1MD7A

Monomeric structure of the zymogen of complement protease c1r
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
328
structure length
304
Chain Sequence
DCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGAHDLRFVRLPVANPQACENWLDVFSQNMFCAGHPSLKQDACQGDAGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C1R COMPLEMENT SERINE PROTEASE
publication title Monomeric structures of the zymogen and active catalytic domain of complement protease c1r: further insights into the c1 activation mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 304
sequence length 328
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1md7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md7A03
2OP9A 2J9NA 2SGFE 3RXKA 2MCYA 3ZZBA 2BDIA 1U5MA 1NZQH 1ZHPA 1EOLA 1H8IH 3MNBA 1TNJA 1GJ5H 3V12A 1QBVH 3ZVFA 1OWJA 3R0FA 1QNJA 4AFQA 1O2NA 1GI6A 1F0UA 5JB9S 4OS7A 2CG6A 1Y3XA 2G8TA 3NWUA 4I31A 1OXGA 4BOHA 4HI3A 1TX6A 2ESTE 1MCTA 4TYDA 2FOCA 1H04P 1AU8A 1AIXH 1C9TA 1W0YH 1IQLA 3A7TA 3GY4A 4IGDA 1ELDE 1GHVH 2UWOA 1ZSJA 4F49A 4ONTD 2KAIB 1J16A 5BRRE 4AYVB 1GHWH 4X1NU 1H9LB 2SGQE 1XKAC 2J34A 1QY6A 1CGJE 1A1RA 1O2UA 2A55A 3S9BA 1C5ZB 3NCLA 3GY7A 3RXSA 2KRIA 4BAKB 2Z9JA 3STIA 3TIUA 2F9VA 1HB0B 4Q7XA 4BNRA 3VXEH 4JK5A 2BY5X 2NU3E 1E35B 2BHGA 1G3BA 4AGJA 4Z6AH 3PLKA 4OGYA 1UJ1A 4FU9A 2VWLA 2ZDLA 3ESTA 1D3TB 1DPOA 2XWJI 2BD2A 7ESTE 2GCTC 1HFHA 1ANBA 1GBCA 3HKJB 3RXTA 4NSVA 4XOJA 1O3EA 4GPGA 2BD9A 1P06A 1YCPK 2ZDKA 1EASA 5HZPB 5AF9H 4LK4A 2NU4E 2ZGCA 1UTQA 1O2YA 1LKBA 3ZVCA 3M3VA 4CSYA 3A88A 1YPMH 2CKUA 3P8FA 2GCTB 1O37A 1QURH 1CT4E 1QQ4A 5LPFA 4NIXA 1A2CH 5IDKA 3RXQA 1KLJH 1S82A 1VR1H 3LGIA 4QT8C 2BDYA 2VINA 1INCA 1TABE 1V2VT 2BXTH 2XBWA 5DP4A 2PKSC 1XKBC 5DP6A 2JH0D 4IMZA 4KTUA 3HPTB 1MMJN 1P01A 3SNDA 3RM0H 1KDQB 3PO1C 5HGGA 1MZDA 1FY8E 1T8MA 1EZSC 5EXLA 3GY5A 1HCGA 1Z8JB 1ZGVA 2AS9A 1UTOA 2MCZA 4B74A 1BITA 2PKSB 2TGAA 4D8NA 2QV1A 3KZJA 1SC8U 3LOXA 1P2KA 3RC4A 3PO1B 2ZQ2A 4R0IA 4I7YH 1GJ6A 2ZA5A 1HYLA 3BEFB 4CH8B 1MTVA 5HYPA 2QAAA 4MNVA 1NROH 1QBOA 4K1SA 1GWAA 3G01A 1P04A 2BY8X 2YNBA 1P3EA 2GCHF 1BZXE 1GVZA 3LGVA 4OGXA 4BAHB 3INBC 2A5KA 2ILNA 1A4WH 1K1LA 5C5OA 3DUXH 2GTBA 3RXJA 2ZP0H 1SG8B 3A8BA 4JHSA 5LPRA 1OWDA 2H5CA 4I8GA 3MNCA 3P8NA 3SN8A 3E6PH 2ZKSA 2Z3CA 3T26A 1NY22 1UTJA 3MU4A 1SL3A 5GXPA 1MKXK 1D3PB 4YT6H 4B2CA 1O3GA 3SU6A 1A46H 3LGUA 4K69A 4B76A 1N6YA 2V8EA 1NT1A 4K3JA 5L6NH 4BTTB 1VITH 1BBRH 3ODFA 2FI4E 3BEIB 1UMAH 1O35A 3KQCA 1S0RA 1TOMH 1BJUA 5C5NA 2DE9A 4AFSA 1MBQA 1GVKB 1NRRH 4AORA 3A81A 2F91A 2XNIA 3UOPA 1XUHA 1TNIA 3PMBB 2J4IA 2TBSA 2G5NA 2ZDMA 5AHGH 5DKMA 1DLKB 3U1JB 3LGYA 4XDEA 1XMNB 4FUEA 2HPPH 1A5GH 1F0SA 1ZPCA 1T31A 1K1PA 3ZZDA 1CHOG 2WIIC 1AUJA 1FXYA 1LTOA 3RXCA 5TJXA 1UHBA 3EAJA 2M5TA 3JZ2B 3SUEA 1UTKA 2BTCE 2A4GA 2EI7A 3MNXA 3WY8A 4F4OC 4OS6A 2GT8A 2ZDVH 3BG4C 3FZZA 2R2MB 3VB5A 1O2XA 4X2VA 1D3QB 3PWBA 2W3IA 1EJNA 1ZPZA 2XYAA 1GI7B 4DVAU 3Q3YA 4X8SH 1ID5H 2HNTE 1C4U2 4FVDA 3RMNH 1K1JA 1C5QA 1XXFA 1JBUH 2WPJS 5SGAE 1S6HA 8ESTE 4ABDA 4DGJA 2Z94A 1AI8H 4NFEA 2C3SA 2ZFTA 6ESTA 2QCYA 4DIIH 1C5MD 3IU3I 4ZXYH 2VWNA 8KME2 2VVVA 4GCHG 3UOUA 2FOHA 1O3DA 1HIAB 1BOQA 1ZSLA 4X6PA 2Y5HA 3ELAH 4MPWA 2QA9E 3RXPA 4Q7YA 2FLBH 5FPYA 1TNKA 5EQSA 2JETC 5L2YH 1OS8A 3QO6A 1MBMA 1T32A 1C4V2 4IN2A 5HM9A 4LXBH 3LPRA 1ZHMA 1FIWA 1PPZA 5DJ7A 1PQAA 3LH3A 1GBAA 1J9CH 3EYDA 1EPTC 1O3NA 1Y3UA 1QL9A 1MTNC 2O39C 3ENSB 1GBEA 2ZU4A 4WVPE 3P8GA 4XBDA 2JETB 2HGTH 1GBHA 2BZMA 2A0QB 1CA0C 3TPIZ 1E5GA 1ARBA 5DG6A 1JOUB 5C2ZA 1B0FA 4OS4A 2BOHB 3MMGA 2GD4B 2G51A 1EPTB 1S0QA 1MTNB 1ZTJA 1L4DA 1DT2A 4UFDH 1GBDA 3E0PB 2ZPRA 1CA0B 1YPHC 3PTNA 1ARCA 3P70B 4KP0A 2RA0A 1P9SA 3O8RA 4M7GA 4FUBA 5FCRA 1UVSH 1T4VH 4ZKRU 5DPAA 3NK8A 1Y8TA 1P11E 4Y71A 3U69H 1D6WA 2P16A 2G55A 2VWOA 4Y7AA 3EGKH 3UNRA 5I46H 3GY8A 2OLGA 1QL8A 1FY1A 1TGSZ 2DE8A 2BQ6B 3P95A 2THFB 4AFUA 4K1EA 1C2DA 1QGFA 1EAUA 2FS8A 1O5FH 3IWMA 4H6SB 2VU8E 3HKIB 2C4FH 2FEQH 3QWCH 1TOCB 1W12U 1X7AC 2XC0A 1J8AA 2A7HA 2BZ6H 5ABWA 3MYWA 2VIDA 1CGHA 1PFXC 4GSOA 1YYY1 1RJXB 1IQIA 4FVBA 2A7CA 1MKWH 2ZTYA 1BTPA 1AUTC 1CQQA 1P09A 2BDGA 5FAHA 3ZVGA 1GBFA 3E3TA 4KGAA 4AYYB 1AO5A 3LC5A 1C5XB 2XWBF 2A4RA 2FX6A 1FMGA 2UUKB 1C2FA 1O3LA 1OYQA 1YPJH 3M7TA 5GCHF 4CRBA 1A5HA 2VNTA 3QDZB 4MVNA 1NC6A 2ZCKP 2WPMS 1AFQC 1GBMA 5FHTA 2AYWA 4CRGA 4B73A 3MH4A 4BAMB 3T5FH 1KIGH 3U1IB 1KY9A 1DITH 4NSYA 3TLOA 1HAXB 1F7ZA 1CU1A 2WPKS 3GYMA 1OP2A 3SNAA 1AFQB 1YPEH 4ISIH 2Y81A 1EZQA 1WCZA 1K1NA 1ELVA 1B7XB 3DFJA 1IOEA 2ZGJA 5FBEA 1NN6A 1EQ9A 1SRZA 1UTLM 1IHTH 4YLUA 1LCYA 3TITA 1C5OH 1L4ZA 2QY0A 1CT0E 1O2JA 5IYTA 2XCFA 3MO3A 4D9QA 2TGPZ 2Y7XA 1FIZA 2R3UA 2ZPSA 4NWKA 3UFAA 1XUGA 3ZD1A 1BDAA 1GMHG 5JB8S 1PQ7A 1IQMA 1GI8B 1C1RA 5C1YA 4RKJB 1FPHH 2D1JA 1SGEE 3T25A 1ABJH 2ZPQA 4NGAH 1V2ST 1CSOE 5AFYH 2BQ7B 4LOTA 1SGDE 2Z9GA 1ANDA 4X0WU 1THRH 3RP2A 1NWVA 1E37B 1SHYA 2FO9A 3EDXB 2OBQA 1AMHA 1SLXB 2ZTZA 4K8BA 1WQSA 2SGAA 2UUYA 1SLWB 2AGIX 1AFEH 2PGBB 3LJJA 2O8WA 1EP6A 2BX3A 3QX5H 1AWFH 1DLEA 3BIVH 2GZ7A 3JZ1B 4JZIA 2EHFA 5A8YA 2XRBA 3SQHE 5F8TA 1H1BA 2BD4A 3SNCA 1QJ7B 1UTNA 3SV7A 5DP3A 2BDBA 3RXBA 