;  3CSH A;  2AAW A;  5F8B A;  4IJ3 A;  4OMV A;  1E6B A;  1Z7P A;  4TW5 A;  2H1A A;  1TDI A;  2P5R A;  1SL2 B;  1GTU A;  2O89 A;  4L0W A;  3KMN A;  4KAE A;  1GLP A;  4O92 A;  3VFI A;  1TW9 A;  2IMD A;  4ZB9 A;  1I5G A;  1PD2 1;  3ISO A;  5G5E A;  1GSS A;  3KP8 A;  4GRF A;  5GZZ B;  1TK0 B;  2E2G A;  3F4R A;  4J2F A;  5G1K A;  1H4O A;  1EP8 A;  4GCI A;  2B7J A;  1EV9 A;  2H73 A;  2PER A;  5DAL B;  2VL2 C;  3FY7 A;  5IMZ A;  4WET A;  3DRN A;  3FW2 A;  4GQF A;  3IRA A;  2OE0 A;  3TRX A;  1UA5 A;  5G31 A;  2L4Q A;  5IMD A;  1YF1 A;  4MK3 A;  2WUL A;  2F3M A;  2VLT A;  1I9D A;  3GKX A;  2H1B A;  2LRT A;  2I81 A;  3NOF A;  1RW1 A;  5JWR B;  3I9V 2;  4G0K A;  2GSS A;  1OC3 A;  1ACV A;  2GZP A;  4OCE A;  4ZBB A;  3APS A;  2MMZ A;  4TR0 A;  4MZB A;  4HDE A;  3TOT A;  2WJU A;  3W6G A;  5B6N A;  4D73 B;  4KB3 A;  4PQI A;  5G1L A;  1O81 A;  1OE8 A;  4XS4 B;  3KH9 A;  4TXV A;  1NM3 A;  4KA0 A;  2VL3 A;  2C8U A;  3QAG A;  1THX A;  3HHV A;  3LXT A;  2DJ3 A;  2IMF A;  1JZR A;  1BG5 A;  2DJ1 A;  3F0I A;  2REM A;  2I9H A;  4ECI A;  3FR3 A;  5DJM A;  1DSB A;  4RUV A;  1SL0 B;  1PA3 A;  4NXI A;  1TRU A;  1DE1 A;  1B8X A;  2VAF A;  3RPP A;  3EE2 A;  3W8S A;  1Q4J A;  4IQ1 A;  2HE3 A;  4TXO B;  4I8B A;  1FHE A;  2OAD A;  2LEG A;  2VCQ A;  1JZD A;  1EZK A;  2IJY A;  3EYT A;  2VCX A;  1SYX A;  3HKR A;  4EVM A;  3H4K A;  2NVL A;  4EKZ A;  3L0H A;  2C0E A;  1O85 A;  1O8W A;  4V2N A;  2I3Y A;  4MAB A;  4DSQ A;  3R3E A;  5A5K A;  1GSY A;  2YWI A;  1KTE A;  4PX1 A;  2LJA A;  3KJY A;  4AGS A;  3RAZ A;  4NV5 A;  3ZRD A;  1JLW A;  2CVD A;  4IP6 A;  2H1G A;  3DKS A;  4MJE A;  3BCK A;  2F51 A;  1O8X A;  4WR4 A;  2YP6 A;  2VM1 A;  2LV3 A;  2FNO A;  2CX3 A;  1T3B A;  4ML6 A;  1PX7 A;  2C80 A;  1UC7 A;  2YCD A;  4EC0 A;  1F9M A;  1TTZ A;  5CRD A;  5IMC A;  3TJB A;  4G0L A;  2X99 A;  1JHB A;  2RM6 A;  3MWH A;  1GNW A;  5G30 A;  22GS A;  3LJR A;  4G0I A;  3SWL A;  3RBT A;  4OCF A;  1EOG A;  5FT3 A;  2VM2 A;  3D21 A;  2TIR A;  4YQM A;  1YZX A;  1B9Y C;  4POL A;  3H8Q A;  2YJH A;  3E9J B;  3H93 A;  1UVZ A;  1O6J A;  3EVI A;  1EOH A;  2H0H A;  1MTC A;  5IQY A;  4E8E A;  3ZIV A;  1GNE A;  1M2D A;  3ZFB A;  4EO3 A;  3F6D A;  1USB A;  2PVQ A;  3GMF A;  2LUS A;  3P7X A;  1ILO A;  5H5R A;  2VCW A;  4G10 A;  3WT2 A;  2WCI A;  2GQL A;  4IP1 A;  1IYH A;  3D6I A;  1K0O A;  5D93 A;  4K7O A;  5AIV A;  1SD9 A;  5AIX A;  2GZY A;  3PR8 A;  2AUV A;  5FWG A;  3LGC A;  1XVW A;  1Z7R A;  4PQ1 A;  4BWS A;  3QMX A;  4MZW A;  2HNL A;  2HLS A;  4GWR A;  3LFL A;  5AGY A;  3DML A;  4IJI A;  4ZIJ A;  1YKA A;  3A2X A;  4YQU A;  3DVW A;  4Z7X A;  1AC1 A;  4I6X A;  3Q18 A;  2ZCT A;  4YH2 A;  1W4V A;  3CSI A;  1T8E B;  4PNF A;  3QFA C;  3OR5 A;  4KDY A;  2LNS A;  1AQV A;  5DVB A;  4I97 A;  3EU3 A;  3KP9 A;  4ZL9 A;  3ZVJ D;  3QFB C;  4XCS A;  1M7T A;  3TRQ A;  1GWC A;  2XPE A;  5HFG A;  1PKZ A;  2B7K A;  2H01 A;  3M9J A;  1CQH A;  2IIY A;  1PRX A;  1G7O A;  2AV4 A;  1PL2 A;  4FQU A;  3FZA A;  5ECO B;  3QDN A;  3HXS A;  1EV4 A;  1X9S B;  1YJ6 A;  3GFK A;  1C72 A;  3SBC A;  1OE7 A;  5DBQ A;  2KP2 A;  1QXH A;  3CSJ A;  2DLX A;  3ZRE A;  3JCM L;  1DBY A;  1EP7 A;  3AY8 A;  1SU9 A;  1GUM A;  5E4W A;  2IPA A;  3TCO A;  2K8V A;  3UBL A;  3KIJ A;  1V57 A;  1SD8 A;  1IYI A;  4KSO A;  1NHO A;  2IMI A;  3U6V A;  1FVK A;  2AYT A;  3F9U A;  2GSQ A;  4JBB A;  1J9B A;  1J08 A;  3NIV A;  3F63 A;  5ECN B;  1ERU A;  4POK A;  3WGE A;  3WT1 A;  4I5Q A;  2JL4 A;  2J23 A;  4PNG A;  3D0Z A;  1TU7 A;  3UJ1 A;  3C73 A;  4HI7 A;  1TI1 A;  3EMP A;  1B48 A;  3TUE A;  4GST A;  2C3Q A;  1AQX A;  4ECC A;  3M0F A;  3LSZ A;  2FWE A;  4L8E A;  3IA1 A;  2JSZ A;  3HY2 A;  4GQC A;  5IOW A;  2CV4 A;  5IMV A;  3D5J A;  4IBP A;  2K9F A;  2XC2 A;  4KCA A;  1K3Y A;  2GQK A;  3TKQ A;  3MAK A;  2BTO T;  2CZ3 A;  3PPU A;  4IW9 A;  1WJK A;  3A5W A;  4J57 E;  1EEM A;  13GS A;  1EEJ A;  4MMM A;  4K7N A;  3DIE A;  4GSS A;  2IWT A;  5JCU A;  4V2L A;  3P8W A;  2M72 A;  1X9M B;  4POM A;  5ECR B;  3DXB A;  2C4J A;  5HR1 A;  1GRX A;  1PN9 A;  2XBQ A;  3DVX A;  1K0B A;  5JWO B;  3L9S A;  1ERW A;  2VO4 A;  3IBH A;  2HRK A;  1ERV A;  5COH A;  4XTS A;  2FCH A;  3WGD A;  3BBY A;  2YOI A;  2H1D A;  1TP9 A;  3KMO A;  3FHK A;  18GS A;  3FZ9 A;  4KW6 A;  4KUN A;  6GSY A;  4BVY B;  3VWV A;  4TRX A;  4ULX A;  2I1U A;  1KNG A;  3VI5 A;  2VUP A;  3MDK A;  1XPV A;  4ECB A;  1B4P A;  4MH2 A;  4G19 A;  2JZR A;  4LL1 B;  3ZYW A;  1FW1 A;  4HUA A;  2FWH A;  2LST A;  3KCM A;  3IC8 A;  3N9J A;  3GIX A;  4XRA A;  1VF3 A;  2GST A;  1A0F A;  2ON5 A;  3HD5 A;  4H86 A;  1LU4 A;  2QSI A;  1GUK A;  3D22 A;  2JZS A;  3F4T A;  3ERW A;  2WRT A;  2PMT A;  1H75 A;  1SJZ A;  2VIM A;  2YAN A;  5J3R A;  1F3A A;  5A4V A;  5ID2 A;  5HR0 A;  4F03 A;  12GS A;  9GSS A;  3E0U A;  1MD3 A;  3ZML A;  4QQ7 A;  3WD6 A;  3CRT A;  4NV2 A;  4EDY A;  3QAV A;  1V2A A;  3IAM 2;  3KM6 A;  5CRG A;  4QL9 A;  2HSY A;  1Z3E A;  5C04 A;  1O7U A;  5DAK A;  1BAY A;  4CDO A;  3QR6 A;  1DE2 A;  4JR4 A;  4X1U A;  3GX0 A;  1PSQ A;  2A4V A;  5JCW A;  3IPZ A;  1QQ2 A;  4K0G A;  4IN0 A;  3W8J A;  1AW9 A;  2IL3 A;  1Y25 A;  2B3S A;  2HFD A;  3TB2 A;  