1MD7A

Monomeric structure of the zymogen of complement protease c1r
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
328
structure length
304
Chain Sequence
b'DCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGAHDLRFVRLPVANPQACENWLDVFSQNMFCAGHPSLKQDACQGDAGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C1R COMPLEMENT SERINE PROTEASE
publication title Monomeric structures of the zymogen and active catalytic domain of complement protease c1r: further insights into the c1 activation mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 304
sequence length 328
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1md7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md7A03
4ZAEA 3SW0X 1SHYA 1LO6A 1Z8RA 2JETB 3NFPI 5A8YA 1C5NH 3A7TA 4JK5A 4AB9A 2IOTA 1MTNC 2XBYA 3GCHB 4WF8A 1BITA 1BMNH 1BMAA 2Z3EA 1UK4A 4FXGH 4Y7AA 2SFAA 5FBIA 4ESTE 1LHCH 2ZEBA 1A3EH 3I78A 3INBC 2G51A 5ABWA 2H5DA 1ELTA 1C5XB 1O2IA 4D9RA 1GHVH 1QB6A 3BIUH 4Y8ZA 1CT2E 1AD8H 3MMGA 4NIWA 1GG6B 1XUHA 2ZPSA 4MPUA 3FANA 2BD5A 1AKSB 1E35B 1HGTH 2CG6A 2ZTXA 1TPOA 3TPIZ 1S0RA 2ZFPH 5EXNA 5A2MH 2RA0A 1LPZB 2ZFTA 3VB7A 2GX4A 2GD4B 3T5FH 7LPRA 3HKJB 1XMNB 2AGEX 5C67A 2MCYA 1F5LA 1GHXH 1EX3A 3DUXH 1Y5AT 4A5WB 4JZEH 4A1TA 4K12A 4AG1A 1O2GH 4Q80A 3MH4A 4M7GA 1AUTC 2OD3B 3FVFB 2ZQ2A 3LKWA 2PFEA 1GI8B 3TGKE 1TRMA 3LPRA 3MWIU 3UOPA 7KMEH 1GPZA 2Y5FA 1THRH 2ZZUH 4DOQA 3TIUA 4KGAA 2ZDVH 5T6FA 3UUZA 1G3CA 1NFUA 4K5ZA 1SGFG 1P02A 4MDSA 5C1YA 2ZU2A 2HVXA 3ESTA 1QIXB 4DURA 1S84A 1TGSZ 3QTVH 1QY6A 4CRCA 2A2XH 1AFQB 1MU8B 2IZ3A 1AUJA 4INHA 4IN1A 1GHBF 1ZMLA 4X2XA 1BHXB 4YTAA 1MTVA 2Z9JA 2PW8H 3ODFA 1O37A 4FUJA 3O8CA 2PR3A 1WV7H 1MD8A 5I25A 2A5AA 2CMYA 1MKWK 1FIWA 4WMFA 4MPWA 1J14A 2PWXA 4I7YH 3ZVEA 1ETSH 1DUEA 1NROH 2NU4E 4YT6H 3LGIA 3MYWA 1GBEA 2H9TH 1KXCA 2THFB 2HPQH 1A61H 2OLGA 4R8TB 1TE0A 3GISB 5JPMH 3LT3A 3RC6A 1TGTA 3SI3H 1FBRA 4CBNA 1C1PA 2ANWA 2FX4A 4LK4A 3KN2A 1IQIA 2BQ6B 2QN5T 1GMHG 3SJ9A 3T2NA 1NU7B 1SFIA 4B75A 2VIOA 2PKAB 2OTVA 1PPHE 4TYDA 3ZD2A 1WYKA 2J94A 3KGPA 3ODDA 4ZXXH 1C5PA 3GICB 2FOCA 2PSYA 3JZ1B 3R0FA 1C2IA 3SHAH 1THPB 1D6WA 3PO1C 3STJA 3VXEH 4ZHAA 1NWVA 2FMJA 3TLOA 1ESBA 2OC1A 3TNTA 1ABIH 3PTNA 1YP9A 2SGPE 1AKSA 3ELAH 1CBWB 3ZRZA 1C5LH 2P3UB 2FO9A 1SGIB 1C1OA 3KQCA 2XBVA 3ATKA 1ELFA 4MTBA 3TH3H 1AWFH 3NWUA 1OXGA 4IS5A 5J4SA 1C4U2 2VWLA 5EQRA 2VB0A 1C9TA 1C4V2 2A31A 8KME2 2OP9A 4ABDA 4RN6A 4AFUA 1ELVA 3E0NB 4DG4A 1VGCC 3QUMP 5CE1A 1WTHD 3PLPA 1OKXA 2Z9GA 3Q3YA 2BLQA 2BMGB 2C8XB 1UCYH 1P2IA 4J38B 1KLJH 1QL8A 1T8LA 2HNTC 2YOLA 4XBCA 4HZHA 3WY8A 3ZZ7A 1CVWH 1C5WB 1YPGH 1HYLA 2BY9X 1ZJDA 1BOQA 3OXUD 1GDQA 