4WY3A 2AMPA 2NU2E 1GJ4H 1WTHD 1QQUA 1UVUH 4DY7B 1W7GH 4J2YB 1TX7A 3GCTG 3SU4A 1EOJA 3I77A 5A09A 1GMDG 3GXEA 3HK6B 4GVUA 2O9QA 3T2NA 2V3OH 3S69A 4OS2A 3M36A 3F1SB 4K1TA 1NFUA 5TCCA 3IX0A 2OC8A 4WWYA 2ODPA 3AAUA 2VIVA 1WSSH 2SGDE 1O36A 2YRAA 4WJG2 1ELEE 1KTTB 4NG9H 4ZUHA 5JBAS 3NUMA 5T6FA 3LU9B 1S6FA 4AYEA 1V2NT 4BANB 2I6SA 3DA9B 1YKTA 2AGGX 3FVFB 2GT7A 3SV9A 2O8MA 2QN5T 4I8LA 1LPKB 3BV9B 4ISNA 1K1MA 3MO6A 1EZXC 1BT7A 1PPFE 2GDEH 1Z1JA 4ABIA 2B5ID 1DWEH 1GBLA 1S5SA 2JH6D 2GVFA 4IBLH 2QXJA 1O2OA 1S83A 3KCGH 2XWAA 4LOYH 1SI5H 3RMMH 1GDQA 3BTWE 3MNSA 1OOKB 3LKWA 3GCHC 2FP7B 3ZVEA 1LPZB 1A61H 1RRKA 5C1UA 1QB6A 1QA0A 4JMYA 3C1KA 3RLYH 1YPHE 1G2LA 2Y6TA 1C1PA 3L89M 1V2LT 4RKOB 1NTPA 2A4QA 1P57B 3HGNA 1A3EH 1GL0E 3GCHB 2BLQA 3M5LA 1MU6B 3RU4T 1AE8H 3AW1A 3MU5A 3MO9A 3AAVA 1O2RA 1O39A 3PMAB 3PTBA 1SGFG 3A7XA 3S9AA 1S85A 5GWZA 1T7CA 1A0JA 3ZZ6A 1J15A 3GOVB 1RTFB 4CH2B 1XUKA 3F9GA 3F9FA 1AVWA 1CBWC 3RXMA 1LY2A 3SV2H 5DP7A 1AKSA 3UIRA 3PV4A 1TPGA 3UR6A 3TJOA 3ERBA 1KLTA 2W3KA 3P17H 1BJVA 4K5ZA 1O2KA 2FI5E 1P10A 2D2DA 3GYLB 3LC3A 4FXGH 1BTZA 1TALA 1ZSKA 1CBWB 1P2JA 4JZEH 3UWJH 1QHRB 1P12E 4YTAA 3A80A 1O2ZA 1GJ8B 1SFIA 2P3FH 1G4GA 2VJ1A 4YM9A 1BRBE 3VXFH 3I29A 3TJVA 4NZQA 4X8VH 4ZH8A 3Q76A 4ISOA 1SOZA 3QTOH 1MD8A 1HAPH 2FOMB 3CENA 1OWKA 3SI3H 1LVOA 3MU1A 3P92A 3RU4D 1V2PT 1QUBA 1HFDA 4BXSA 5L2ZH 1PYTD 1DSTA 1MCVA 4WMEA 3MQLA 2VIPA 2HALA 3MTYA 4AB9A 1GHYH 1GI1A 4FUIA 2ZGHA 3FP7E 2DUCA 3ZZ3A 1AWHB 1PQ8A 1DE7H 3MHWU 1CO7E 3NPSA 1XVOA 2A31A 5EG4A 4WF8A 3S0NA 1HDTH 4K8YA 1V2RT 1TPPA 5EQQA 4NA9H 1TNGA 2LPRA 2H1UA 3STJA 1MKXH 1VCWA 1GMHF 1UVTH 3HGPA 3SU1A 4NFFA 3ATWA 3BTDE 2XXLA 3MU8A 3TH4H 2W80A 2ZFRH 1UCYK 2BOKA 3UNQA 1K9OE 1TMUH 2P95A 2BDHA 1T8NA 2ZWLH 5EXMA 5HYUB 3F68H 4JZFH 1LHFH 2PR3A 1ELGA 1DVAH 2EI8A 1GBJA 4A5TS 1E88A 1W10U 4OS1A 3DFLA 1XXDA 1IQKA 1O34A 2ANYA 4UFEH 2IOTA 4HFPB 3NZIA 4X1RU 5JPMG 1QBNA 4MPVA 1KXAA 1E38B 4JYUH 8GCHG 2C90B 3UUZA 2STBE 3GY2A 2Q6GA 2PTNA 1AZ8A 3RXLA 4X8TH 1ZLRA 1HAGE 1W13U 1V6DA 1SGFA 1AN1E 1O5GH 1BTXA 1GHAG 3QLPH 1GPZA 1TLDA 1SLVB 1V2JT 1A0LA 5E2OA 3ZZAA 4X1QU 3KXVA 5DK1A 1THPB 3T28A 5F6MA 1FLEE 3PWCA 1YGCH 3BIUH 2BD8A 4FU7A 5GJ4B 3MI4A 3PLBA 3GDUA 3M5NA 1ETSH 1UTPA 1KXFA 1J14A 1HJ8A 4XSKU 1GI5A 1L1NA 4JK6A 1NRPH 1V2TT 4I8KA 5H4IB 3M7QA 3A82A 3D65E 2ZHEH 1OWEA 3BTKE 5LPEA 3ATLA 2FXRA 3BF6H 1V2UT 3VB7A 2O8TA 1K2I1 1Y3VA 3AASA 4UFGH 1TPAE 3VB4A 1SOTA 1OK1A 4RN6A 3O8BA 1IQHA 2FTMA 3TNTA 1QIXB 3T62A 1LHEH 2WPHS 2Q6FA 1GI3A 1RGQA 3QN7A 3K65B 4DG4A 1EAXA 1C1WH 4FUHA 2JGWA 1IQNA 1TA2A 1LQEA 2A45B 1HFIA 3MH6A 3SNEA 1ZOMA 3MH5A 1S84A 4XE4A 2XC4A 5CHAC 4MTBA 4AG1A 2ZGBH 4IN1A 1GHBG 1EXFA 2ZHFH 4YOIA 1O2WA 1GGDC 2Y7ZA 4ZKNU 1MAXA 2RDLA 2AMDA 2H6MA 4INHA 2SGPE 2ANWA 3KQBA 2PTCE 3LT3A 1QA7A 4ISLA 1O2LA 3LIWA 4Y11E 1FY3A 2J94A 5CHAB 1P3CA 1LMWB 1G30B 2BDCA 2ODQA 1GGDB 1P2MA 1RXPA 4IMQA 5E0JA 3SNBA 3VGCC 1QR3E 3QGNB 4X1SU 3RMOH 1C2IA 5CMXH 2ZFSA 1IQJA 2TGDA 1FY4A 3K9XB 2FTLE 2GZ8A 3T5OA 4ABEA 4FUCA 1NO9H 1EKBB 3VGCB 1OK9A 1O2GH 4WH8A 4ESTE 1OJWA 2A5AA 2V3HH 1TFXA 1UCYE 3ZZ7A 4D7GA 3SJOA 3BTHE 3A8AA 5B6OA 1VCPA 3AW0A 4X2XA 1DUAA 1Z8GA 5JDUB 3BEUA 3Q3XA 1E34B 3QK1A 4BAOB 2ERJA 3ZZ4A 1XUFA 2H9EH 1TGTA 4KTSA 1Z71A 1YPKH 1BRUP 2AFQB 3KNXA 3SUFA 1O5CB 1DY9A 1O2MA 1MTSA 3GDSA 3K6YA 4YOJA 4ABJA 2WUBA 2Z3EA 4IW4E 2P94A 2BYAX 3SJ8A 4RSPA 1F92A 1SGYE 2SFAA 2XRCA 2ZHDA 1VJAU 1ZHRA 1GMCG 2NU1E 1QL7A 3OP8A 3SI4H 4MPXA 1BIOA 3TK6A 2VH6A 1BA8B 1HPGA 3SU0A 1Y5BT 4A1XA 3SU5A 1WBGB 1FNIA 2R3YA 3ITIA 4Y8XA 5BPEA 3ZVBA 3SW0X 4B1TA 1ELFA 2WPLS 3U8RH 4FU8A 3V0XA 3H7TA 1DWDH 2AIQA 1O3IA 2ZDNA 1ZMLA 5F03A 1HXEH 2RCEA 1TAWA 5ESBA 1AHTH 2IZ3A 3V7TA 1L0ZA 2C8YB 2ZGXH 4ABFA 4AYMA 1GJAB 2OBOA 2EC3A 3ZYEA 1F5KU 3E16B 2ODYB 3FZDA 2FZZA 4XBCA 1BBRK 2PSXA 2XCNA 3UWIA 4AGKA 4CRFA 3O8CA 1PPCE 1QGBA 4ABBA 5HYTB 5T6DA 4NIWA 1F5RA 3LJOA 2Y82A 2ZF0H 2CHAC 2R0KA 2IZ4A 5EW1H 2OINA 3SU3A 2BY6X 1H03P 1JMOH 4KTCA 1QJ6B 3P6ZB 2C8WB 1CGIE 2FIRH 5EU8A 3GDVA 1G4FA 5DGJA 2OTVA 2OC0A 2ZC9H 3BTFE 4J1YA 4JYVH 2HPQH 1SQAA 2CHAB 1YP9A 3RC6A 1C2JA 1SQTA 4Y76A 1YLCA 2QF0A 1EX3A 2ALPA 2A32A 1UK4A 2XBYA 2XC5A 1FUJA 2PUXB 1V2QT 2EI6A 1QRWA 1O3HA 2Z6BD 1HUTH 1Z7KA 1F2SE 1P05A 1W7XH 3EJHA 1NM6A 2PKAA 3L3TA 3PROA 2CXVA 1G3EA 5K7RA 1RTLA 2ZECA 3T27A 1HCCA 2XQWC 3KEEA 3NKKA 4A1VA 2NU0E 4A7IB 5LH8A 3HATH 4GHTA 2CMYA 3SJKA 4A92A 5DP9A 1QFKH 6LPRA 1VGCC 4GAWA 1BUIA 3FP6E 1GG6C 3DT0H 1KXCA 2O8LA 1LO6A 1UHBB 3RXOA 2B9LA 1YPLH 2O8UA 2JRAA 1P03A 1C2LA 1OWIA 2ZQ1A 1KLIH 1HAVA 1RFNA 2W7SA 1Y5UT 1O3CA 1AE5A 4E7NA 1SGCA 1DX5M 2VH0A 2EA3A 1VGCB 1G3CA 1WV7H 1GG6B 1WAYB 2Z3DA 4ZAEA 1C5VA 1SSXA 1EZUC 5EODA 2EEKA 5EGMA 4K2YA 1DANH 4SGAE 1SB1H 1LHGH 2BXUH 4ABHA 5EOKA 3RM2H 1G36A 1KXEA 1BMAA 4YT7H 1DXWA 2G4TA 1MD7A 3TGKE 3RXRA 1CHOF 1RIWC 2IPHA 3ATKA 1W0ZU 1AD8H 3Q00A 3GCNA 3SV8A 1LQDB 1Y3YA 1O2QA 5HMAA 2ZI2H 1WUNH 5C20A 1C2MA 3K6ZA 4DURA 3A84A 1M9UA 2W26A 1AZZA 3OY6U 2ZG0H 3U8OH 3UQVA 3A8CA 1RIWB 1VVCA 2P93A 4ZHLU 1SBWA 1RS0A 1DDJA 4WH6A 4B2SA 9LPRA 1DWCH 1WU1A 3ZRZA 1OPHB 3OSYA 5LGOA 4C16A 5A0AE 2GKVE 7LPRA 1FQ3A 3DD2H 1G9IE 1GBBA 