2LQO A;  4CW9 A;  2H70 A;  5CRW A;  2WZ9 A;  5GSS A;  1NSW A;  1V40 A;  1YEP A;  5GST A;  3GHA A;  2YV7 A;  3HZ8 A;  4N11 A;  5LD0 A;  1K0N A;  3APQ A;  1U3I A;  2L5L A;  2YZU A;  2DJ0 A;  2YPM A;  4LMV A;  2LJK A;  1SJI A;  2JSY A;  2B5E A;  4EL1 A;  5D8I A;  4PXO A;  1AXD A;  1R4W A;  3FEU A;  3DYR A;  3VWX A;  4MCU A;  4XIH A;  2FA8 A;  2LTK A;  3GN3 A;  1N2A A;  4Q5N A;  3BOA A;  1WMJ A;  3FKF A;  1Z6M A;  2V32 A;  1OKD A;  4WBR D;  3GTU B;  5DAL A;  1XCC A;  2PGT A;  5E59 A;  3O76 A;  1BQ7 A;  1MDK A;  2OAC A;  5ELG A;  1G0T A;  5HQP A;  3TKR A;  2H6X A;  5H5Q A;  3ZL5 A;  3KEB A;  4WBJ A;  2PUK C;  2YZH A;  3KTL A;  2OKA A;  5FHI A;  3UAP A;  3NZN A;  2XPD A;  1Y6E A;  2H30 A;  2TRC P;  1EGR A;  4ZBD A;  4TKY A;  2VLU A;  2FUG 2;  2HI7 A;  2O85 A;  2KOK A;  2FD3 A;  2VOC A;  3F3R A;  2VD0 A;  2OA7 A;  3US3 A;  3M1G A;  2AB6 A;  1S3D A;  1LBK A;  4WF4 A;  1AQW A;  1TI3 A;  5KN2 A;  2LKU A;  2I4A A;  4KE3 A;  5HFK A;  1QGV A;  4D73 A;  2VLV A;  4K8M A;  2JAD A;  4XS4 A;  4FYC A;  3TJK A;  1TRW A;  3CMI A;  2N5A A;  5DDL A;  5DCH A;  1TK8 B;  1O73 A;  4ID0 A;  1YQ1 A;  4ML1 A;  1GP1 A;  2XHF A;  2VD1 A;  2NPB A;  2ES7 A;  3R2Q A;  3V1W A;  3CTF A;  1PGT A;  2DIY A;  4X43 A;  3UOM A;  3HVV A;  2YWM A;  1YF0 A;  4FYU A;  3IK9 A;  2GZZ A;  2N5F A;  20GS A;  5A4W A;  3IR4 A;  2J9H A;  2B5X A;  5G5F A;  4KDX A;  2WFC A;  4BVX B;  17GS A;  3VPT A;  3TOU A;  2CVB A;  3FK8 A;  2K6V A;  1SJ6 A;  2A2S A;  2C0G A;  3RDW A;  2ON7 A;  5LNK e;  1XFL A;  1HYU A;  3Q74 A;  3ME8 A;  6GST A;  4TXO A;  1RK4 A;  5ECI B;  3A3T A;  2VL9 A;  4LMW A;  2HSM B;  1KEB A;  1ZZY A;  4MJA A;  3FZ5 A;  3IE3 A;  4MH3 A;  5EY6 A;  1K0M A;  3APO A;  2OE1 A;  5J4U A;  1U87 A;  2X8H A;  4ZIL A;  14GS A;  4OFM A;  3A2V A;  2FHE A;  3F8U A;  4N30 A;  4O7H A;  3J7Y k;  5B6M A;  1R5A A;  2MBS A;  3CYN A;  4IQA A;  5CYY A;  5D9X A;  2L5O A;  1OKT A;  5DCG A;  1FVJ A;  3D4M A;  2H19 A;  1GSQ A;  5J9C A;  1VF1 A;  4HS1 A;  2MYG A;  2F8A A;  1GTA A;  5DQS A;  1F3B A;  3C8E A;  4K9Z A;  1A0R P;  4E8H A;  2RM5 A;  3CRU A;  4RI6 A;  4EXJ A;  2H8L A;  3E3E A;  1XW6 A;  2C3T A;  4KH7 A;  2PU9 C;  3FR6 A;  5CAX A;  2TRX A;  1GLQ A;  3M8N A;  4K1F A;  4RQX A;  3ZFL A;  3LXZ A;  4DVC A;  4BWQ A;  1M2B A;  3Q6O A;  2MMA A;  1S3A A;  1GSU A;  4V1A g;  4NAX A;  2HZE B;  4RI7 A;  4WR5 A;  5CO3 A;  4MJC A;  1PL1 A;  2H76 A;  4DSS B;  4XS1 A;  2HZF A;  1CQG A;  2DBC A;  1OC9 B;  5CRE A;  2KHP A;  1XW9 A;  3EIN A;  5ABR A;  1J0F A;  1WP0 A;  19GS A;  2DC5 A;  3KXO A;  3LYP A;  3GUR A;  3HJO A;  2EC4 A;  4YQV A;  2HRA A;  2EIQ A;  5JCG A;  5AN1 A;  1SL1 B;  1PKW A;  3HJP A;  1WPI A;  4ZB8 A;  1SK0 A;  3MNG A;  1A2M A;  1GTB A;  3DGQ A;  3GH6 A;  1V58 A;  2VCZ A;  4OFN A;  2IFQ B;  3O6T A;  4JE1 A;  1HD2 A;  1RQM A;  1X5E A;  5B8B A;  4HQZ A;  3UVT A;  3DD3 A;  5EL8 A;  3RHB A;  5ECM B;  3UAR A;  3BD2 A;  1XOB A;  1ABA A;  3TJJ A;  3RPN A;  2DIZ A;  1ZCP A;  4Q5R A;  2EIO A;  3GH9 A;  5H5S A;  1X5D A;  1QFN A;  3F4S A;  4I2T A;  4DEJ A;  5JWQ B;  2GT5 A;  1MEK A;  2MBT A;  4AJ7 A;  4TVE A;  1QUW A;  3GL5 A;  3KZQ A;  3GKN A;  2MMN A;  3EWL A;  2FGX A;  3PIN A;  2FWF A;  3LOR A;  5B8A A;  4BL7 B;  1OVN A;  5HR2 A;  1BYE A;  3M9K A;  4F0C A;  1PX6 A;  4MF7 A;  2O7K A;  3ZTL A;  3BCI A;  4IKH A;  4K0N A;  2YNX A;  1TU8 A;  2H74 A;  2PVO C;  1K3O A;  4EE0 A;  2IME A;  4K6X A;  3GUS A;  3K8N A;  2GGT A;  3TKS A;  2ZUP A;  1YKC A;  3O3T A;  4YAP A;  2RLI A;  3ERF A;  3HA9 A;  2H0I A;  4OD7 A;  4TR3 A;  4V2M A;  1A8L A;  4QL7 A;  2YJ7 A;  3VI7 A;  4TR4 A;  1T4Z A;  1HNA A;  3ZIJ A;  4V1A p;  2GS3 A;  1SKR B;  3WYW A;  1ZYE A;  2B6M A;  1TKD B;  3I6A A;  2IN3 A;  3A2W A;  3H79 A;  3GKM A;  4RQR A;  2M80 A;  1G6Y A;  1K0D A;  4IHU A;  4LL4 B;  3G7J A;  2AHE A;  5ECK B;  3PH9 A;  4HEA 2;  1XVQ A;  2VL2 A;  3VWW A;  1M0U A;  1NW2 A;  1M9A A;  1F2E A;  1FG4 A;  4EUY A;  2LRC A;  4XRD A;  2QGV A;  2DMM A;  3C71 A;  2PN8 A;  3GX8 A;  1WIK A;  3FR9 A;  3QAW A;  3MSZ A;  2RII A;  3S9F A;  1R7H A;  3IOS A;  5LCZ A;  2ZNM A;  4JR6 A;  6GSX A;  1E2Y A;  1XXU A;  4DSR A;  4ZB6 A;  2RUF A;  4HU9 A;  4MPG A;  4XS6 A;  4KX4 A;  1YDK A;  1FO5 A;  3GST A;  2JAC A;  5J41 A;  4ZL8 A;  4IGJ A;  2X8C A;  2H6Y A;  2E2M A;  2L4C A;  3LG6 A;  4HZ2 A;  4N0V A;  1YEX A;  3QOU A;  5ELA A;  2CZ2 A;  4PUA A;  2M46 A;  3CTG A;  2G2Q A;  2HQT A;  1VF2 A;  10GS A;  2V41 A;  2DJ2 A;  1OC8 A;  1WOU A;  1N8J A;  3FYG A;  3C1R A;  3GYK A;  1G6W A;  2C1Y A;  2HRN A;  2FWG A;  2KLX A;  4AJ6 A;  4MPF A;  4K2D A;  1XWC A;  5J9B A;  3QCP A;  3IV4 A;  3BJ5 A;  1B9X C;  3IDV A;  5IO0 A;  2JZT A;  2HT9 A;  3HDC A;  1A8Y A;  3N5O A;  2F9S A;  3ERG A;  3TGZ A;  5ENU A;  5D9W A;  4NPB A;  4PUR A;  4NMU A;  1F6M C;  4EDZ A;  3G7I A;  2HRF A;  2MMO A;  1SKW B;  16GS A;  3DEX A;  2X64 A;  4F2I A;  5ECH B;  1XW5 A;  2OBK A;  1K3L A;  3VLN A;  3VUR A;  2C0D A;  2VCT A;  4LA1 A;  1XWB A;  1F37 A;  2UZ8 A;  2WGR A;  1BX9 A;  5ECQ B;  3EC3 A;  1Z6N A;  1V98 A;  2CVK A;  4N0Z A;  4PTS A;  4EF0 A;  4WEY A;  3G9B A;  3HJM A;  2LQQ A;  1JFU A;  1A2J A;  4BVY A;  1A2L A;  2B1K A;  4GLT A;  3P2A A;  4XHM A;  3QD9 A;  2O87 A;  3CXG A;  8GSS A;  5D9V A;  2HYX A;  2L6D A;  1TK5 B;  3HZ4 A;  2R4V A;  5IMA A;  2N5B A;  4GSN A;  1FB6 A;  1G7E A;  3G7Y A; 
