1MD3A

A folding mutant of human class pi glutathione transferase, created by mutating glycine 146 of the wild-type protein to alanine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVADQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pi glutathione transferase
publication title Contribution of Glycine 146 to a Conserved Folding Module Affecting Stability and Refolding of Human Glutathione Transferase P1-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1md3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1md3A01
6GSWA 3U6VA 3DMLA 5IMFA 2JSYA 1F9MA 2L6CA 1UVZA 2HRFA 2AV4A 2L59A 3UVTA 1HNAA 2NBSA 3ZIJA 1OE7A 7GSSA 1GSYA 1ABAA 4LMWA 4E8EA 3C73A 3H93A 22GSA 3O76A 5IMVA 1K0NA 4IJIA 3M9KA 4TXVA 4KX4A 1UN2A 3ZRDA 1V2AA 4OFTA 1AQVA 3A2VA 4YAPA 2M46A 3VFIA 2IWTA 4TRXA 2XC2A 3IK9A 2H70A 2JADA 5D9TA 4YQVA 3D22A 19GSA 3GTUA 5H5QA 5A4VA 2C3TA 4MJCA 2B1LA 3QD9A 1M0UA 2RUEA 3VWWA 4G0IA 2CQ9A 4WF4A 4MH2A 1CQGA 2GZZA 4J57E 3TB2A 4OD7A 3EE2A 5B6NA 4K2DA 2YOIA 1RW1A 4N10A 5AISA 5KEJA 5G2ZA 4HJMA 4L0UA 4KSOA 6GSSA 4LL4B 4F0CA 4K7NA 2NDOA 2FGXA 4HZ4A 3RAZA 4CDOA 4N0VA 4ZL7A 5HR2A 2I3YA 5CRDA 1OC9A 4GRFA 5HR3A 1JLVA 1NW2A 3US3A 2V1MA 1TTZA 3HD5A 3R3EA 1LU4A 5B6MA 3GKMA 4TR1A 1TW9A 2GDRA 2VL9A 4MA9A 4O7HA 1YF0A 1HD2A 3Q74A 2FHEA 5H5RA 1GL8A 2C0FA 2YZUA 4V2MA 2PMTA 1YQ1A 2IPAA 1A2JA 5DQSA 3FK8A 4IQ1A 3TJKA 1RK4A 5HFKA 5IMDA 2CX4A 2YWNA 5FWGA 1OC8A 5D73A 3FEUA 4V1Ap 3D4TA 3HKRA 2E2MA 2YWOA 5JWRB 4MF7A 1R7HA 4PTSA 4X1UA 4G0LA 2IL3A 4KE3A 1X5CA 1GSDA 4LL1B 2VM1A 2LQOA 4KUNA 4V1Ag 2QSIA 3GV1A 1R4WA 4DVCA 4MF5A 3IC4A 4DEJA 4JR6A 4TR3A 4ZBBA 1IYIA 2WJUA 4XHMA 1WE0A 1SD9A 4HQSA 4EF0A 2E2GA 1SK0A 4Q5RA 1BX9A 2NPBA 4DSSA 3TJBA 3UJ1A 4XIHA 3FYGA 2GLRA 2DJ1A 1ML6A 1SYXA 3G9BA 4V2LA 2H1AA 2KP2A 2MMNA 1SK2A 1B9YC 5EL8A 3P7XA 1XW6A 3MAKA 4IVFA 3VPTA 2O85A 4YH2A 2GZYA 4J56E 4KAEA 1I9DA 1X9SB 2DSAA 1PSQA 3N9JA 3FKFA 2CV4A 2FCHA 4MH3A 4PNGA 2H1GA 2X8GA 4IP1A 1ZOFA 3GL3A 4ID0A 1NHOA 2V41A 1A0FA 1ZZYA 1EOGA 1XOBA 12GSA 4KDXA 3QPMA 3GL5A 4ZL8A 3GA4A 4TXOA 5ECRB 2IMDA 3FZ5A 1JZOA 4GCIA 4BVYA 1DSBA 2FA4A 1T3BA 2JZRA 1X9WB 1YJ6A 3KH9A 1OKTA 1ZMAA 2N5AA 2IFQA 2AB6A 4D73B 3I43A 2J9HA 3CTFA 5ABRA 2ON7A 5G31A 2FUG2 1QXHA 4XS6A 2KLXA 2H1BA 2WGRA 2A4VA 1M9AA 5F06A 4MPGA 3DVWA 2L4CA 4MZBA 3VWVA 14GSA 2LEGA 5JWQB 4GTUA 5JWOB 4HUAA 5INYA 3GKNA 3GX8A 2E7PA 1PRXA 3IHQA 1M99A 1GNEA 1ERWA 2WRTA 2B5YA 4GQFA 2D2ZA 2LV3A 1QUWA 4FYCA 1XWKA 2KUCA 1HYUA 2C3NA 3NZNA 5D9WA 4PNFA 1AIUA 1OC3A 4L5LA 1QMVA 2EIRA 2CVDA 4TOPA 2DIZA 2K9FA 4NMUA 1WWJA 2O87A 1GTUA 3LQ7A 3PINA 3ISOA 2L5LA 2OE1A 3OR5A 2BJXA 5B8AA 4EE0A 3F4TA 4F9ZA 3ZTLA 5DCGA 1Q98A 2CZ3A 4TR0A 1GWCA 2DIYA 4PQ1A 3WYWA 1FW1A 3GH9A 3QFBC 3UIWA 4KSMA 1V57A 5IM9A 5F05A 1ERTA 3KEBA 3HCZA 3L9SA 3KZQA 4FO5A 3MNGA 1O81A 1QQ2A 1SKWB 5B8BA 2H0HA 3BJ5A 4EDYA 3ZIVA 5AIVA 1B4PA 1PKWA 4RI7A 2PN8A 3EMXA 2RM5A 2PGTA 5DVBA 2G0FA 4Q5NA 4NV5A 4N0ZA 2HSNB 3ZFBA 1VGLA 4ZB9A 1PD21 3L9VA 5EPFA 1TJDA 3LG6A 4F2IA 1GTAA 4JRRA 5ENUA 4I2TA 2GQMA 3HJMA 4ECJA 4ZXGA 4V2NA 5DAKA 1K3YA 1JZWA 3LXZA 1XW5A 1A2MA 1OKDA 3FR3A 2PU9C 1R26A 5KN2A 1ZYEA 3CSJA 3QAVA 1WP0A 2B3SA 4OMVA 3H79A 3K8NA 3UMAA 1K0OA 3ME8A 3VWUA 3ME7A 4AJ8A 2C0EA 2HT9A 2XBIA 5CRGA 1GH2A 3D21A 1M2AA 1Y6EA 3UVHA 2WS2A 2H0GA 1Z7PA 4K1FA 3HVVA 5HFIA 2NTOA 1ON4A 4K0NA 3TCOA 2P5QA 3A2XA 3F6DA 1TK8B 4X0XA 3QAWA 3VURA 3KJYA 2N5FA 3DXBA 4HOJA 4EO3A 1AW9A 2ZUPA 1K0DA 2K18A 2H66A 1GUKA 4KDUA 1FOVA 4ECCA 1M9BA 4IGJA 3AY8A 4ECIA 2FWHA 3IAS2 4NAXA 3L4NA 3HHVA 1TRUA 4WKWA 1EOHA 3F4RA 3D0ZA 2H0IA 4N11A 4MLYA 4USSA 4L8EA 5ECQB 3EWLA 4RUVA 5JCUA 1PA3A 2DMMA 1YF1A 3QMXA 4G10A 2OE3A 3IPZA 2X64A 3L0HA 3L9UA 3RPPA 3VWXA 3E9JB 2B7KA 2AJQB 3HVSA 2HRKA 2OADA 2HI7A 5ECMB 1GP1A 4H86A 4TN8A 5GSSA 5HQPA 1EEMA 4F0BA 1G7EA 1OE8A 3G7IA 3P90A 5ELGA 5DALA 5GSTA 1EWXA 1XIYA 4MPFA 3IDVA 11GSA 1G7OA 5J4UA 3ZVJD 1B9XC 2VLUA 3EC3A 1E2YA 1SU9A 4AGSA 1GLQA 2VO4A 3GUSA 1ILOA 1O85A 1MDKA 3H8QA 1EEJA 4JEDA 4EC0A 3DRNA 2V6KA 2H8LA 2V6OA 1G6WA 4BWQA 2FLSA 4TR4A 2FWEA 4G19A 4MZCA 4NXIA 1YKAA 5HR1A 1XWCA 5CP1A 1JLWA 4BA7A 3M8NA 5ECKB 1BYEA 1F37A 4BWSA 2HXKA 3ZZXA 1F2EA 3F9UA 3TGZA 1EV4A 5HFGA 1MDJA 3GTUB 1GLPA 5G30A 2MMOA 1HNBA 1A23A 4J2FA 2TRXA 3F8UA 5JCWA 3QOUA 2JZTA 1W4VA 3LXTA 2K6VA 3EMPA 1SK1A 2DJJA 5CRHA 4EVMA 4NHWA 2R4VA 3KGKA 3ZREA 2HZEA 2GSRA 3BCIA 3JCML 3F0IA 4IELA 3DVXA 4HEA2 4WBRD 2K8SA 4ML1A 1Z6NA 3LSZA 2CVKA 2OBKA 1XOAA 3EU4A 3FR6A 3BCKA 1WJKA 1VF2A 3IC8A 4ZB6A 4BVXB 2C0GA 2HLSA 2AAWA 5G1KA 5C00A 20GSA 1S3CA 1URMA 4L5OA 4OCEA 4OO5A 1XWBA 2H6ZA 1OC9B 1XPVA 4RI6A 1TRSA 3FRCA 3KM6A 4MJEA 1FO5A 2PVOC 2UZ8A 3KIJA 2B5XA 2RIIA 5AIXA 2ZNMA 3PH9A 4TR1B 2F3MA 3CMIA 3CSHA 4POLA 3ERGA 3TRQA 2YZHA 2LJKA 3GIXA 1AC1A 3A5WA 1RQMA 3IE3A 3TKRA 4WXTA 5IOWA 4P3YB 5CYYA 1PL2A 2ES7A 3NOFA 4I5QA 3TKSA 5EVOA 2YN1A 4YQUA 1GUHA 3DGQA 1M2DA 4TKYA 4POBA 4BL7A 4LA1A 3RDWA 5DBQA 4MJAA 3V1WA 4PURA 2CT6A 2LRNA 1FG4A 2ALBA 1WMJA 3GRXA 5DCHA 4IKHA 3H1NA 3ZMKA 2PUKC 1EV9A 1SKSB 1PKZA 1MD3A 3CBUA 2H1DA 3LYKA 1TDIA 1V98A 4K9ZA 2EIOA 4ULXA 4IHUA 2H72A 2MZCA 2YP6A 3EU3A 3LJRA 5DQYA 1YEXA 4OFMA 2VCZA 3HYPA 1V40A 1FVJA 3M0FA 2IIYA 4WETA 2PVQA 3N5OA 1K0AA 4DSSB 1KNGA 1HNCA 1ZCPA 1YZXA 2O7KA 1A8YA 2GVPA 3LYPA 3IRAA 2LRTA 4WBJA 4O32A 2DBCA 5CREA 4K8MA 1ST9A 4XS4A 4PXOA 5CAXA 4RQRA 4I8BA 4YAVA 5DDLA 1X0RA 2LNSA 1LJRA 1ERVA 1O73A 3TRXA 2L4QA 3DD3A 1FVKA 2FWFA 1A8LA 2O8VB 3QCPA 4ZILA 4TXOB 1PL1A 1T7PB 3VPQA 4K6XA 4ILFA 3D6IA 1YEPA 4BVYB 3IOSA 3BBYA 1M2BA 3A3TA 3TKQA 3TKPA 3MWHA 3I69A 1BAYA 5G1LA 1S3DA 6GSTA 1FB0A 2GSSA 1SYRA 2PPTA 4MMMA 1UC7A 3UARA 4KF9A 1FHEA 1XWAA 2OACA 2P31A 1K0BA 3BOAA 1J08A 3APOA 3ZITA 3EINA 2FWGA 5GZZB 2OA7A 2LJRA 4ZB8A 1WIKA 2DMLA 2VLTA 17GSA 3GMFA 2N5BA 1I5GA 3WT2A 3LORA 2HSMA 1A24A 4FIWA 4DSRA 2L57A 3GFKA 3KMNA 2TIRA 2WZ9A 3TUEA 2C8UA 4XRDA 2CX3A 3CYNA 4MDCA 2P5RA 2QGVA 5J41A 3TOTA 3J7Yk 2Z9SA 1EGRA 3RHCA 2YJ7A 1K0MA 2YCDA 3APSA 1K0CA 2X8HA 4HU7A 2GTUA 3QDNA 1MDIA 1PQNA 2G2QA 1MTCA 1TK0B 4F82A 1X9MB 2IJYA 4HI7A 6GSVA 3CTGA 5IOXA 1X5DA 5IMZA 2IN3A 2AHEA 2LUSA 4K0GA 1XBSA 18GSA 3M9JA 1TU8A 3GKKA 5J3RA 1AXDA 4KW6A 1SJIA 4OCFA 2BMXA 1X5EA 2O89A 2HZFA 5DJLA 3Q19A 1XXUA 3F3QA 2VCVA 2JZSA 5LD0A 5E59A 3G7YA 1GSEA 3F63A 2MMZA 3ED3A 3H4KA 4LMVA 1U3AA 2A2RA 5DAKB 3HDCA 2VL3A 3P8WA 4HJ2A 1GSQA 4PX1A 1JHBA 2PBJA 3O6TA 1EP8A 4NHZA 1J0FA 1T4YA 4KB3A 3ZYWA 3CRTA 4CHSA 3LEFA 3UL3A 3ERFA 4ZL9A 4IS0A 1Y25A 2XPEA 5A4WA 4KH7A 2XPDA 1O8WA 1DUGA 3IK7A 2WCIA 1GUMA 2DLXA 3HXSA 3IR4A 3UBKA 4OO4A 5LNKe 2RUFA 1ERUA 2PERA 2X8CA 4FYUA 5J5NA 4HZ2A 1SKRB 3QR6A 3CRUA 2EIQA 5EY6A 3C8EA 3ZMLA 5IPGA 1G6YA 2VD1A 2QKEA 2B7JA 1XWGA 2VM2A 3SBCA 5ECPB 2YANA 1TU7A 5IQYA 2H6YA 1U88A 2F9SA 1PN9A 4ZBDA 2CZ2A 5KN1A 3TJGA 5ID2A 4MCUA 2R37A 2GQLA 1O7UA 2EC4A 1AUCA 3APQA 4O92A 5D9VA 3U5RE 1JZDA 1WOUA 1WPIA 2RLIA 1U87A 4MJBA 2M72A 2B6MA 1T1VA 3O3TA 1GNWA 2R3XA 2F8FA 5H5SA 4XTSA 2H19A 4L0WA 2XHFA 1OVNA 1XCCA 1GSSA 4GSNA 4IW9A 1U6TA 3D5JA 3UEMA 1AQWA 2VCQA 5F07A 4WF5A 1O6JA 2HRAA 1ZGNA 2E0QA 2LRCA 2B1KA 4PUAA 1V9WA 1XVQA 4KNDA 4KCEA 1N2AA 4QL9A 3FR9A 1Z7RA 5DALB 1A0RP 3E0UA 1YDKA 3W6GA 4FH8A 5JCGA 1XFLA 1Z9HA 2FA8A 3HVXA 3HY2A 4Z7XA 4Q5FA 3KTLA 1KBNA 5HR0A 3E3EA 2DJ3A 3FW2A 1BQ7A 3MDKA 1PGTA 5IO2A 1Z5YE 3GYKA 2C1YA 4AF2A 5J9BA 2HRNA 1E6BA 1H4OA 2CVBA 3KMOA 3DWVA 2FNOA 4POKA 2KP1A 1HQOA 1GRXA 1SJZA 3BD2A 4HQZA 3I6AA 4MP4A 3KP8A 4AJ7A 4X43A 2IMKA 2VUPA 4HU9A 2GQKA 2LSTA 3CXGA 4ACSA 3GX0A 4IJ3A 3TOUA 4IP6A 2PWJA 3GN3A 1B48A 1GTIA 4GXZA 2ON5A 3VI5A 3DYRA 1BEDA 4EUYA 3GHAA 2QC7A 1DE2A 2I9HA 3C1RA 4QQ7A 2GS3A 5IIZA 2MBTA 4MZWA 1EGOA 2HFDA 2JU5A 2H75A 2GT5A 4G2EA 5GAPD 2HZEB 3M3MA 1FAAA 2MMAA 2LJAA 1KEBA 4I97A 2WDUA 3GKXA 1XZOA 3C7MA 1Z6MA 1R5AA 2VL2A 4BVXA 2HNLA 1XW9A 5B7CA 1GSUA 5F0GA 3GURA 4K7OA 2X99A 3L78A 3HZ4A 1Z3EA 2YNXA 5G5EA 1QGVA 5ELAA 1NM3A 2GT6A 4G0KA 4JU5A 5IO0A 2J23A 1QFNA 3IAM2 3HA9A 2XBQA 1XVWA 4JZQA 1VF3A 5G5FA 3HJOA 13GSA 4CW9A 4IN0A 1ZL9A 5D9XA 5F8BA 5CRWA 4EL1A 4HDEA 2CAIA 3LWAA 2H76A 2IMEA 3TJJA 1K3OA 3W8JA 5BMUA 3RHBA 1JZRA 4XS1A 4QL7A 3QFAC 3TJFA 5ECSA 2K8VA 1JFUA 3IA1A 4EKZA 3KH7A 2JSZA 1QK8A 2LKUA 5D96A 2VCWA 4BL7B 4ML6A 3C71A 1T4ZA 2F8AA 1O8XA 3Q18A 2DJKA 2YWIA 2H73A 3FZAA 3MSZA 1Q4JA 3TKSE 4KGIA 3TDGA 3P2AA 4TVEA 1W89A 9GSSA 3PPUA 2H71A 2WFCA 4MK3A 3IXRA 2OKAA 3PGTA 3DKSA 2VD0A 3FHKA 2VAFA 3FZ9A 5J9CA 3RPNA 4Q5QA 4K7IA 1DBYA 2I1UA 4KDYA 2MBSA 1GTBA 1NHYA 2A2SA 2GGTA 1LBKA 4JE1A 5KN3A 4EXJA 3GSTA 2OBIA 2L6DA 3D4MA 4WEYA 5ECLB 4XCSA 3UBLA 1B8XA 4G9HA 4HS1A 1K3LA 1ZYQB 3PR8A 1TXXA 4O5RA 3EYTA 4BPYA 4YQMA 2HE3A 1EP7A 3FY7A 2DJ0A 5A4UA 5LCZA 3ZFLA 4PQIA 1THXA 2VCXA 2KOKA 2OE0A 3ZVJA 4XS4B 2BTOT 8GSSA 2REMA 3M1GA 2AYTA 3A2WA 3UOMA 1TOFA 2I81A 4PQHA 4D73A 1DE1A 3GNJA 2V2GA 5GAND 3WD6A 2IFQB 2WULA 2AUVA 3VLNA 1TRVA 1SL0B 3DIEA 3W8SA 1THOA 2R6KA 1WRYA 4N30A 2C3QA 1R5PA 3J7Yb 3LFLA 1OYJA 3EVIA 4I2UA 2YV7A 4XRAA 1SENA 2H6XA 1BJXA 1NSWA 2B5EA 5CNWA 2CAQA 2HSYA 2VCTA 2H30A 1YKCA 5E4WA 1SJ6A 3HJPA 4TW5A 4JBBA 2HQTA 2VOCA 3ZLPA 4AJ6A 1M7TA 1TI3A 4GSTA 5ECHB 1FB6A 3IBHA 1SD8A 2YPMA 1YY7A 4ECBA 5FHIA 4GQCA 3GSSA 3LGCA 5ECNB 1H75A 2NVLA 3CSIA 2YWMA 2HSMB 4MF6A 2H01A 10GSA 1MD4A 4IBPA 4KCAA 5IPHA 6GSUA 6GSXA 3WT1A 1TP9A 4ZBAA 1AQXA 1PMTA 5AGYA 3R2QA 2R2JA 1F3AA 4GWRA 5CO3A 4MABA 3F4SA 2VLVA 4NPBA 4ZIJA 3HZ8A 1V58A 1A2LA 1VRSD 5D93A 1IYHA 1VF4A 5L71A 3S9FA 3GH6A 16GSA 3F3RA 3VI7A 1TKDB 4GF0A 1U3IA 1PX7A 4WR5A 2VL2C 2LQQA 4I6XA 3WGDA 2YV9A 4KA0A 4E8HA 4F03A 4FYBA 4PGTA 3G7JA 2FY6A 4EDZA 2DJ2A 4JR4A 3IV4A 2HSHA 4ISDA 2JL4A 3KD0A 2M80A 2LS5A 1B4QA 5IMAA 3TKSC 1AAZA 2FD3A 5ECOB 1T8EB 5DJMA 2WB9A 3ZL5A 3Q6OA 6GSYA 1N8JA 5COHA 2OJLA 3KTBA 1EZKA 1TI1A 4DSQA 3QAGA 3VK9A 5FT3A 4IQAA 1S3AA 5IMCA 3UAPA 1KTEA 2GZPA 3ERWA 2C0DA 4POMA 2LNTA 1VF1A 2VIMA 5ECIB 1J9BA 1C72A 1MEKA 2V32A 1SL1B 1F6MC 2H74A 2MYGA 2R5GA 1G0TA 1F3BA 3DEXA 2DC5A 2JACA 3SWLA 1SL2B 3C1SA 2P0GA 4OFNA 2L5OA 5C04A 2TRCP 4NV2A 1GULA 1T00A 3WGXA 3KP9A 2KHPA 3I9V2 5AN1A 4WR4A 1TK5B 1CQHA 2GSTA 4LLRA 2I4AA 1PX6A 1TRWA 1USBA 5ID2B 2F51A 4RQXA 3WGEA 4GLTA 1ACVA 3FZ4A 2C80A 2RM6A 4PUFC 2YJHA 1GSFA 2LTKA 3TRPA 1BG5A 3KCMA 3KXOA 5KN0A 2HRKB 1OAZA 4OWYA 2IMIA 3F6FA 4GSSA 3EURA 3RBTA 5A5KA 2CA8A 2IMFA 2GSQA 5D8IA 1UA5A 2ZCTA 4NWYA 2HYXA 2C4JA 4FQUA 3NIVA