2KAIA 1O32A 1IQEA 4GCHF 3OX7U 4A5WB 2BVXH 1OYTH 2B8OH 1F0TA 5ESTE 5L30H 1OP8A 2VIOA 1C5TA 1O3PB 3CS0A 1BBRE 1PYTC 3E8LA 1GJCB 4TY6A 3BTGE 1GJ7B 3TU7H 4Y8ZA 1C2EA 2CGAA 3LH1A 3EA8A 2F9NA 1O3OA 1C5PA 1GL1A 2OUAA 1W8BH 2QC2A 1BHXF 1O30A 4FUDA 1F0RA 3BTME 1V2OT 1RTKA 2A5IA 2YOLA 1SHHB 3OTJE 2GZ9A 1IAUA 4JYTA 1GJBB 1Z92B 1OJYA 1QRZA 4GUXA 1W3CA 5A0BA 2P59A 2VVUA 3CP7A 2TPIZ 3QUMP 1K21H 1P2QA 1FN6A 4Y79A 2GDDA 2IN2A 1TQ0B 2PWXA 2VWMA 5C3NA 1CHGA 3GY3A 2GMTC 3AVZA 1FBRA 1OWHA 3O8DA 1C1VH 2OC7A 6GCHG 1DICA 1SGIB 3SUGA 1A0HB 1BCUH 4FUGA 3Q77A 4Z0KA 1EAWA 2GCHG 3V3MA 3NFPI 2HNTF 1GJDB 3MU0A 5I0QB 3RXDA 3KQEA 1VCQA 5GIBA 1XM1A 2GMTB 3TH3H 2XBXA 2FDAA 4B75A 1EATA 1KDQA 4B2BA 3ZV8A 5G4BA 1QCPA 3RXGA 1SGPE 2ZFPH 1SS2A 1TB6H 4O9VA 1C1TA 3UTUH 1YCPH 4Y7BA 2BB4A 1ESTA 2A7JA 2A2XH 3C27B 2H9TH 1MZAA 1BB0B 2XRDA 1UK2A 3M7PA 7GCHG 3PB1E 4NA7A 2WV4A 5DO4H 3PMJA 2PFEA 1PQ5A 1HRTH 4X8UH 1VITG 4ZHMU 3UPEA 2TRMA 3OEDC 1TBQH 2OCVB 1BHXB 2ZO3H 2BQWB 2Y5GA 1EJMA 5F8ZA 3BTEE 2AIPA 1ANCA 2ULLA 3A7YA 1OK2A 1DS2E 1C5LH 1YPGH 3QTVH 3OXUD 4UE7H 1YLDA 5J4QA 2V35A 2GGVB 2QXHA 5A2MH 2YBYA 1TE0A 1Q3XA 2HVXA 1N8OC 2ZU5A 4LOSA 1W11U 1E0FD 1DWBH 1YM0A 4MDSA 1HNEE 4MQAA 1SMFE 2BVRH 1TRMA 5DP5A 3A86A 1V2MT 1TMTH 2Z9IA 2PUQH 1BMNH 1C5YB 4ZH1D 1G32B 2HNTC 1P2NA 4MNXA 1TNLA 2QY0B 3RJ3D 3SUDA 4HZHA 3SHCH 1FV9A 1D4PB 3TH2H 2WINI 3A7ZA 4X2WA 1FAXA 2PHBA 1J17T 5E2PA 4CBNA 1NU9A 4TPYA 4ZKOU 3URDA 1N8OB 2ZCHP 1CA8B 4SGBE 1FDPA 1KTSB 2FOFA 2HOBA 4Y0ZE 1EAIA 1L1GA 3L6PA 3GISB 2FOAA 3K2UA 2H9HA 2FOBA 1G2MA 3R62A 1HLTH 2UWPA 3TVJA 3RUOA 1Y59T 1TRYA 3PM3A 5T6GA 4Y8YA 1VVDA 2KMSA 1ZTLA 2STAE 1SLUB 5HYOA 2W5EA 2D8WA 1PJPA 1OSSA 1UO6A 2H5DA 1OKXA 3SGQE 4U2WA 4A6LA 1TONA 1DSUA 1Z6EA 4Q7ZA 1WTGH 1WOFA 4D9RA 2J38A 3D23A 3SORA 1SVPA 2W7UA 2WPIS 2Y80A 1P2IA 3EA7A 1Q31A 1TIOA 2P8OC 4WXVA 1GCDA 1CVWH 4JCNA 4B2RA 1LDTT 3SW2B 1GI4A 3SV6A 1O5BB 3M37A 1GHQB 2AEIH 1JRTA 1KYNA 2TIOA 3UR9A 1TPNA 9ESTA 2FX4A 3MOCA 1GBIA 1TNHA 3DHKH 5FO8C 1BRCE 4FUJA 2UWNA 1KSNA 4WMDA 4X6NA 2PW8H 4AN7A 3A87A 2W81A 3V13A 1KXBA 1MUEB 2BLWA 4NIVA 1T8LA 1CKLA 3CALA 1P0SH 2AERH 2P8OB 4XBBA 2QGRA 3BTQE 1NFXA 3LONA 3MWIU 1TPSA 1DY8A 3UNSA 2SNVA 3SHAH 1C5NH 1SQOA 1UTMA 4ABGA 3ZD2A 1Z8IB 4U32A 2V0BA 1HIAA 2ZEBA 2UUFB 4AZ2B 2WV5A 3TGIE 3IG6B 1F5LA 3UREA 2FMJA 1GI2A 1OJVA 1O31A 1U6QA 1NRNH 2GV7A 1AGJA 3EQ0H 1S81A 3SJ9A 1UVPA 3W95A 2WYJA 3ODDA 2BD7A 4LZ4B 1QRXA 5J4SA 4DJZA 1GDUA 2JGXA 2FESH 4PROA 2ALVA 5TCAA 1E36B 3S9CA 2R9PA 2FOEA 3GCTF 1XUJA 2C93B 4TWYA 3PYHA 1GMDF 2ZDAH 2ZHWH 1K1OA 2Z9LA 1RD3B 4I8HA 2CV3A 2G7IA 2C8ZB 5E8EH 5T3HA 1H2QP 1DOJA 3RU4E 1HV7A 1TBZH 1PPHE 2BVSH 1E8BA 4UDWH 1TWXB 5EW2H 1O3JA 5C1XA 1EPTA 5FPSA 4DCDA 4YNXA 4A1TA 1C9PA 3QGJA 4THNH 1ZMNA 1HJAC 2BX4A 2B5TB 5A8XA 4CBOA 2D26C 1CT2E 1GI0A 4KELA 1LHDH 2FWWA 2LNCA 4OS5A 1H2PP 2QF3A 2F3CE 1TGCA 4INKA 4AOQA 3QZQA 4B71A 1A5IA 1V2WT 2PGQB 4AX9H 2F9PA 1O2PA 1YBWA 1ZMJA 6GCHF 3IITA 1GKGA 2AMQA 1HJAB 1SR5C 5GDSH 1VZQH 5EPYA 4CRCA 2XW9A 4BXWA 4D76A 1AKSB 3M61U 2BD5A 5GCHG 4X6OA 1NFYA 2G52A 4O3TA 1FONA 1TYNA 1UK3A 1T8OA 1Y3WA 1O9AA 2QXGA 4ZHAA 4MUCA 3LGWA 7GCHF 2Q6DA 1O3FA 3F6UH 2CF9H 3RDZA 4R8TB 6CHAC 1VITF 3D62A 2F9UA 3M5MA 2FM2A 1NRSH 2BLOA 2FYRA 1HJ9A 3SGAE 3SQEE 2H2ZA 1Y5AT 3ZZ8A 4PZ5A 3H5CB 1TGBA 5FBIA 4ABAA 2BY7X 3TVJB 3A83A 4U30A 2RG3A 1AQ7A 1MTWA 2BLVA 1C5WB 1EB2A 2CJIA 6CHAB 1EUFA 1ZRBA 5AVDA 4O3UA 1C2KA 2ZU1A 5HXFA 2FOGA 1GVLA 1FI8A 2SGEE 1C5RA 4WXIA 2FYQA 3H7OA 2XTTB 2VIWA 2EC9H 2OXSA 3PLPA 3SGBE 2GP9B 5JBCS 1P2OA 4I8JA 4HTCH 1W14U 1EP5A 1BTYA 3ZV9A 2RKZA 2GX4A 1IHSH 2B0FA 2A1DB 5K0HA 1TBRH 1ANEA 4NA8A 2BD3A 1MTUA 3OYPA 3ATMA 2QIQA 4J38B 3SOSA 4IC5A 5EXNA 2PSYA 1BQYA 1BTWA 2WUCA 1OP0A 2CG7A 1ELCA 4I32A 1L1JA 3ZVAA 3BTTE 3BG4B 4ZKSU 2CF8H 4MPUA 3BG8A 2K1QA 1GKNA 1O0DH 3ZYDA 2OD3B 4CR9A 1C1NA 1CE5A 3E90B 2R2WU 1HAHH 1NS3A 1PPGE 2LOJA 1JRSA 3UY9A 1O33A 3A8DA 3EE0B 3ATIA 5EPNA 3M35A 3GY6A 1QO6A 1BRAA 2G00A 1JIRA 3D49H 2F9OA 1D3DB 2JH5D 3OU0A 2FS9A 4YO9A 5AFZH 1NPMA 1ZR0A 1K22H 4DJZB 1PPBH 1C1OA 1HXFH 3ZZ9A 1A3BH 4GHQA 4H6TA 2AGEX 4MNWA 2QYIA 1C5UA 4E05H 1YF4A 5A8ZA 3TJNA 2ZFQH 3N7OA 1P02A 4U01A 4AYIA 1ELBA 3F9EA 1ORFA 3GICB 8GCHF 4ZMAH 4Y10E 3SZNA 8LPRA 5ETXA 2YNAA 5JPMH 4B2AA 1T4UH 2AH4X 1AVXA 1TMBH 1O5AB 5EQRA 4JZDH 1GHAF 2SNWA 1C1UH 5E0HA 3RXEA 3VEQB 1G37A 1AB9C 4UD9H 1G3DA 2VVCA 1TPMA 2A2QH 2BZAA 3B9FH 1MAYA 1DM4B 4Y0YE 4CRAA 2UWLA 1GDNA 2ZHQH 4BTIB 1SFQB 1MQ5A 1ZGIA 1JIMA 1QB9A 2ZNKH 3Q3KA 3E0NB 1XVMA 3GCOA 3S7HB 5HM2A 1AB9B 1BTUA 4MNYA 1O5EH 1BTHH 2G5VA 2ANMH 3A89A 1V3XA 1Z8RA 1WYKA 3E91A 4Q80A 1AY6H 4IC6A 1BMMH 3MH7A 3SU2A 2ZIQH 1PPQA 3T29A 1ESBA 1UOTP 3SJIA 3VPKA 1OX1A 2P3TB 4FUFA 1DFPA 4CHAC 4YOGA 4LZ1H 1O3BA 3TGJE 1SGRE 3M3TA 4O97A 5JBTA 1QJ1B 4NIYA 1FZZA 2ZU3A 2UUJB 4CR5A 3RXFA 4FXGG 1P8VC 4CHAB 1O2IA 2BM2A 2FLRH 1ESAA 1PPEE 1NFWA 1JXPA 1SPJA 1O2SA 4YESB 4DIHH 1C2HA 2TGTA 4HGCA 4K12A 3HK3B 4AG2A 1C1SA 3A7VA 3TK9A 1SGNE 4VGCC 1A7SA 3FFGA 1GHBF 2FODA 2VIQA 4O03A 3KN2A 1FN8A 5PTPA 1Z6JH 2ZU2A 1DUEA 1ZPBA 3OY5U 3VFEA 5I25A 1GJ9B 2RLPA 1SGQE 1ELTA 1C2GA 1BMLA 5JBBS 1HAYB 1ZRKA 3P8OA 1P9UA 