#chains in the Genus database with same CATH topology
 5F07 A;  2L57 A;  3HYP A;  4MZC A;  1GSE A;  1GTI A;  2HSH A;  4Q5Q A;  4HU7 A;  1SEN A;  5A1N B;  2K18 A;  1ZOF A;  2FA4 A;  5CRH A;  2A2R A;  1XWA A;  3IXR A;  3TRP A;  5L71 A;  5CP1 A;  4BA7 A;  2CQ9 A;  1URM A;  4ZXG A;  3IHQ A;  1M2A A;  5IM9 A;  1Q98 A;  2R3X A;  4LLR A;  2L59 A;  1SKS B;  5IIZ A;  4HJ2 A;  1XWK A;  1ZYN A;  1Z5Y E;  2NTO A;  2OE3 A;  2RUE A;  1T1V A;  2H0G A;  3C7M A;  3GKK A;  2EFC A;  2C0F A;  2NBS A;  2R0P A;  2PPT A;  2EFH A;  2FY6 A;  1XWG A;  4J56 E;  1XG8 A;  2B1L A;  2V2G A;  4USS A;  1TRS A;  4GXZ A;  1AAZ A;  4ISD A;  2DJJ A;  4IS0 A;  1BJX A;  3FMW A;  3F6F A;  4NHW A;  5HFI A;  4NWY A;  3M3M A;  2YWO A;  5D9T A;  3Q19 A;  5A4U A;  5GAP D;  5DQY A;  4G01 A;  4IVF A;  1FOV A;  1WWJ A;  2V1M A;  1ZMA A;  3UVH A;  4FO5 A;  2QKE A;  1HQO A;  4KND A;  4G9H A;  1KBN A;  1LJR A;  1WE0 A;  5BMU A;  2V6K A;  5KN1 A;  3H1N A;  1T4Y A;  4KF9 A;  4JZQ A;  2V6O A;  3ZMK A;  3KD0 A;  3TKS E;  2FLS A;  1SK2 A;  2CAQ A;  2KUC A;  4TN8 A;  5IMF A;  2R0C A;  4N10 A;  1T00 A;  5KEJ A;  5G2Z A;  2G0F A;  5ECS A;  4ZBA A;  1DUG A;  3GTU A;  3WGX A;  3L9U A;  1XIY A;  4EIP A;  1A24 A;  4PI2 C;  3HVX A;  4PUF C;  1ST9 A;  2P0G A;  5B7C A;  5IOX A;  3UIW A;  3VWU A;  4PQH A;  1WRY A;  5C00 A;  4K7I A;  4Z2T A;  2VCV A;  1ZL9 A;  1OYJ A;  2H6Z A;  2HSN B;  1GSF A;  2R5G A;  3EUR A;  1JLV A;  3RHC A;  1X5C A;  3FZ4 A;  1QMV A;  2P31 A;  4WF5 A;  1FB0 A;  3TJF A;  2YWN A;  4FIW A;  1W89 A;  2R6K A;  4BPY A;  5IPG A;  1M99 A;  3IK7 A;  1YY7 A;  1GH2 A;  3L78 A;  2EIR A;  3GNJ A;  1GUH A;  4MF6 A;  2LRN A;  2L6C A;  3PGT A;  5GAN D;  1BED A;  2WW1 A;  2LNT A;  4F0B A;  3KH7 A;  4AF2 A;  2AJQ B;  3P90 A;  3HVS A;  1B4Q A;  3UMA A;  1U88 A;  2DJK A;  4KSM A;  2MZC A;  4ACS A;  2WDU A;  1QK8 A;  3J7Y b;  1U6T A;  4OWY A;  4O5Q A;  1Z9H A;  4JRR A;  4I2U A;  1FOH A;  4HJM A;  3QPM A;  4CHS A;  2ALB A;  2H75 A;  5HR3 A;  2D2Z A;  1VF4 A;  4F9Z A;  1R26 A;  5D73 A;  3LYK A;  4WKW A;  4BVX A;  5J4V A;  2DSA A;  2GTU A;  1ERT A;  3GV1 A;  3GRX A;  3ZLP A;  2IMK A;  2XBI A;  2BJX A;  2C3N A;  1MDJ A;  1XZO A;  4G2E A;  2O8V B;  3GSS A;  2QC7 A;  1ON4 A;  1S3C A;  1SYR A;  2NDO A;  1XOA A;  2HSM A;  4OO5 A;  1EGO A;  1TOF A;  2GLR A;  1VGL A;  3EU4 A;  2CX4 A;  2P5Q A;  2DML A;  1X9W B;  3LEF A;  2JU5 A;  2LS5 A;  5BRT A;  1PMT A;  5J5N A;  4KGI A;  3TKP A;  2R37 A;  2H72 A;  4TR1 B;  2GDR A;  4MDC A;  1TXX A;  2EFD A;  6GSS A;  1UN2 A;  4OO4 A;  4K5S A;  4AJ8 A;  3L4N A;  1NHY A;  3VK9 A;  5KN3 A;  5CNW A;  4Q5F A;  1SK1 A;  2WS2 A;  4MLY A;  2X8G A;  1GUL A;  3GL3 A;  4PI0 C;  5F05 A;  5AIS A;  1EWX A;  4L5L A;  1ZYQ B;  2X4A A;  4GTU A;  3C1S A;  1GL8 A;  3U5R E;  1ZGN A;  2WVY A;  3UL3 A;  3LWA A;  4F82 A;  2UV8 G;  1U3A A;  3TDG A;  4X0X A;  2HRK B;  4KDU A;  4PGT A;  5DJL A;  1JZO A;  4OFT A;  2HZE A;  3CBU A;  1A23 A;  5KN0 A;  7GSS A;  4MJB A;  3ZZX A;  1MDI A;  1AIU A;  2WB9 A;  3ME7 A;  3FRC A;  4MF5 A;  6GSW A;  1XBS A;  1TRV A;  3HCZ A;  2H71 A;  4NHZ A;  4FH8 A;  4DSS A;  2VKZ G;  2R0G A;  3KGK A;  3ED3 A;  1OC9 A;  3L9V A;  3ZIT A;  3IC4 A;  2CA8 A;  1MD4 A;  1HNC A;  2R2J A;  5F0G A;  4ICY A;  1R5P A;  2HXK A;  1AUC A;  1T7P B;  4HOJ A;  1V9W A;  2GVP A;  5ECP B;  2OJL A;  4POB A;  4O32 A;  4IEL A;  4JU5 A;  1OAZ A;  1ML6 A;  4FYB A;  3KTB A;  3RGB C;  2GSR A;  2LJR A;  1I1I P;  2YN1 A;  3TJG A;  1M9B A;  2IFQ A;  3VPQ A;  4TR1 A;  3EMX A;  3I69 A;  4AKH A;  1FAA A;  2B5Y A;  2PBJ A;  6GSU A;  11GS A;  5ECL B;  2GQM A;  5ID2 B;  4KCE A;  2PWJ A;  2H66 A;  4WXT A;  4MA9 A;  2CT6 A;  2E7P A;  1TXU A;  3IAS 2;  4JED A;  2YV9 A;  2K8S A;  1VRS D;  5F06 A;  3GA4 A;  4TOP A;  4W66 A;  2BMX A;  3F3Q A;  1THO A;  5DAK B;  4L0U A;  2OBI A;  6GSV A;  4HQS A;  4ECJ A;  1TJD A;  4YAV A;  4BL7 A;  5IO2 A;  4ZL7 A;  5EVO A;  4EIQ A;  3D4T A;  3DWV A;  4L5O A;  4GF0 A;  5INY A;  1HNB A;  1GSD A;  3I43 A;  3LQ7 A;  4HZ4 A;  2KP1 A;  3UEM A;  2E0Q A;  5A5H A;  1K0A A;  4O5R A;  2CAI A;  4P3Y B;  5EPF A;  3ZVJ A;  4MP4 A;  4ILF A;  1K0C A;  1PQN A;  3UBK A;  2Z9S A;  5IPH A;  2GT6 A;  3TKS C;  2F8F A;  1JZW A;  1X0R A;  5D96 A;  3CSH A;  2AAW A;  5F8B A;  4IJ3 A;  4OMV A;  1E6B A;  1Z7P A;  4TW5 A;  2H1A A;  2WVX A;  1TDI A;  2P5R A;  1SL2 B;  1GTU A;  2O89 A;  4L0W A;  2EFE A;  3KMN A;  4MNN A;  4KAE A;  1GLP A;  4O92 A;  3VFI A;  1TW9 A;  2IMD A;  4ZB9 A;  1I5G A;  1PD2 1;  3ISO A;  5G5E A;  1GSS A;  3KP8 A;  4GRF A;  5GZZ B;  1TK0 B;  2E2G A;  3F4R A;  4J2F A;  5G1K A;  1H4O A;  1EP8 A;  4GCI A;  2B7J A;  1EV9 A;  2H73 A;  2PER A;  5DAL B;  2VL2 C;  3FY7 A;  5IMZ A;  4WET A;  3DRN A;  3FW2 A;  4GQF A;  3IRA A;  2OE0 A;  3TRX A;  1UA5 A;  5G31 A;  2L4Q A;  5IMD A;  4YKG A;  1YF1 A;  4MK3 A;  5A34 B;  2WUL A;  2F3M A;  2VLT A;  1I9D A;  4Z2U A;  3GKX A;  2H1B A;  2LRT A;  2I81 A;  3NOF A;  1RW1 A;  5JWR B;  3I9V 2;  4G0K A;  2GSS A;  1OC3 A;  1ACV