chains in the Genus database with same CATH superfamily
6GSWA 3U6VA 3DMLA 5IMFA 2JSYA 1F9MA 2L6CA 1UVZA 2HRFA 2AV4A 2L59A 3UVTA 1HNAA 2NBSA 1SVOA 3ZIJA 1OE7A 7GSSA 1GSYA 1ABAA 4LMWA 3A5IA 4E8EA 2R0CA 3C73A 3H93A 22GSA 2O5VA 3O76A 5IMVA 1K0NA 4IJIA 2WVZA 3M9KA 4TXVA 2R0PA 4KX4A 1UN2A 3ZRDA 1V2AA 4OFTA 1AQVA 3A2VA 4YAPA 2M46A 3VFIA 2IWTA 4TRXA 2XC2A 3IK9A 2H70A 2JADA 5D9TA 4YQVA 3D22A 19GSA 3GTUA 5H5QA 5A4VA 2C3TA 4MJCA 2B1LA 3QD9A 1M0UA 2RUEA 3VWWA 4G0IA 2CQ9A 4WF4A 4MH2A 1CQGA 2GZZA 4J57E 3TB2A 4OD7A 3EE2A 5J40A 5B6NA 4K2DA 2YOIA 1RW1A 4N10A 5AISA 5KEJA 5G2ZA 4HJMA 4L0UA 4KSOA 6GSSA 4LL4B 4F0CA 2OT3A 4K7NA 1ZYPA 2NDOA 2FGXA 4HZ4A 3RAZA 4CDOA 4N0VA 4ZL7A 5HR2A 2I3YA 5CRDA 1OC9A 4HSCX 4GRFA 5HR3A 1JLVA 1NW2A 3US3A 2V1MA 1TTZA 3HD5A 3R3EA 1LU4A 5B6MA 3GKMA 4TR1A 1TW9A 2GDRA 2VL9A 4MA9A 4O7HA 1YF0A 1HD2A 3Q74A 2FHEA 5H5RA 1GL8A 2C0FA 2YZUA 4V2MA 2PMTA 1YQ1A 2IPAA 1A2JA 5DQSA 3FK8A 4IQ1A 3TJKA 5A1NB 1RK4A 5HFKA 5IMDA 2CX4A 2X49A 2YWNA 5FWGA 1OC8A 5D73A 3FEUA 4V1Ap 3D4TA 2YWOA 3HKRA 5BMUB 2E2MA 5A5HB 5A34B 4MF7A 5JWRB 1R7HA 4K2XA 4PTSA 4X1UA 4G0LA 2IL3A 4KE3A 1X5CA 1GSDA 4LL1B 2VM1A 2LQOA 4KUNA 4V1Ag 2QSIA 3GV1A 1R4WA 4DVCA 4MF5A 3IC4A 4DEJA 4JR6A 4TR3A 4ZBBA 1IYIA 2WJUA 4BIKA 4XHMA 1WE0A 1SD9A 4HQSA 4EF0A 2E2GA 1SK0A 4Q5RA 4MNNA 1BX9A 2NPBA 4DSSA 3TJBA 3UJ1A 4XIHA 3FYGA 2GLRA 2DJ1A 1ML6A 1SYXA 3G9BA 4V2LA 2H1AA 2KP2A 2MMNA 1SK2A 1B9YC 5EL8A 3P7XA 1XW6A 3MAKA 4IVFA 3VPTA 2O85A 4YH2A 2GZYA 4J56E 4KAEA 1I9DA 1X9SB 2DSAA 1PSQA 3N9JA 3FKFA 2CV4A 2FCHA 4MH3A 4PNGA 2H1LA 2H1GA 2X8GA 4IP1A 1ZOFA 3GL3A 4ID0A 1NHOA 2V41A 1A0FA 1ZZYA 1EOGA 4AKXB 1XOBA 12GSA 4KDXA 4PI0C 3QPMA 3GL5A 4ZL8A 3GA4A 4TXOA 5ECRB 2IMDA 3FZ5A 1JZOA 4GCIA 4BVYA 1SVLA 1DSBA 2FA4A 1T3BA 5KOWA 2JZRA 1X9WB 1YJ6A 3KH9A 1OKTA 1ZMAA 2N5AA 2IFQA 2AB6A 4D73B 3I43A 2J9HA 3CTFA 5ABRA 2ON7A 5G31A 2FUG2 1QXHA 4XS6A 2KLXA 2H1BA 2WGRA 2A4VA 1M9AA 5F06A 4MPGA 3DVWA 2L4CA 4MZBA 3VWVA 14GSA 2LEGA 3CWGA 5JWQB 4GTUA 5JWOB 4HUAA 5INYA 3GKNA 3GX8A 2E7PA 3CHXC 1PRXA 3IHQA 1M99A 1GNEA 1ERWA 2WRTA 2B5YA 4GQFA 2D2ZA 2LV3A 1QUWA 4FYCA 1XWKA 4ZB7A 2KUCA 1HYUA 2C3NA 3NZNA 5D9WA 4PNFA 1AIUA 1OC3A 4L5LA 1QMVA 2EIRA 2CVDA 4TOPA 2DIZA 2K9FA 4NMUA 1WWJA 2O87A 1GTUA 3LQ7A 3PINA 3ISOA 2L5LA 2OE1A 3OR5A 2BJXA 5B8AA 5J4YA 1XG8A 4EE0A 3F4TA 4F9ZA 3ZTLA 5DCGA 1Q98A 2CZ3A 4TR0A 1GWCA 2DIYA 4PQ1A 3WYWA 1FW1A 3GH9A 3QFBC 3UIWA 4KSMA 1N25A 1V57A 5IM9A 5F05A 1ERTA 3KEBA 3HCZA 3L9SA 3KZQA 4FO5A 2WW0A 3MNGA 1O81A 1QQ2A 1SKWB 5B8BA 4O5QA 2H0HA 3BJ5A 4EDYA 3ZIVA 5AIVA 1B4PA 2PN8A 1PKWA 4RI7A 3EMXA 2RM5A 2PGTA 5DVBA 2G0FA 4Q5NA 4NV5A 4N0ZA 2HSNB 4EIQA 3ZFBA 1VGLA 4ZB9A 1PD21 3L9VA 1BF5A 5EPFA 1TJDA 3LG6A 4F2IA 1GTAA 4JRRA 5ENUA 4I2TA 2GQMA 3HJMA 4ECJA 4ZXGA 4V2NA 5DAKA 1K3YA 1JZWA 3LXZA 1XW5A 1A2MA 1OKDA 3CQFA 3FR3A 2PU9C 1R26A 5KN2A 1ZYEA 3CSJA 3QAVA 1WP0A 2B3SA 4OMVA 3H79A 4AI6A 3K8NA 3UMAA 1K0OA 3ME8A 3VWUA 3ME7A 4AJ8A 2C0EA 2HT9A 2XBIA 5CRGA 1GH2A 3D21A 1M2AA 1Y6EA 3UVHA 2WS2A 2H0GA 1Z7PA 4K1FA 3HVVA 5HFIA 2NTOA 1ON4A 4K0NA 3TCOA 2P5QA 3A2XA 3F6DA 1TK8B 4X0XA 3QAWA 3VURA 3KJYA 2N5FA 3DXBA 4HOJA 2EFCA 4EO3A 1AW9A 2ZUPA 1K0DA 2K18A 2H66A 1GUKA 4KDUA 1FOVA 4ECCA 1M9BA 4IGJA 3AY8A 4ECIA 2FWHA 3IAS2 4NAXA 3L4NA 3HHVA 1TRUA 4WKWA 1EOHA 3F4RA 3D0ZA 2H0IA 4N11A 4MLYA 4USSA 4L8EA 5ECQB 3EWLA 4RUVA 5JCUA 1PA3A 2DMMA 1YF1A 3QMXA 4G10A 2OE3A 3IPZA 2X64A 3L0HA 3L9UA 3RPPA 3VWXA 1PFOA 3E9JB 2B7KA 2AJQB 3HVSA 2HRKA 2OADA 2HI7A 5ECMB 1GP1A 4H86A 4TN8A 5GSSA 5HQPA 1EEMA 4F0BA 1G7EA 1OE8A 3G7IA 3P90A 5ELGA 5DALA 5GSTA 1EWXA 1XIYA 4MPFA 3IDVA 5KOXA 11GSA 1G7OA 5J4UA 2WVXB 1B9XC 3ZVJD 2VLUA 3EC3A 1E2YA 1SU9A 3RFRC 4AGSA 1GLQA 2VO4A 3GUSA 1ILOA 2WZSA 1O85A 1MDKA 3H8QA 1EEJA 4JEDA 4EC0A 3DRNA 2V6KA 2H8LA 2V6OA 1G6WA 2WW2A 4BWQA 2FLSA 4TR4A 2FWEA 4G19A 4MZCA 4NXIA 1YKAA 5HR1A 1XWCA 5CP1A 1JLWA 4BA7A 3M8NA 2O3EA 5ECKB 1BYEA 1F37A 4BWSA 2HXKA 3ZZXA 1F2EA 3F9UA 3TGZA 3IHGA 1EV4A 5HFGA 1MDJA 3GTUB 2VKZG 1GLPA 5G30A 2MMOA 1HNBA 1A23A 4J2FA 2TRXA 3F8UA 5JCWA 2JZTA 3QOUA 1W4VA 3LXTA 2K6VA 3EMPA 1SK1A 2DJJA 5CRHA 4EVMA 4NHWA 2R4VA 3KGKA 3ZREA 2HZEA 2GSRA 3BCIA 4GDFA 3JCML 3F0IA 4IELA 3DVXA 4HEA2 4WBRD 2K8SA 4ML1A 1Z6NA 3LSZA 2CVKA 2OBKA 1XOAA 3EU4A 3FR6A 3BCKA 1WJKA 2EFHA 1VF2A 3IC8A 4ZB6A 4BVXB 2C0GA 2HLSA 2AAWA 5G1KA 1S4BP 5C00A 20GSA 1S3CA 1URMA 4L5OA 4OCEA 4OO5A 1XWBA 2H6ZA 1OC9B 1XPVA 4RI6A 1TRSA 3FRCA 3KM6A 4MJEA 1FO5A 2PVOC 2UZ8A 3KIJA 2B5XA 2RIIA 5AIXA 2ZNMA 3PH9A 4TR1B 2F3MA 3CMIA 3CSHA 4POLA 3ERGA 3TRQA 2YZHA 2LJKA 3GIXA 1AC1A 3A5WA 1RQMA 3IE3A 3TKRA 4WXTA 5IOWA 4P3YB 5CYYA 1PL2A 2ES7A 3NOFA 4I5QA 3TKSA 5EVOA 2YN1A 4YQUA 1GUHA 3DGQA 1M2DA 4TKYA 4POBA 3HMJG 4BL7A 5A34A 4LA1A 3RDWA 5DBQA 4MJAA 1YVLA 3V1WA 4PURA 2CT6A 2LRNA 1FG4A 2ALBA 1WMJA 3GRXA 5DCHA 4IKHA 3H1NA 3ZMKA 2PUKC 1EV9A 1SKSB 1PKZA 1MD3A 3CBUA 2H1DA 3LYKA 1TDIA 1V98A 4K9ZA 2EIOA 4ULXA 4IHUA 2H72A 2MZCA 2YP6A 3EU3A 3LJRA 1YEWC 5DQYA 4Z2UA 1YEXA 4OFMA 2VCZA 3HYPA 1V40A 1FVJA 4ICYA 3M0FA 2IIYA 4WETA 2PVQA 3N5OA 1K0AA 4DSSB 1KNGA 1HNCA 1ZCPA 1YZXA 2O7KA 1A8YA 2GVPA 3LYPA 3IRAA 2LRTA 4WBJA 4O32A 2DBCA 5CREA 4K8MA 1ST9A 4XS4A 4PXOA 5CAXA 4RQRA 4I8BA 4YAVA 5DDLA 1X0RA 2LNSA 1LJRA 1ERVA 1O73A 3TRXA 2L4QA 3DD3A 1FVKA 2FWFA 1A8LA 2O8VB 3QCPA 4ZILA 4TXOB 1PL1A 1T7PB 3VPQA 4K6XA 4ILFA 3D6IA 1YEPA 4BVYB 3IOSA 3BBYA 1M2BA 3A3TA 3TKQA 3TKPA 3MWHA 3I69A 1BAYA 5G1LA 1S3DA 6GSTA 1FB0A 2GSSA 1SYRA 2PPTA 4MMMA 1UC7A 3UARA 4KF9A 1FHEA 1XWAA 2OACA 2P31A 1K0BA 3BOAA 5BRTA 1J08A 3APOA 3ZITA 3EINA 2FWGA 5GZZB 2OA7A 2LJRA 4ZB8A 1WIKA 2DMLA 2VLTA 17GSA 3GMFA 2N5BA 1I5GA 3WT2A 3LORA 2HSMA 1A24A 4FIWA 4DSRA 2O36A 2L57A 3GFKA 3KMNA 2TIRA 2WZ9A 3TUEA 2C8UA 4XRDA 2CX3A 3CYNA 1M3JA 4MDCA 2P5RA 2QGVA 5J41A 3TOTA 3J7Yk 2Z9SA 1EGRA 3RHCA 2YJ7A 1SVMA 4CY6A 3MIXA 1K0MA 2YCDA 3APSA 1K0CA 2X8HA 4HU7A 2GTUA 1TXUA 3QDNA 1MDIA 1PQNA 2G2QA 1MTCA 1TK0B 4F82A 1X9MB 2IJYA 4HI7A 6GSVA 3CTGA 5IOXA 1X5DA 5IMZA 2IN3A 2AHEA 1Y1UA 2LUSA 4K0GA 1XBSA 18GSA 3M9JA 1TU8A 3GKKA 5J3RA 1AXDA 4KW6A 1SJIA 4OCFA 2BMXA 1X5EA 2O89A 2HZFA 2HSNA 5DJLA 3Q19A 1XXUA 3F3QA 2VCVA 2JZSA 5LD0A 4QMKA 5E59A 3G7YA 1GSEA 3F63A 2MMZA 3ED3A 3H4KA 4LMVA 1U3AA 2A2RA 3HDCA 5DAKB 2VL3A 3P8WA 4HJ2A 1GSQA 4PX1A 1JHBA 2PBJA 3O6TA 1EP8A 4NHZA 1J0FA 1T4YA 4KB3A 3ZYWA 3CRTA 4CHSA 3LEFA 3UL3A 1PN0A 3ERFA 3LW9A 4ZL9A 4IS0A 1Y25A 2XPEA 5A4WA 4KH7A 2XPDA 1O8WA 1DUGA 3IK7A 2WCIA 1GUMA 2DLXA 3HXSA 3IR4A 3UBKA 4OO4A 3TU3B 5LNKe 2RUFA 1ERUA 2PERA 2X8CA 3HVNA 4FYUA 5J5NA 4HZ2A 1SKRB 4YKFA 3QR6A 3CRUA 2EIQA 5EY6A 3C8EA 3ZMLA 5IPGA 1G6YA 2VD1A 2QKEA 2B7JA 1XWGA 2VM2A 3SBCA 5ECPB 2YANA 1TU7A 5IQYA 2H6YA 1U88A 2F9SA 1PN9A 4ZBDA 4Z2RA 2CZ2A 5KN1A 3TJGA 5ID2A 4MCUA 2R37A 2GQLA 1O7UA 2EC4A 1AUCA 2A4HA 3APQA 2EFEA 4O92A 5D9VA 3U5RE 1JZDA 1WOUA 1WPIA 2RLIA 1U87A 4MJBA 2M72A 2B6MA 1T1VA 3O3TA 1GNWA 2QA1A 2R3XA 2F8FA 5H5SA 4XTSA 2H19A 4L0WA 5J47A 2XHFA 1XCCA 1OVNA 1GSSA 4GSNA 4IW9A 2WW3A 1U6TA 3D5JA 3UEMA 1AQWA 2VCQA 5F07A 4WF5A 1O6JA 2HRAA 1ZGNA 2E0QA 2LRCA 2B1KA 4PUAA 1BG1A 1V9WA 1XVQA 4KNDA 4KCEA 1N2AA 4QL9A 3FR9A 1Z7RA 5DALB 1A0RP 3E0UA 1YDKA 3W6GA 4FH8A 2WVXA 3RGBC 5JCGA 1XFLA 1Z9HA 2FA8A 3HVXA 3HY2A 4Z7XA 4Q5FA 3KTLA 1KBNA 5HR0A 3E3EA 5J4VA 2DJ3A 3FW2A 4E68A 1BQ7A 3MDKA 1PGTA 5IO2A 1Z5YE 3GYKA 2C1YA 4AF2A 5J9BA 2HRNA 1E6BA 1H4OA 2CVBA 3KMOA 3DWVA 2FNOA 4POKA 2KP1A 1HQOA 2WVYA 1GRXA 1SJZA 3BD2A 4HQZA 3I6AA 4MP4A 3KP8A 4AJ7A 4X43A 2IMKA 2VUPA 4HU9A 2GQKA 2LSTA 3CXGA 4ACSA 3GX0A 4IJ3A 3TOUA 4IP6A 2PWJA 4AKGA 4CY8A 3GN3A 1B48A 1GTIA 4GXZA 2ON5A 3VI5A 3DYRA 1BEDA 4EUYA 3GHAA 2QC7A 1DE2A 2I9HA 3C1RA 4QQ7A 2GS3A 5IIZA 2A2PA 2MBTA 4MZWA 1EGOA 2HFDA 2JU5A 2H75A 2GT5A 4G2EA 5GAPD 2HZEB 3M3MA 1FAAA 2MMAA 2LJAA 1KEBA 4I97A 2WDUA 4N3ZA 3GKXA 1XZOA 3C7MA 1Z6MA 1R5AA 2VL2A 4BVXA 2HNLA 1XW9A 5B7CA 1GSUA 5F0GA 3GURA 4FXYP 4K7OA 2X99A 3L78A 3HZ4A 1Z3EA 2YNXA 5G5EA 1QGVA 5ELAA 1NM3A 2GT6A 4G0KA 4JU5A 5IO0A 2J23A 1QFNA 3IAM2 3HA9A 2XBQA 1XVWA 4JZQA 1VF3A 5G5FA 4EIPA 3HJOA 4X4JA 5A1NA 13GSA 4CW9A 4IN0A 1ZL9A 1FOHA 5D9XA 5F8BA 5CRWA 4EL1A 4HDEA 2CAIA 3LWAA 2H76A 2IMEA 3TJJA 1K3OA 3W8JA 5BMUA 3RHBA 5A5HA 1JZRA 4XS1A 4QL7A 2DKIA 3QFAC 3TJFA 5ECSA 2K8VA 1JFUA 3IA1A 4EKZA 3KH7A 2JSZA 1QK8A 2LKUA 5D96A 2VCWA 4BL7B 4ML6A 3C71A 1T4ZA 2F8AA 1O8XA 3Q18A 2DJKA 2YWIA 2H73A 3FZAA 3MSZA 1Q4JA 3TKSE 2R0GA 4KGIA 3TDGA 3P2AA 4TVEA 1W89A 9GSSA 3PPUA 2H71A 2WFCA 4MK3A 3IXRA 2OKAA 3PGTA 3DKSA 2VD0A 3FHKA 2VAFA 3FZ9A 5J9CA 3RPNA 4Q5QA 4K7IA 1DBYA 2I1UA 4KDYA 2MBSA 3MYDA 1GTBA 1NHYA 2A2SA 2GGTA 1LBKA 4JE1A 5KN3A 4EXJA 3GSTA 2OBIA 2L6DA 3D4MA 4WEYA 5ECLB 4XCSA 3UBLA 1B8XA 4G9HA 4HS1A 1K3LA 1ZYQB 3PR8A 2WW1A 1TXXA 4O5RA 3EYTA 4BPYA 4YQMA 2HE3A 1EP7A 3FY7A 2DJ0A 5A4UA 5LCZA 3ZFLA 4PQIA 1THXA 2VCXA 2KOKA 2OE0A 4PHZC 3ZVJA 4W66A 4XS4B 2BTOT 2X4AA 8GSSA 2REMA 3M1GA 2AYTA 3A2WA 3UOMA 1TOFA 2I81A 4PQHA 4D73A 1DE1A 3GNJA 2V2GA 5GAND 3WD6A 2IFQB 2WULA 2AUVA 3VLNA 1TRVA 1SL0B 3DIEA 3W8SA 1THOA 2R6KA 1WRYA 4N30A 2C3QA 1R5PA 