1ELAA 2HWLB 3A85A 3L33A 4ISHH 3R3GB 3BSQA 4TWWA 2NWNA 3GOVA 4VGCB 4DOQA 4E06H 3CS7A 2G4UA 2CN0H 5FCKA 1WQVH 1HAIH 2J92A 4X6MA 1O2VA 1MU8B 2HRVA 2FI3E 1EB1H 2P3UB 2R0LA 4H4FA 2ANKH 1V2KT 3TJUA 1W2KH 2I6QA 4ZXXH 3UQOA 3PMHB 3FP8E 3A7WA 1THSH 1O3AA 3FANA 1IQGA 3ZVDA 4YZUA 4NCYA 3S7KB 2JKHA 5FXLA 1N6XA 4INLA 2XBVA 3U8TH 1C5SA 1QTFA 2VGCC 1L2EA 3F9HA 4XFQA 4KKDA 2J95A 3W94A 2WYGA 1H9HE 1LVBA 2F83A 2FPZA 3MFJA 2ASUB 1TGNA 5A0CA 1LPGB 1ZTKA 2OQUA 4CRDA 4ASHA 2RA3A 4AB8A 4E7RG 1YCPM 2ZTXA 2IJOB 3I78A 1ETRH 2VGCB 1MH0A 2C8XB 2G81E 3BN9A 2PV9B 2J2UA 3TK5A 4IS5A 3M3SA 1C4Y2 1IQFA 4MLFB 1ZJKA 1UVOA 4WMFA 3VB3A 1C1QA 3B23B 1O2TA 2V6NA 1GBKA 2A4OA 1HAOH 4TY7A 1ABIH 2XWBI 1B5GH 2Y5FA 3LGTA 3TNSA 1O2HA 5CE1A 3RLWH 1LKAA 1MKWK 3RC5A 1KXDA 1LVYA 3M5OA 1GMCF 2RLQA 1JWTA 4DW2U 1MQ6A 4D7FA 1AVGH 4I33A 2ZCLP 1ZYOA 3B8JA 1GI9B 1TX8A 1ZZZA 1HBTH 1FPCH 4AFZA 4BTUB 4NZLA 1K28D 1H9IE 1FAKH 4AYDA 1O3MA 2Z7FE 3KF2A 1C1ZA 2VB0A 2Q1JA 1GCTC 1H8DH 4Y6DA 1GHZA 3NXPA 1ETTH 3U98H 1GHXH 2ZFFH 4MG3A 1FY5A 1NRQH 5FPTA 3FAOA 4GLYA 3U9AH 2GV6A 1UCYH 1GCTB 1O3KA 2Z9KA 2ZZUH 4K60A 2BDAA 1LHCH 7KMEH 3EA9A 1GBTA 2PKAB 2BMGB 3QZRA 1SGTA 3URCA 1QB1A 2QXIA 1TRNA 3RMLH 1D6RA 3RXHA 5DP8A 1K1IA 1D9IA 1TQ7B 1TPOA 1ZJDA 2BY9X 5F8XA 3LDXH 2B7DH 2OQ5A 3KHVA 4JZ1A 1C1MA 1NESE 2HLCA 4X1PU 3M7UA 3SBKA 4BAQB 1Q2WA 1DXPA 4YLQH 4X2YA 3O8EB 5JYIA 1ACBE 3RXIA 3KIDU 4UEHH 3KL6A 3ZZ5A 2OC1A 1VJ9U 4UONA 2RL0A 5FX5A 5C67A 1XUIA 3RXUA 1NU7B 3ZZCA 3KQDA 1TA6A 4UFFH 1H4WA 4ZROA 3VB6A 1N1LA 1HAVB 3RXVA 1HAZB 2PLXA 1EJAA 1OK3A 3E1XB 5E0GA 1YC0A 1FJSA 1LVMA 4Q2KA 3SO3A 2F9BH 1HGTH 5FX6A 4CREA 1O5DH 4NWLA 4TPIZ 4H42U 1Z1IA 2RKYA 3RXAA 4DT7B 1O38A 1XX9A 5GPIB 3KGPA 1B0EA
chains in the Genus database with same CATH superfamily
2OP9A 2J9NA 2SGFE 3RXKA 2MCYA 3ZZBA 2BDIA 1U5MA 1NZQH 2LELA 1ZHPA 1EOLA 1H8IH 3MNBA 1TNJA 1GJ5H 3V12A 1QBVH 3ZVFA 2XOKD 1RLHA 1OWJA 3R0FA 1QNJA 4AFQA 1O2NA 1GI6A 1F0UA 5JB9S 4OS7A 2CG6A 1Y3XA 2G8TA 3NWUA 4I31A 1KMHB 1OXGA 2YMSB 4BOHA 4HI3A 1TX6A 2ESTE 1MCTA 4TYDA 2FOCA 3KQ5A 1H04P 1AU8A 1AIXH 1C9TA 1W0YH 1IQLA 3A7TA 3GY4A 3KYFA 4IGDA 3VWOA 1ELDE 1GHVH 2UWOA 1ZSJA 5C17A 4F49A 4ONTD 2KAIB 1J16A 5BRRE 4AYVB 1GHWH 4X1NU 1H9LB 2SGQE 1XKAC 2J34A 1QY6A 1CGJE 1A1RA 1O2UA 5HIZA 2A55A 3S9BA 1C5ZB 3NCLA 3GY7A 2WPDD 2KRIA 3RXSA 4BAKB 2Z9JA 3STIA 3TIUA 2F9VA 1HB0B 4Q7XA 1COWD 4BNRA 3VXEH 4N7EA 2BY5X 4JK5A 2NU3E 1E35B 2BHGA 1G3BA 4AGJA 4Z6AH 3PLKA 4MSLA 4OGYA 1UJ1A 4FU9A 2VWLA 2ZDLA 3ESTA 1D3TB 1DPOA 2XWJI 2BD2A 7ESTE 2GCTC 1HFHA 1ANBA 1GBCA 3HKJB 3RXTA 4NSVA 4XOJA 1O3EA 4GPGA 2BD9A 1P06A 1YCPK 2ZDKA 1EASA 5HZPB 5AF9H 4LK4A 2NU4E 2ZGCA 1UTQA 3OFND 1O2YA 1LKBA 3ZVCA 3M3VA 4CSYA 3A88A 1YPMH 2CKUA 3P8FA 2GCTB 1O37A 1QURH 1CT4E 3F0OA 1QQ4A 5LPFA 4NIXA 1A2CH 5IDKA 3RXQA 1KLJH 1S82A 1VR1H 3LGIA 4QT8C 2QF4A 2BDYA 2VINA 1INCA 1TABE 1V2VT 2BXTH 2XBWA 5DP4A 2PKSC 1XKBC 5DP6A 2JH0D 4IMZA 4KTUA 3WSXA 3HPTB 1MMJN 1P01A 3SNDA 3RM0H 5KECA 1KDQB 3PO1C 5HGGA 1MZDA 1FY8E 1T8MA 1EZSC 5EXLA 3GY5A 1HCGA 1Z8JB 1ZGVA 2AS9A 1UTOA 2MCZA 4B74A 1BITA 2PKSB 2TGAA 4D8NA 1YWUA 2QV1A 3KZJA 1SC8U 3LOXA 1P2KA 3RC4A 3PO1B 3DSOA 2ZQ2A 4R0IA 4I7YH 1GJ6A 2ZA5A 1HYLA 3BEFB 4CH8B 1MTVA 5HYPA 2QAAA 4MNVA 1NROH 1QBOA 4K1SA 1GWAA 3N99A 3G01A 1P04A 2BY8X 2YNBA 1P3EA 2GCHF 1BZXE 1GVZA 3LGVA 2YMSD 4OGXA 4BAHB 3INBC 2A5KA 2ILNA 1A4WH 1K1LA 5C5OA 3DUXH 2LP6A 2GTBA 3RXJA 2ZP0H 1SG8B 3A8BA 4JHSA 5LPRA 3FGRA 1OWDA 2H5CA 4I8GA 3MNCA 3P8NA 3SN8A 3E6PH 2ZKSA 2Z3CA 3T26A 1NY22 1UTJA 2KZ4A 3MU4A 3PRBA 1SL3A 2J98B 5GXPA 1MKXK 1D3PB 4YT6H 2OK5A 4B2CA 5FL7D 1O3GA 3SU6A 1A46H 3LGUA 4K69A 4B76A 1N6YA 2V8EA 1NT1A 4K3JA 5L6NH 4BTTB 1VITH 1BBRH 3ODFA 2FI4E 3BEIB 1UMAH 1O35A 3KQCA 1S0RA 1TOMH 1BJUA 5C5NA 2DE9A 4AFSA 1MBQA 1GVKB 1NRRH 4AORA 3A81A 2F91A 2XNIA 3UOPA 1XUHA 1TNIA 3PMBB 2J4IA 2TBSA 2G5NA 2ZDMA 5AHGH 5DKMA 1DLKB 3U1JB 3LGYA 4XDEA 1XMNB 4FUEA 2HPPH 1A5GH 1F0SA 3FOAA 1ZPCA 1T31A 1K1PA 3ZZDA 1CHOG 2WIIC 1AUJA 1FXYA 1LTOA 3RXCA 2X2ZA 5TJXA 1UHBA 3EAJA 2M5TA 3JZ2B 3K3TA 3SUEA 1UTKA 2BTCE 2A4GA 1S6LA 2EI7A 3MNXA 3WY8A 4F4OC 4OS6A 2GT8A 2ZDVH 3BG4C 3FZZA 2R2MB 3VB5A 1O2XA 4X2VA 1D3QB 3PWBA 2W3IA 1YY3A 1EJNA 1ZPZA 2XYAA 1GI7B 4DVAU 3Q3YA 4X8SH 4DT4A 1ID5H 2HNTE 1C4U2 4FVDA 3RMNH 1K1JA 3WSYA 1C5QA 1JBUH 1XXFA 2WPJS 5SGAE 1S6HA 8ESTE 5KGOA 4ABDA 4DGJA 2Z94A 1AI8H 4NFEA 2C3SA 2ZFTA 6ESTA 3AK5A 2QCYA 5HIYA 4DIIH 2KCYA 1C5MD 3IU3I 4ZXYH 2VWNA 8KME2 2VVVA 4GCHG 3UOUA 2FOHA 1O3DA 1HIAB 1BOQA 1ZSLA 4X6PA 2Y5HA 3ELAH 4MPWA 2QA9E 3RXPA 4Q7YA 2FLBH 5FPYA 1TNKA 5EQSA 2JETC 5L2YH 1OS8A 3QO6A 1MBMA 1T32A 1C4V2 4IN2A 5CHBA 5HM9A 4LXBH 3LPRA 1ZHMA 1FIWA 1PPZA 4P02A 5DJ7A 1PQAA 3LH3A 1GBAA 1J9CH 2KX4A 3EYDA 1EPTC 1O3NA 1Y3UA 1QL9A 1MTNC 2O39C 3ENSB 1GBEA 2ZU4A 4WVPE 3P8GA 4XBDA 2JETB 1WDIA 2HGTH 1GBHA 2BZMA 2A0QB 3H09A 2QE7D 1CA0C 3TPIZ 1E5GA 1ARBA 5DG6A 1JOUB 5C2ZA 1B0FA 4OS4A 2BOHB 3MMGA 2GD4B 2G51A 1EPTB 1S0QA 1MTNB 1ZTJA 1L4DA 1DT2A 4UFDH 1GBDA 3E0PB 2ZPRA 2Y8RA 1CA0B 1YPHC 3PTNA 1ARCA 3P70B 4KP0A 2RA0A 1P9SA 3O8RA 4M7GA 4FUBA 5FCRA 1UVSH 1T4VH 4ZKRU 5DPAA 4XD7D 1BMFD 3NK8A 1Y8TA 1P11E 4Y71A 