A;  1PFO A;  2GZP A;  4OCE A;  4ZBB A;  3APS A;  5J4Y A;  2MMZ A;  4TR0 A;  4MZB A;  4HDE A;  3TOT A;  2WJU A;  3W6G A;  5B6N A;  4D73 B;  4KB3 A;  4PQI A;  5G1L A;  1O81 A;  1OE8 A;  4XS4 B;  3KH9 A;  2WZS A;  4TXV A;  1NM3 A;  4KA0 A;  2VL3 A;  2C8U A;  3QAG A;  1THX A;  3HHV A;  5J40 A;  3LXT A;  2DJ3 A;  2O36 A;  2IMF A;  1JZR A;  1BG5 A;  2DJ1 A;  3MIX A;  3F0I A;  2REM A;  2I9H A;  4ECI A;  3FR3 A;  5DJM A;  1DSB A;  4RUV A;  1SL0 B;  3A5I A;  1PA3 A;  4NXI A;  1TRU A;  1DE1 A;  1B8X A;  2VAF A;  3RPP A;  3EE2 A;  3W8S A;  1Q4J A;  4ZB7 A;  4IQ1 A;  2HE3 A;  4TXO B;  4I8B A;  1FHE A;  2OAD A;  2LEG A;  2VCQ A;  1JZD A;  1EZK A;  2IJY A;  3EYT A;  2VCX A;  1SYX A;  3HKR A;  4EVM A;  3H4K A;  2NVL A;  4EKZ A;  3L0H A;  2C0E A;  1O85 A;  1O8W A;  4V2N A;  2I3Y A;  4MAB A;  4DSQ A;  3R3E A;  5KOX A;  5A5K A;  1GSY A;  2YWI A;  1KTE A;  4PX1 A;  2LJA A;  3KJY A;  4AGS A;  3RAZ A;  4NV5 A;  3ZRD A;  2WW3 A;  1JLW A;  2CVD A;  4IP6 A;  2H1G A;  1M3J A;  3DKS A;  4MJE A;  3BCK A;  2F51 A;  1ZYP A;  1O8X A;  4WR4 A;  2YP6 A;  2VM1 A;  2LV3 A;  2FNO A;  2CX3 A;  1T3B A;  4ML6 A;  1PX7 A;  2C80 A;  1UC7 A;  2YCD A;  3HVN A;  4EC0 A;  1F9M A;  1TTZ A;  5CRD A;  5IMC A;  5A1N A;  3TJB A;  4G0L A;  2X99 A;  1JHB A;  2RM6 A;  3MWH A;  1GNW A;  5G30 A;  22GS A;  3LJR A;  2X49 A;  4G0I A;  3SWL A;  3RBT A;  4OCF A;  1EOG A;  5FT3 A;  2VM2 A;  3D21 A;  2TIR A;  4YQM A;  1YZX A;  1B9Y C;  4POL A;  4AKG A;  3H8Q A;  2YJH A;  3E9J B;  3H93 A;  1UVZ A;  1O6J A;  3EVI A;  1EOH A;  2H0H A;  1MTC A;  4CY6 A;  5IQY A;  4E8E A;  3ZIV A;  1GNE A;  1M2D A;  3ZFB A;  4EO3 A;  3F6D A;  1USB A;  2PVQ A;  3GMF A;  2LUS A;  3P7X A;  1ILO A;  5H5R A;  2VCW A;  4G10 A;  3WT2 A;  2WCI A;  2GQL A;  4IP1 A;  1IYH A;  3D6I A;  1K0O A;  5D93 A;  4K7O A;  5AIV A;  1SD9 A;  5AIX A;  2GZY A;  3PR8 A;  2AUV A;  5FWG A;  3LGC A;  1XVW A;  1Z7R A;  5KOW A;  4PQ1 A;  3HMJ G;  4BWS A;  3QMX A;  4MZW A;  2HNL A;  2HLS A;  4GWR A;  3LFL A;  5AGY A;  3DML A;  4IJI A;  4ZIJ A;  1YKA A;  3A2X A;  4YQU A;  3DVW A;  4Z7X A;  1AC1 A;  4I6X A;  3Q18 A;  2ZCT A;  4YH2 A;  1W4V A;  3CSI A;  4X4J A;  1T8E B;  4PNF A;  3QFA C;  3OR5 A;  4KDY A;  2LNS A;  1AQV A;  5DVB A;  4BIK A;  4I97 A;  3EU3 A;  3KP9 A;  4ZL9 A;  3ZVJ D;  3QFB C;  4XCS A;  4QMK A;  1M7T A;  3TRQ A;  1GWC A;  2XPE A;  5HFG A;  1PKZ A;  2B7K A;  2H01 A;  3M9J A;  1CQH A;  2IIY A;  1PRX A;  2HSN A;  1G7O A;  2AV4 A;  1PL2 A;  4FQU A;  3FZA A;  5ECO B;  3QDN A;  3HXS A;  2WW2 A;  1EV4 A;  1X9S B;  1YJ6 A;  3GFK A;  1C72 A;  3SBC A;  1OE7 A;  1M3I A;  5DBQ A;  2KP2 A;  1QXH A;  3CSJ A;  2DLX A;  3ZRE A;  3JCM L;  1DBY A;  1EP7 A;  3AY8 A;  1SU9 A;  1GUM A;  5E4W A;  2IPA A;  3TCO A;  2K8V A;  3UBL A;  3KIJ A;  4AI6 A;  4O5U A;  1V57 A;  1SD8 A;  1IYI A;  4KSO A;  1NHO A;  2IMI A;  3U6V A;  1FVK A;  2AYT A;  3F9U A;  2GSQ A;  4JBB A;  1J9B A;  1J08 A;  3NIV A;  3F63 A;  5ECN B;  1ERU A;  4POK A;  3WGE A;  3WT1 A;  4I5Q A;  2JL4 A;  2J23 A;  4PNG A;  3D0Z A;  1TU7 A;  3UJ1 A;  3C73 A;  4HI7 A;  1TI1 A;  3EMP A;  1B48 A;  3TUE A;  4GST A;  2C3Q A;  1AQX A;  4E68 A;  4ECC A;  3M0F A;  3LSZ A;  2FWE A;  4L8E A;  3IA1 A;  2JSZ A;  3HY2 A;  4GQC A;  5IOW A;  2CV4 A;  5IMV A;  3D5J A;  4IBP A;  2K9F A;  2XC2 A;  4KCA A;  1K3Y A;  2GQK A;  3TKQ A;  3MAK A;  2BTO T;  2CZ3 A;  3PPU A;  4IW9 A;  1WJK A;  3A5W A;  4J57 E;  2DKH A;  4Z2R A;  1EEM A;  13GS A;  1EEJ A;  4MMM A;  4K7N A;  3DIE A;  4GSS A;  2IWT A;  5JCU A;  4V2L A;  3P8W A;  2M72 A;  1X9M B;  4POM A;  5ECR B;  3DXB A;  2C4J A;  5HR1 A;  1GRX A;  1PN9 A;  2XBQ A;  3DVX A;  1K0B A;  1SVL A;  5JWO B;  3L9S A;  1ERW A;  2VO4 A;  3IBH A;  2HRK A;  1ERV A;  5COH A;  4XTS A;  2FCH A;  3WGD A;  3BBY A;  2YOI A;  2H1D A;  1TP9 A;  3KMO A;  3FHK A;  18GS A;  3FZ9 A;  4KW6 A;  4KUN A;  6GSY A;  4BVY B;  3VWV A;  4TRX A;  4ULX A;  2I1U A;  1KNG A;  3VI5 A;  2VUP A;  3MDK A;  1XPV A;  4ECB A;  1B4P A;  4MH2 A;  4G19 A;  2JZR A;  4LL1 B;  3ZYW A;  1FW1 A;  4HUA A;  2FWH A;  2LST A;  3KCM A;  3IC8 A;  3N9J A;  3GIX A;  4XRA A;  1VF3 A;  2GST A;  1A0F A;  2ON5 A;  2O3E A;  3HD5 A;  4H86 A;  1LU4 A;  2QSI A;  1GUK A;  3D22 A;  2JZS A;  3F4T A;  3ERW A;  2WRT A;  2PMT A;  1H75 A;  1SJZ A;  2VIM A;  2YAN A;  1PN0 A;  5J3R A;  1F3A A;  5A4V A;  5ID2 A;  5HR0 A;  4F03 A;  12GS A;  9GSS A;  3E0U A;  4N3Z A;  1MD3 A;  3ZML A;  4A5P A;  4QQ7 A;  3WD6 A;  3CRT A;  4NV2 A;  4EDY A;  3QAV A;  1V2A A;  3IAM 2;  3KM6 A;  5CRG A;  4QL9 A;  2HSY A;  1Z3E A;  4K2X A;  5C04 A;  1O7U A;  5DAK A;  1BAY A;  4CDO A;  2A4H A;  3QR6 A;  2H1L A;  1DE2 A;  4JR4 A;  4X1U A;  3GX0 A;  1PSQ A;  2A4V A;  5JCW A;  3IPZ A;  1QQ2 A;  4K0G A;  4IN0 A;  3W8J A;  1AW9 A;  2IL3 A;  1Y25 A;  2B3S A;  1SVO A;  2WVZ A;  2HFD A;  3TB2 A;  2LQO A;  4CW9 A;  2H70 A;  5CRW A;  2WZ9 A;  5GSS A;  1NSW A;  1V40 A;  1YEP A;  5GST A;  3GHA A;  2YV7 A;  3HZ8 A;  4N11 A;  5LD0 A;  1K0N A;  3APQ A;  1U3I A;  2L5L A;  2YZU A;  2DJ0 A;  2YPM A;  4LMV A;  2LJK A;  1SJI A;  1N25 A;  5BMU B;  2JSY A;  2B5E A;  4EL1 A;  1SVM A;  5D8I A;  3IHG A;  4PXO A;  1AXD A;  1R4W A;  