3J7Yb 3LFLA 1OYJA 3EVIA 4I2UA 2YV7A 4XRAA 4YKGA 1SENA 2H6XA 1BJXA 1NSWA 2B5EA 5CNWA 2CAQA 2HSYA 2VCTA 2H30A 1YKCA 5E4WA 1SJ6A 3HJPA 4TW5A 4JBBA 2HQTA 2VOCA 3ZLPA 4AJ6A 1M7TA 1ZYNA 1TI3A 4GSTA 5ECHB 1FB6A 3IBHA 1SD8A 2YPMA 1YY7A 4ECBA 5FHIA 4GQCA 3GSSA 3LGCA 5ECNB 3EPTA 1H75A 2NVLA 3CSIA 2YWMA 2HSMB 4MF6A 2H01A 10GSA 1MD4A 4K5RA 4IBPA 4KCAA 5IPHA 6GSUA 6GSXA 3WT1A 1TP9A 4ZBAA 4A5PA 1AQXA 1PMTA 5AGYA 3R2QA 2R2JA 1F3AA 4GWRA 5CO3A 4MABA 3F4SA 2VLVA 4NPBA 1S3RA 2EFDA 4ZIJA 3HZ8A 1V58A 1A2LA 1VRSD 5D93A 1IYHA 1VF4A 5L71A 3S9FA 3GH6A 16GSA 3F3RA 3VI7A 1TKDB 4GF0A 1U3IA 1PX7A 4WR5A 2VL2C 2LQQA 4I6XA 3WGDA 4O5UA 2YV9A 4KA0A 4E8HA 4F03A 4K5SA 4FYBA 4PGTA 3G7JA 2FY6A 4EDZA 2DJ2A 4G01A 4JR4A 3IV4A 2HSHA 4ISDA 2JL4A 3KD0A 2M80A 2LS5A 1B4QA 5IMAA 3TKSC 1AAZA 2FD3A 5ECOB 1T8EB 5DJMA 2WB9A 3ZL5A 3Q6OA 6GSYA 1N8JA 5COHA 2OJLA 3KTBA 2QA2A 1EZKA 1TI1A 4DSQA 3QAGA 3VK9A 5FT3A 4IQAA 1S3AA 5IMCA 3UAPA 1KTEA 2GZPA 3ERWA 2C0DA 4POMA 2LNTA 1VF1A 2VIMA 5ECIB 1J9BA 2V32A 1C72A 1MEKA 1SL1B 1F6MC 2H74A 2MYGA 2R5GA 1M3IA 1G0TA 1F3BA 3DEXA 2DC5A 2JACA 1I1IP 3SWLA 1SL2B 3C1SA 2P0GA 4OFNA 2L5OA 5C04A 2TRCP 4NV2A 1GULA 1T00A 3WGXA 3KP9A 2KHPA 3I9V2 5AN1A 4WR4A 1TK5B 1CQHA 2GSTA 4LLRA 2I4AA 4AKIA 1PX6A 1TRWA 1USBA 5ID2B 2F51A 4RQXA 3WGEA 4GLTA 1ACVA 3FZ4A 2C80A 2RM6A 4PUFC 2YJHA 1GSFA 2LTKA 4Z2TA 3TRPA 1BG5A 4AKHA 3KXOA 3KCMA 5KN0A 2HRKB 1OAZA 4OWYA 2IMIA 3F6FA 3FMWA 4GSSA 3EURA 3RBTA 5A5KA 2DKHA 2CA8A 2IMFA 2GSQA 5D8IA 1UA5A 2ZCTA 4NWYA 2UV8G 2HYXA 4PI2C 2C4JA 4FQUA 3NIVA
chains in the Genus database with same CATH topology
6GSWA 3U6VA 3DMLA 5IMFA 2JSYA 1F9MA 2L6CA 1UVZA 2HRFA 2AV4A 2L59A 3UVTA 1HNAA 2NBSA 1SVOA 3ZIJA 1OE7A 7GSSA 1GSYA 1ABAA 4LMWA 3A5IA 4E8EA 2R0CA 3C73A 3H93A 22GSA 2O5VA 3O76A 5IMVA 1K0NA 4IJIA 3M9KA 4TXVA 2R0PA 4KX4A 1UN2A 3ZRDA 1V2AA 4OFTA 1AQVA 3A2VA 4YAPA 2M46A 3VFIA 2IWTA 4TRXA 2XC2A 3IK9A 2H70A 2JADA 5D9TA 4YQVA 3D22A 19GSA 3GTUA 5H5QA 5A4VA 2C3TA 4MJCA 2B1LA 3QD9A 1M0UA 2RUEA 3VWWA 4G0IA 2CQ9A 4WF4A 4MH2A 1CQGA 2GZZA 4J57E 3TB2A 4OD7A 3EE2A 5J40A 5B6NA 4K2DA 2YOIA 1RW1A 4N10A 5AISA 5KEJA 5G2ZA 4HJMA 4L0UA 4KSOA 6GSSA 4LL4B 4F0CA 2OT3A 4K7NA 1ZYPA 2NDOA 2FGXA 4HZ4A 3RAZA 4CDOA 4N0VA 4ZL7A 5HR2A 2I3YA 5CRDA 1OC9A 4GRFA 5HR3A 1JLVA 1NW2A 3US3A 2V1MA 1TTZA 3HD5A 3R3EA 1LU4A 5B6MA 3GKMA 4TR1A 1TW9A 2GDRA 2VL9A 4MA9A 4O7HA 1YF0A 1HD2A 3Q74A 2FHEA 5H5RA 1GL8A 2C0FA 2YZUA 4V2MA 2PMTA 1YQ1A 2IPAA 1A2JA 5DQSA 3FK8A 4IQ1A 3TJKA 5A1NB 1RK4A 5HFKA 5IMDA 2CX4A 2X49A 2YWNA 5FWGA 1OC8A 5D73A 3FEUA 4V1Ap 3D4TA 2YWOA 3HKRA 5BMUB 2E2MA 5A5HB 5A34B 4MF7A 5JWRB 1R7HA 4K2XA 4PTSA 4X1UA 4G0LA 2IL3A 4KE3A 1X5CA 1GSDA 4LL1B 2VM1A 2LQOA 4KUNA 4V1Ag 2QSIA 3GV1A 1R4WA 4DVCA 4MF5A 3IC4A 4DEJA 4JR6A 4TR3A 4ZBBA 1IYIA 2WJUA 4XHMA 1WE0A 1SD9A 4HQSA 4EF0A 2E2GA 1SK0A 4Q5RA 4MNNA 1BX9A 2NPBA 4DSSA 3TJBA 3UJ1A 4XIHA 3FYGA 2GLRA 2DJ1A 1ML6A 1SYXA 3G9BA 4V2LA 2H1AA 2KP2A 2MMNA 1SK2A 1B9YC 5EL8A 3P7XA 1XW6A 3MAKA 4IVFA 3VPTA 2O85A 4YH2A 2GZYA 4J56E 4KAEA 1I9DA 1X9SB 2DSAA 1PSQA 3N9JA 3FKFA 2CV4A 2FCHA 4MH3A 4PNGA 2H1LA 2H1GA 2X8GA 4IP1A 1ZOFA 3GL3A 4ID0A 1NHOA 2V41A 1A0FA 1ZZYA 1EOGA 4AKXB 1XOBA 12GSA 4KDXA 3QPMA 3GL5A 4ZL8A 3GA4A 4TXOA 5ECRB 2IMDA 3FZ5A 1JZOA 4GCIA 4BVYA 1SVLA 1DSBA 2FA4A 1T3BA 5KOWA 2JZRA 1X9WB 1YJ6A 3KH9A 1OKTA 1ZMAA 2N5AA 2IFQA 2AB6A 4D73B 3I43A 2J9HA 3CTFA 5ABRA 2ON7A 5G31A 2FUG2 1QXHA 4XS6A 2KLXA 2H1BA 2WGRA 2A4VA 1M9AA 5F06A 4MPGA 3DVWA 2L4CA 4MZBA 3VWVA 14GSA 2LEGA 3CWGA 5JWQB 4GTUA 5JWOB 4HUAA 5INYA 3GKNA 3GX8A 2E7PA 1PRXA 3IHQA 1M99A 1GNEA 1ERWA 2WRTA 2B5YA 4GQFA 2D2ZA 2LV3A 1QUWA 4FYCA 1XWKA 4ZB7A 2KUCA 1HYUA 2C3NA 3NZNA 5D9WA 4PNFA 1AIUA 1OC3A 4L5LA 1QMVA 2EIRA 2CVDA 4TOPA 2DIZA 2K9FA 4NMUA 1WWJA 2O87A 1GTUA 3LQ7A 3PINA 3ISOA 2L5LA 2OE1A 3OR5A 2BJXA 5B8AA 5J4YA 4EE0A 3F4TA 4F9ZA 3ZTLA 5DCGA 1Q98A 2CZ3A 4TR0A 1GWCA 2DIYA 4PQ1A 3WYWA 1FW1A 3GH9A 3QFBC 3UIWA 4KSMA 1N25A 1V57A 5IM9A 5F05A 1ERTA 3KEBA 3HCZA 3L9SA 3KZQA 4FO5A 3MNGA 1O81A 1QQ2A 1SKWB 5B8BA 4O5QA 2H0HA 3BJ5A 4EDYA 3ZIVA 5AIVA 1B4PA 2PN8A 1PKWA 4RI7A 3EMXA 2RM5A 2PGTA 5DVBA 2G0FA 4Q5NA 4NV5A 4N0ZA 2HSNB 4EIQA 3ZFBA 1VGLA 4ZB9A 1PD21 3L9VA 1BF5A 5EPFA 1TJDA 3LG6A 4F2IA 1GTAA 4JRRA 5ENUA 4I2TA 2GQMA 3HJMA 4ECJA 4ZXGA 4V2NA 5DAKA 1K3YA 1JZWA 3LXZA 1XW5A 1A2MA 1OKDA 3FR3A 2PU9C 1R26A 5KN2A 1ZYEA 3CSJA 3QAVA 1WP0A 2B3SA 4OMVA 3H79A 4AI6A 3K8NA 3UMAA 1K0OA 3ME8A 3VWUA 3ME7A 4AJ8A 2C0EA 2HT9A 2XBIA 5CRGA 1GH2A 3D21A 1M2AA 1Y6EA 3UVHA 2WS2A 2H0GA 1Z7PA 4K1FA 3HVVA 5HFIA 2NTOA 1ON4A 4K0NA 3TCOA 2P5QA 3A2XA 3F6DA 1TK8B 4X0XA 3QAWA 3VURA 3KJYA 2N5FA 3DXBA 4HOJA 2EFCA 4EO3A 1AW9A 2ZUPA 1K0DA 2K18A 2H66A 1GUKA 4KDUA 1FOVA 4ECCA 1M9BA 4IGJA 3AY8A 4ECIA 2FWHA 3IAS2 4NAXA 3L4NA 3HHVA 1TRUA 4WKWA 1EOHA 3F4RA 3D0ZA 2H0IA 4N11A 4MLYA 4USSA 4L8EA 5ECQB 3EWLA 4RUVA 5JCUA 1PA3A 2DMMA 1YF1A 3QMXA 4G10A 2OE3A 3IPZA 2X64A 3L0HA 3L9UA 3RPPA 3VWXA 3E9JB 2B7KA 2AJQB 3HVSA 2HRKA 2OADA 2HI7A 5ECMB 1GP1A 4H86A 4TN8A 5GSSA 5HQPA 1EEMA 4F0BA 1G7EA 1OE8A 3G7IA 3P90A 5ELGA 5DALA 5GSTA 1EWXA 1XIYA 4MPFA 3IDVA 5KOXA 11GSA 1G7OA 5J4UA 3ZVJD 1B9XC 2VLUA 3EC3A 1E2YA 1SU9A 4AGSA 1GLQA 2VO4A 3GUSA 1ILOA 1O85A 1MDKA 3H8QA 1EEJA 4JEDA 4EC0A 3DRNA 2V6KA 2H8LA 2V6OA 1G6WA 4BWQA 2FLSA 4TR4A 2FWEA 4G19A 4MZCA 4NXIA 1YKAA 5HR1A 1XWCA 5CP1A 1JLWA 4BA7A 3M8NA 5ECKB 1BYEA 1F37A 4BWSA 2HXKA 3ZZXA 1F2EA 3F9UA 3TGZA 3IHGA 1EV4A 5HFGA 1MDJA 3GTUB 2VKZG 1GLPA 5G30A 2MMOA 1HNBA 1A23A 4J2FA 2TRXA 3F8UA 5JCWA 2JZTA 3QOUA 1W4VA 3LXTA 2K6VA 3EMPA 1SK1A 2DJJA 5CRHA 4EVMA 4NHWA 2R4VA 3KGKA 3ZREA 2HZEA 2GSRA 3BCIA 4GDFA 3JCML 3F0IA 4IELA 3DVXA 4HEA2 4WBRD 2K8SA 4ML1A 1Z6NA 3LSZA 2CVKA 2OBKA 1XOAA 3EU4A 3FR6A 3BCKA 1WJKA 2EFHA 1VF2A 3IC8A 4ZB6A 4BVXB 2C0GA 2HLSA 2AAWA 5G1KA 5C00A 20GSA 1S3CA 1URMA 4L5OA 4OCEA 4OO5A 1XWBA 2H6ZA 1OC9B 1XPVA 4RI6A 1TRSA 3FRCA 3KM6A 4MJEA 1FO5A 2PVOC 2UZ8A 3KIJA 2B5XA 2RIIA 5AIXA 2ZNMA 3PH9A 4TR1B 2F3MA 3CMIA 3CSHA 4POLA 3ERGA 3TRQA 2YZHA 2LJKA 3GIXA 1AC1A 3A5WA 1RQMA 3IE3A 3TKRA 4WXTA 5IOWA 4P3YB 5CYYA 1PL2A 2ES7A 3NOFA 4I5QA 3TKSA 5EVOA 2YN1A 4YQUA 1GUHA 3DGQA 1M2DA 4TKYA 4POBA 3HMJG 4BL7A 5A34A 4LA1A 3RDWA 5DBQA 4MJAA 1YVLA 3V1WA 4PURA 2CT6A 2LRNA 1FG4A 2ALBA 1WMJA 3GRXA 5DCHA 4IKHA 3H1NA 3ZMKA 2PUKC 1EV9A 1SKSB 1PKZA 1MD3A 3CBUA 2H1DA 3LYKA 1TDIA 1V98A 4K9ZA 2EIOA 4ULXA 4IHUA 2H72A 2MZCA 2YP6A 3EU3A 3LJRA 5DQYA 4Z2UA 1YEXA 4OFMA 2VCZA 3HYPA 1V40A 1FVJA 4ICYA 3M0FA 2IIYA 4WETA 2PVQA 3N5OA 1K0AA 4DSSB 1KNGA 1HNCA 1ZCPA 1YZXA 2O7KA 1A8YA 2GVPA 3LYPA 3IRAA 2LRTA 4WBJA 4O32A 2DBCA 5CREA 4K8MA 1ST9A 4XS4A 4PXOA 5CAXA 4RQRA 4I8BA 4YAVA 5DDLA 1X0RA 2LNSA 1LJRA 1ERVA 1O73A 3TRXA 2L4QA 3DD3A 1FVKA 2FWFA 1A8LA 2O8VB 3QCPA 4ZILA 4TXOB 1PL1A 1T7PB 3VPQA 4K6XA 4ILFA 3D6IA 1YEPA 4BVYB 3IOSA 3BBYA 1M2BA 3A3TA 3TKQA 3TKPA 3MWHA 3I69A 1BAYA 5G1LA 1S3DA 6GSTA 1FB0A 2GSSA 1SYRA 2PPTA 4MMMA 1UC7A 3UARA 4KF9A 1FHEA 1XWAA 2OACA 2P31A 1K0BA 3BOAA 5BRTA 1J08A 3APOA 3ZITA 3EINA 2FWGA 5GZZB 2OA7A 2LJRA 4ZB8A 1WIKA 2DMLA 2VLTA 17GSA 3GMFA 2N5BA 1I5GA 3WT2A 3LORA 2HSMA 1A24A 4FIWA 4DSRA 2L57A 3GFKA 3KMNA 2TIRA 2WZ9A 3TUEA 2C8UA 4XRDA 2CX3A 3CYNA 4MDCA 2P5RA 2QGVA 5J41A 3TOTA 3J7Yk 2Z9SA 1EGRA 3RHCA 2YJ7A 1SVMA 4CY6A 3MIXA 1K0MA 2YCDA 3APSA 1K0CA 2X8HA 4HU7A 2GTUA 1TXUA 3QDNA 1MDIA 1PQNA 2G2QA 1MTCA 1TK0B 4F82A 1X9MB 2IJYA 4HI7A 6GSVA 3CTGA 5IOXA 1X5DA 5IMZA 2IN3A 2AHEA 1Y1UA 2LUSA 4K0GA 1XBSA 18GSA 3M9JA 1TU8A 3GKKA 5J3RA 1AXDA 4KW6A 1SJIA 4OCFA 2BMXA 1X5EA 2O89A 2HZFA 2HSNA 5DJLA 3Q19A 1XXUA 3F3QA 2VCVA 2JZSA 5LD0A 4QMKA 5E59A 3G7YA 1GSEA 3F63A 2MMZA 3ED3A 3H4KA 4LMVA 1U3AA 2A2RA 5DAKB 3HDCA 2VL3A 3P8WA 4HJ2A 1GSQA 4PX1A 1JHBA 2PBJA 3O6TA 1EP8A 4NHZA 1J0FA 1T4YA 4KB3A 3ZYWA 3CRTA 4CHSA 3LEFA 3UL3A 1PN0A 3ERFA 3LW9A 4ZL9A 4IS0A 1Y25A 2XPEA 5A4WA 4KH7A 2XPDA 1O8WA 1DUGA 3IK7A 2WCIA 1GUMA 2DLXA 3HXSA 3IR4A 3UBKA 4OO4A 3TU3B 5LNKe 2RUFA 1ERUA 2PERA 2X8CA 4FYUA 5J5NA 4HZ2A 1SKRB 4YKFA 3QR6A 3CRUA 2EIQA 5EY6A 3C8EA 3ZMLA 5IPGA 1G6YA 2VD1A 2QKEA 2B7JA 1XWGA 2VM2A 3SBCA 5ECPB 2YANA 1TU7A 5IQYA 2H6YA 1U88A 2F9SA 1PN9A 4ZBDA 4Z2RA 2CZ2A 5KN1A 3TJGA 5ID2A 4MCUA 2R37A 2GQLA 1O7UA 2EC4A 1AUCA 2A4HA 3APQA 2EFEA 4O92A 5D9VA 3U5RE 1JZDA 1WOUA 1WPIA 2RLIA 1U87A 4MJBA 2M72A 2B6MA 1T1VA 3O3TA 1GNWA 2QA1A 2R3XA 2F8FA 5H5SA 4XTSA 2H19A 4L0WA 5J47A 2XHFA 1XCCA 1OVNA 1GSSA 4GSNA 4IW9A 1U6TA 3D5JA 3UEMA 1AQWA 2VCQA 5F07A 4WF5A 1O6JA 2HRAA 1ZGNA 2E0QA 2LRCA 2B1KA 4PUAA 1BG1A 1V9WA 1XVQA 4KNDA 4KCEA 1N2AA 4QL9A 3FR9A 1Z7RA 5DALB 1A0RP 3E0UA 1YDKA 3W6GA 4FH8A 5JCGA 1XFLA 1Z9HA 2FA8A 3HVXA 3HY2A 4Z7XA 4Q5FA 3KTLA 1KBNA 5HR0A 3E3EA 5J4VA 2DJ3A 3FW2A 4E68A 1BQ7A 3MDKA 1PGTA 5IO2A 1Z5YE 3GYKA 2C1YA 4AF2A 5J9BA 2HRNA 1E6BA 1H4OA 2CVBA 3KMOA 3DWVA 2FNOA 4POKA 2KP1A 1HQOA 1GRXA 1SJZA 3BD2A 4HQZA 3I6AA 4MP4A 3KP8A 4AJ7A 4X43A 2IMKA 2VUPA 4HU9A 2GQKA 2LSTA 3CXGA 4ACSA 3GX0A 4IJ3A 3TOUA 4IP6A 2PWJA 4AKGA 4CY8A 3GN3A 1B48A 1GTIA 4GXZA 2ON5A 3VI5A 3DYRA 1BEDA 4EUYA 3GHAA 2QC7A 1DE2A 2I9HA 3C1RA 4QQ7A 2GS3A 5IIZA 2A2PA 2MBTA 4MZWA 1EGOA 2HFDA 2JU5A 2H75A 2GT5A 4G2EA 5GAPD 2HZEB 3M3MA 1FAAA 2MMAA 2LJAA 1KEBA 4I97A 2WDUA 4N3ZA 3GKXA 1XZOA 3C7MA 1Z6MA 1R5AA 2VL2A 4BVXA 2HNLA 1XW9A 5B7CA 1GSUA 5F0GA 3GURA 4K7OA 2X99A 3L78A 3HZ4A 1Z3EA 2YNXA 5G5EA 1QGVA 5ELAA 1NM3A 2GT6A 4G0KA 4JU5A 5IO0A 2J23A 1QFNA 3IAM2 3HA9A 2XBQA 1XVWA 4JZQA 1VF3A 5G5FA 4EIPA 3HJOA 4X4JA 5A1NA 13GSA 4CW9A 4IN0A 1ZL9A 1FOHA 5D9XA 5F8BA 5CRWA 4EL1A 4HDEA 2CAIA 3LWAA 2H76A 2IMEA 3TJJA 1K3OA 3W8JA 5BMUA 3RHBA 5A5HA 1JZRA 4XS1A 4QL7A 2DKIA 3QFAC 3TJFA 5ECSA 2K8VA 1JFUA 3IA1A 4EKZA 3KH7A 2JSZA 1QK8A 2LKUA 5D96A 2VCWA 4BL7B 