3U69H 1D6WA 2P16A 2G55A 2VWOA 4Y7AA 3EGKH 3UNRA 5I46H 3GY8A 2OLGA 1QL8A 1FY1A 1TGSZ 2DE8A 2BQ6B 3P95A 3VG8A 2THFB 4AFUA 4K1EA 3WWFA 1C2DA 2WHXA 1QGFA 1EAUA 2FS8A 1O5FH 3IWMA 4H6SB 2VU8E 3HKIB 2C4FH 2FEQH 3QWCH 1TOCB 1OHHD 1W12U 1X7AC 2XC0A 1J8AA 2A7HA 2BZ6H 5ABWA 3MYWA 2VIDA 4Q63A 1CGHA 1PFXC 4GSOA 1YYY1 1RJXB 1IQIA 4FVBA 2A7CA 1MKWH 2K8IA 2ZTYA 1BTPA 1AUTC 1CQQA 1P09A 2BDGA 5FAHA 3ZVGA 1GBFA 3E3TA 4KGAA 4AYYB 1AO5A 3LC5A 1C5XB 2XWBF 2A4RA 2FX6A 1FMGA 2UUKB 1EFRD 1C2FA 1O3LA 1OYQA 1YPJH 3M7TA 5GCHF 4CRBA 1A5HA 2VNTA 3QDZB 4MVNA 1NC6A 2ZCKP 2WPMS 1AFQC 1GBMA 5FHTA 2AYWA 4CRGA 2KCPA 4B73A 3MH4A 4BAMB 3T5FH 1KIGH 3U1IB 1KY9A 1DITH 4NSYA 3TLOA 1HAXB 1F7ZA 1CU1A 2WPKS 3GYMA 2EQNA 1OP2A 3SNAA 1AFQB 1YPEH 4ISIH 2Y81A 1EZQA 1WCZA 1K1NA 1ELVA 1B7XB 3DFJA 1IOEA 2ZGJA 5FBEA 1NN6A 1EQ9A 4XRNA 1SRZA 1UTLM 1IHTH 4YLUA 1LCYA 3TITA 1C5OH 1L4ZA 2QY0A 1CT0E 1O2JA 5IYTA 2XCFA 3MO3A 4D9QA 2TGPZ 2Y7XA 1FIZA 2R3UA 2ZPSA 4NWKA 3UFAA 5HKKD 1XUGA 3ZD1A 1BDAA 1GMHG 5JB8S 1PQ7A 1IQMA 1GI8B 1C1RA 5C1YA 4RKJB 1FPHH 2D1JA 1SGEE 3T25A 1ABJH 2ZPQA 4NGAH 1V2ST 1CSOE 5AFYH 2BQ7B 4LOTA 1SGDE 3UAIC 2Z9GA 1ANDA 4X0WU 1THRH 3RP2A 1NWVA 1E37B 1SHYA 2FO9A 3EDXB 2OBQA 1AMHA 1SLXB 2ZTZA 4K8BA 1WQSA 2SGAA 4ZCNA 2UUYA 1SLWB 3OEED 2AGIX 1AFEH 2PGBB 3LJJA 3SYJA 2O8WA 1EP6A 2BX3A 2KCOA 3QX5H 1AWFH 1DLEA 3BIVH 2GZ7A 3JZ1B 4JZIA 2EHFA 5DN4A 5A8YA 2XRBA 3SQHE 5F8TA 1H1BA 2BD4A 3SNCA 1QJ7B 1UTNA 3SV7A 5DP3A 2BDBA 3RXBA 4WY3A 1FX0B 2AMPA 2NU2E 1GJ4H 1WTHD 1QQUA 1UVUH 4DY7B 1W7GH 4J2YB 1TX7A 3GCTG 3SU4A 1EOJA 5EJ1A 2J97A 3I77A 5A09A 1GMDG 3GXEA 3HK6B 4GVUA 2O9QA 3T2NA 2V3OH 3S69A 4OS2A 3M36A 3F1SB 4K1TA 1NFUA 5TCCA 3IX0A 2OC8A 4WWYA 2ODPA 3AAUA 2VIVA 1WSSH 2SGDE 1O36A 2YRAA 4WJG2 1ELEE 1KTTB 5CDFE 4NG9H 4ZUHA 5JBAS 3NUMA 5T6FA 3LU9B 1WXRA 1S6FA 4AYEA 1V2NT 4BANB 2I6SA 3DA9B 1YKTA 2AGGX 3FVFB 2GT7A 3SV9A 2O8MA 2QN5T 4I8LA 1LPKB 3BV9B 4ISNA 1K1MA 1MABB 3MO6A 1EZXC 3F3BA 1BT7A 1PPFE 2GDEH 1Z1JA 4ABIA 2B5ID 1DWEH 1GBLA 1S5SA 2JH6D 2GVFA 4IBLH 2QXJA 1O2OA 1S83A 3KCGH 2XWAA 4LOYH 1SI5H 3RMMH 1GDQA 3BTWE 3MNSA 1OOKB 3LKWA 3GCHC 2FP7B 3ZVEA 1LPZB 1A61H 1RRKA 5C1UA 1QB6A 1QA0A 4JMYA 3C1KA 3RLYH 1YPHE 1G2LA 2Y6TA 1C1PA 3L89M 1V2LT 4RKOB 1NTPA 2A4QA 1P57B 3HGNA 2JDID 1A3EH 1GL0E 3GCHB 2BLQA 3M5LA 1MU6B 3RU4T 1AE8H 3AW1A 3MU5A 3MO9A 3AAVA 1O2RA 1O39A 3PMAB 3PTBA 1SGFG 3A7XA 3S9AA 1S85A 5GWZA 1T7CA 1A0JA 3ZZ6A 1J15A 3GOVB 3WW7A 1RTFB 4CH2B 1XUKA 3F9GA 3F9FA 1AVWA 1CBWC 3RXMA 1LY2A 3SV2H 5DP7A 1AKSA 3UIRA 3PV4A 1TPGA 3UR6A 3TJOA 3ERBA 1KLTA 2W3KA 3P17H 1BJVA 4K5ZA 1O2KA 2FI5E 2V3MA 1P10A 2D2DA 3GYLB 3LC3A 4FXGH 1BTZA 2YMSC 3OTPA 1TALA 1ZSKA 1CBWB 1P2JA 4JZEH 3UWJH 1QHRB 1P12E 4YTAA 3A80A 1O2ZA 1GJ8B 1SFIA 2P3FH 1G4GA 2VJ1A 4YM9A 1BRBE 3VXFH 3ZLEA 3I29A 3TJVA 4NZQA 4X8VH 4ZH8A 3Q76A 4ISOA 1SOZA 3QTOH 1MD8A 1HAPH 2FOMB 3CENA 1OWKA 2HVYB 3SI3H 1LVOA 3MU1A 3P92A 3RU4D 1V2PT 5C94A 1QUBA 1HFDA 4BXSA 5L2ZH 1PYTD 4HG6A 1DSTA 1MCVA 4WMEA 3MQLA 2VIPA 2HALA 3MTYA 4AB9A 1GHYH 1GI1A 4FUIA 2ZGHA 3FP7E 2DUCA 3ZZ3A 1AWHB 1PQ8A 2Y8TA 1DE7H 3MHWU 1CO7E 3NPSA 1XVOA 2A31A 5EG4A 4WF8A 3S0NA 1HDTH 4K8YA 1V2RT 4Q4LA 1TPPA 5EQQA 4NA9H 1TNGA 2LPRA 2H1UA 3STJA 1MKXH 1VCWA 1GMHF 1UW7A 1UVTH 3HGPA 3SU1A 4NFFA 3ATWA 3BTDE 2XXLA 3MU8A 3TH4H 2W80A 2ZFRH 1UCYK 2BOKA 3UNQA 1K9OE 1TMUH 2P95A 2BDHA 1T8NA 2ZWLH 5EXMA 5HYUB 2L6OA 3F68H 4JZFH 1LHFH 2PR3A 1ELGA 1DVAH 1NBME 2EI8A 1GBJA 4A5TS 1E88A 1W10U 4OS1A 3DFLA 1XXDA 1IQKA 1O34A 2ANYA 4UFEH 2IOTA 4HFPB 3NZIA 2F43B 4X1RU 5JPMG 1QBNA 4MPVA 1KXAA 1E38B 4JYUH 8GCHG 2C90B 3UUZA 2STBE 3GY2A 2Q6GA 2PTNA 1AZ8A 3RXLA 4X8TH 1ZLRA 1HAGE 1W13U 1V6DA 1SGFA 1AN1E 5C0UA 1O5GH 1BTXA 1GHAG 3QLPH 1GPZA 1TLDA 1SLVB 1V2JT 1A0LA 2VBCA 5E2OA 3ZZAA 4X1QU 3KXVA 5DK1A 1THPB 3T28A 5F6MA 1FLEE 3PWCA 1YGCH 3BIUH 2BD8A 4FU7A 5GJ4B 3MI4A 3PLBA 3GDUA 3M5NA 1ETSH 1UTPA 1KXFA 1J14A 1HJ8A 4XSKU 1GI5A 1L1NA 4JK6A 1NRPH 1V2TT 4I8KA 5H4IB 3M7QA 2CK3D 3A82A 2ZHEH 3D65E 1OWEA 3BTKE 5LPEA 3ATLA 5IK2D 2FXRA 3BF6H 1V2UT 3VB7A 2O8TA 1K2I1 1Y3VA 3AASA 4UFGH 1TPAE 3VB4A 1SOTA 1OK1A 4RN6A 4M9FA 5GNDA 3O8BA 1IQHA 2FTMA 3TNTA 1QIXB 3T62A 1LHEH 2WPHS 2Q6FA 1GI3A 1RGQA 3QN7A 3K65B 4DG4A 1EAXA 1C1WH 4FUHA 2JGWA 1IQNA 1TA2A 1LQEA 2A45B 1HFIA 3MH6A 3SNEA 1ZOMA 3MH5A 1S84A 4XE4A 2XC4A 5CHAC 4MTBA 4AG1A 2ZGBH 4IN1A 1GHBG 1EXFA 2ZHFH 4YOIA 1O2WA 1GGDC 2Y7ZA 4ZKNU 1MAXA 2RDLA 2AMDA 2H6MA 4INHA 2SGPE 2ANWA 4FETA 1K0HA 3KQBA 2PTCE 3LT3A 1QA7A 4ISLA 1O2LA 3LIWA 4Y11E 1FY3A 2J94A 5CHAB 1P3CA 1LMWB 1G30B 2BDCA 2ODQA 1GGDB 1P2MA 1RXPA 4IMQA 5E0JA 2GJGA 3SNBA 1QR3E 3VGCC 3QGNB 5C0TA 4X1SU 3RMOH 1C2IA 5CMXH 2ZFSA 1IQJA 2TGDA 1FY4A 3K9XB 2FTLE 2GZ8A 3T5OA 4ABEA 4FUCA 1NO9H 4RT0A 1EKBB 3VGCB 1OK9A 4ASUD 1O2GH 4WH8A 4ESTE 1OJWA 2A5AA 2V3HH 1TFXA 1UCYE 3ZZ7A 4D7GA 3SJOA 3BTHE 3A8AA 5B6OA 1VCPA 3AW0A 4X2XA 1DUAA 1Z8GA 5JDUB 3BEUA 3Q3XA 4YXWD 1E34B 3QK1A 4BAOB 2ERJA 3ZZ4A 1XUFA 2H9EH 1TGTA 4KTSA 1Z71A 1YPKH 1BRUP 2AFQB 3KNXA 3SUFA 1O5CB 3DSPA 1DY9A 1O2MA 1MTSA 3GDSA 3K6YA 4YOJA 4ABJA 2WUBA 2Z3EA 4IW4E 2P94A 2BYAX 3SJ8A 4RSPA 1F92A 1SGYE 2SFAA 2XRCA 2ZHDA 1VJAU 1ZHRA 1GMCG 2NU1E 