3FEU A;  3DYR A;  3VWX A;  4MCU A;  4XIH A;  2FA8 A;  2LTK A;  3GN3 A;  1N2A A;  4Q5N A;  3BOA A;  1WMJ A;  2OT3 A;  3FKF A;  1Z6M A;  2V32 A;  1OKD A;  4WBR D;  3GTU B;  5DAL A;  1XCC A;  2PGT A;  5E59 A;  3O76 A;  1BQ7 A;  1MDK A;  2OAC A;  5ELG A;  1G0T A;  5HQP A;  3TKR A;  2H6X A;  5H5Q A;  3ZL5 A;  3KEB A;  4WBJ A;  2PUK C;  2YZH A;  3KTL A;  2OKA A;  5FHI A;  3UAP A;  3NZN A;  5A34 A;  2XPD A;  1Y6E A;  2H30 A;  2TRC P;  1EGR A;  4ZBD A;  4TKY A;  2VLU A;  2FUG 2;  2HI7 A;  2O85 A;  2KOK A;  2FD3 A;  2VOC A;  3F3R A;  2VD0 A;  2OA7 A;  3US3 A;  3M1G A;  2AB6 A;  1S3D A;  1LBK A;  4WF4 A;  1AQW A;  1TI3 A;  5KN2 A;  2LKU A;  2I4A A;  4KE3 A;  5HFK A;  1QGV A;  4D73 A;  2VLV A;  4K8M A;  2JAD A;  3LW9 A;  4XS4 A;  4FYC A;  3TJK A;  1TRW A;  3CMI A;  2N5A A;  5DDL A;  5DCH A;  1TK8 B;  1O73 A;  4ID0 A;  1YQ1 A;  4ML1 A;  1GP1 A;  2XHF A;  2QA2 A;  3MYD A;  2VD1 A;  2NPB A;  2ES7 A;  3R2Q A;  3V1W A;  3CTF A;  1PGT A;  2DIY A;  4X43 A;  3UOM A;  3HVV A;  3CWG A;  2YWM A;  1YF0 A;  4FYU A;  4HSC X;  3IK9 A;  2GZZ A;  2WW0 A;  2N5F A;  20GS A;  5A4W A;  3IR4 A;  2J9H A;  2B5X A;  5G5F A;  4KDX A;  2WFC A;  4BVX B;  17GS A;  3VPT A;  3TOU A;  2CVB A;  3FK8 A;  4YKF A;  2K6V A;  1SJ6 A;  2A2S A;  2C0G A;  3RDW A;  2ON7 A;  5LNK e;  1XFL A;  3CHX C;  1HYU A;  3Q74 A;  6GST A;  3ME8 A;  4TXO A;  1RK4 A;  5ECI B;  3A3T A;  2VL9 A;  4LMW A;  2HSM B;  1KEB A;  1ZZY A;  4MJA A;  3FZ5 A;  3EPT A;  3IE3 A;  4MH3 A;  5EY6 A;  1K0M A;  3APO A;  2OE1 A;  5J4U A;  1U87 A;  2X8H A;  4ZIL A;  14GS A;  1YEW C;  4OFM A;  2A2P A;  3A2V A;  2FHE A;  3F8U A;  4N30 A;  4O7H A;  3J7Y k;  5B6M A;  1R5A A;  2MBS A;  3CYN A;  4FXY P;  4IQA A;  5CYY A;  5D9X A;  2L5O A;  1OKT A;  5DCG A;  1FVJ A;  3D4M A;  2H19 A;  1GSQ A;  5J9C A;  1VF1 A;  4HS1 A;  2MYG A;  2F8A A;  2DKI A;  1GTA A;  5DQS A;  1F3B A;  4K5R A;  3C8E A;  4K9Z A;  1A0R P;  4E8H A;  2RM5 A;  3CRU A;  4RI6 A;  4EXJ A;  2H8L A;  3E3E A;  1XW6 A;  2C3T A;  4KH7 A;  2PU9 C;  3FR6 A;  5CAX A;  2TRX A;  1GLQ A;  3M8N A;  4K1F A;  4RQX A;  3ZFL A;  3LXZ A;  4DVC A;  4BWQ A;  1M2B A;  3Q6O A;  2MMA A;  1S3A A;  1GSU A;  4V1A g;  4NAX A;  2HZE B;  4RI7 A;  4WR5 A;  5CO3 A;  4MJC A;  1PL1 A;  2H76 A;  4DSS B;  4XS1 A;  2HZF A;  1CQG A;  2DBC A;  1OC9 B;  5CRE A;  2KHP A;  1XW9 A;  3EIN A;  5ABR A;  4PHZ C;  1J0F A;  1WP0 A;  19GS A;  2DC5 A;  3KXO A;  3LYP A;  3GUR A;  3HJO A;  2EC4 A;  4YQV A;  2HRA A;  2EIQ A;  5JCG A;  5AN1 A;  1SL1 B;  1PKW A;  3HJP A;  1WPI A;  4ZB8 A;  1SK0 A;  3MNG A;  1A2M A;  1GTB A;  3DGQ A;  3GH6 A;  1V58 A;  2VCZ A;  4OFN A;  2IFQ B;  3O6T A;  4JE1 A;  1HD2 A;  1RQM A;  1X5E A;  5B8B A;  4HQZ A;  3UVT A;  3DD3 A;  5EL8 A;  3RHB A;  5ECM B;  1S4B P;  3UAR A;  3BD2 A;  1XOB A;  1ABA A;  1S3R A;  3TJJ A;  3RPN A;  2DIZ A;  1ZCP A;  4Q5R A;  2EIO A;  3GH9 A;  5H5S A;  1X5D A;  1QFN A;  3F4S A;  4I2T A;  4DEJ A;  5JWQ B;  2GT5 A;  1MEK A;  2MBT A;  4AJ7 A;  4TVE A;  1QUW A;  3GL5 A;  3KZQ A;  3GKN A;  2MMN A;  3EWL A;  2FGX A;  3PIN A;  2FWF A;  3LOR A;  5B8A A;  4BL7 B;  1YVL A;  1OVN A;  5HR2 A;  1BYE A;  3M9K A;  4F0C A;  1PX6 A;  4MF7 A;  2O7K A;  3ZTL A;  3BCI A;  4IKH A;  4K0N A;  2YNX A;  1TU8 A;  2H74 A;  2PVO C;  1K3O A;  4EE0 A;  2IME A;  5A5H B;  4K6X A;  3GUS A;  3K8N A;  2GGT A;  3TKS A;  2ZUP A;  1YKC A;  3O3T A;  4YAP A;  2RLI A;  3ERF A;  3HA9 A;  2H0I A;  1BF5 A;  4OD7 A;  4TR3 A;  4V2M A;  1Y1U A;  1A8L A;  4QL7 A;  2YJ7 A;  3VI7 A;  4TR4 A;  1T4Z A;  1HNA A;  3ZIJ A;  4V1A p;  2GS3 A;  1SKR B;  3WYW A;  1ZYE A;  2B6M A;  2WVX B;  1TKD B;  3I6A A;  2IN3 A;  3A2W A;  3H79 A;  3GKM A;  4RQR A;  2M80 A;  1G6Y A;  1K0D A;  4IHU A;  4LL4 B;  3G7J A;  2AHE A;  5ECK B;  3PH9 A;  4HEA 2;  1XVQ A;  2VL2 A;  3VWW A;  1M0U A;  1NW2 A;  2QA1 A;  1M9A A;  1F2E A;  1FG4 A;  4EUY A;  2LRC A;  4XRD A;  2QGV A;  2DMM A;  3C71 A;  2PN8 A;  3GX8 A;  1WIK A;  3FR9 A;  3QAW A;  3MSZ A;  2RII A;  3S9F A;  1R7H A;  3IOS A;  5LCZ A;  2ZNM A;  4JR6 A;  6GSX A;  1E2Y A;  1XXU A;  4DSR A;  3RFR C;  4ZB6 A;  2RUF A;  4HU9 A;  4MPG A;  4XS6 A;  4KX4 A;  1YDK A;  1FO5 A;  5J47 A;  3GST A;  2JAC A;  5J41 A;  4ZL8 A;  4IGJ A;  2X8C A;  2H6Y A;  2E2M A;  2L4C A;  3LG6 A;  4HZ2 A;  4N0V A;  1YEX A;  3QOU A;  5ELA A;  2CZ2 A;  4PUA A;  2M46 A;  3CTG A;  2G2Q A;  2HQT A;  1VF2 A;  10GS A;  2V41 A;  2DJ2 A;  1OC8 A;  1WOU A;  1N8J A;  3FYG A;  3C1R A;  3GYK A;  1G6W A;  2C1Y A;  2HRN A;  2FWG A;  2KLX A;  4AJ6 A;  4MPF A;  4K2D A;  1XWC A;  5J9B A;  3TU3 B;  3QCP A;  3IV4 A;  3BJ5 A;  1B9X C;  3IDV A;  2O5V A;  5IO0 A;  2JZT A;  2HT9 A;  3HDC A;  1A8Y A;  3N5O A;  2F9S A;  3ERG A;  3TGZ A;  5ENU A;  5D9W A;  4NPB A;  4PUR A;  4NMU A;  1F6M C;  4EDZ A;  3G7I A;  2HRF A;  2MMO A;  1SKW B;  16GS A;  4CY8 A;  3DEX A;  2X64 A;  4F2I A;  5ECH B;  1XW5 A;  2OBK A;  4AKX B;  1K3L A;  3VLN A;  3VUR A;  2C0D A;  2VCT A;  4LA1 A;  1XWB A;  1F37 A;  2UZ8 A;  2WGR A;  1BX9 A;  5ECQ B;  4AKI A;  3EC3 A;  1Z6N A;  1V98 A;  2CVK A;  4N0Z A;  4PTS A;  4EF0 A;  4WEY A;  3G9B A;  3HJM A;  2LQQ A;  1JFU A;  1A2J A;  4BVY A;  1A2L A;  2B1K A;  4GLT A;  3P2A A;  4XHM A;  4GDF A;  3QD9 A;  2O87 A;  3CQF A;  3CXG A;  8GSS A;  5D9V A;  2HYX A;  2L6D A;  1TK5 B;  3HZ4 A;  2R4V A;  5IMA A;  2N5B A;  4GSN A;  1FB6 A;  1BG1 A;  1G7E A;  3G7Y A; 