4ML6A 3C71A 1T4ZA 2F8AA 1O8XA 3Q18A 2DJKA 2YWIA 2H73A 3FZAA 3MSZA 1Q4JA 3TKSE 2R0GA 4KGIA 3TDGA 3P2AA 4TVEA 1W89A 9GSSA 3PPUA 2H71A 2WFCA 4MK3A 3IXRA 2OKAA 3PGTA 3DKSA 2VD0A 3FHKA 2VAFA 3FZ9A 5J9CA 3RPNA 4Q5QA 4K7IA 1DBYA 2I1UA 4KDYA 2MBSA 3MYDA 1GTBA 1NHYA 2A2SA 2GGTA 1LBKA 4JE1A 5KN3A 4EXJA 3GSTA 2OBIA 2L6DA 3D4MA 4WEYA 5ECLB 4XCSA 3UBLA 1B8XA 4G9HA 4HS1A 1K3LA 1ZYQB 3PR8A 1TXXA 4O5RA 3EYTA 4BPYA 4YQMA 2HE3A 1EP7A 3FY7A 2DJ0A 5A4UA 5LCZA 3ZFLA 4PQIA 1THXA 2VCXA 2KOKA 2OE0A 3ZVJA 4W66A 4XS4B 2BTOT 2X4AA 8GSSA 2REMA 3M1GA 2AYTA 3A2WA 3UOMA 1TOFA 2I81A 4PQHA 4D73A 1DE1A 3GNJA 2V2GA 5GAND 3WD6A 2IFQB 2WULA 2AUVA 3VLNA 1TRVA 1SL0B 3DIEA 3W8SA 1THOA 2R6KA 1WRYA 4N30A 2C3QA 1R5PA 3J7Yb 3LFLA 1OYJA 3EVIA 4I2UA 2YV7A 4XRAA 4YKGA 1SENA 2H6XA 1BJXA 1NSWA 2B5EA 5CNWA 2CAQA 2HSYA 2VCTA 2H30A 1YKCA 5E4WA 1SJ6A 3HJPA 4TW5A 4JBBA 2HQTA 2VOCA 3ZLPA 4AJ6A 1M7TA 1ZYNA 1TI3A 4GSTA 5ECHB 1FB6A 3IBHA 1SD8A 2YPMA 1YY7A 4ECBA 5FHIA 4GQCA 3GSSA 3LGCA 5ECNB 3EPTA 1H75A 2NVLA 3CSIA 2YWMA 2HSMB 4MF6A 2H01A 10GSA 1MD4A 4K5RA 4IBPA 4KCAA 5IPHA 6GSUA 6GSXA 3WT1A 1TP9A 4ZBAA 4A5PA 1AQXA 1PMTA 5AGYA 3R2QA 2R2JA 1F3AA 4GWRA 5CO3A 4MABA 3F4SA 2VLVA 4NPBA 2EFDA 4ZIJA 3HZ8A 1V58A 1A2LA 1VRSD 5D93A 1IYHA 1VF4A 5L71A 3S9FA 3GH6A 16GSA 3F3RA 3VI7A 1TKDB 4GF0A 1U3IA 1PX7A 4WR5A 2VL2C 2LQQA 4I6XA 3WGDA 4O5UA 2YV9A 4KA0A 4E8HA 4F03A 4K5SA 4FYBA 4PGTA 3G7JA 2FY6A 4EDZA 2DJ2A 4G01A 4JR4A 3IV4A 2HSHA 4ISDA 2JL4A 3KD0A 2M80A 2LS5A 1B4QA 5IMAA 3TKSC 1AAZA 2FD3A 5ECOB 1T8EB 5DJMA 2WB9A 3ZL5A 3Q6OA 6GSYA 1N8JA 5COHA 2OJLA 3KTBA 2QA2A 1EZKA 1TI1A 4DSQA 3QAGA 3VK9A 5FT3A 4IQAA 1S3AA 5IMCA 3UAPA 1KTEA 2GZPA 3ERWA 2C0DA 4POMA 2LNTA 1VF1A 2VIMA 5ECIB 1J9BA 1C72A 1MEKA 2V32A 1SL1B 1F6MC 2H74A 2MYGA 2R5GA 1G0TA 1F3BA 3DEXA 2DC5A 2JACA 3SWLA 1SL2B 3C1SA 2P0GA 4OFNA 2L5OA 5C04A 2TRCP 4NV2A 1GULA 1T00A 3WGXA 3KP9A 2KHPA 3I9V2 5AN1A 4WR4A 1TK5B 1CQHA 2GSTA 4LLRA 2I4AA 4AKIA 1PX6A 1TRWA 1USBA 5ID2B 2F51A 4RQXA 3WGEA 4GLTA 1ACVA 3FZ4A 2C80A 2RM6A 4PUFC 2YJHA 1GSFA 2LTKA 4Z2TA 3TRPA 1BG5A 4AKHA 3KXOA 3KCMA 5KN0A 2HRKB 1OAZA 4OWYA 2IMIA 3F6FA 3FMWA 4GSSA 3EURA 3RBTA 5A5KA 2DKHA 2CA8A 2IMFA 2GSQA 5D8IA 1UA5A 2ZCTA 4NWYA 2UV8G 2HYXA 2C4JA 4FQUA 3NIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSW A;  3U6V A;  3DML A;  5IMF A;  2JSY A;  1F9M A;  2L6C A;  1UVZ A;  2HRF A;  2AV4 A;  2L59 A;  3UVT A;  1HNA A;  2NBS A;  3ZIJ A;  1OE7 A;  7GSS A;  1GSY A;  1ABA A;  4LMW A;  4E8E A;  3C73 A;  3H93 A;  22GS A;  3O76 A;  5IMV A;  1K0N A;  4IJI A;  3M9K A;  4TXV A;  4KX4 A;  1UN2 A;  3ZRD A;  1V2A A;  4OFT A;  1AQV A;  3A2V A;  4YAP A;  2M46 A;  3VFI A;  2IWT A;  4TRX A;  2XC2 A;  3IK9 A;  2H70 A;  2JAD A;  5D9T A;  4YQV A;  3D22 A;  19GS A;  3GTU A;  5H5Q A;  5A4V A;  2C3T A;  4MJC A;  2B1L A;  3QD9 A;  1M0U A;  2RUE A;  3VWW A;  4G0I A;  2CQ9 A;  4WF4 A;  4MH2 A;  1CQG A;  2GZZ A;  4J57 E;  3TB2 A;  4OD7 A;  3EE2 A;  5B6N A;  4K2D A;  2YOI A;  1RW1 A;  4N10 A;  5AIS A;  5KEJ A;  5G2Z A;  4HJM A;  4L0U A;  4KSO A;  6GSS A;  4LL4 B;  4F0C A;  4K7N A;  2NDO A;  2FGX A;  4HZ4 A;  3RAZ A;  4CDO A;  4N0V A;  4ZL7 A;  5HR2 A;  2I3Y A;  5CRD A;  1OC9 A;  4GRF A;  5HR3 A;  1JLV A;  1NW2 A;  3US3 A;  2V1M A;  1TTZ A;  3HD5 A;  3R3E A;  1LU4 A;  5B6M A;  3GKM A;  4TR1 A;  1TW9 A;  2GDR A;  2VL9 A;  4MA9 A;  4O7H A;  1YF0 A;  1HD2 A;  3Q74 A;  2FHE A;  5H5R A;  1GL8 A;  2C0F A;  2YZU A;  4V2M A;  2PMT A;  1YQ1 A;  2IPA A;  1A2J A;  5DQS A;  3FK8 A;  4IQ1 A;  3TJK A;  1RK4 A;  5HFK A;  5IMD A;  2CX4 A;  2YWN A;  5FWG A;  1OC8 A;  5D73 A;  3FEU A;  4V1A p;  3D4T A;  3HKR A;  2E2M A;  2YWO A;  5JWR B;  4MF7 A;  1R7H A;  4PTS A;  4X1U A;  4G0L A;  2IL3 A;  4KE3 A;  1X5C A;  1GSD A;  4LL1 B;  2VM1 A;  2LQO A;  4KUN A;  4V1A g;  2QSI A;  3GV1 A;  1R4W A;  4DVC A;  4MF5 A;  3IC4 A;  4DEJ A;  4JR6 A;  4TR3 A;  4ZBB A;  1IYI A;  2WJU A;  4XHM A;  1WE0 A;  1SD9 A;  4HQS A;  4EF0 A;  2E2G A;  1SK0 A;  4Q5R A;  1BX9 A;  2NPB A;  4DSS A;  3TJB A;  3UJ1 A;  4XIH A;  3FYG A;  2GLR A;  2DJ1 A;  1ML6 A;  1SYX A;  3G9B A;  4V2L A;  2H1A A;  2KP2 A;  2MMN A;  1SK2 A;  1B9Y C;  5EL8 A;  3P7X A;  1XW6 A;  3MAK A;  4IVF A;  3VPT A;  2O85 A;  4YH2 A;  2GZY A;  4J56 E;  4KAE A;  1I9D A;  1X9S B;  2DSA A;  1PSQ A;  3N9J A;  3FKF A;  2CV4 A;  2FCH A;  4MH3 A;  4PNG A;  2H1G A;  2X8G A;  4IP1 A;  1ZOF A;  3GL3 A;  4ID0 A;  1NHO A;  2V41 A;  1A0F A;  1ZZY A;  1EOG A;  1XOB A;  12GS A;  4KDX A;  3QPM A;  3GL5 A;  4ZL8 A;  3GA4 A;  4TXO A;  5ECR B;  2IMD A;  3FZ5 A;  1JZO A;  4GCI A;  4BVY A;  1DSB A;  2FA4 A;  1T3B A;  2JZR A;  1X9W B;  1YJ6 A;  3KH9 A;  1OKT A;  1ZMA A;  2N5A A;  2IFQ A;  2AB6 A;  4D73 B;  3I43 A;  2J9H A;  3CTF A;  5ABR A;  2ON7 A;  5G31 A;  2FUG 2;  1QXH A;  4XS6 A;  2KLX A;  2H1B A;  2WGR A;  2A4V A;  1M9A A;  5F06 A;  4MPG A;  3DVW A;  2L4C A;  4MZB A;  3VWV A;  14GS A;  2LEG A;  5JWQ B;  4GTU A;  5JWO B;  4HUA A;  5INY A;  3GKN A;  3GX8 A;  2E7P A;  1PRX A;  3IHQ A;  1M99 A;  1GNE A;  1ERW A;  2WRT A;  2B5Y A;  4GQF A;  2D2Z A;  2LV3 A;  1QUW A;  4FYC A;  1XWK A;  2KUC A;  1HYU A;  2C3N A;  3NZN A;  5D9W A;  4PNF A;  1AIU A;  1OC3 A;  4L5L A;  1QMV A;  2EIR A;  2CVD A;  4TOP A;  2DIZ A;  2K9F A;  4NMU A;  1WWJ A;  2O87 A;  1GTU A;  3LQ7 A;  3PIN A;  3ISO A;  2L5L A;  2OE1 A;  3OR5 A;  2BJX A;  5B8A A;  4EE0 A;  3F4T A;  4F9Z A;  3ZTL A;  5DCG A;  1Q98 A;  2CZ3 A;  4TR0 A;  1GWC A;  2DIY A;  4PQ1 A;  3WYW A;  1FW1 A;  3GH9 A;  3QFB C;  3UIW A;  4KSM A;  1V57 A;  5IM9 A;  5F05 A;  1ERT A;  3KEB A;  3HCZ A;  3L9S A;  3KZQ A;  4FO5 A;  3MNG A;  1O81 A;  1QQ2 A;  1SKW B;  5B8B A;  2H0H A;  3BJ5 A;  4EDY A;  3ZIV A;  5AIV A;  1B4P A;  1PKW A;  4RI7 A;  2PN8 A;  3EMX A;  2RM5 A;  2PGT A;  5DVB A;  2G0F A;  4Q5N A;  4NV5 A;  4N0Z A;  2HSN B;  3ZFB A;  1VGL A;  4ZB9 A;  1PD2 1;  3L9V A;  5EPF A;  1TJD A;  3LG6 A;  4F2I A;  1GTA A;  4JRR A;  5ENU A;  4I2T A;  2GQM A;  3HJM A;  4ECJ A;  4ZXG A;  4V2N A;  5DAK A;  1K3Y A;  1JZW A;  3LXZ A;  1XW5 A;  1A2M A;  1OKD A;  3FR3 A;  2PU9 C;  1R26 A;  5KN2 A;  1ZYE A;  3CSJ A;  3QAV A;  1WP0 A;  2B3S A;  4OMV A;  3H79 A;  3K8N A;  3UMA A;  1K0O A;  3ME8 A;  3VWU A;  3ME7 A;  4AJ8 A;  2C0E A;  2HT9 A;  2XBI A;  5CRG A;  1GH2 A;  3D21 A;  1M2A A;  1Y6E A;  3UVH A;  2WS2 A;  2H0G A;  1Z7P A;  4K1F A;  3HVV A;  5HFI A;  2NTO A;  1ON4 A;  4K0N A;  3TCO A;  2P5Q A;  3A2X A;  3F6D A;  1TK8 B;  4X0X A;  3QAW A;  3VUR A;  3KJY A;  2N5F A;  3DXB A;  4HOJ A;  4EO3 A;  1AW9 A;  2ZUP A;  1K0D A;  2K18 A;  2H66 A;  1GUK A;  4KDU A;  1FOV A;  4ECC A;  1M9B A;  4IGJ A;  3AY8 A;  4ECI A;  2FWH A;  3IAS 2;  4NAX A;  3L4N A;  3HHV A;  1TRU A;  4WKW A;  1EOH A;  3F4R A;  3D0Z A;  2H0I A;  4N11 A;  4MLY A;  4USS A;  4L8E A;  5ECQ B;  3EWL A;  4RUV A;  5JCU A;  1PA3 A;  2DMM A;  1YF1 A;  3QMX A;  4G10 A;  2OE3 A;  3IPZ A;  2X64 A;  3L0H A;  3L9U A;  3RPP A;  3VWX A;  3E9J B;  2B7K A;  2AJQ B;  3HVS A;  2HRK A;  2OAD A;  2HI7 A;  5ECM B;  1GP1 A;  4H86 A;  4TN8 A;  5GSS A;  5HQP A;  1EEM A;  4F0B A;  1G7E A;  1OE8 A;  3G7I A;  3P90 A;  5ELG A;  5DAL A;  5GST A;  1EWX A;  1XIY A;  4MPF A;  3IDV A;  11GS A;  1G7O A;  5J4U A;  3ZVJ D;  1B9X C;  2VLU A;  3EC3 A;  1E2Y A;  1SU9 A;  4AGS A;  1GLQ A;  2VO4 A;  3GUS A;  1ILO A;  1O85 A;  1MDK A;  3H8Q A;  1EEJ A;  4JED A;  4EC0 A;  3DRN A;  2V6K A;  2H8L A;  2V6O A;  1G6W A;  4BWQ A;  2FLS A;  4TR4 A;  2FWE A;  4G19 A;  4MZC A;  4NXI A;  1YKA A;  5HR1 A;  1XWC A;  5CP1 A;  1JLW A;  4BA7 A;  3M8N A;  5ECK B;  1BYE A;  1F37 A;  4BWS A;  2HXK A;  3ZZX A;  1F2E A;  3F9U A;  3TGZ A;  1EV4 A;  5HFG A;  1MDJ A;  3GTU B;  1GLP A;  5G30 A;  2MMO A;  1HNB A;  1A23 A;  4J2F A;  2TRX A;  3F8U A;  5JCW A;  3QOU A;  2JZT A;  1W4V A;  3LXT A;  2K6V A;  3EMP A;  1SK1 A;  2DJJ A;  5CRH A;  4EVM A;  4NHW A;  2R4V A;  3KGK A;  3ZRE A;  2HZE A;  2GSR A;  3BCI A;  3JCM L;  3F0I A;  4IEL A;  3DVX A;  4HEA 2;  4WBR D;  2K8S A;  4ML1 A;  1Z6N A;  3LSZ A;  2CVK A;  2OBK A;  1XOA A;  3EU4 A;  3FR6 A;  3BCK A;  1WJK A;  1VF2 A;  3IC8 A;  4ZB6 A;  4BVX B;  2C0G A;  2HLS A;  2AAW A;  5G1K A;  5C00 A;  20GS A;  1S3C A;  1URM A;  4L5O A;  4OCE A;  4OO5 A;  1XWB A;  2H6Z A;  1OC9 B;  1XPV A;  4RI6 A;  1TRS A;  3FRC A;  3KM6 A;  4MJE A;  1FO5 A;  2PVO C;  2UZ8 A;  3KIJ A;  2B5X A;  2RII A;  5AIX A;  2ZNM A;  3PH9 A;  4TR1 B;  2F3M A;  3CMI A;  3CSH A;  4POL A;  3ERG A;  3TRQ A;  2YZH A;  2LJK A;  3GIX A;  1AC1 A;  3A5W A;  1RQM A;  3IE3 A;  3TKR A;  4WXT A;  5IOW A;  4P3Y B;  5CYY A;  1PL2 A;  2ES7 A;  3NOF A;  4I5Q A;  3TKS A;  5EVO A;  2YN1 A;  4YQU A;  1GUH A;  3DGQ A;  1M2D A;  4TKY A;  4POB A;  4BL7 A;  4LA1 A;  3RDW A;  5DBQ A;  4MJA A;  3V1W A;  4PUR A;  2CT6 A;  2LRN A;  1FG4 A;  2ALB A;  1WMJ A;  3GRX A;  5DCH A;  4IKH A;  3H1N A;  3ZMK A;  2PUK C;  1EV9 A;  1SKS B;  1PKZ A;  1MD3 A;  3CBU A;  2H1D A;  3LYK A;  1TDI A;  1V98 A;  4K9Z A;  2EIO A;  4ULX A;  4IHU A;  2H72 A;  2MZC A;  2YP6 A;  3EU3 A;  3LJR A;  5DQY A;  1YEX A;  4OFM A;  2VCZ A;  3HYP A;  1V40 A;  1FVJ A;  3M0F A;  2IIY A;  4WET A;  2PVQ A;  3N5O A;  1K0A A;  4DSS B;  1KNG A;  1HNC A;  1ZCP A;  1YZX A;  2O7K A;  1A8Y A;  2GVP A;  3LYP A;  3IRA A;  2LRT A;  4WBJ A;  4O32 A;  2DBC A;  5CRE A;  4K8M A;  1ST9 A;  4XS4 A;  4PXO A;  5CAX A;  4RQR A;  4I8B A;  4YAV A;  5DDL A;  1X0R A;  2LNS A;  1LJR A;  1ERV A;  1O73 A;  3TRX A;  2L4Q A;  3DD3 A;  1FVK A;  2FWF A;  1A8L A;  2O8V B;  3QCP A;  4ZIL A;  4TXO B;  1PL1 A;  1T7P