1QL7A 2PP6A 3OP8A 3SI4H 4MPXA 1BIOA 3TK6A 5T1VA 2VH6A 1BA8B 1HPGA 2RDEA 3GS9A 3SU0A 1Y5BT 4A1XA 3SU5A 1WBGB 1FNIA 2R3YA 3ITIA 3PRDA 4Y8XA 5BPEA 3ZVBA 3SW0X 4B1TA 4RT1A 1ELFA 2WPLS 3U8RH 4FU8A 3V0XA 3H7TA 1DWDH 2AIQA 1O3IA 2ZDNA 1ZMLA 5F03A 1HXEH 4TT3D 2RCEA 1TAWA 5EJLA 2KM0A 5ESBA 1AHTH 2IZ3A 3V7TA 1L0ZA 2C8YB 2ZGXH 4ABFA 4AYMA 1GJAB 2OBOA 2EC3A 3ZYEA 1F5KU 3E16B 2ODYB 3FZDA 2FZZA 4XBCA 1BBRK 2PSXA 2XCNA 3UWIA 4AGKA 4CRFA 3O8CA 1PPCE 1QGBA 4ABBA 5HYTB 2WZQA 5T6DA 4NIWA 1F5RA 3LJOA 2Y82A 2ZF0H 2CHAC 3EE7A 2R0KA 2IZ4A 5EW1H 2OINA 3SU3A 2BY6X 1H03P 1JMOH 4KTCA 1QJ6B 3P6ZB 2C8WB 1CGIE 2FIRH 5EU8A 3GDVA 1G4FA 5DGJA 2EY4C 2OTVA 2OC0A 2ZC9H 3BTFE 4J1YA 4JYVH 2HPQH 4ACBA 1SQAA 2CHAB 1YP9A 3RC6A 1C2JA 1SQTA 4Y76A 1YLCA 2QF0A 1EX3A 2ALPA 2A32A 1UK4A 2XBYA 2XC5A 1FUJA 2PUXB 1V2QT 2EI6A 1QRWA 1O3HA 1E79D 2Z6BD 1HUTH 1Z7KA 1F2SE 1P05A 1W7XH 3EJHA 1NM6A 2PKAA 5B6LA 3L3TA 3PROA 2CXVA 1G3EA 5K7RA 1RTLA 2ZECA 3T27A 1HCCA 2XQWC 3KEEA 3NKKA 4A1VA 2NU0E 4A7IB 5LH8A 3HATH 4GHTA 2CMYA 3SJKA 4A92A 5DP9A 1QFKH 6LPRA 1W0KD 1VGCC 4GAWA 1BUIA 3FP6E 1GG6C 3DT0H 1KXCA 2O8LA 1LO6A 1UHBB 3RXOA 2B9LA 1YPLH 2O8UA 2JRAA 1P03A 1C2LA 1OWIA 2ZQ1A 1KLIH 1HAVA 1RFNA 2W7SA 1Y5UT 3OAAD 1O3CA 1AE5A 4E7NA 1SGCA 1DX5M 2VH0A 2ZYCA 2EA3A 1VGCB 1G3CA 1WV7H 1GG6B 1WAYB 2Z3DA 4ZAEA 1C5VA 1SSXA 1EZUC 5EODA 2EEKA 5EGMA 4K2YA 1DANH 4SGAE 1SB1H 1LHGH 2BXUH 4ABHA 5EOKA 3RM2H 1G36A 1KXEA 1BMAA 4YT7H 1DXWA 2G4TA 1MD7A 3TGKE 3RXRA 1CHOF 1RIWC 2IPHA 3ATKA 1W0ZU 2M2AA 1AD8H 3N7DA 3Q00A 3GCNA 3SV8A 1LQDB 1Y3YA 1O2QA 5HMAA 2ZI2H 1WUNH 5C20A 1C2MA 3K6ZA 4DURA 3A84A 1M9UA 2W26A 1AZZA 3OY6U 2ZG0H 3U8OH 3UQVA 3A8CA 1RIWB 1VVCA 2P93A 4ZHLU 1SBWA 1RS0A 1DDJA 4WH6A 4B2SA 9LPRA 1DWCH 1WU1A 3ZRZA 1OPHB 3OSYA 5LGOA 4C16A 5A0AE 2GKVE 7LPRA 1FQ3A 3DD2H 1G9IE 1GBBA 2KAIA 3U28C 1O32A 1IQEA 4GCHF 3OX7U 4A5WB 2BVXH 1OYTH 2B8OH 1F0TA 5ESTE 5L30H 1OP8A 2VIOA 1C5TA 1O3PB 3CS0A 2QF5A 3F2FA 1BBRE 1PYTC 3E8LA 1GJCB 4TY6A 3BTGE 1GJ7B 3TU7H 4Y8ZA 4FOUC 1C2EA 2CGAA 3LH1A 3EA8A 2F9NA 1O3OA 1C5PA 1GL1A 2OUAA 1W8BH 2QC2A 1BHXF 4F55A 1O30A 4FUDA 1F0RA 3BTME 1V2OT 1RTKA 2A5IA 2YOLA 1SHHB 3OTJE 2GZ9A 4PO7A 5KEDA 1IAUA 3CNRA 4JYTA 1GJBB 1Z92B 1OJYA 1QRZA 1W0JD 4GUXA 1W3CA 1E1QD 5A0BA 2P59A 2VVUA 3CP7A 2TPIZ 3QUMP 1K21H 1P2QA 1FN6A 4Y79A 2GDDA 2IN2A 1TQ0B 2PWXA 2VWMA 5C3NA 1CHGA 3GY3A 2GMTC 3AVZA 1H8ED 1FBRA 1OWHA 3O8DA 1C1VH 2OC7A 6GCHG 1DICA 1SGIB 3SUGA 1A0HB 1BCUH 4FUGA 3Q77A 4Z0KA 2WV9A 1EAWA 2GCHG 3V3MA 3NFPI 2HNTF 1GJDB 3MU0A 5I0QB 3RXDA 3KQEA 1VCQA 5GIBA 1XM1A 2GMTB 3TH3H 2XBXA 2FDAA 4B75A 1EATA 1KDQA 4B2BA 3ZV8A 5G4BA 1QCPA 3RXGA 1SGPE 2ZFPH 1SS2A 1TB6H 4O9VA 1C1TA 3UTUH 1YCPH 4Y7BA 2BB4A 1ESTA 2A7JA 2A2XH 3C27B 2H9TH 1MZAA 1BB0B 2XRDA 1UK2A 3M7PA 7GCHG 3PB1E 4NA7A 2WV4A 5DO4H 3PMJA 2PFEA 1PQ5A 1HRTH 3SZEA 4X8UH 1VITG 4ZHMU 3UPEA 2TRMA 3OEDC 1TBQH 2OCVB 1BHXB 2ZO3H 2BQWB 2Y5GA 1EJMA 5F8ZA 3BTEE 2AIPA 1ANCA 2ULLA 3A7YA 1OK2A 1DS2E 1C5LH 1YPGH 3QTVH 3OXUD 4UE7H 1YLDA 5J4QA 2V35A 2GGVB 2QXHA 5A2MH 2YBYA 1TE0A 1Q3XA 2HVXA 1N8OC 2ZU5A 4LOSA 1W11U 1E0FD 1DWBH 1YM0A 4MDSA 1HNEE 4MQAA 1SMFE 2BVRH 1TRMA 5DP5A 2RFKC 3A86A 1V2MT 1TMTH 2Z9IA 2PUQH 1BMNH 1C5YB 4ZH1D 1G32B 2HNTC 1P2NA 4MNXA 1TNLA 2QY0B 3RJ3D 3SUDA 4HZHA 2J98A 4TSFD 1FV9A 3SHCH 1D4PB 3TH2H 2WINI 3A7ZA 4X2WA 1FAXA 2PHBA 1J17T 5E2PA 4CBNA 1NU9A 4TPYA 4ZKOU 3URDA 1N8OB 2ZCHP 1CA8B 4SGBE 1FDPA 1KTSB 2FOFA 2HOBA 4Y0ZE 1EAIA 1L1GA 3L6PA 3GISB 2KR7A 2FOAA 3K2UA 2H9HA 2FOBA 1G2MA 3R62A 1HLTH 2UWPA 3TVJA 3RUOA 1E1RD 1Y59T 1TRYA 3PM3A 5T6GA 4Y8YA 1VVDA 2KMSA 1ZTLA 2STAE 1SLUB 5HYOA 2W5EA 2D8WA 1PJPA 1OSSA 1UO6A 2H5DA 1OKXA 3SGQE 4U2WA 4A6LA 1TONA 1DSUA 1Z6EA 4Q7ZA 1WTGH 1WOFA 4D9RA 2J38A 3D23A 3SORA 1SVPA 2W7UA 2WPIS 4P00A 2Y80A 1P2IA 3EA7A 1Q31A 1TIOA 2P8OC 4WXVA 1GCDA 1CVWH 4JCNA 4B2RA 1LDTT 3SW2B 1GI4A 3SV6A 1O5BB 3M37A 1GHQB 2AEIH 1JRTA 1KYNA 2TIOA 3UR9A 1TPNA 9ESTA 2FX4A 3PV2A 3MOCA 1GBIA 1TNHA 3DHKH 5FO8C 1BRCE 4FUJA 2UWNA 1KSNA 4WMDA 4X6NA 2PW8H 4AN7A 3A87A 2W81A 3V13A 1KXBA 1MUEB 2BLWA 4NIVA 1T8LA 1CKLA 3CALA 1P0SH 2AERH 2P8OB 4XBBA 3ZLDA 2QGRA 3BTQE 1NFXA 3LONA 3MWIU 1TPSA 1DY8A 2L74A 3UNSA 2KCAA 2SNVA 3SHAH 1C5NH 1SQOA 2JJ2D 1UTMA 4ABGA 3ZD2A 1Z8IB 4U32A 2V0BA 1SQRA 1HIAA 2ZEBA 2UUFB 4AZ2B 2WV5A 3TGIE 3IG6B 1F5LA 3UREA 2FMJA 1GI2A 1OJVA 1O31A 3DCLA 1U6QA 1NRNH 2GV7A 1AGJA 3EQ0H 1S81A 3SJ9A 1UVPA 3W95A 2WYJA 3ODDA 2BD7A 4LZ4B 1QRXA 5J4SA 4DJZA 1GDUA 2JGXA 2FESH 4PROA 2ALVA 5TCAA 1E36B 3S9CA 2R9PA 2FOEA 3GCTF 1XUJA 2C93B 4TWYA 3PYHA 3MQKC 1GMDF 2ZDAH 2ZHWH 1K1OA 2Z9LA 1RD3B 4I8HA 2CV3A 2G7IA 2C8ZB 5E8EH 5T3HA 1H2QP 1DOJA 3RU4E 1HV7A 2Y8SA 1TBZH 3F2HA 1PPHE 3PV5A 2BVSH 1E8BA 4UDWH 1TWXB 5EW2H 1O3JA 5C1XA 1EPTA 5FPSA 4DCDA 4YNXA 4A1TA 1C9PA 3QGJA 4THNH 1ZMNA 1HJAC 2BX4A 2B5TB 5A8XA 4CBOA 2D26C 1CT2E 1GI0A 4KELA 1LHDH 2FWWA 2LNCA 3WWBA 4OS5A 1H2PP 2QF3A 2F3CE 1TGCA 4INKA 4AOQA 3QZQA 4B71A 1A5IA 1V2WT 2PGQB 4AX9H 2F9PA 1O2PA 1YBWA 1ZMJA 6GCHF 3IITA 1GKGA 2KFWA 2AMQA 1HJAB 1SR5C 5GDSH 1VZQH 5EPYA 4CRCA 3FN8A 5F53A 2XW9A 4BXWA 4D76A 1AKSB 2IJD1 3M61U 2BD5A 3FGTA 5GCHG 4X6OA 1NFYA 2G52A 4O3TA 