#chains in the Genus database with same CATH homology
 5F07 A;  2L57 A;  3HYP A;  4MZC A;  1GSE A;  1GTI A;  2HSH A;  4Q5Q A;  4HU7 A;  1SEN A;  5A1N B;  2K18 A;  1ZOF A;  2FA4 A;  5CRH A;  2A2R A;  1XWA A;  3IXR A;  3TRP A;  5L71 A;  5CP1 A;  4BA7 A;  2CQ9 A;  1URM A;  4ZXG A;  3IHQ A;  1M2A A;  5IM9 A;  1Q98 A;  2R3X A;  4LLR A;  2L59 A;  1SKS B;  5IIZ A;  4HJ2 A;  1XWK A;  1ZYN A;  1Z5Y E;  2NTO A;  2OE3 A;  2RUE A;  1T1V A;  2H0G A;  3C7M A;  3GKK A;  2EFC A;  2C0F A;  2NBS A;  2R0P A;  2PPT A;  2EFH A;  2FY6 A;  1XWG A;  4J56 E;  2B1L A;  2V2G A;  4USS A;  1TRS A;  4GXZ A;  1AAZ A;  4ISD A;  2DJJ A;  4IS0 A;  1BJX A;  3FMW A;  3F6F A;  4NHW A;  5HFI A;  4NWY A;  3M3M A;  2YWO A;  5D9T A;  3Q19 A;  5A4U A;  5GAP D;  5DQY A;  4G01 A;  4IVF A;  1FOV A;  1WWJ A;  2V1M A;  1ZMA A;  3UVH A;  4FO5 A;  2QKE A;  1HQO A;  4KND A;  4G9H A;  1KBN A;  1LJR A;  1WE0 A;  5BMU A;  2V6K A;  5KN1 A;  3H1N A;  1T4Y A;  4KF9 A;  4JZQ A;  2V6O A;  3ZMK A;  3KD0 A;  3TKS E;  2FLS A;  1SK2 A;  2CAQ A;  2KUC A;  4TN8 A;  5IMF A;  2R0C A;  4N10 A;  1T00 A;  5KEJ A;  5G2Z A;  2G0F A;  5ECS A;  4ZBA A;  1DUG A;  3GTU A;  3WGX A;  3L9U A;  1XIY A;  4EIP A;  1A24 A;  3HVX A;  4PUF C;  1ST9 A;  2P0G A;  5B7C A;  5IOX A;  3UIW A;  3VWU A;  4PQH A;  1WRY A;  5C00 A;  4K7I A;  4Z2T A;  2VCV A;  1ZL9 A;  1OYJ A;  2H6Z A;  2HSN B;  1GSF A;  2R5G A;  3EUR A;  1JLV A;  3RHC A;  1X5C A;  3FZ4 A;  1QMV A;  2P31 A;  4WF5 A;  1FB0 A;  3TJF A;  2YWN A;  4FIW A;  1W89 A;  2R6K A;  4BPY A;  5IPG A;  1M99 A;  3IK7 A;  1YY7 A;  1GH2 A;  3L78 A;  2EIR A;  3GNJ A;  1GUH A;  4MF6 A;  2LRN A;  2L6C A;  3PGT A;  5GAN D;  1BED A;  2LNT A;  4F0B A;  3KH7 A;  4AF2 A;  2AJQ B;  3P90 A;  3HVS A;  1B4Q A;  3UMA A;  1U88 A;  2DJK A;  4KSM A;  2MZC A;  4ACS A;  2WDU A;  1QK8 A;  3J7Y b;  1U6T A;  4OWY A;  4O5Q A;  1Z9H A;  4JRR A;  4I2U A;  1FOH A;  4HJM A;  3QPM A;  4CHS A;  2ALB A;  2H75 A;  5HR3 A;  2D2Z A;  1VF4 A;  4F9Z A;  1R26 A;  5D73 A;  3LYK A;  4WKW A;  4BVX A;  5J4V A;  2DSA A;  2GTU A;  1ERT A;  3GV1 A;  3GRX A;  3ZLP A;  2IMK A;  2XBI A;  2BJX A;  2C3N A;  1MDJ A;  1XZO A;  4G2E A;  2O8V B;  3GSS A;  2QC7 A;  1ON4 A;  1S3C A;  1SYR A;  2NDO A;  1XOA A;  2HSM A;  4OO5 A;  1EGO A;  1TOF A;  2GLR A;  1VGL A;  3EU4 A;  2CX4 A;  2P5Q A;  2DML A;  1X9W B;  3LEF A;  2JU5 A;  2LS5 A;  5BRT A;  1PMT A;  5J5N A;  4KGI A;  3TKP A;  2R37 A;  2H72 A;  4TR1 B;  2GDR A;  4MDC A;  1TXX A;  2EFD A;  6GSS A;  1UN2 A;  4OO4 A;  4K5S A;  4AJ8 A;  3L4N A;  1NHY A;  3VK9 A;  5KN3 A;  5CNW A;  4Q5F A;  1SK1 A;  2WS2 A;  4MLY A;  2X8G A;  1GUL A;  3GL3 A;  5F05 A;  5AIS A;  1EWX A;  4L5L A;  1ZYQ B;  2X4A A;  4GTU A;  3C1S A;  1GL8 A;  3U5R E;  1ZGN A;  3UL3 A;  3LWA A;  4F82 A;  2UV8 G;  1U3A A;  3TDG A;  4X0X A;  2HRK B;  4KDU A;  4PGT A;  5DJL A;  1JZO A;  4OFT A;  2HZE A;  3CBU A;  1A23 A;  5KN0 A;  7GSS A;  4MJB A;  3ZZX A;  1MDI A;  1AIU A;  2WB9 A;  3ME7 A;  3FRC A;  4MF5 A;  6GSW A;  1XBS A;  1TRV A;  3HCZ A;  2H71 A;  4NHZ A;  4FH8 A;  4DSS A;  2VKZ G;  2R0G A;  3KGK A;  3ED3 A;  1OC9 A;  3L9V A;  3ZIT A;  3IC4 A;  2CA8 A;  1MD4 A;  1HNC A;  2R2J A;  5F0G A;  4ICY A;  1R5P A;  2HXK A;  1AUC A;  1T7P B;  4HOJ A;  1V9W A;  2GVP A;  5ECP B;  2OJL A;  4POB A;  4O32 A;  4IEL A;  4JU5 A;  1OAZ A;  1ML6 A;  4FYB A;  3KTB A;  2GSR A;  2LJR A;  2YN1 A;  3TJG A;  1M9B A;  2IFQ A;  3VPQ A;  4TR1 A;  3EMX A;  3I69 A;  4AKH A;  1FAA A;  2B5Y A;  2PBJ A;  6GSU A;  11GS A;  5ECL B;  2GQM A;  5ID2 B;  4KCE A;  2PWJ A;  2H66 A;  4WXT A;  4MA9 A;  2CT6 A;  2E7P A;  1TXU A;  3IAS 2;  4JED A;  2YV9 A;  2K8S A;  1VRS D;  5F06 A;  3GA4 A;  4TOP A;  4W66 A;  2BMX A;  3F3Q A;  1THO A;  5DAK B;  4L0U A;  2OBI A;  6GSV A;  4HQS A;  4ECJ A;  1TJD A;  4YAV A;  4BL7 A;  5IO2 A;  4ZL7 A;  5EVO A;  4EIQ A;  3D4T A;  3DWV A;  4L5O A;  4GF0 A;  5INY A;  1HNB A;  1GSD A;  3I43 A;  3LQ7 A;  4HZ4 A;  2KP1 A;  3UEM A;  2E0Q A;  5A5H A;  1K0A A;  4O5R A;  2CAI A;  4P3Y B;  5EPF A;  3ZVJ A;  4MP4 A;  4ILF A;  1K0C A;  1PQN A;  3UBK A;  2Z9S A;  5IPH A;  2GT6 A;  3TKS C;  2F8F A;  1JZW A;  1X0R A;  5D96 A;  3CSH A;  2AAW A;  5F8B A;  4IJ3 A;  4OMV A;  1E6B A;  1Z7P A;  4TW5 A;  2H1A A;  1TDI A;  2P5R A;  1SL2 B;  1GTU A;  2O89 A;  4L0W A;  2EFE A;  3KMN A;  4MNN A;  4KAE A;  1GLP A;  4O92 A;  3VFI A;  1TW9 A;  2IMD A;  4ZB9 A;  1I5G A;  1PD2 1;  3ISO A;  5G5E A;  1GSS A;  3KP8 A;  4GRF A;  5GZZ B;  1TK0 B;  2E2G A;  3F4R A;  4J2F A;  5G1K A;  1H4O A;  1EP8 A;  4GCI A;  2B7J A;  1EV9 A;  2H73 A;  2PER A;  5DAL B;  2VL2 C;  3FY7 A;  5IMZ A;  4WET A;  3DRN A;  3FW2 A;  4GQF A;  3IRA A;  2OE0 A;  3TRX A;  1UA5 A;  5G31 A;  2L4Q A;  5IMD A;  4YKG A;  1YF1 A;  4MK3 A;  5A34 B;  2WUL A;  2F3M A;  2VLT A;  1I9D A;  4Z2U A;  3GKX A;  2H1B A;  2LRT A;  2I81 A;  3NOF A;  1RW1 A;  5JWR B;  3I9V 2;  4G0K A;  2GSS A;  1OC3 A;  1ACV A;  2GZP A;  4OCE A;  4ZBB A;  3APS A;  5J4Y