B;  3VPQ A;  4K6X A;  4ILF A;  3D6I A;  1YEP A;  4BVY B;  3IOS A;  3BBY A;  1M2B A;  3A3T A;  3TKQ A;  3TKP A;  3MWH A;  3I69 A;  1BAY A;  5G1L A;  1S3D A;  6GST A;  1FB0 A;  2GSS A;  1SYR A;  2PPT A;  4MMM A;  1UC7 A;  3UAR A;  4KF9 A;  1FHE A;  1XWA A;  2OAC A;  2P31 A;  1K0B A;  3BOA A;  1J08 A;  3APO A;  3ZIT A;  3EIN A;  2FWG A;  5GZZ B;  2OA7 A;  2LJR A;  4ZB8 A;  1WIK A;  2DML A;  2VLT A;  17GS A;  3GMF A;  2N5B A;  1I5G A;  3WT2 A;  3LOR A;  2HSM A;  1A24 A;  4FIW A;  4DSR A;  2L57 A;  3GFK A;  3KMN A;  2TIR A;  2WZ9 A;  3TUE A;  2C8U A;  4XRD A;  2CX3 A;  3CYN A;  4MDC A;  2P5R A;  2QGV A;  5J41 A;  3TOT A;  3J7Y k;  2Z9S A;  1EGR A;  3RHC A;  2YJ7 A;  1K0M A;  2YCD A;  3APS A;  1K0C A;  2X8H A;  4HU7 A;  2GTU A;  3QDN A;  1MDI A;  1PQN A;  2G2Q A;  1MTC A;  1TK0 B;  4F82 A;  1X9M B;  2IJY A;  4HI7 A;  6GSV A;  3CTG A;  5IOX A;  1X5D A;  5IMZ A;  2IN3 A;  2AHE A;  2LUS A;  4K0G A;  1XBS A;  18GS A;  3M9J A;  1TU8 A;  3GKK A;  5J3R A;  1AXD A;  4KW6 A;  1SJI A;  4OCF A;  2BMX A;  1X5E A;  2O89 A;  2HZF A;  5DJL A;  3Q19 A;  1XXU A;  3F3Q A;  2VCV A;  2JZS A;  5LD0 A;  5E59 A;  3G7Y A;  1GSE A;  3F63 A;  2MMZ A;  3ED3 A;  3H4K A;  4LMV A;  1U3A A;  2A2R A;  5DAK B;  3HDC A;  2VL3 A;  3P8W A;  4HJ2 A;  1GSQ A;  4PX1 A;  1JHB A;  2PBJ A;  3O6T A;  1EP8 A;  4NHZ A;  1J0F A;  1T4Y A;  4KB3 A;  3ZYW A;  3CRT A;  4CHS A;  3LEF A;  3UL3 A;  3ERF A;  4ZL9 A;  4IS0 A;  1Y25 A;  2XPE A;  5A4W A;  4KH7 A;  2XPD A;  1O8W A;  1DUG A;  3IK7 A;  2WCI A;  1GUM A;  2DLX A;  3HXS A;  3IR4 A;  3UBK A;  4OO4 A;  5LNK e;  2RUF A;  1ERU A;  2PER A;  2X8C A;  4FYU A;  5J5N A;  4HZ2 A;  1SKR B;  3QR6 A;  3CRU A;  2EIQ A;  5EY6 A;  3C8E A;  3ZML A;  5IPG A;  1G6Y A;  2VD1 A;  2QKE A;  2B7J A;  1XWG A;  2VM2 A;  3SBC A;  5ECP B;  2YAN A;  1TU7 A;  5IQY A;  2H6Y A;  1U88 A;  2F9S A;  1PN9 A;  4ZBD A;  2CZ2 A;  5KN1 A;  3TJG A;  5ID2 A;  4MCU A;  2R37 A;  2GQL A;  1O7U A;  2EC4 A;  1AUC A;  3APQ A;  4O92 A;  5D9V A;  3U5R E;  1JZD A;  1WOU A;  1WPI A;  2RLI A;  1U87 A;  4MJB A;  2M72 A;  2B6M A;  1T1V A;  3O3T A;  1GNW A;  2R3X A;  2F8F A;  5H5S A;  4XTS A;  2H19 A;  4L0W A;  2XHF A;  1OVN A;  1XCC A;  1GSS A;  4GSN A;  4IW9 A;  1U6T A;  3D5J A;  3UEM A;  1AQW A;  2VCQ A;  5F07 A;  4WF5 A;  1O6J A;  2HRA A;  1ZGN A;  2E0Q A;  2LRC A;  2B1K A;  4PUA A;  1V9W A;  1XVQ A;  4KND A;  4KCE A;  1N2A A;  4QL9 A;  3FR9 A;  1Z7R A;  5DAL B;  1A0R P;  3E0U A;  1YDK A;  3W6G A;  4FH8 A;  5JCG A;  1XFL A;  1Z9H A;  2FA8 A;  3HVX A;  3HY2 A;  4Z7X A;  4Q5F A;  3KTL A;  1KBN A;  5HR0 A;  3E3E A;  2DJ3 A;  3FW2 A;  1BQ7 A;  3MDK A;  1PGT A;  5IO2 A;  1Z5Y E;  3GYK A;  2C1Y A;  4AF2 A;  5J9B A;  2HRN A;  1E6B A;  1H4O A;  2CVB A;  3KMO A;  3DWV A;  2FNO A;  4POK A;  2KP1 A;  1HQO A;  1GRX A;  1SJZ A;  3BD2 A;  4HQZ A;  3I6A A;  4MP4 A;  3KP8 A;  4AJ7 A;  4X43 A;  2IMK A;  2VUP A;  4HU9 A;  2GQK A;  2LST A;  3CXG A;  4ACS A;  3GX0 A;  4IJ3 A;  3TOU A;  4IP6 A;  2PWJ A;  3GN3 A;  1B48 A;  1GTI A;  4GXZ A;  2ON5 A;  3VI5 A;  3DYR A;  1BED A;  4EUY A;  3GHA A;  2QC7 A;  1DE2 A;  2I9H A;  3C1R A;  4QQ7 A;  2GS3 A;  5IIZ A;  2MBT A;  4MZW A;  1EGO A;  2HFD A;  2JU5 A;  2H75 A;  2GT5 A;  4G2E A;  5GAP D;  2HZE B;  3M3M A;  1FAA A;  2MMA A;  2LJA A;  1KEB A;  4I97 A;  2WDU A;  3GKX A;  1XZO A;  3C7M A;  1Z6M A;  1R5A A;  2VL2 A;  4BVX A;  2HNL A;  1XW9 A;  5B7C A;  1GSU A;  5F0G A;  3GUR A;  4K7O A;  2X99 A;  3L78 A;  3HZ4 A;  1Z3E A;  2YNX A;  5G5E A;  1QGV A;  5ELA A;  1NM3 A;  2GT6 A;  4G0K A;  4JU5 A;  5IO0 A;  2J23 A;  1QFN A;  3IAM 2;  3HA9 A;  2XBQ A;  1XVW A;  4JZQ A;  1VF3 A;  5G5F A;  3HJO A;  13GS A;  4CW9 A;  4IN0 A;  1ZL9 A;  5D9X A;  5F8B A;  5CRW A;  4EL1 A;  4HDE A;  2CAI A;  3LWA A;  2H76 A;  2IME A;  3TJJ A;  1K3O A;  3W8J A;  5BMU A;  3RHB A;  1JZR A;  4XS1 A;  4QL7 A;  3QFA C;  3TJF A;  5ECS A;  2K8V A;  1JFU A;  3IA1 A;  4EKZ A;  3KH7 A;  2JSZ A;  1QK8 A;  2LKU A;  5D96 A;  2VCW A;  4BL7 B;  4ML6 A;  3C71 A;  1T4Z A;  2F8A A;  1O8X A;  3Q18 A;  2DJK A;  2YWI A;  2H73 A;  3FZA A;  3MSZ A;  1Q4J A;  3TKS E;  4KGI A;  3TDG A;  3P2A A;  4TVE A;  1W89 A;  9GSS A;  3PPU A;  2H71 A;  2WFC A;  4MK3 A;  3IXR A;  2OKA A;  3PGT A;  3DKS A;  2VD0 A;  3FHK A;  2VAF A;  3FZ9 A;  5J9C A;  3RPN A;  4Q5Q A;  4K7I A;  1DBY A;  2I1U A;  4KDY A;  2MBS A;  1GTB A;  1NHY A;  2A2S A;  2GGT A;  1LBK A;  4JE1 A;  5KN3 A;  4EXJ A;  3GST A;  2OBI A;  2L6D A;  3D4M A;  4WEY A;  5ECL B;  4XCS A;  3UBL A;  1B8X A;  4G9H A;  4HS1 A;  1K3L A;  1ZYQ B;  3PR8 A;  1TXX A;  4O5R A;  3EYT A;  4BPY A;  4YQM A;  2HE3 A;  1EP7 A;  3FY7 A;  2DJ0 A;  5A4U A;  5LCZ A;  3ZFL A;  4PQI A;  1THX A;  2VCX A;  2KOK A;  2OE0 A;  3ZVJ A;  4XS4 B;  2BTO T;  8GSS A;  2REM A;  3M1G A;  2AYT A;  3A2W A;  3UOM A;  1TOF A;  2I81 A;  4PQH A;  4D73 A;  1DE1 A;  3GNJ A;  2V2G A;  5GAN D;  3WD6 A;  2IFQ B;  2WUL A;  2AUV A;  3VLN A;  1TRV A;  1SL0 B;  3DIE A;  3W8S A;  1THO A;  2R6K A;  1WRY A;  4N30 A;  2C3Q A;  1R5P A;  3J7Y b;  3LFL A;  1OYJ A;  3EVI A;  4I2U A;  2YV7 A;  4XRA A;  1SEN A;  2H6X A;  1BJX A;  1NSW A;  2B5E A;  5CNW A;  2CAQ A;  2HSY A;  2VCT A;  2H30 A;  1YKC A;  5E4W A;  1SJ6 A;  3HJP A;  4TW5 A;  4JBB A;  2HQT A;  2VOC A;  3ZLP A;  4AJ6 A;  1M7T A;  1TI3 A;  4GST A;  5ECH B;  1FB6 A;  3IBH A;  1SD8 A;  2YPM A;  1YY7 A;  4ECB A;  5FHI A;  4GQC A;  3GSS A;  3LGC A;  5ECN B;  1H75 A;  2NVL A;  3CSI A;  2YWM A;  2HSM B;  4MF6 A;  2H01 A;  10GS A;  1MD4 A;  4IBP A;  4KCA A;  5IPH A;  6GSU A;  6GSX A;  3WT1 A;  1TP9 A;  4ZBA A;  1AQX A;  1PMT A;  5AGY A;  3R2Q A;  2R2J A;  1F3A A;  4GWR A;  5CO3 A;  4MAB A;  3F4S A;  2VLV A;  4NPB A;  4ZIJ A;  3HZ8 A;  1V58 A;  1A2L A;  1VRS D;  5D93 A;  1IYH A;  1VF4 A;  5L71 A;  3S9F A;  3GH6 A;  16GS A;  3F3R A;  3VI7 A;  1TKD B;  4GF0 A;  1U3I A;  1PX7 A;  4WR5 A;  2VL2 C;  2LQQ A;  4I6X A;  3WGD A;  2YV9 A;  4KA0 A;  4E8H A;  4F03 A;  4FYB A;  4PGT A;  3G7J A;  2FY6 A;  4EDZ A;  2DJ2 A;  4JR4 A;  3IV4 A;  2HSH A;  4ISD A;  2JL4 A;  3KD0 A;  2M80 A;  2LS5 A;  1B4Q A;  5IMA A;  3TKS C;  1AAZ A;  2FD3 A;  5ECO B;  1T8E B;  5DJM A;  2WB9 A;  3ZL5 A;  3Q6O A;  6GSY A;  1N8J A;  5COH A;  2OJL A;  3KTB A;  1EZK A;  1TI1 A;  4DSQ A;  3QAG A;  3VK9 A;  5FT3 A;  4IQA A;  1S3A A;  5IMC A;  3UAP A;  1KTE A;  2GZP A;  3ERW A;  2C0D A;  4POM A;  2LNT A;  1VF1 A;  2VIM A;  5ECI B;  1J9B A;  1C72 A;  1MEK A;  2V32 A;  1SL1 B;  1F6M C;  2H74 A;  2MYG A;  2R5G A;  1G0T A;  1F3B A;  3DEX A;  2DC5 A;  2JAC A;  3SWL A;  1SL2 B;  3C1S A;  2P0G A;  4OFN A;  2L5O A;  5C04 A;  2TRC P;  4NV2 A;  1GUL A;  1T00 A;  3WGX A;  3KP9 A;  2KHP A;  3I9V 2;  5AN1 A;  4WR4 A;  1TK5 B;  1CQH A;  2GST A;  4LLR A;  2I4A A;  1PX6 A;  1TRW A;  1USB A;  5ID2 B;  2F51 A;  4RQX A;  3WGE A;  4GLT A;  1ACV A;  3FZ4 A;  2C80 A;  2RM6 A;  4PUF C;  2YJH A;  1GSF A;  2LTK A;  3TRP A;  1BG5 A;  3KCM A;  3KXO A;  5KN0 A;  2HRK B;  1OAZ A;  4OWY A;  2IMI A;  3F6F A;  4GSS A;  3EUR A;  3RBT A;  5A5K A;  2CA8 A;  2IMF A;  2GSQ A;  5D8I A;  1UA5 A;  2ZCT A;  4NWY A;  2HYX A;  2C4J A;  4FQU A;  3NIV A; 
#chains in the Genus database with same CATH topology
 6GSW A;  3U6V A;  3DML A;  5IMF A;  2JSY A;  1F9M A;  2L6C A;  1UVZ A;  2HRF A;  2AV4 A;  2L59 A;  3UVT A;  1HNA A;  2NBS A;  1SVO A;  3ZIJ A;  1OE7 A;  7GSS A;  1GSY A;  1ABA A;  4LMW A;  3A5I A;  4E8E A;  2R0C A;  3C73 A;  3H93 A;  22GS A;  2O5V A;  3O76 A;  5IMV A;  1K0N A;  4IJI A;  2WVZ A;  3M9K A;  4TXV A;  2R0P A;  4KX4 A;  1UN2 A;  3ZRD A;  1V2A A;  4OFT A;  1AQV A;  3A2V A;  4YAP A;  2M46 A;  3VFI A;  2IWT A;  4TRX A;  2XC2 A;  3IK9 A;  2H70 A;  2JAD A;  5D9T A;  4YQV A;  3D22 A;  19GS A;  3GTU A;  5H5Q A;  5A4V A;  2C3T A;  4MJC A;  2B1L A;  3QD9 A;  1M0U A;  2RUE A;  3VWW A;  4G0I A;  2CQ9 A;  4WF4 A;  4MH2 A;  1CQG A;  2GZZ A;  4J57 E;  3TB2 A;  4OD7 A;  3EE2 A;  5J40 A;  5B6N A;  4K2D A;  2YOI A;  1RW1 A;  4N10 A;  5AIS A;  5KEJ A;  5G2Z A;  4HJM A;  4L0U A;  4KSO A;  6GSS A;  4LL4 B;  4F0C A;  2OT3 A;  4K7N A;  1ZYP A;  2NDO A;  2FGX A;  4HZ4 A;  3RAZ A;  4CDO A;  4N0V A;  4ZL7 A;  5HR2 A;  2I3Y A;  5CRD A;  1OC9 A;  4HSC X;  4GRF A;  5HR3 A;  1JLV A;  1NW2 A;  3US3 A;  2V1M A;  1TTZ A;  3HD5 A;  3R3E A;  1LU4 A;  5B6M A;  3GKM A;  4TR1 A;  1TW9 A;  2GDR A;  2VL9 A;  4MA9 A;  4O7H A;  1YF0 A;  1HD2 A;  3Q74 A;  2FHE A;  5H5R A;  1GL8 A;  2C0F A;  2YZU A;  4V2M A;  2PMT A;  1YQ1 A;  2IPA A;  1A2J A;  5DQS A;  3FK8 A;  4IQ1 A;  3TJK A;  5A1N B;  1RK4 A;  5HFK A;  5IMD A;  2CX4 A;  2X49 A;  2YWN A;  5FWG A;  1OC8 A;  5D73 A;  3FEU A;  4V1A p;  3D4T A;  2YWO A;  3HKR A;  5BMU B;  2E2M A;  5A5H B;  5A34 B;  4MF7 A;  5JWR B;  1R7H A;  4K2X A;  4PTS A;  4X1U A;  4G0L A;  2IL3 A;  4KE3 A;  1X5C A;  1GSD A;  4LL1 B;  2VM1 A;  2LQO A;  4KUN A;  4V1A g;  2QSI A;  3GV1 A;  1R4W A;  4DVC A;  4MF5 A;  3IC4 A;  4DEJ A;  4JR6 A;  4TR3 A;  4ZBB A;  1IYI A;  2WJU A;  4BIK A;  4XHM A;  1WE0 A;  1SD9 A;  4HQS A;  4EF0 A;  2E2G A;  1SK0 A;  4Q5R A;  4MNN A;  1BX9 A;  2NPB A;  4DSS A;  3TJB A;  3UJ1 A;  4XIH A;  3FYG A;  2GLR A;  2DJ1 A;  1ML6 A;  1SYX A;  3G9B A;  4V2L A;  2H1A A;  2KP2 A;  2MMN A;  1SK2 A;  1B9Y C;  5EL8 A;  3P7X A;  1XW6 A;  3MAK A;  4IVF A;  3VPT A;  2O85 A;  4YH2 A;  2GZY A;  4J56 E;  4KAE A;  1I9D A;  1X9S B;  2DSA A;  1PSQ A;  3N9J A;  3FKF A;  2CV4 A;  2FCH A;  4MH3 A;  4PNG A;  2H1L A;  2H1G A;  2X8G A;  4IP1 A;  1ZOF A;  3GL3 A;  4ID0 A;  1NHO