1FONA 1TYNA 1UK3A 2F4LA 2XNDD 1T8OA 1Y3WA 1O9AA 2QXGA 4ZHAA 4MUCA 3LGWA 7GCHF 2Q6DA 1O3FA 3F6UH 2CF9H 3RDZA 4R8TB 6CHAC 1VITF 4BWCA 3D62A 2F9UA 3M5MA 3F6KA 2FM2A 1NRSH 4B6FA 2BLOA 2FYRA 1HJ9A 3SGAE 3SQEE 2H2ZA 1Y5AT 3ZZ8A 4PZ5A 3H5CB 1TGBA 5FBIA 4ABAA 2BY7X 3TVJB 3A83A 4U30A 2RG3A 1AQ7A 1MTWA 2BLVA 1C5WB 1EB2A 2CJIA 6CHAB 1EUFA 1ZRBA 5AVDA 4O3UA 1C2KA 2ZU1A 5HXFA 2FOGA 1GVLA 1FI8A 2SGEE 1C5RA 4WXIA 5EJZA 2FYQA 5DSFA 3H7OA 2XTTB 2VIWA 2EC9H 2W6JD 2OXSA 3PLPA 3SGBE 2V7QD 2GP9B 5JBCS 1P2OA 4I8JA 4HTCH 1W14U 1EP5A 1BTYA 3OEHD 2HLDD 3ZV9A 2RKZA 2GX4A 1IHSH 2B0FA 2A1DB 5K0HA 1TBRH 1ANEA 4NA8A 2BD3A 1MTUA 3OYPA 3ATMA 2QIQA 4J38B 3SOSA 4IC5A 5EXNA 2PSYA 1BQYA 1BTWA 2WUCA 1OP0A 2CG7A 1ELCA 4I32A 4F48B 1L1JA 3ZVAA 3BTTE 3BG4B 4APLA 4ZKSU 2CF8H 4MPUA 3BG8A 2K1QA 1GKNA 1O0DH 3ZYDA 2OD3B 4CR9A 4RI0A 2I2LA 1C1NA 2K0QA 1CE5A 3E90B 2R2WU 1HAHH 1NS3A 1PPGE 3F0PA 2LOJA 1JRSA 3UY9A 1O33A 3A8DA 3EE0B 3ATIA 1QZ8A 5EPNA 3M35A 4ACAA 3GY6A 3DSGA 1QO6A 1BRAA 2G00A 4AC9A 1JIRA 1SKYE 2F9OA 3D49H 1D3DB 2JH5D 3OU0A 2FS9A 4YO9A 5AFZH 1NPMA 1ZR0A 1K22H 4DJZB 1PPBH 3OE7D 1C1OA 1HXFH 3ZZ9A 1A3BH 4YIZA 4GHQA 4H6TA 2AGEX 4MNWA 2QYIA 1C5UA 4E05H 1YF4A 5A8ZA 3TJNA 2ZFQH 3N7OA 1P02A 4U01A 4AYIA 1ELBA 3F9EA 1ORFA 3GICB 8GCHF 4ZMAH 4Y10E 3SZNA 8LPRA 5ETXA 2YNAA 5JPMH 4B2AA 1T4UH 2AH4X 1AVXA 1TMBH 2J5UA 1O5AB 5EQRA 4JZDH 1GHAF 2SNWA 1C1UH 5E0HA 3RXEA 3VEQB 1G37A 1AB9C 4UD9H 1G3DA 2VVCA 1TPMA 2A2QH 2BZAA 3B9FH 5EIYA 1MAYA 1DM4B 4Y0YE 4CRAA 2UWLA 1GDNA 2ZHQH 4BTIB 1SFQB 1MQ5A 1ZGIA 1JIMA 1QB9A 2ZNKH 3Q3KA 3E0NB 1XVMA 3GCOA 3S7HB 5HM2A 1AB9B 1BTUA 4MNYA 1O5EH 1BTHH 2G5VA 2ANMH 3A89A 1V3XA 1Z8RA 1WYKA 1VKYA 3E91A 4Q80A 1AY6H 4IC6A 1BMMH 3MH7A 4OM9A 2ZIQH 3SU2A 1PPQA 3T29A 1ESBA 1UOTP 3SJIA 3VPKA 1OX1A 2P3TB 4FUFA 1DFPA 4CHAC 4YOGA 4LZ1H 1O3BA 3TGJE 3NJAA 1SGRE 3M3TA 4O97A 5JBTA 1QJ1B 4NIYA 1FZZA 2ZU3A 2UUJB 4CR5A 3RXFA 4B6EA 1H8HD 4FXGG 1P8VC 4CHAB 5DN6D 1O2IA 2BM2A 2FLRH 1ESAA 1PPEE 1NFWA 1JXPA 1SPJA 1O2SA 4YESB 4DIHH 1C2HA 2TGTA 4HGCA 4K12A 3HK3B 4AG2A 1C1SA 3A7VA 3TK9A 1SGNE 4VGCC 1A7SA 3FFGA 1GHBF 2FODA 2VIQA 4O03A 3KN2A 1FN8A 5PTPA 1Z6JH 2ZU2A 1DUEA 1ZPBA 3OY5U 3VFEA 5I25A 1GJ9B 2RLPA 1SGQE 1ELTA 1C2GA 1BMLA 5JBBS 1HAYB 1ZRKA 3P8OA 1P9UA 1ELAA 2HWLB 3A85A 3L33A 4ISHH 3R3GB 3BSQA 4TWWA 2NWNA 3F2GA 3GOVA 4VGCB 4DOQA 4E06H 3CS7A 2G4UA 2CN0H 5FCKA 1WQVH 1HAIH 2J92A 4X6MA 1O2VA 1MU8B 2HRVA 2FI3E 2AHME 1EB1H 2P3UB 2R0LA 4H4FA 2ANKH 1V2KT 3TJUA 1W2KH 2I6QA 4ZXXH 3UQOA 3PMHB 3FP8E 3A7WA 1THSH 1O3AA 3FANA 1IQGA 3ZVDA 4YZUA 4NCYA 3S7KB 2JKHA 5FXLA 1N6XA 4INLA 2XBVA 1YLNA 3U8TH 1C5SA 1QTFA 2VGCC 1L2EA 3F9HA 4XFQA 4KKDA 2J95A 3W94A 2WYGA 1H9HE 1LVBA 2F83A 2FPZA 3MFJA 2ASUB 1TGNA 4Z1MD 5A0CA 1LPGB 1ZTKA 2OQUA 4CRDA 4ASHA 2RA3A 4AB8A 4E7RG 1YCPM 2ZTXA 2IJOB 3I78A 1ETRH 2VGCB 2JIZD 1MH0A 2C8XB 2G81E 3BN9A 2PV9B 2J2UA 3TK5A 4IS5A 3M3SA 1C4Y2 1IQFA 4MLFB 1ZJKA 1UVOA 4WMFA 3VB3A 1C1QA 3B23B 1O2TA 2V6NA 1GBKA 2A4OA 1HAOH 4TY7A 1ABIH 2XWBI 1B5GH 2Y5FA 3LGTA 3TNSA 1O2HA 5CE1A 3RLWH 1LKAA 1MKWK 3RC5A 1KXDA 1LVYA 3M5OA 1GMCF 2RLQA 1JWTA 4DW2U 1MQ6A 4D7FA 1AVGH 4I33A 2ZCLP 1ZYOA 3B8JA 1GI9B 1TX8A 1ZZZA 2IPQX 1HBTH 1FPCH 4AFZA 4BTUB 4NZLA 1K28D 1H9IE 1FAKH 4AYDA 1O3MA 2Z7FE 3KF2A 1C1ZA 2VB0A 2Q1JA 1GCTC 1H8DH 4Y6DA 1GHZA 3NXPA 1ETTH 3U98H 3ZIAD 1GHXH 3N7EA 2ZFFH 4MG3A 1FY5A 1NRQH 5FPTA 3FAOA 4GLYA 3U9AH 3UB0A 2GV6A 1UCYH 1GCTB 1O3KA 2Z9KA 2ZZUH 4K60A 2BDAA 3KYGA 1LHCH 7KMEH 3EA9A 1GBTA 2PKAB 2BMGB 3QZRA 1SGTA 3URCA 1QB1A 2QXIA 1TRNA 3RMLH 1D6RA 3FO8D 3RXHA 5DP8A 1K1IA 1D9IA 1TQ7B 1TPOA 1ZJDA 2BY9X 5F8XA 3LDXH 2B7DH 2OQ5A 3KHVA 4JZ1A 1C1MA 1NESE 3NRLA 2HLCA 4X1PU 3M7UA 3SBKA 4BAQB 1Q2WA 4I86A 2JJ1D 1DXPA 4YLQH 4X2YA 2WSSD 3O8EB 5JYIA 1ACBE 3RXIA 3KIDU 4UEHH 3KL6A 3ZZ5A 2OC1A 1VJ9U 4UONA 2RL0A 5FX5A 5C67A 1XUIA 5DN5A 3RXUA 1NU7B 3ZZCA 3FKSD 3KQDA 1TA6A 4UFFH 1H4WA 4ZROA 3VB6A 1N1LA 1HAVB 3RXVA 1HAZB 2PLXA 1EJAA 1OK3A 3E1XB 5E0GA 1YC0A 3W1EA 1FJSA 1LVMA 4Q2KA 3SO3A 1NBMD 2F9BH 1HGTH 3CI0J 5FX6A 4CREA 1O5DH 4NWLA 4TPIZ 2W6ID 4H42U 1Z1IA 2RKYA 3RXAA 4DT7B 1O38A 1XX9A 5GPIB 3KGPA 1B0EA
chains in the Genus database with same CATH topology
2OP9A 2J9NA 2SGFE 3RXKA 2MCYA 3ZZBA 2BDIA 1U5MA 1NZQH 1ZHPA 1EOLA 1H8IH 3MNBA 1TNJA 1GJ5H 3V12A 1QBVH 3ZVFA 1OWJA 3R0FA 1QNJA 4AFQA 1O2NA 1GI6A 1F0UA 5JB9S 4OS7A 2CG6A 1Y3XA 2G8TA 3NWUA 4I31A 1OXGA 4BOHA 4HI3A 1TX6A 2ESTE 1MCTA 4TYDA 2FOCA 1H04P 1AU8A 1AIXH 1C9TA 1W0YH 1IQLA 3A7TA 3GY4A 4IGDA 1ELDE 1GHVH 2UWOA 1ZSJA 4F49A 4ONTD 2KAIB 1J16A 5BRRE 4AYVB 1GHWH 4X1NU 1H9LB 2SGQE 1XKAC 2J34A 1QY6A 1CGJE 1A1RA 1O2UA 2A55A 3S9BA 1C5ZB 3NCLA 3GY7A 3RXSA 2KRIA 4BAKB 2Z9JA 3STIA 3TIUA 2F9VA 1HB0B 4Q7XA 4BNRA 3VXEH 4JK5A 2BY5X 2NU3E 1E35B 2BHGA 1G3BA 4AGJA 4Z6AH 3PLKA 4OGYA 1UJ1A 4FU9A 2VWLA 2ZDLA 3ESTA 1D3TB 1DPOA 2XWJI 2BD2A 7ESTE 2GCTC 1HFHA 1ANBA 1GBCA 3HKJB 3RXTA 4NSVA 4XOJA 1O3EA 4GPGA 2BD9A 1P06A 1YCPK 2ZDKA 1EASA 5HZPB 5AF9H 4LK4A 2NU4E 2ZGCA 1UTQA 1O2YA 1LKBA 3ZVCA 3M3VA 4CSYA 3A88A 1YPMH 2CKUA 3P8FA 2GCTB 1O37A 1QURH 1CT4E 1QQ4A 5LPFA 4NIXA 1A2CH 5IDKA 3RXQA 1KLJH 1S82A 1VR1H 3LGIA 4QT8C 2BDYA 