A;  2MMZ A;  4TR0 A;  4MZB A;  4HDE A;  3TOT A;  2WJU A;  3W6G A;  5B6N A;  4D73 B;  4KB3 A;  4PQI A;  5G1L A;  1O81 A;  1OE8 A;  4XS4 B;  3KH9 A;  4TXV A;  1NM3 A;  4KA0 A;  2VL3 A;  2C8U A;  3QAG A;  1THX A;  3HHV A;  5J40 A;  3LXT A;  2DJ3 A;  2IMF A;  1JZR A;  1BG5 A;  2DJ1 A;  3MIX A;  3F0I A;  2REM A;  2I9H A;  4ECI A;  3FR3 A;  5DJM A;  1DSB A;  4RUV A;  1SL0 B;  3A5I A;  1PA3 A;  4NXI A;  1TRU A;  1DE1 A;  1B8X A;  2VAF A;  3RPP A;  3EE2 A;  3W8S A;  1Q4J A;  4ZB7 A;  4IQ1 A;  2HE3 A;  4TXO B;  4I8B A;  1FHE A;  2OAD A;  2LEG A;  2VCQ A;  1JZD A;  1EZK A;  2IJY A;  3EYT A;  2VCX A;  1SYX A;  3HKR A;  4EVM A;  3H4K A;  2NVL A;  4EKZ A;  3L0H A;  2C0E A;  1O85 A;  1O8W A;  4V2N A;  2I3Y A;  4MAB A;  4DSQ A;  3R3E A;  5KOX A;  5A5K A;  1GSY A;  2YWI A;  1KTE A;  4PX1 A;  2LJA A;  3KJY A;  4AGS A;  3RAZ A;  4NV5 A;  3ZRD A;  1JLW A;  2CVD A;  4IP6 A;  2H1G A;  3DKS A;  4MJE A;  3BCK A;  2F51 A;  1ZYP A;  1O8X A;  4WR4 A;  2YP6 A;  2VM1 A;  2LV3 A;  2FNO A;  2CX3 A;  1T3B A;  4ML6 A;  1PX7 A;  2C80 A;  1UC7 A;  2YCD A;  4EC0 A;  1F9M A;  1TTZ A;  5CRD A;  5IMC A;  5A1N A;  3TJB A;  4G0L A;  2X99 A;  1JHB A;  2RM6 A;  3MWH A;  1GNW A;  5G30 A;  22GS A;  3LJR A;  2X49 A;  4G0I A;  3SWL A;  3RBT A;  4OCF A;  1EOG A;  5FT3 A;  2VM2 A;  3D21 A;  2TIR A;  4YQM A;  1YZX A;  1B9Y C;  4POL A;  4AKG A;  3H8Q A;  2YJH A;  3E9J B;  3H93 A;  1UVZ A;  1O6J A;  3EVI A;  1EOH A;  2H0H A;  1MTC A;  4CY6 A;  5IQY A;  4E8E A;  3ZIV A;  1GNE A;  1M2D A;  3ZFB A;  4EO3 A;  3F6D A;  1USB A;  2PVQ A;  3GMF A;  2LUS A;  3P7X A;  1ILO A;  5H5R A;  2VCW A;  4G10 A;  3WT2 A;  2WCI A;  2GQL A;  4IP1 A;  1IYH A;  3D6I A;  1K0O A;  5D93 A;  4K7O A;  5AIV A;  1SD9 A;  5AIX A;  2GZY A;  3PR8 A;  2AUV A;  5FWG A;  3LGC A;  1XVW A;  1Z7R A;  5KOW A;  4PQ1 A;  3HMJ G;  4BWS A;  3QMX A;  4MZW A;  2HNL A;  2HLS A;  4GWR A;  3LFL A;  5AGY A;  3DML A;  4IJI A;  4ZIJ A;  1YKA A;  3A2X A;  4YQU A;  3DVW A;  4Z7X A;  1AC1 A;  4I6X A;  3Q18 A;  2ZCT A;  4YH2 A;  1W4V A;  3CSI A;  4X4J A;  1T8E B;  4PNF A;  3QFA C;  3OR5 A;  4KDY A;  2LNS A;  1AQV A;  5DVB A;  4I97 A;  3EU3 A;  3KP9 A;  4ZL9 A;  3ZVJ D;  3QFB C;  4XCS A;  4QMK A;  1M7T A;  3TRQ A;  1GWC A;  2XPE A;  5HFG A;  1PKZ A;  2B7K A;  2H01 A;  3M9J A;  1CQH A;  2IIY A;  1PRX A;  2HSN A;  1G7O A;  2AV4 A;  1PL2 A;  4FQU A;  3FZA A;  5ECO B;  3QDN A;  3HXS A;  1EV4 A;  1X9S B;  1YJ6 A;  3GFK A;  1C72 A;  3SBC A;  1OE7 A;  5DBQ A;  2KP2 A;  1QXH A;  3CSJ A;  2DLX A;  3ZRE A;  3JCM L;  1DBY A;  1EP7 A;  3AY8 A;  1SU9 A;  1GUM A;  5E4W A;  2IPA A;  3TCO A;  2K8V A;  3UBL A;  3KIJ A;  4AI6 A;  4O5U A;  1V57 A;  1SD8 A;  1IYI A;  4KSO A;  1NHO A;  2IMI A;  3U6V A;  1FVK A;  2AYT A;  3F9U A;  2GSQ A;  4JBB A;  1J9B A;  1J08 A;  3NIV A;  3F63 A;  5ECN B;  1ERU A;  4POK A;  3WGE A;  3WT1 A;  4I5Q A;  2JL4 A;  2J23 A;  4PNG A;  3D0Z A;  1TU7 A;  3UJ1 A;  3C73 A;  4HI7 A;  1TI1 A;  3EMP A;  1B48 A;  3TUE A;  4GST A;  2C3Q A;  1AQX A;  4E68 A;  4ECC A;  3M0F A;  3LSZ A;  2FWE A;  4L8E A;  3IA1 A;  2JSZ A;  3HY2 A;  4GQC A;  5IOW A;  2CV4 A;  5IMV A;  3D5J A;  4IBP A;  2K9F A;  2XC2 A;  4KCA A;  1K3Y A;  2GQK A;  3TKQ A;  3MAK A;  2BTO T;  2CZ3 A;  3PPU A;  4IW9 A;  1WJK A;  3A5W A;  4J57 E;  2DKH A;  4Z2R A;  1EEM A;  13GS A;  1EEJ A;  4MMM A;  4K7N A;  3DIE A;  4GSS A;  2IWT A;  5JCU A;  4V2L A;  3P8W A;  2M72 A;  1X9M B;  4POM A;  5ECR B;  3DXB A;  2C4J A;  5HR1 A;  1GRX A;  1PN9 A;  2XBQ A;  3DVX A;  1K0B A;  1SVL A;  5JWO B;  3L9S A;  1ERW A;  2VO4 A;  3IBH A;  2HRK A;  1ERV A;  5COH A;  4XTS A;  2FCH A;  3WGD A;  3BBY A;  2YOI A;  2H1D A;  1TP9 A;  3KMO A;  3FHK A;  18GS A;  3FZ9 A;  4KW6 A;  4KUN A;  6GSY A;  4BVY B;  3VWV A;  4TRX A;  4ULX A;  2I1U A;  1KNG A;  3VI5 A;  2VUP A;  3MDK A;  1XPV A;  4ECB A;  1B4P A;  4MH2 A;  4G19 A;  2JZR A;  4LL1 B;  3ZYW A;  1FW1 A;  4HUA A;  2FWH A;  2LST A;  3KCM A;  3IC8 A;  3N9J A;  3GIX A;  4XRA A;  1VF3 A;  2GST A;  1A0F A;  2ON5 A;  3HD5 A;  4H86 A;  1LU4 A;  2QSI A;  1GUK A;  3D22 A;  2JZS A;  3F4T A;  3ERW A;  2WRT A;  2PMT A;  1H75 A;  1SJZ A;  2VIM A;  2YAN A;  1PN0 A;  5J3R A;  1F3A A;  5A4V A;  5ID2 A;  5HR0 A;  4F03 A;  12GS A;  9GSS A;  3E0U A;  4N3Z A;  1MD3 A;  3ZML A;  4A5P A;  4QQ7 A;  3WD6 A;  3CRT A;  4NV2 A;  4EDY A;  3QAV A;  1V2A A;  3IAM 2;  3KM6 A;  5CRG A;  4QL9 A;  2HSY A;  1Z3E A;  4K2X A;  5C04 A;  1O7U A;  5DAK A;  1BAY A;  4CDO A;  2A4H A;  3QR6 A;  2H1L A;  1DE2 A;  4JR4 A;  4X1U A;  3GX0 A;  1PSQ A;  2A4V A;  5JCW A;  3IPZ A;  1QQ2 A;  4K0G A;  4IN0 A;  3W8J A;  1AW9 A;  2IL3 A;  1Y25 A;  2B3S A;  1SVO A;  2HFD A;  3TB2 A;  2LQO A;  4CW9 A;  2H70 A;  5CRW A;  2WZ9 A;  5GSS A;  1NSW A;  1V40 A;  1YEP A;  5GST A;  3GHA A;  2YV7 A;  3HZ8 A;  4N11 A;  5LD0 A;  1K0N A;  3APQ A;  1U3I A;  2L5L A;  2YZU A;  2DJ0 A;  2YPM A;  4LMV A;  2LJK A;  1SJI A;  1N25 A;  5BMU B;  2JSY A;  2B5E A;  4EL1 A;  1SVM A;  5D8I A;  3IHG A;  4PXO A;  1AXD A;  1R4W A;  3FEU A;  3DYR A;  3VWX A;  4MCU A;  4XIH A;  2FA8 A;  2LTK A;  3GN3 A;  1N2A A;  4Q5N A;  3BOA A;  1WMJ A;  2OT3 A;  3FKF A;  1Z6M A;  2V32 A;  