A;  2V41 A;  1A0F A;  1ZZY A;  1EOG A;  4AKX B;  1XOB A;  12GS A;  4KDX A;  4PI0 C;  3QPM A;  3GL5 A;  4ZL8 A;  3GA4 A;  4TXO A;  5ECR B;  2IMD A;  3FZ5 A;  1JZO A;  4GCI A;  4BVY A;  1SVL A;  1DSB A;  2FA4 A;  1T3B A;  5KOW A;  2JZR A;  1X9W B;  1YJ6 A;  3KH9 A;  1OKT A;  1ZMA A;  2N5A A;  2IFQ A;  2AB6 A;  4D73 B;  3I43 A;  2J9H A;  3CTF A;  5ABR A;  2ON7 A;  5G31 A;  2FUG 2;  1QXH A;  4XS6 A;  2KLX A;  2H1B A;  2WGR A;  2A4V A;  1M9A A;  5F06 A;  4MPG A;  3DVW A;  2L4C A;  4MZB A;  3VWV A;  14GS A;  2LEG A;  3CWG A;  5JWQ B;  4GTU A;  5JWO B;  4HUA A;  5INY A;  3GKN A;  3GX8 A;  2E7P A;  3CHX C;  1PRX A;  3IHQ A;  1M99 A;  1GNE A;  1ERW A;  2WRT A;  2B5Y A;  4GQF A;  2D2Z A;  2LV3 A;  1QUW A;  4FYC A;  1XWK A;  4ZB7 A;  2KUC A;  1HYU A;  2C3N A;  3NZN A;  5D9W A;  4PNF A;  1AIU A;  1OC3 A;  4L5L A;  1QMV A;  2EIR A;  2CVD A;  4TOP A;  2DIZ A;  2K9F A;  4NMU A;  1WWJ A;  2O87 A;  1GTU A;  3LQ7 A;  3PIN A;  3ISO A;  2L5L A;  2OE1 A;  3OR5 A;  2BJX A;  5B8A A;  5J4Y A;  1XG8 A;  4EE0 A;  3F4T A;  4F9Z A;  3ZTL A;  5DCG A;  1Q98 A;  2CZ3 A;  4TR0 A;  1GWC A;  2DIY A;  4PQ1 A;  3WYW A;  1FW1 A;  3GH9 A;  3QFB C;  3UIW A;  4KSM A;  1N25 A;  1V57 A;  5IM9 A;  5F05 A;  1ERT A;  3KEB A;  3HCZ A;  3L9S A;  3KZQ A;  4FO5 A;  2WW0 A;  3MNG A;  1O81 A;  1QQ2 A;  1SKW B;  5B8B A;  4O5Q A;  2H0H A;  3BJ5 A;  4EDY A;  3ZIV A;  5AIV A;  1B4P A;  2PN8 A;  1PKW A;  4RI7 A;  3EMX A;  2RM5 A;  2PGT A;  5DVB A;  2G0F A;  4Q5N A;  4NV5 A;  4N0Z A;  2HSN B;  4EIQ A;  3ZFB A;  1VGL A;  4ZB9 A;  1PD2 1;  3L9V A;  1BF5 A;  5EPF A;  1TJD A;  3LG6 A;  4F2I A;  1GTA A;  4JRR A;  5ENU A;  4I2T A;  2GQM A;  3HJM A;  4ECJ A;  4ZXG A;  4V2N A;  5DAK A;  1K3Y A;  1JZW A;  3LXZ A;  1XW5 A;  1A2M A;  1OKD A;  3CQF A;  3FR3 A;  2PU9 C;  1R26 A;  5KN2 A;  1ZYE A;  3CSJ A;  3QAV A;  1WP0 A;  2B3S A;  4OMV A;  3H79 A;  4AI6 A;  3K8N A;  3UMA A;  1K0O A;  3ME8 A;  3VWU A;  3ME7 A;  4AJ8 A;  2C0E A;  2HT9 A;  2XBI A;  5CRG A;  1GH2 A;  3D21 A;  1M2A A;  1Y6E A;  3UVH A;  2WS2 A;  2H0G A;  1Z7P A;  4K1F A;  3HVV A;  5HFI A;  2NTO A;  1ON4 A;  4K0N A;  3TCO A;  2P5Q A;  3A2X A;  3F6D A;  1TK8 B;  4X0X A;  3QAW A;  3VUR A;  3KJY A;  2N5F A;  3DXB A;  4HOJ A;  2EFC A;  4EO3 A;  1AW9 A;  2ZUP A;  1K0D A;  2K18 A;  2H66 A;  1GUK A;  4KDU A;  1FOV A;  4ECC A;  1M9B A;  4IGJ A;  3AY8 A;  4ECI A;  2FWH A;  3IAS 2;  4NAX A;  3L4N A;  3HHV A;  1TRU A;  4WKW A;  1EOH A;  3F4R A;  3D0Z A;  2H0I A;  4N11 A;  4MLY A;  4USS A;  4L8E A;  5ECQ B;  3EWL A;  4RUV A;  5JCU A;  1PA3 A;  2DMM A;  1YF1 A;  3QMX A;  4G10 A;  2OE3 A;  3IPZ A;  2X64 A;  3L0H A;  3L9U A;  3RPP A;  3VWX A;  1PFO A;  3E9J B;  2B7K A;  2AJQ B;  3HVS A;  2HRK A;  2OAD A;  2HI7 A;  5ECM B;  1GP1 A;  4H86 A;  4TN8 A;  5GSS A;  5HQP A;  1EEM A;  4F0B A;  1G7E A;  1OE8 A;  3G7I A;  3P90 A;  5ELG A;  5DAL A;  5GST A;  1EWX A;  1XIY A;  4MPF A;  3IDV A;  5KOX A;  11GS A;  1G7O A;  5J4U A;  2WVX B;  1B9X C;  3ZVJ D;  2VLU A;  3EC3 A;  1E2Y A;  1SU9 A;  3RFR C;  4AGS A;  1GLQ A;  2VO4 A;  3GUS A;  1ILO A;  2WZS A;  1O85 A;  1MDK A;  3H8Q A;  1EEJ A;  4JED A;  4EC0 A;  3DRN A;  2V6K A;  2H8L A;  2V6O A;  1G6W A;  2WW2 A;  4BWQ A;  2FLS A;  4TR4 A;  2FWE A;  4G19 A;  4MZC A;  4NXI A;  1YKA A;  5HR1 A;  1XWC A;  5CP1 A;  1JLW A;  4BA7 A;  3M8N A;  2O3E A;  5ECK B;  1BYE A;  1F37 A;  4BWS A;  2HXK A;  3ZZX A;  1F2E A;  3F9U A;  3TGZ A;  3IHG A;  1EV4 A;  5HFG A;  1MDJ A;  3GTU B;  2VKZ G;  1GLP A;  5G30 A;  2MMO A;  1HNB A;  1A23 A;  4J2F A;  2TRX A;  3F8U A;  5JCW A;  2JZT A;  3QOU A;  1W4V A;  3LXT A;  2K6V A;  3EMP A;  1SK1 A;  2DJJ A;  5CRH A;  4EVM A;  4NHW A;  2R4V A;  3KGK A;  3ZRE A;  2HZE A;  2GSR A;  3BCI A;  4GDF A;  3JCM L;  3F0I A;  4IEL A;  3DVX A;  4HEA 2;  4WBR D;  2K8S A;  4ML1 A;  1Z6N A;  3LSZ A;  2CVK A;  2OBK A;  1XOA A;  3EU4 A;  3FR6 A;  3BCK A;  1WJK A;  2EFH A;  1VF2 A;  3IC8 A;  4ZB6 A;  4BVX B;  2C0G A;  2HLS A;  2AAW A;  5G1K A;  1S4B P;  5C00 A;  20GS A;  1S3C A;  1URM A;  4L5O A;  4OCE A;  4OO5 A;  1XWB A;  2H6Z A;  1OC9 B;  1XPV A;  4RI6 A;  1TRS A;  3FRC A;  3KM6 A;  4MJE A;  1FO5 A;  2PVO C;  2UZ8 A;  3KIJ A;  2B5X A;  2RII A;  5AIX A;  2ZNM A;  3PH9 A;  4TR1 B;  2F3M A;  3CMI A;  3CSH A;  4POL A;  3ERG A;  3TRQ A;  2YZH A;  2LJK A;  3GIX A;  1AC1 A;  3A5W A;  1RQM A;  3IE3 A;  3TKR A;  4WXT A;  5IOW A;  4P3Y B;  5CYY A;  1PL2 A;  2ES7 A;  3NOF A;  4I5Q A;  3TKS A;  5EVO A;  2YN1 A;  4YQU A;  1GUH A;  3DGQ A;  1M2D A;  4TKY A;  4POB A;  3HMJ G;  4BL7 A;  5A34 A;  4LA1 A;  3RDW A;  5DBQ A;  4MJA A;  1YVL A;  3V1W A;  4PUR A;  2CT6 A;  2LRN A;  1FG4 A;  2ALB A;  1WMJ A;  3GRX A;  5DCH A;  4IKH A;  3H1N A;  3ZMK A;  2PUK C;  1EV9 A;  1SKS B;  1PKZ A;  1MD3 A;  3CBU A;  2H1D A;  3LYK A;  1TDI A;  1V98 A;  4K9Z A;  2EIO A;  4ULX A;  4IHU A;  2H72 A;  2MZC A;  2YP6 A;  3EU3 A;  3LJR A;  1YEW C;  5DQY A;  4Z2U A;  1YEX A;  4OFM A;  2VCZ A;  3HYP A;  1V40 A;  1FVJ A;  4ICY A;  3M0F A;  2IIY A;  4WET A;  2PVQ A;  3N5O A;  1K0A A;  4DSS B;  1KNG A;  1HNC A;  1ZCP A;  1YZX A;  2O7K A;  1A8Y A;  2GVP A;  3LYP A;  3IRA A;  2LRT A;  4WBJ A;  4O32 A;  2DBC A;  5CRE A;  4K8M A;  1ST9 A;  4XS4 A;  4PXO A;  5CAX A;  4RQR A;  4I8B A;  4YAV A;  5DDL A;  1X0R A;  2LNS A;  1LJR A;  1ERV A;  1O73 A;  3TRX A;  2L4Q A;  3DD3 A;  1FVK A;  2FWF A;  1A8L A;  2O8V B;  3QCP A;  4ZIL A;  4TXO B;  1PL1 A;  1T7P B;  3VPQ A;  4K6X A;  4ILF A;  3D6I A;  1YEP A;  4BVY B;  3IOS A;  3BBY A;  1M2B A;  3A3T A;  3TKQ A;  3TKP A;  3MWH A;  3I69 A;  1BAY A;  5G1L A;  1S3D A;  6GST A;  1FB0 A;  2GSS A;  1SYR A;  2PPT A;  4MMM A;  1UC7 A;  3UAR A;  4KF9 A;  1FHE A;  1XWA A;  2OAC A;  2P31 A;  1K0B A;  3BOA A;  5BRT A;  1J08 A;  3APO A;  3ZIT A;  3EIN A;  2FWG A;  5GZZ B;  2OA7 A;  2LJR A;  4ZB8 A;  1WIK A;  2DML A;  2VLT A;  17GS A;  3GMF A;  2N5B A;  1I5G A;  3WT2 A;  3LOR A;  2HSM A;  1A24 A;  4FIW A;  4DSR A;  2O36 A;  2L57 A;  3GFK A;  3KMN A;  2TIR A;  2WZ9 A;  3TUE A;  2C8U A;  4XRD A;  2CX3 A;  3CYN A;  1M3J A;  4MDC A;  2P5R A;  2QGV A;  5J41 A;  3TOT A;  3J7Y k;  2Z9S A;  1EGR A;  3RHC A;  2YJ7 A;  1SVM A;  4CY6 A;  3MIX A;  1K0M A;  2YCD A;  3APS A;  1K0C A;  2X8H A;  4HU7 A;  2GTU A;  1TXU A;  3QDN A;  1MDI A;  1PQN A;  2G2Q A;  1MTC A;  1TK0 B;  4F82 A;  1X9M B;  2IJY A;  4HI7 A;  6GSV A;  3CTG A;  5IOX A;  1X5D A;  5IMZ A;  2IN3 A;  2AHE A;  1Y1U A;  2LUS A;  4K0G A;  1XBS A;  18GS A;  3M9J A;  1TU8 A;  3GKK A;  5J3R A;  1AXD A;  4KW6 A;  1SJI A;  4OCF A;  2BMX A;  1X5E A;  2O89 A;  2HZF A;  2HSN A;  5DJL A;  3Q19 A;  1XXU A;  3F3Q A;  2VCV A;  2JZS A;  5LD0 A;  4QMK A;  5E59 A;  3G7Y A;  1GSE A;  3F63 A;  2MMZ A;  3ED3 A;  3H4K A;  4LMV A;  1U3A A;  2A2R A;  3HDC A;  5DAK B;  2VL3 A;  3P8W A;  4HJ2 A;  1GSQ A;  4PX1 A;  1JHB A;  2PBJ A;  3O6T A;  1EP8 A;  4NHZ A;  1J0F A;  1T4Y A;  4KB3 A;  3ZYW A;  3CRT A;  4CHS A;  3LEF A;  3UL3 A;  1PN0 A;  3ERF A;  3LW9 A;  4ZL9 A;  4IS0 A;  1Y25 A;  2XPE A;  5A4W A;  4KH7 A;  2XPD A;  1O8W A;  1DUG A;  3IK7 A;  2WCI A;  1GUM A;  2DLX A;  3HXS A;  3IR4 A;  3UBK A;  4OO4 A;  3TU3 B;  5LNK e;  2RUF A;  1ERU A;  2PER A;  2X8C A;  3HVN A;  4FYU A;  5J5N A;  4HZ2 A;  1SKR B;  4YKF A;  3QR6 A;  3CRU A;  2EIQ A;  5EY6 A;  3C8E A;  3ZML A;  5IPG A;  1G6Y A;  2VD1 A;  2QKE A;  2B7J A;  1XWG A;  2VM2 A;  3SBC A;  5ECP B;  2YAN A;  1TU7 A;  5IQY A;  2H6Y A;  1U88 A;  2F9S A;  1PN9 A;  4ZBD A;  4Z2R A;  2CZ2 A;  5KN1 A;  3TJG A;  5ID2 A;  4MCU A;  2R37 A;  2GQL A;  1O7U A;  2EC4 A;  1AUC A;  2A4H A;  3APQ A;  2EFE A;  4O92 A;  5D9V A;  3U5R E;  1JZD A;  1WOU A;  1WPI A;  2RLI A;  1U87 A;  4MJB A;  2M72 A;  2B6M A;  1T1V A;  3O3T A;  1GNW A;  2QA1 A;  2R3X A;  2F8F A;  5H5S A;  4XTS A;  2H19 A;  4L0W A;  5J47 A;  2XHF A;  1XCC A;  1OVN A;  1GSS A;  4GSN A;  4IW9 A;  2WW3 A;  1U6T A;  3D5J A;  3UEM A;  1AQW A;  2VCQ A;  5F07 A;  4WF5 A;  1O6J A;  2HRA A;  1ZGN A;  2E0Q A;  2LRC A;  2B1K A;  4PUA A;  1BG1 A;  1V9W A;  1XVQ A;  4KND A;  4KCE A;  1N2A A;  4QL9 A;  3FR9 A;  1Z7R A;  5DAL B;  1A0R P;  3E0U A;  1YDK A;  3W6G A;  4FH8 A;  2WVX A;  3RGB C;  5JCG A;  1XFL A;  1Z9H A;  2FA8 A;  3HVX A;  3HY2 A;  4Z7X A;  4Q5F A;  3KTL A;  1KBN A;  5HR0 A;  3E3E A;  5J4V A;  2DJ3 A;  3FW2 A;  4E68 A;  1BQ7 A;  3MDK A;  1PGT A;  5IO2 A;  1Z5Y E;  3GYK A;  2C1Y A;  4AF2 A;  5J9B A;  2HRN A;  1E6B A;  1H4O A;  2CVB A;  3KMO A;  3DWV A;  2FNO A;  4POK A;  2KP1 A;  1HQO A;  2WVY A;  1GRX A;  1SJZ A;  3BD2 A;  4HQZ A;  3I6A A;  4MP4 A;  3KP8 A;  4AJ7 A;  4X43 A;  2IMK A;  2VUP A;  4HU9 A;  2GQK A;  2LST A;  3CXG A;  4ACS A;  3GX0 A;  4IJ3 A;  3TOU A;  4IP6 A;  2PWJ A;  4AKG A;  4CY8 A;  3GN3 A;  1B48 A;  1GTI A;  4GXZ A;  2ON5 A;  3VI5 A;  3DYR A;  1BED A;  4EUY A;  3GHA A;  2QC7 A;  1DE2 A;  2I9H A;  3C1R A;  4QQ7 A;  2GS3 A;  5IIZ A;  2A2P A;  2MBT A;  4MZW A;  1EGO A;  2HFD A;  2JU5 A;  2H75 A;  2GT5 A;  4G2E A;  5GAP D;  2HZE B;  3M3M A;  1FAA A;  2MMA A;  2LJA A;  1KEB A;  4I97 A;  2WDU A;  4N3Z A;  3GKX A;  1XZO A;  3C7M A;  1Z6M A;  1R5A A;  2VL2 A;  4BVX A;  2HNL A;  1XW9 A;  5B7C A;  1GSU A;  5F0G A;  3GUR A;  4FXY P;  4K7O A;  2X99 A;  3L78 A;  3HZ4 A;  1Z3E A;  2YNX A;  5G5E A;  1QGV A;  5ELA A;  1NM3 A;  2GT6 A;  4G0K A;  4JU5 A;  5IO0 A;  2J23 A;  1QFN A;  3IAM 2;  3HA9 A;  2XBQ A;  1XVW A;  4JZQ A;  1VF3 A;  5G5F A;  4EIP A;  3HJO A;  4X4J A;  5A1N A;  13GS A;  4CW9 A;  4IN0 A;  1ZL9 A;  1FOH A;  5D9X