2VINA 1INCA 1TABE 1V2VT 2BXTH 2XBWA 5DP4A 2PKSC 1XKBC 5DP6A 2JH0D 4IMZA 4KTUA 3HPTB 1MMJN 1P01A 3SNDA 3RM0H 1KDQB 3PO1C 5HGGA 1MZDA 1FY8E 1T8MA 1EZSC 5EXLA 3GY5A 1HCGA 1Z8JB 1ZGVA 2AS9A 1UTOA 2MCZA 4B74A 1BITA 2PKSB 2TGAA 4D8NA 2QV1A 3KZJA 1SC8U 3LOXA 1P2KA 3RC4A 3PO1B 2ZQ2A 4R0IA 4I7YH 1GJ6A 2ZA5A 1HYLA 3BEFB 4CH8B 1MTVA 5HYPA 2QAAA 4MNVA 1NROH 1QBOA 4K1SA 1GWAA 3G01A 1P04A 2BY8X 2YNBA 1P3EA 2GCHF 1BZXE 1GVZA 3LGVA 4OGXA 4BAHB 3INBC 2A5KA 2ILNA 1A4WH 1K1LA 5C5OA 3DUXH 2GTBA 3RXJA 2ZP0H 1SG8B 3A8BA 4JHSA 5LPRA 1OWDA 2H5CA 4I8GA 3MNCA 3P8NA 3SN8A 3E6PH 2ZKSA 2Z3CA 3T26A 1NY22 1UTJA 3MU4A 1SL3A 5GXPA 1MKXK 1D3PB 4YT6H 4B2CA 1O3GA 3SU6A 1A46H 3LGUA 4K69A 4B76A 1N6YA 2V8EA 1NT1A 4K3JA 5L6NH 4BTTB 1VITH 1BBRH 3ODFA 2FI4E 3BEIB 1UMAH 1O35A 3KQCA 1S0RA 1TOMH 1BJUA 5C5NA 2DE9A 4AFSA 1MBQA 1GVKB 1NRRH 4AORA 3A81A 2F91A 2XNIA 3UOPA 1XUHA 1TNIA 3PMBB 2J4IA 2TBSA 2G5NA 2ZDMA 5AHGH 5DKMA 1DLKB 3U1JB 3LGYA 4XDEA 1XMNB 4FUEA 2HPPH 1A5GH 1F0SA 1ZPCA 1T31A 1K1PA 3ZZDA 1CHOG 2WIIC 1AUJA 1FXYA 1LTOA 3RXCA 5TJXA 1UHBA 3EAJA 2M5TA 3JZ2B 3SUEA 1UTKA 2BTCE 2A4GA 2EI7A 3MNXA 3WY8A 4F4OC 4OS6A 2GT8A 2ZDVH 3BG4C 3FZZA 2R2MB 3VB5A 1O2XA 4X2VA 1D3QB 3PWBA 2W3IA 1EJNA 1ZPZA 2XYAA 1GI7B 4DVAU 3Q3YA 4X8SH 1ID5H 2HNTE 1C4U2 4FVDA 3RMNH 1K1JA 1C5QA 1XXFA 1JBUH 2WPJS 5SGAE 1S6HA 8ESTE 4ABDA 4DGJA 2Z94A 1AI8H 4NFEA 2C3SA 2ZFTA 6ESTA 2QCYA 4DIIH 1C5MD 3IU3I 4ZXYH 2VWNA 8KME2 2VVVA 4GCHG 3UOUA 2FOHA 1O3DA 1HIAB 1BOQA 1ZSLA 4X6PA 2Y5HA 3ELAH 4MPWA 2QA9E 3RXPA 4Q7YA 2FLBH 5FPYA 1TNKA 5EQSA 2JETC 5L2YH 1OS8A 3QO6A 1MBMA 1T32A 1C4V2 4IN2A 5HM9A 4LXBH 3LPRA 1ZHMA 1FIWA 1PPZA 5DJ7A 1PQAA 3LH3A 1GBAA 1J9CH 3EYDA 1EPTC 1O3NA 1Y3UA 1QL9A 1MTNC 2O39C 3ENSB 1GBEA 2ZU4A 4WVPE 3P8GA 4XBDA 2JETB 2HGTH 1GBHA 2BZMA 2A0QB 1CA0C 3TPIZ 1E5GA 1ARBA 5DG6A 1JOUB 5C2ZA 1B0FA 4OS4A 2BOHB 3MMGA 2GD4B 2G51A 1EPTB 1S0QA 1MTNB 1ZTJA 1L4DA 1DT2A 4UFDH 1GBDA 3E0PB 2ZPRA 1CA0B 1YPHC 3PTNA 1ARCA 3P70B 4KP0A 2RA0A 1P9SA 3O8RA 4M7GA 4FUBA 5FCRA 1UVSH 1T4VH 4ZKRU 5DPAA 3NK8A 1Y8TA 1P11E 4Y71A 3U69H 1D6WA 2P16A 2G55A 2VWOA 4Y7AA 3EGKH 3UNRA 5I46H 3GY8A 2OLGA 1QL8A 1FY1A 1TGSZ 2DE8A 2BQ6B 3P95A 2THFB 4AFUA 4K1EA 1C2DA 1QGFA 1EAUA 2FS8A 1O5FH 3IWMA 4H6SB 2VU8E 3HKIB 2C4FH 2FEQH 3QWCH 1TOCB 1W12U 1X7AC 2XC0A 1J8AA 2A7HA 2BZ6H 5ABWA 3MYWA 2VIDA 1CGHA 1PFXC 4GSOA 1YYY1 1RJXB 1IQIA 4FVBA 2A7CA 1MKWH 2ZTYA 1BTPA 1AUTC 1CQQA 1P09A 2BDGA 5FAHA 3ZVGA 1GBFA 3E3TA 4KGAA 4AYYB 1AO5A 3LC5A 1C5XB 2XWBF 2A4RA 2FX6A 1FMGA 2UUKB 1C2FA 1O3LA 1OYQA 1YPJH 3M7TA 5GCHF 4CRBA 1A5HA 2VNTA 3QDZB 4MVNA 1NC6A 2ZCKP 2WPMS 1AFQC 1GBMA 5FHTA 2AYWA 4CRGA 4B73A 3MH4A 4BAMB 3T5FH 1KIGH 3U1IB 1KY9A 1DITH 4NSYA 3TLOA 1HAXB 1F7ZA 1CU1A 2WPKS 3GYMA 1OP2A 3SNAA 1AFQB 1YPEH 4ISIH 2Y81A 1EZQA 1WCZA 1K1NA 1ELVA 1B7XB 3DFJA 1IOEA 2ZGJA 5FBEA 1NN6A 1EQ9A 1SRZA 1UTLM 1IHTH 4YLUA 1LCYA 3TITA 1C5OH 1L4ZA 2QY0A 1CT0E 1O2JA 5IYTA 2XCFA 3MO3A 4D9QA 2TGPZ 2Y7XA 1FIZA 2R3UA 2ZPSA 4NWKA 3UFAA 1XUGA 3ZD1A 1BDAA 1GMHG 5JB8S 1PQ7A 1IQMA 1GI8B 1C1RA 5C1YA 4RKJB 1FPHH 2D1JA 1SGEE 3T25A 1ABJH 2ZPQA 4NGAH 1V2ST 1CSOE 5AFYH 2BQ7B 4LOTA 1SGDE 2Z9GA 1ANDA 4X0WU 1THRH 3RP2A 1NWVA 1E37B 1SHYA 2FO9A 3EDXB 2OBQA 1AMHA 1SLXB 2ZTZA 4K8BA 1WQSA 2SGAA 2UUYA 1SLWB 2AGIX 1AFEH 2PGBB 3LJJA 2O8WA 1EP6A 2BX3A 3QX5H 1AWFH 1DLEA 3BIVH 2GZ7A 3JZ1B 4JZIA 2EHFA 5A8YA 2XRBA 3SQHE 5F8TA 1H1BA 2BD4A 3SNCA 1QJ7B 1UTNA 3SV7A 5DP3A 2BDBA 3RXBA 4WY3A 2AMPA 2NU2E 1GJ4H 1WTHD 1QQUA 1UVUH 4DY7B 1W7GH 4J2YB 1TX7A 3GCTG 3SU4A 1EOJA 3I77A 5A09A 1GMDG 3GXEA 3HK6B 4GVUA 2O9QA 3T2NA 2V3OH 3S69A 4OS2A 3M36A 3F1SB 4K1TA 1NFUA 5TCCA 3IX0A 2OC8A 4WWYA 2ODPA 3AAUA 2VIVA 1WSSH 2SGDE 1O36A 2YRAA 4WJG2 1ELEE 1KTTB 4NG9H 4ZUHA 5JBAS 3NUMA 5T6FA 3LU9B 1S6FA 4AYEA 1V2NT 4BANB 2I6SA 3DA9B 1YKTA 2AGGX 3FVFB 2GT7A 3SV9A 2O8MA 2QN5T 4I8LA 1LPKB 3BV9B 4ISNA 1K1MA 3MO6A 1EZXC 1BT7A 1PPFE 2GDEH 1Z1JA 4ABIA 2B5ID 1DWEH 1GBLA 1S5SA 2JH6D 2GVFA 4IBLH 2QXJA 1O2OA 1S83A 3KCGH 2XWAA 4LOYH 1SI5H 3RMMH 1GDQA 3BTWE 3MNSA 1OOKB 3LKWA 3GCHC 2FP7B 3ZVEA 1LPZB 1A61H 1RRKA 5C1UA 1QB6A 1QA0A 4JMYA 3C1KA 3RLYH 1YPHE 1G2LA 2Y6TA 1C1PA 3L89M 1V2LT 4RKOB 1NTPA 2A4QA 1P57B 3HGNA 1A3EH 1GL0E 3GCHB 2BLQA 3M5LA 1MU6B 3RU4T 1AE8H 3AW1A 3MU5A 3MO9A 3AAVA 1O2RA 1O39A 3PMAB 3PTBA 1SGFG 3A7XA 3S9AA 1S85A 5GWZA 1T7CA 1A0JA 3ZZ6A 1J15A 3GOVB 1RTFB 4CH2B 1XUKA 3F9GA 3F9FA 1AVWA 1CBWC 3RXMA 1LY2A 3SV2H 5DP7A 1AKSA 3UIRA 3PV4A 1TPGA 3UR6A 3TJOA 3ERBA 1KLTA 2W3KA 3P17H 1BJVA 4K5ZA 1O2KA 2FI5E 1P10A 2D2DA 3GYLB 3LC3A 4FXGH 1BTZA 1TALA 1ZSKA 1CBWB 1P2JA 4JZEH 3UWJH 1QHRB 1P12E 4YTAA 3A80A 1O2ZA 1GJ8B 1SFIA 2P3FH 1G4GA 2VJ1A 4YM9A 1BRBE 3VXFH 3I29A 3TJVA 4NZQA 4X8VH 4ZH8A 3Q76A 4ISOA 1SOZA 3QTOH 1MD8A 1HAPH 2FOMB 3CENA 1OWKA 3SI3H 1LVOA 3MU1A 3P92A 3RU4D 1V2PT 1QUBA 1HFDA 4BXSA 5L2ZH 1PYTD 1DSTA 1MCVA 4WMEA 3MQLA 2VIPA 2HALA 3MTYA 4AB9A 1GHYH 1GI1A 4FUIA 2ZGHA 3FP7E 2DUCA 3ZZ3A 1AWHB 1PQ8A 1DE7H 3MHWU 1CO7E 3NPSA 1XVOA 2A31A 5EG4A 4WF8A 3S0NA 1HDTH 4K8YA 1V2RT 1TPPA 5EQQA 4NA9H 1TNGA 2LPRA 2H1UA 3STJA 1MKXH 1VCWA 1GMHF 1UVTH 3HGPA 3SU1A 4NFFA 3ATWA 3BTDE 2XXLA 3MU8A 3TH4H 2W80A