1OKD A;  4WBR D;  3GTU B;  5DAL A;  1XCC A;  2PGT A;  5E59 A;  3O76 A;  1BQ7 A;  1MDK A;  2OAC A;  5ELG A;  1G0T A;  5HQP A;  3TKR A;  2H6X A;  5H5Q A;  3ZL5 A;  3KEB A;  4WBJ A;  2PUK C;  2YZH A;  3KTL A;  2OKA A;  5FHI A;  3UAP A;  3NZN A;  5A34 A;  2XPD A;  1Y6E A;  2H30 A;  2TRC P;  1EGR A;  4ZBD A;  4TKY A;  2VLU A;  2FUG 2;  2HI7 A;  2O85 A;  2KOK A;  2FD3 A;  2VOC A;  3F3R A;  2VD0 A;  2OA7 A;  3US3 A;  3M1G A;  2AB6 A;  1S3D A;  1LBK A;  4WF4 A;  1AQW A;  1TI3 A;  5KN2 A;  2LKU A;  2I4A A;  4KE3 A;  5HFK A;  1QGV A;  4D73 A;  2VLV A;  4K8M A;  2JAD A;  3LW9 A;  4XS4 A;  4FYC A;  3TJK A;  1TRW A;  3CMI A;  2N5A A;  5DDL A;  5DCH A;  1TK8 B;  1O73 A;  4ID0 A;  1YQ1 A;  4ML1 A;  1GP1 A;  2XHF A;  2QA2 A;  3MYD A;  2VD1 A;  2NPB A;  2ES7 A;  3R2Q A;  3V1W A;  3CTF A;  1PGT A;  2DIY A;  4X43 A;  3UOM A;  3HVV A;  3CWG A;  2YWM A;  1YF0 A;  4FYU A;  3IK9 A;  2GZZ A;  2N5F A;  20GS A;  5A4W A;  3IR4 A;  2J9H A;  2B5X A;  5G5F A;  4KDX A;  2WFC A;  4BVX B;  17GS A;  3VPT A;  3TOU A;  2CVB A;  3FK8 A;  4YKF A;  2K6V A;  1SJ6 A;  2A2S A;  2C0G A;  3RDW A;  2ON7 A;  5LNK e;  1XFL A;  1HYU A;  3Q74 A;  3ME8 A;  6GST A;  4TXO A;  1RK4 A;  5ECI B;  3A3T A;  2VL9 A;  4LMW A;  2HSM B;  1KEB A;  1ZZY A;  4MJA A;  3FZ5 A;  3EPT A;  3IE3 A;  4MH3 A;  5EY6 A;  1K0M A;  3APO A;  2OE1 A;  5J4U A;  1U87 A;  2X8H A;  4ZIL A;  14GS A;  4OFM A;  2A2P A;  3A2V A;  2FHE A;  3F8U A;  4N30 A;  4O7H A;  3J7Y k;  5B6M A;  1R5A A;  2MBS A;  3CYN A;  4IQA A;  5CYY A;  5D9X A;  2L5O A;  1OKT A;  5DCG A;  1FVJ A;  3D4M A;  2H19 A;  1GSQ A;  5J9C A;  1VF1 A;  4HS1 A;  2MYG A;  2F8A A;  2DKI A;  1GTA A;  5DQS A;  1F3B A;  4K5R A;  3C8E A;  4K9Z A;  1A0R P;  4E8H A;  2RM5 A;  3CRU A;  4RI6 A;  4EXJ A;  2H8L A;  3E3E A;  1XW6 A;  2C3T A;  4KH7 A;  2PU9 C;  3FR6 A;  5CAX A;  2TRX A;  1GLQ A;  3M8N A;  4K1F A;  4RQX A;  3ZFL A;  3LXZ A;  4DVC A;  4BWQ A;  1M2B A;  3Q6O A;  2MMA A;  1S3A A;  1GSU A;  4V1A g;  4NAX A;  2HZE B;  4RI7 A;  4WR5 A;  5CO3 A;  4MJC A;  1PL1 A;  2H76 A;  4DSS B;  4XS1 A;  2HZF A;  1CQG A;  2DBC A;  1OC9 B;  5CRE A;  2KHP A;  1XW9 A;  3EIN A;  5ABR A;  1J0F A;  1WP0 A;  19GS A;  2DC5 A;  3KXO A;  3LYP A;  3GUR A;  3HJO A;  2EC4 A;  4YQV A;  2HRA A;  2EIQ A;  5JCG A;  5AN1 A;  1SL1 B;  1PKW A;  3HJP A;  1WPI A;  4ZB8 A;  1SK0 A;  3MNG A;  1A2M A;  1GTB A;  3DGQ A;  3GH6 A;  1V58 A;  2VCZ A;  4OFN A;  2IFQ B;  3O6T A;  4JE1 A;  1HD2 A;  1RQM A;  1X5E A;  5B8B A;  4HQZ A;  3UVT A;  3DD3 A;  5EL8 A;  3RHB A;  5ECM B;  3UAR A;  3BD2 A;  1XOB A;  1ABA A;  3TJJ A;  3RPN A;  2DIZ A;  1ZCP A;  4Q5R A;  2EIO A;  3GH9 A;  5H5S A;  1X5D A;  1QFN A;  3F4S A;  4I2T A;  4DEJ A;  5JWQ B;  2GT5 A;  1MEK A;  2MBT A;  4AJ7 A;  4TVE A;  1QUW A;  3GL5 A;  3KZQ A;  3GKN A;  2MMN A;  3EWL A;  2FGX A;  3PIN A;  2FWF A;  3LOR A;  5B8A A;  4BL7 B;  1YVL A;  1OVN A;  5HR2 A;  1BYE A;  3M9K A;  4F0C A;  1PX6 A;  4MF7 A;  2O7K A;  3ZTL A;  3BCI A;  4IKH A;  4K0N A;  2YNX A;  1TU8 A;  2H74 A;  2PVO C;  1K3O A;  4EE0 A;  2IME A;  5A5H B;  4K6X A;  3GUS A;  3K8N A;  2GGT A;  3TKS A;  2ZUP A;  1YKC A;  3O3T A;  4YAP A;  2RLI A;  3ERF A;  3HA9 A;  2H0I A;  1BF5 A;  4OD7 A;  4TR3 A;  4V2M A;  1Y1U A;  1A8L A;  4QL7 A;  2YJ7 A;  3VI7 A;  4TR4 A;  1T4Z A;  1HNA A;  3ZIJ A;  4V1A p;  2GS3 A;  1SKR B;  3WYW A;  1ZYE A;  2B6M A;  1TKD B;  3I6A A;  2IN3 A;  3A2W A;  3H79 A;  3GKM A;  4RQR A;  2M80 A;  1G6Y A;  1K0D A;  4IHU A;  4LL4 B;  3G7J A;  2AHE A;  5ECK B;  3PH9 A;  4HEA 2;  1XVQ A;  2VL2 A;  3VWW A;  1M0U A;  1NW2 A;  2QA1 A;  1M9A A;  1F2E A;  1FG4 A;  4EUY A;  2LRC A;  4XRD A;  2QGV A;  2DMM A;  3C71 A;  2PN8 A;  3GX8 A;  1WIK A;  3FR9 A;  3QAW A;  3MSZ A;  2RII A;  3S9F A;  1R7H A;  3IOS A;  5LCZ A;  2ZNM A;  4JR6 A;  6GSX A;  1E2Y A;  1XXU A;  4DSR A;  4ZB6 A;  2RUF A;  4HU9 A;  4MPG A;  4XS6 A;  4KX4 A;  1YDK A;  1FO5 A;  5J47 A;  3GST A;  2JAC A;  5J41 A;  4ZL8 A;  4IGJ A;  2X8C A;  2H6Y A;  2E2M A;  2L4C A;  3LG6 A;  4HZ2 A;  4N0V A;  1YEX A;  3QOU A;  5ELA A;  2CZ2 A;  4PUA A;  2M46 A;  3CTG A;  2G2Q A;  2HQT A;  1VF2 A;  10GS A;  2V41 A;  2DJ2 A;  1OC8 A;  1WOU A;  1N8J A;  3FYG A;  3C1R A;  3GYK A;  1G6W A;  2C1Y A;  2HRN A;  2FWG A;  2KLX A;  4AJ6 A;  4MPF A;  4K2D A;  1XWC A;  5J9B A;  3TU3 B;  3QCP A;  3IV4 A;  3BJ5 A;  1B9X C;  3IDV A;  2O5V A;  5IO0 A;  2JZT A;  2HT9 A;  3HDC A;  1A8Y A;  3N5O A;  2F9S A;  3ERG A;  3TGZ A;  5ENU A;  5D9W A;  4NPB A;  4PUR A;  4NMU A;  1F6M C;  4EDZ A;  3G7I A;  2HRF A;  2MMO A;  1SKW B;  16GS A;  4CY8 A;  3DEX A;  2X64 A;  4F2I A;  5ECH B;  1XW5 A;  2OBK A;  4AKX B;  1K3L A;  3VLN A;  3VUR A;  2C0D A;  2VCT A;  4LA1 A;  1XWB A;  1F37 A;  2UZ8 A;  2WGR A;  1BX9 A;  5ECQ B;  4AKI A;  3EC3 A;  1Z6N A;  1V98 A;  2CVK A;  4N0Z A;  4PTS A;  4EF0 A;  4WEY A;  3G9B A;  3HJM A;  2LQQ A;  1JFU A;  1A2J A;  4BVY A;  1A2L A;  2B1K A;  4GLT A;  3P2A A;  4XHM A;  4GDF A;  3QD9 A;  2O87 A;  3CXG A;  8GSS A;  5D9V A;  2HYX A;  2L6D A;  1TK5 B;  3HZ4 A;  2R4V A;  5IMA A;  2N5B A;  4GSN A;  1FB6 A;  1BG1 A;  1G7E A;  3G7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...