A;  5F8B A;  5CRW A;  4EL1 A;  4HDE A;  2CAI A;  3LWA A;  2H76 A;  2IME A;  3TJJ A;  1K3O A;  3W8J A;  5BMU A;  3RHB A;  5A5H A;  1JZR A;  4XS1 A;  4QL7 A;  2DKI A;  3QFA C;  3TJF A;  5ECS A;  2K8V A;  1JFU A;  3IA1 A;  4EKZ A;  3KH7 A;  2JSZ A;  1QK8 A;  2LKU A;  5D96 A;  2VCW A;  4BL7 B;  4ML6 A;  3C71 A;  1T4Z A;  2F8A A;  1O8X A;  3Q18 A;  2DJK A;  2YWI A;  2H73 A;  3FZA A;  3MSZ A;  1Q4J A;  3TKS E;  2R0G A;  4KGI A;  3TDG A;  3P2A A;  4TVE A;  1W89 A;  9GSS A;  3PPU A;  2H71 A;  2WFC A;  4MK3 A;  3IXR A;  2OKA A;  3PGT A;  3DKS A;  2VD0 A;  3FHK A;  2VAF A;  3FZ9 A;  5J9C A;  3RPN A;  4Q5Q A;  4K7I A;  1DBY A;  2I1U A;  4KDY A;  2MBS A;  3MYD A;  1GTB A;  1NHY A;  2A2S A;  2GGT A;  1LBK A;  4JE1 A;  5KN3 A;  4EXJ A;  3GST A;  2OBI A;  2L6D A;  3D4M A;  4WEY A;  5ECL B;  4XCS A;  3UBL A;  1B8X A;  4G9H A;  4HS1 A;  1K3L A;  1ZYQ B;  3PR8 A;  2WW1 A;  1TXX A;  4O5R A;  3EYT A;  4BPY A;  4YQM A;  2HE3 A;  1EP7 A;  3FY7 A;  2DJ0 A;  5A4U A;  5LCZ A;  3ZFL A;  4PQI A;  1THX A;  2VCX A;  2KOK A;  2OE0 A;  4PHZ C;  3ZVJ A;  4W66 A;  4XS4 B;  2BTO T;  2X4A A;  8GSS A;  2REM A;  3M1G A;  2AYT A;  3A2W A;  3UOM A;  1TOF A;  2I81 A;  4PQH A;  4D73 A;  1DE1 A;  3GNJ A;  2V2G A;  5GAN D;  3WD6 A;  2IFQ B;  2WUL A;  2AUV A;  3VLN A;  1TRV A;  1SL0 B;  3DIE A;  3W8S A;  1THO A;  2R6K A;  1WRY A;  4N30 A;  2C3Q A;  1R5P A;  3J7Y b;  3LFL A;  1OYJ A;  3EVI A;  4I2U A;  2YV7 A;  4XRA A;  4YKG A;  1SEN A;  2H6X A;  1BJX A;  1NSW A;  2B5E A;  5CNW A;  2CAQ A;  2HSY A;  2VCT A;  2H30 A;  1YKC A;  5E4W A;  1SJ6 A;  3HJP A;  4TW5 A;  4JBB A;  2HQT A;  2VOC A;  3ZLP A;  4AJ6 A;  1M7T A;  1ZYN A;  1TI3 A;  4GST A;  5ECH B;  1FB6 A;  3IBH A;  1SD8 A;  2YPM A;  1YY7 A;  4ECB A;  5FHI A;  4GQC A;  3GSS A;  3LGC A;  5ECN B;  3EPT A;  1H75 A;  2NVL A;  3CSI A;  2YWM A;  2HSM B;  4MF6 A;  2H01 A;  10GS A;  1MD4 A;  4K5R A;  4IBP A;  4KCA A;  5IPH A;  6GSU A;  6GSX A;  3WT1 A;  1TP9 A;  4ZBA A;  4A5P A;  1AQX A;  1PMT A;  5AGY A;  3R2Q A;  2R2J A;  1F3A A;  4GWR A;  5CO3 A;  4MAB A;  3F4S A;  2VLV A;  4NPB A;  1S3R A;  2EFD A;  4ZIJ A;  3HZ8 A;  1V58 A;  1A2L A;  1VRS D;  5D93 A;  1IYH A;  1VF4 A;  5L71 A;  3S9F A;  3GH6 A;  16GS A;  3F3R A;  3VI7 A;  1TKD B;  4GF0 A;  1U3I A;  1PX7 A;  4WR5 A;  2VL2 C;  2LQQ A;  4I6X A;  3WGD A;  4O5U A;  2YV9 A;  4KA0 A;  4E8H A;  4F03 A;  4K5S A;  4FYB A;  4PGT A;  3G7J A;  2FY6 A;  4EDZ A;  2DJ2 A;  4G01 A;  4JR4 A;  3IV4 A;  2HSH A;  4ISD A;  2JL4 A;  3KD0 A;  2M80 A;  2LS5 A;  1B4Q A;  5IMA A;  3TKS C;  1AAZ A;  2FD3 A;  5ECO B;  1T8E B;  5DJM A;  2WB9 A;  3ZL5 A;  3Q6O A;  6GSY A;  1N8J A;  5COH A;  2OJL A;  3KTB A;  2QA2 A;  1EZK A;  1TI1 A;  4DSQ A;  3QAG A;  3VK9 A;  5FT3 A;  4IQA A;  1S3A A;  5IMC A;  3UAP A;  1KTE A;  2GZP A;  3ERW A;  2C0D A;  4POM A;  2LNT A;  1VF1 A;  2VIM A;  5ECI B;  1J9B A;  2V32 A;  1C72 A;  1MEK A;  1SL1 B;  1F6M C;  2H74 A;  2MYG A;  2R5G A;  1M3I A;  1G0T A;  1F3B A;  3DEX A;  2DC5 A;  2JAC A;  1I1I P;  3SWL A;  1SL2 B;  3C1S A;  2P0G A;  4OFN A;  2L5O A;  5C04 A;  2TRC P;  4NV2 A;  1GUL A;  1T00 A;  3WGX A;  3KP9 A;  2KHP A;  3I9V 2;  5AN1 A;  4WR4 A;  1TK5 B;  1CQH A;  2GST A;  4LLR A;  2I4A A;  4AKI A;  1PX6 A;  1TRW A;  1USB A;  5ID2 B;  2F51 A;  4RQX A;  3WGE A;  4GLT A;  1ACV A;  3FZ4 A;  2C80 A;  2RM6 A;  4PUF C;  2YJH A;  1GSF A;  2LTK A;  4Z2T A;  3TRP A;  1BG5 A;  4AKH A;  3KXO A;  3KCM A;  5KN0 A;  2HRK B;  1OAZ A;  4OWY A;  2IMI A;  3F6F A;  3FMW A;  4GSS A;  3EUR A;  3RBT A;  5A5K A;  2DKH A;  2CA8 A;  2IMF A;  2GSQ A;  5D8I A;  1UA5 A;  2ZCT A;  4NWY A;  2UV8 G;  2HYX A;  4PI2 C;  2C4J A;  4FQU A;  3NIV A; 
#chains in the Genus database with same CATH homology
 6GSW A;  3U6V A;  3DML A;  5IMF A;  2JSY A;  1F9M A;  2L6C A;  1UVZ A;  2HRF A;  2AV4 A;  2L59 A;  3UVT A;  1HNA A;  2NBS A;  1SVO A;  3ZIJ A;  1OE7 A;  7GSS A;  1GSY A;  1ABA A;  4LMW A;  3A5I A;  4E8E A;  2R0C A;  3C73 A;  3H93 A;  22GS A;  2O5V A;  3O76 A;  5IMV A;  1K0N A;  4IJI A;  3M9K A;  4TXV A;  2R0P A;  4KX4 A;  1UN2 A;  3ZRD A;  1V2A A;  4OFT A;  1AQV A;  3A2V A;  4YAP A;  2M46 A;  3VFI A;  2IWT A;  4TRX A;  2XC2 A;  3IK9 A;  2H70 A;  2JAD A;  5D9T A;  4YQV A;  3D22 A;  19GS A;  3GTU A;  5H5Q A;  5A4V A;  2C3T A;  4MJC A;  2B1L A;  3QD9 A;  1M0U A;  2RUE A;  3VWW A;  4G0I A;  2CQ9 A;  4WF4 A;  4MH2 A;  1CQG A;  2GZZ A;  4J57 E;  3TB2 A;  4OD7 A;  3EE2 A;  5J40 A;  5B6N A;  4K2D A;  2YOI A;  1RW1 A;  4N10 A;  5AIS A;  5KEJ A;  5G2Z A;  4HJM A;  4L0U A;  4KSO A;  6GSS A;  4LL4 B;  4F0C A;  2OT3 A;  4K7N A;  1ZYP A;  2NDO A;  2FGX A;  4HZ4 A;  3RAZ A;  4CDO A;  4N0V A;  4ZL7 A;  5HR2 A;  2I3Y A;  5CRD A;  1OC9 A;  4GRF A;  5HR3 A;  1JLV A;  1NW2 A;  3US3 A;  2V1M A;  1TTZ A;  3HD5 A;  3R3E A;  1LU4 A;  5B6M A;  3GKM A;  4TR1 A;  1TW9 A;  2GDR A;  2VL9 A;  4MA9 A;  4O7H A;  1YF0 A;  1HD2 A;  3Q74 A;  2FHE A;  5H5R A;  1GL8 A;  2C0F A;  2YZU A;  4V2M A;  2PMT A;  1YQ1 A;  2IPA A;  1A2J A;  5DQS A;  3FK8 A;  4IQ1 A;  3TJK A;  5A1N B;  1RK4 A;  5HFK A;  5IMD A;  2CX4 A;  2X49 A;  2YWN A;  5FWG A;  1OC8 A;  5D73 A;  3FEU A;  4V1A p;  3D4T A;  2YWO A;  3HKR A;  5BMU B;  2E2M A;  5A5H B;  5A34 B;  4MF7 A;  5JWR B;  1R7H A;  4K2X A;  4PTS A;  4X1U A;  4G0L A;  2IL3 A;  4KE3 A;  1X5C A;  1GSD A;  4LL1 B;  2VM1 A;  2LQO A;  4KUN A;  4V1A g;  2QSI A;  3GV1 A;  1R4W A;  4DVC A;  4MF5 A;  3IC4 A;  4DEJ A;  4JR6 A;  4TR3 A;  4ZBB A;  1IYI A;  2WJU A;  4XHM A;  1WE0 A;  1SD9 A;  4HQS A;  4EF0 A;  2E2G A;  1SK0 A;  4Q5R A;  4MNN A;  1BX9 A;  2NPB A;  4DSS A;  3TJB A;  3UJ1 A;  4XIH A;  3FYG A;  2GLR A;  2DJ1 A;  1ML6 A;  1SYX A;  3G9B A;  4V2L A;  2H1A A;  2KP2 A;  2MMN A;  1SK2 A;  1B9Y C;  5EL8 A;  3P7X A;  1XW6 A;  3MAK A;  4IVF A;  3VPT A;  2O85 A;  4YH2 A;  2GZY A;  4J56 E;  4KAE A;  1I9D A;  1X9S B;  2DSA A;  1PSQ A;  3N9J A;  3FKF A;  2CV4 A;  2FCH A;  4MH3 A;  4PNG A;  2H1L A;  2H1G A;  2X8G A;  4IP1 A;  1ZOF A;  3GL3 A;  4ID0 A;  1NHO A;  2V41 A;  1A0F A;  1ZZY A;  1EOG A;  4AKX B;  1XOB A;  12GS A;  4KDX A;  3QPM A;  3GL5 A;  4ZL8 A;  3GA4 A;  4TXO A;  5ECR B;  2IMD A;  3FZ5 A;  1JZO A;  4GCI A;  4BVY A;  1SVL A;  1DSB A;  2FA4 A;  1T3B A;  5KOW A;  2JZR A;  1X9W B;  1YJ6 A;  3KH9 A;  1OKT A;  1ZMA A;  2N5A A;  2IFQ A;  2AB6 A;  4D73 B;  3I43 A;  2J9H A;  3CTF A;  5ABR A;  2ON7 A;  5G31 A;  2FUG 2;  1QXH A;  4XS6 A;  2KLX A;  2H1B A;  2WGR A;  2A4V A;  1M9A A;  5F06 A;  4MPG A;  3DVW A;  2L4C A;  4MZB A;  3VWV A;  14GS A;  2LEG A;  3CWG A;  5JWQ B;  4GTU A;  5JWO B;  4HUA A;  5INY A;  3GKN A;  3GX8 A;  2E7P A;  1PRX A;  3IHQ A;  1M99 A;  1GNE A;  1ERW A;  2WRT A;  2B5Y A;  4GQF A;  2D2Z A;  2LV3 A;  1QUW A;  4FYC A;  1XWK A;  4ZB7 A;  2KUC A;  1HYU A;  2C3N A;  3NZN A;  5D9W A;  4PNF A;  1AIU A;  1OC3 A;  4L5L A;  1QMV A;  2EIR A;  2CVD A;  4TOP A;  2DIZ A;  2K9F A;  4NMU A;  1WWJ A;  2O87 A;  1GTU A;  3LQ7 A;  3PIN A;  3ISO A;  2L5L A;  2OE1 A;  3OR5 A;  2BJX A;  5B8A A;  5J4Y A;  4EE0 A;  3F4T A;  4F9Z A;  3ZTL A;  5DCG A;  1Q98 A;  2CZ3 A;  4TR0 A;  1GWC A;  2DIY A;  4PQ1 A;  3WYW A;  1FW1 A;  3GH9 A;  3QFB C;  3UIW A;  4KSM A;  1N25 A;  1V57 A;  5IM9 A;  5F05 A;  1ERT A;  3KEB A;  3HCZ A;  3L9S A;  3KZQ A;  4FO5 A;  3MNG A;  1O81 A;  1QQ2 A;  1SKW B;  5B8B A;  4O5Q A;  2H0H A;  3BJ5 A;  4EDY A;  3ZIV A;  5AIV A;  1B4P A;  2PN8 A;  1PKW A;  4RI7 A;  3EMX A;  2RM5 A;  2PGT A;  5DVB A;  2G0F A;  4Q5N A;  4NV5 A;  4N0Z A;  2HSN B;  4EIQ A;  3ZFB A;  1VGL A;  4ZB9 A;  1PD2 1;  3L9V A;  1BF5 A;  5EPF A;  1TJD A;  3LG6 A;  4F2I A;  1GTA A;  4JRR A;  5ENU A;  4I2T A;  2GQM A;  3HJM A;  4ECJ A;  4ZXG A;  4V2N A;  5DAK A;  1K3Y A;  1JZW A;  3LXZ A;  1XW5 A;  1A2M A;  1OKD A;  3FR3 A;  2PU9 C;  1R26 A;  5KN2 A;  1ZYE A;  3CSJ A;  3QAV A;  1WP0 A;  2B3S A;  4OMV A;  3H79 A;  4AI6 A;  3K8N A;  3UMA A;  1K0O A;  3ME8 A;  3VWU A;  3ME7 A;  4AJ8 A;  2C0E A;  2HT9 A;  2XBI A;  5CRG A;  1GH2 A;  3D21 A;  1M2A A;  1Y6E A;  3UVH A;  2WS2 A;  2H0G A;  1Z7P A;  4K1F A;  3HVV A;  5HFI A;  2NTO A;  1ON4 A;  4K0N A;  3TCO A;  2P5Q A;  3A2X A;  3F6D A;  1TK8 B;  4X0X A;  3QAW A;  3VUR A;  3KJY A;  2N5F A;  3DXB A;  4HOJ A;  2EFC A;  4EO3 A;  1AW9 A;  2ZUP A;  1K0D A;  2K18 A;  2H66 A;  1GUK A;  4KDU A;  1FOV A;  4ECC A;  1M9B A;  4IGJ A;  3AY8 A;  4ECI A;  2FWH A;  3IAS 2;  4NAX A;  3L4N A;  3HHV A;  1TRU A;  4WKW A;  1EOH A;  3F4R A;  3D0Z A;  2H0I A;  4N11 A;  4MLY A;  4USS A;  4L8E A;  5ECQ B;  3EWL A;  4RUV A;  5JCU A;  1PA3 A;  2DMM A;  1YF1 A;  3QMX A;  4G10 A;  2OE3 A;  3IPZ A;  2X64 A;  3L0H A;  3L9U A;  3RPP A;  3VWX A;  3E9J B;  2B7K A;  2AJQ B;  3HVS A;  2HRK A;  2OAD A;  2HI7 A;  5ECM B;  1GP1 A;  4H86 A;  4TN8 A;  5GSS A;  5HQP A;  1EEM A;  4F0B A;  1G7E A;  1OE8 A;  3G7I A;  3P90 A;  5ELG A;  5DAL A;  5GST A;  1EWX A;  1XIY A;  4MPF A;  3IDV A;  5KOX A;  11GS A;  1G7O A;  5J4U A;  3ZVJ D;  1B9X C;  2VLU A;  3EC3 A;  1E2Y A;  1SU9 A;  4AGS A;  1GLQ A;  2VO4 A;  3GUS A;  1ILO A;  1O85 A;  1MDK A;  3H8Q A;  1EEJ A;  4JED A;  4EC0 A;  3DRN A;  2V6K A;  2H8L A;  2V6O A;  1G6W A;  4BWQ A;  2FLS A;  4TR4 A;  2FWE A;  4G19 A;  4MZC A;  4NXI A;  1YKA A;  5HR1 A;  1XWC A;  5CP1 A;  1JLW A;  4BA7 A;  3M8N A;  5ECK B;  1BYE A;  1F37 A;  4BWS A;  2HXK A;  3ZZX A;  1F2E A;  3F9U A;  3TGZ A;  3IHG A;  1EV4 A;  5HFG A;  1MDJ A;  3GTU B;  2VKZ G;  1GLP A;  5G30 A;  2MMO A;  1HNB A;  1A23 A;  4J2F A;  2TRX A;  3F8U A;  5JCW A;  2JZT A;  3QOU A;  1W4V A;  3LXT A;  2K6V A;  3EMP A;  1SK1 A;  2DJJ A;  5CRH A;  4EVM A;  4NHW A;  2R4V A;  3KGK A;  3ZRE A;  2HZE A;  2GSR A;  3BCI A;  4GDF A;  3JCM L;  3F0I A;  4IEL A;  3DVX A;  4HEA 2;  4WBR D;  2K8S A;  4ML1 A;  1Z6N A;  3LSZ A;  2CVK A;  2OBK A;  1XOA A;  3EU4 A;  3FR6 A;  3BCK A;  1WJK A;  2EFH A;  1VF2 A;  3IC8 A;  4ZB6 A;  4BVX B;  2C0G A;  2HLS A;  2AAW A;  5G1K A;  5C00 A;  20GS A;  1S3C A;  1URM A;  4L5O A;  4OCE A;  4OO5 A;  1XWB A;  2H6Z A;  1OC9 B;  1XPV A;  4RI6 A;  1TRS A;  3FRC A;  3KM6 A;  4MJE A;  1FO5 A;  2PVO C;  2UZ8 A;  3KIJ A;  2B5X A;  2RII A;  5AIX A;  2ZNM A;  3PH9 A;  4TR1 B;  2F3M A;  3CMI A;  3CSH A;  4POL A;  3ERG A;  3TRQ A;  2YZH A;  2LJK A;  3GIX A;  1AC1 A;  3A5W A;  1RQM A;  3IE3 A;  3TKR A;  4WXT A;  5IOW A;  4P3Y B;  5CYY A;  1PL2 A;  2ES7 A;  3NOF A;  4I5Q A;  3TKS A;  5EVO A;  2YN1 A;  4YQU A;  1GUH A;  3DGQ A;  1M2D A;  4TKY A;  4POB A;  3HMJ G;  4BL7 A;  5A34 A;  4LA1 A;  3RDW A;  5DBQ A;  4MJA A;  1YVL A;  3V1W A;  4PUR A;  2CT6 A;  2LRN A;  1FG4 A;  2ALB A;  1WMJ A;  3GRX A;  5DCH A;  4IKH A;  3H1N A;  3ZMK A;  2PUK C;  1EV9 A;  1SKS B;  1PKZ A;  1MD3 A;  3CBU A;  2H1D A;  3LYK A;  1TDI A;  1V98 A;  4K9Z A;  2EIO A;  4ULX A;  4IHU A;  2H72 A;  2MZC A;  2YP6 A;  3EU3 A;  3LJR A;  5DQY A;  4Z2U A;  1YEX A;  4OFM A;  2VCZ A;  3HYP A;  1V40 A;  1FVJ A;  4ICY A;  3M0F A;  2IIY A;  4WET A;  2PVQ A;  3N5O A;  1K0A A;  4DSS B;  1KNG A;  1HNC A;  1ZCP A;  1YZX A;  2O7K A;  1A8Y A;  2GVP A;  3LYP A;  3IRA A;  2LRT A;  4WBJ A;  4O32 A;  2DBC A;  5CRE A;  4K8M A;  1ST9 A;  4XS4 A;  4PXO A;  5CAX A;  4RQR A;  4I8B A;  4YAV A;  5DDL A;  1X0R A;  2LNS A;  1LJR A;  1ERV A;  1O73 A;  3TRX A;  2L4Q A;  3DD3 A;  1FVK A;  2FWF A;  1A8L A;  2O8V B;  3QCP A;  4ZIL A;  4TXO B;  1PL1 A;  1T7P B;  3VPQ A;  4K6X A;  4ILF A;  3D6I A;  1YEP A;  4BVY B;  3IOS A;  3BBY A;  1M2B A;  3A3T A;  3TKQ A;  3TKP A;  3MWH A;  3I69 A;  1BAY A;  5G1L A;  1S3D A;  6GST A;  1FB0 A;  2GSS A;  1SYR A;  2PPT A;  4MMM A;  1UC7 A;  3UAR A;  4KF9 A;  1FHE A;  1XWA A;  2OAC A;  2P31 A;  1K0B A;  3BOA A;  5BRT A;  1J08 A;  3APO A;  3ZIT A;  3EIN A;  2FWG A;  5GZZ B;  2OA7 A;  2LJR A;  4ZB8 A;  1WIK A;  2DML A;  2VLT A;  17GS A;  3GMF A;  2N5B A;  1I5G A;  3WT2 A;  3LOR A;  2HSM A;  1A24 A;  4FIW A;  4DSR A;  2L57 A;  3GFK A;  3KMN A;  2TIR A;  2WZ9 A;  3TUE A;  2C8U A;  4XRD A;  2CX3 A;  3CYN A;  4MDC A;  2P5R A;  2QGV A;  5J41 A;  3TOT A;  3J7Y k;  2Z9S A;  1EGR A;  3RHC A;  2YJ7 A;  1SVM A;  4CY6 A;  3MIX A;  1K0M A;  2YCD A;  3APS A;  1K0C A;  2X8H A;  4HU7 A;  2GTU A;  1TXU A;  3QDN A;  1MDI A;  1PQN A;  2G2Q A;  1MTC A;  1TK0 B;  4F82 A;  1X9M B;  2IJY A;  4HI7 A;  6GSV A;  3CTG A;  5IOX A;  1X5D A;  5IMZ A;  2IN3 A;  2AHE A;  1Y1U A;  2LUS A;  4K0G A;  1XBS A;  18GS A;  3M9J A;  1TU8 A;  3GKK A;  5J3R A;  1AXD A;  4KW6 A;  1SJI A;  4OCF A;  2BMX A;  1X5E A;  2O89 A;  2HZF A;  2HSN A;  5DJL A;  3Q19 A;  1XXU A;  3F3Q A;  2VCV A;  2JZS A;  5LD0 A;  4QMK A;  5E59 A;  3G7Y A;  1GSE A;  3F63 A;  2MMZ A;  3ED3 A;  3H4K A;  4LMV A;  1U3A A;  2A2R A;  5DAK B;  3HDC A;  2VL3 A;  3P8W A;  4HJ2 A;  1GSQ A;  4PX1 A;  1JHB A;  2PBJ A;  3O6T A;  1EP8 A;  4NHZ A;  1J0F A;  1T4Y A;  4KB3 A;  3ZYW A;  3CRT A;  4CHS A;  3LEF A;  3UL3 A;  1PN0 A;  3ERF A;  3LW9 A;  4ZL9 A;  4IS0 A;  1Y25 A;  2XPE A;  5A4W A;  4KH7 A;  2XPD A;  1O8W A;  1DUG A;  3IK7 A;  2WCI A;  1GUM A;  2DLX A;  3HXS A;  3IR4 A;  3UBK A;  4OO4 A;  3TU3 B;  5LNK e;  2RUF A;  1ERU A;  2PER A;  2X8C A;  4FYU A;  5J5N A;  4HZ2 A;  1SKR B;  4YKF A;  3QR6 A;  3CRU A;  2EIQ A;  5EY6 A;  3C8E A;  3ZML A;  5IPG A;  1G6Y A;  2VD1 A;  2QKE A;  2B7J A;  1XWG A;  2VM2 A;  3SBC A;  5ECP B;  2YAN A;  1TU7 A;  5IQY A;  2H6Y A;  1U88 A;  2F9S A;  1PN9 A;  4ZBD A;  4Z2R A;  2CZ2 A;  5KN1 A;  3TJG A;  5ID2 A;  4MCU A;  2R37 A;  2GQL A;  1O7U A;  2EC4 A;  1AUC A;  2A4H A;  3APQ A;  2EFE A;  4O92 A;  5D9V A;  3U5R E;  1JZD A;  1WOU A;  1WPI A;  2RLI A;  1U87 A;  4MJB A;  2M72 A;  2B6M A;  1T1V A;  3O3T A;  1GNW A;  2QA1 A;  2R3X A;  2F8F A;  5H5S A;  4XTS A;  2H19 A;  4L0W A;  5J47 A;  2XHF A;  1XCC A;  1OVN A;  1GSS A;  4GSN A;  4IW9 A;  1U6T A;  3D5J A;  3UEM A;  1AQW A;  2VCQ A;  5F07 A;  4WF5 A;  1O6J A;  2HRA A;  1ZGN A;  2E0Q A;  2LRC A;  2B1K A;  4PUA A;  1BG1 A;  1V9W A;  1XVQ A;  4KND A;  4KCE A;  1N2A A;  4QL9 A;  3FR9 A;  1Z7R A;  5DAL B;  1A0R P;  3E0U A;  1YDK A;  3W6G A;  4FH8 A;  5JCG A;  1XFL A;  1Z9H A;  2FA8 A;  3HVX A;  3HY2 A;  4Z7X A;  4Q5F A;  3KTL A;  1KBN A;  5HR0 A;  3E3E A;  5J4V A;  2DJ3 A;  3FW2 A;  4E68 A;  1BQ7 A;  3MDK A;  1PGT A;  5IO2 A;  1Z5Y E;  3GYK A;  2C1Y A;  4AF2 A;  5J9B A;  2HRN A;  1E6B A;  1H4O A;  2CVB A;  3KMO A;  3DWV A;  2FNO A;  4POK A;  2KP1 A;  1HQO A;  1GRX A;  1SJZ A;  3BD2 A;  4HQZ A;  3I6A A;  4MP4 A;  3KP8 A;  4AJ7 A;  4X43 A;  2IMK A;  2VUP A;  4HU9 A;  2GQK A;  2LST A;  3CXG A;  4ACS A;  3GX0 A;  4IJ3 A;  3TOU A;  4IP6 A;  2PWJ A;  4AKG A;  4CY8 A;  3GN3 A;  1B48 A;  1GTI A;  4GXZ A;  2ON5 A;  3VI5 A;  3DYR A;  1BED A;  4EUY A;  3GHA A;  2QC7 A;  1DE2 A;  2I9H A;  3C1R A;  4QQ7 A;  2GS3 A;  5IIZ A;  2A2P A;  2MBT A;  4MZW A;  1EGO A;  2HFD A;  2JU5 A;  2H75 A;  2GT5 A;  4G2E A;  5GAP D;  2HZE B;  3M3M A;  1FAA A;  2MMA A;  2LJA A;  1KEB A;  4I97 A;  2WDU A;  4N3Z A;  3GKX A;  1XZO A;  3C7M A;  1Z6M A;  1R5A A;  2VL2 A;  4BVX A;  2HNL A;  1XW9 A;  5B7C A;  1GSU A;  5F0G A;  3GUR A;  4K7O A;  2X99 A;  3L78 A;  3HZ4 A;  1Z3E A;  2YNX A;  5G5E A;  1QGV A;  5ELA A;  1NM3 A;  2GT6 A;  4G0K A;  4JU5 A;  5IO0 A;  2J23 A;  1QFN A;  3IAM 2;  3HA9 A;  2XBQ A;  1XVW A;  4JZQ A;  1VF3 A;  5G5F A;  4EIP A;  3HJO A;  4X4J A;  5A1N A;  13GS A;  4CW9 A;  4IN0 A;  1ZL9 A;  1FOH A;  5D9X A;  5F8B A;  5CRW A;  4EL1 A;  4HDE A;  2CAI A;  3LWA A;  2H76 A;  2IME A;  3TJJ A;  1K3O A;  3W8J A;  5BMU A;  3RHB A;  5A5H A;  1JZR A;  4XS1 A;  4QL7 A;  2DKI A;  3QFA C;  3TJF A;  5ECS A;  2K8V A;  1JFU A;  3IA1 A;  4EKZ A;  3KH7 A;  2JSZ A;  1QK8 A;  2LKU A;  5D96 A;  2VCW A;  4BL7 B;  4ML6 A;  3C71 A;  1T4Z A;  2F8A A;  1O8X A;  3Q18 A;  2DJK A;  2YWI A;  2H73 A;  3FZA A;  3MSZ A;  1Q4J A;  3TKS E;  2R0G A;  4KGI A;  3TDG A;  3P2A A;  4TVE A;  1W89 A;  9GSS A;  3PPU A;  2H71 A;  2WFC A;  4MK3 A;  3IXR A;  2OKA A;  3PGT A;  3DKS A;  2VD0 A;  3FHK A;  2VAF A;  3FZ9 A;  5J9C A;  3RPN A;  4Q5Q A;  4K7I A;  1DBY A;  2I1U A;  4KDY A;  2MBS A;  3MYD A;  1GTB A;  1NHY A;  2A2S A;  2GGT A;  1LBK A;  4JE1 A;  5KN3 A;  4EXJ A;  3GST A;  2OBI A;  2L6D A;  3D4M A;  4WEY A;  5ECL B;  4XCS A;  3UBL A;  1B8X A;  4G9H A;  4HS1 A;  1K3L A;  1ZYQ B;  3PR8 A;  1TXX A;  4O5R A;  3EYT A;  4BPY A;  4YQM A;  2HE3 A;  1EP7 A;  3FY7 A;  2DJ0 A;  5A4U A;  5LCZ A;  3ZFL A;  4PQI A;  1THX A;  2VCX A;  2KOK A;  2OE0 A;  3ZVJ A;  4W66 A;  4XS4 B;  2BTO T;  2X4A A;  8GSS A;  2REM A;  3M1G A;  2AYT A;  3A2W A;  3UOM A;  1TOF A;  2I81 A;  4PQH A;  4D73 A;  1DE1 A;  3GNJ A;  2V2G A;  5GAN D;  3WD6 A;  2IFQ B;  2WUL A;  2AUV A;  3VLN A;  1TRV A;  1SL0 B;  3DIE A;  3W8S A;  1THO A;  2R6K A;  1WRY A;  4N30 A;  2C3Q A;  1R5P A;  3J7Y b;  3LFL A;  1OYJ A;  3EVI A;  4I2U A;  2YV7 A;  4XRA A;  4YKG A;  1SEN A;  2H6X A;  1BJX A;  1NSW A;  2B5E A;  5CNW A;  2CAQ A;  2HSY A;  2VCT A;  2H30 A;  1YKC A;  5E4W A;  1SJ6 A;  3HJP A;  4TW5 A;  4JBB A;  2HQT A;  2VOC A;  3ZLP A;  4AJ6 A;  1M7T A;  1ZYN A;  1TI3 A;  4GST A;  5ECH B;  1FB6 A;  3IBH A;  1SD8 A;  2YPM A;  1YY7 A;  4ECB A;  5FHI A;  4GQC A;  3GSS A;  3LGC A;  5ECN B;  3EPT A;  1H75 A;  2NVL A;  3CSI A;  2YWM A;  2HSM B;  4MF6 A;  2H01 A;  10GS A;  1MD4 A;  4K5R A;  4IBP A;  4KCA A;  5IPH A;  6GSU A;  6GSX A;  3WT1 A;  1TP9 A;  4ZBA A;  4A5P A;  1AQX A;  1PMT A;  5AGY A;  3R2Q A;  2R2J A;  1F3A A;  4GWR A;  5CO3 A;  4MAB A;  3F4S A;  2VLV A;  4NPB A;  2EFD A;  4ZIJ A;  3HZ8 A;  1V58 A;  1A2L A;  1VRS D;  5D93 A;  1IYH A;  1VF4 A;  5L71 A;  3S9F A;  3GH6 A;  16GS A;  3F3R A;  3VI7 A;  1TKD B;  4GF0 A;  1U3I A;  1PX7 A;  4WR5 A;  2VL2 C;  2LQQ A;  4I6X A;  3WGD A;  4O5U A;  2YV9 A;  4KA0 A;  4E8H A;  4F03 A;  4K5S A;  4FYB A;  4PGT A;  3G7J A;  2FY6 A;  4EDZ A;  2DJ2 A;  4G01 A;  4JR4 A;  3IV4 A;  2HSH A;  4ISD A;  2JL4 A;  3KD0 A;  2M80 A;  2LS5 A;  1B4Q A;  5IMA A;  3TKS C;  1AAZ A;  2FD3 A;  5ECO B;  1T8E B;  5DJM A;  2WB9 A;  3ZL5 A;  3Q6O A;  6GSY A;  1N8J A;  5COH A;  2OJL A;  3KTB A;  2QA2 A;  1EZK A;  1TI1 A;  4DSQ A;  3QAG A;  3VK9 A;  5FT3 A;  4IQA A;  1S3A A;  5IMC A;  3UAP A;  1KTE A;  2GZP A;  3ERW A;  2C0D A;  4POM A;  2LNT A;  1VF1 A;  2VIM A;  5ECI B;  1J9B A;  1C72 A;  1MEK A;  2V32 A;  1SL1 B;  1F6M C;  2H74 A;  2MYG A;  2R5G A;  1G0T A;  1F3B A;  3DEX A;  2DC5 A;  2JAC A;  3SWL A;  1SL2 B;  3C1S A;  2P0G A;  4OFN A;  2L5O A;  5C04 A;  2TRC P;  4NV2 A;  1GUL A;  1T00 A;  3WGX A;  3KP9 A;  2KHP A;  3I9V 2;  5AN1 A;  4WR4 A;  1TK5 B;  1CQH A;  2GST A;  4LLR A;  2I4A A;  4AKI A;  1PX6 A;  1TRW A;  1USB A;  5ID2 B;  2F51 A;  4RQX A;  3WGE A;  4GLT A;  1ACV A;  3FZ4 A;  2C80 A;  2RM6 A;  4PUF C;  2YJH A;  1GSF A;  2LTK A;  4Z2T A;  3TRP A;  1BG5 A;  4AKH A;  3KXO A;  3KCM A;  5KN0 A;  2HRK B;  1OAZ A;  4OWY A;  2IMI A;  3F6F A;  3FMW A;  4GSS A;  3EUR A;  3RBT A;  5A5K A;  2DKH A;  2CA8 A;  2IMF A;  2GSQ A;  5D8I A;  1UA5 A;  2ZCT A;  4NWY A;  2UV8 G;  2HYX A;  2C4J A;  4FQU A;  3NIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...