1NRQH 1BHXF 4A5TS 3CS7A 1ZGIA 1O2HA 1C2DA 2G00A 1QJ1B 2ZFSA 4K2YA 5AFZH 1O2VA 3VGCC 2G5NA 1UTPA 3GDSA 1KDQB 1CSOE 4KP0A 1TNLA 3URCA 5AHGH 3ZZBA 1F5KU 2FZZA 1V2KT 1P9SA 1ZSJA 4NGAH 1GBBA 5DGJA 2Q6FA 2UWPA 1O36A 2V8EA 1V2TT 2B9LA 4UE7H 1LQEA 5JYIA 3LGVA 2Y6TA 1GMDG 3SJKA 1BA8B 1GHAG 5LPRA 4NIXA 1ZRBA 2FTMA 2IPHA 5BRRE 3VB3A 3ZZ3A 1Z7KA 4CHAC 1EASA 1YPHC 3RXCA 3VB5A 1ZOMA 1C1WH 1TFXA 2ZHWH 1QB9A 2O9QA 1O2PA 2EI6A 2WPJS 1HFDA 1FY1A 3D65E 4NG9H 2PKAA 3A88A 1SQOA 2AIQA 2BVXH 1LPGB 1SGEE 2XCNA 3LC5A 4TPIZ 1VITG 2Q6DA 1Z8GA 1KLTA 2CN0H 1E38B 1JWTA 1OWEA 4DW2U 1E88A 2XYAA 1BRAA 4CRBA 1UTOA 3U9AH 1UO6A 1IAUA 4WVPE 2FESH 4CR9A 5C5OA 1GHZA 3P8OA 2VVVA 4O3TA 1SQTA 1QRWA 2P8OC 1EPTC 4MLFB 1E0FD 1EAIA 5GPIB 1N6YA 2A55A 2XBWA 1LMWB 2VGCC 1Q2WA 2NWNA 3RMOH 3ZVFA 3T25A 3VB4A 1GJ6A 1QL7A 1ETRH 3BEIB 1DPOA 3MH7A 2UUYA 4E05H 2D1JA 5A8XA 1ZTJA 2FOGA 1GCTC 3A82A 3FZDA 4MQAA 3S9BA 2GMTB 3GY5A 4Y8YA 1K2I1 4IC5A 3LGWA 1K1OA 3OU0A 2BHGA 2DUCA 2Y80A 1VGCB 3LIWA 2PTCE 1W10U 2ZWLH 1TBZH 2GGVB 3GY4A 1CU1A 3A7XA 2ZDNA 4FUFA 2Z7FE 3M3SA 1V2NT 3RJ3D 2ZGBH 3PMJA 2VWOA 1MMJN 4IGDA 3BV9B 2ZDLA 5JBBS 2OQ5A 4BOHA 5BPEA 1QBVH 2G5VA 2ZGJA 3BSQA 3RXDA 3FP8E 3RP2A 1AI8H 4MPVA 1BBRE 5FCKA 2Y5GA 3A83A 1H9HE 1LQDB 2XRCA 3BTDE 2ALPA 1DXPA 1NC6A 3RXEA 4Q7ZA 5T3HA 3M61U 1QQ4A 3QZRA 1W7XH 5L2YH 1O3LA 2RKZA 1V2LT 1BMMH 3PYHA 5LH8A 1TPMA 4E7RG 3B9FH 2BD7A 5F8XA 3S9AA 4FU7A 1A5IA 4GLYA 2YBYA 2W80A 1KDQA 1O3FA 1ABJH 1W14U 2EC3A 1Y59T 2OC8A 5EQQA 1KY9A 4MNWA 5HYUB 1IHTH 1O3KA 1VR1H 3C27B 4WWYA 2F3CE 2AGIX 2BTCE 1F2SE 9LPRA 3T27A 4B71A 1EZUC 1TPSA 1A4WH 3PTBA 4BAMB 1OX1A 3TGJE 3ATIA 4CBOA 3RMLH 1DS2E 2GDEH 3P92A 4NA7A 1OK2A 2ZU5A 4IN2A 3TNSA 1D3DB 3RU4E 1OSSA 1N8OC 2BXTH 5LPFA 2PGBB 4B74A 4WMEA 4A1VA 2ZO3H 1EJNA 4OGYA 1HBTH 1SI5H 3QGNB 1LVMA 2F83A 1G4GA 8GCHG 1GCDA 1W7GH 3SU2A 5JDUB 1IQEA 1O39A 1C2EA 3FP6E 3PROA 1YPHE 1ZLRA 1TX6A 4VGCC 4JYTA 5EODA 1CGJE 5AFYH 1O3CA 5FCRA 3ZVAA 1Y3VA 2GKVE 5IYTA 4Z6AH 2F9OA 2XWBF 1EUFA 2GCHG 3SU1A 3RLYH 1C2LA 3RMMH 3LDXH 5TJXA 3RXUA 1QHRB 1FZZA 2ALVA 2I6QA 3T26A 1HAOH 1EPTB 3LONA 3I29A 1DSUA 1P8VC 1ZPBA 1OOKB 1W12U 2BDIA 3MTYA 1HCGA 1FUJA 4X8TH 2HLCA 1L1NA 5K0HA 2AS9A 3GY8A 2J34A 3B8JA 4E7NA 5LGOA 3BTHE 4JZIA 2BDGA 3QTOH 1WU1A 1G9IE 4Z0KA 3A89A 3RXFA 1GJ5H 4D7FA 1W3CA 1DXWA 1UCYK 3GCHC 5C3NA 3RXBA 3PMAB 5EPYA 1ZPZA 1O5AB 1LPKB 1T32A 1D9IA 4I8JA 2BY7X 1ZJKA 2VNTA 4NWKA 1O2MA 3MO9A 1YPLH 1C5MD 4Y6DA 2BOHB 1O3MA 1V2RT 3U1JB 2HNTF 1H9IE 1IQJA 4IC6A 2RCEA 2OC0A 2BY6X 1QJ7B 4YOGA 2VWMA 5GCHF 1EZSC 3BTTE 1SGRE 1B7XB 3GYLB 3L3TA 3SV8A 1NRPH 3SV6A 5AVDA 1EZQA 1CKLA 3PMHB 4X8UH 5EXLA 1ZZZA 2P3FH 3KEEA 1V2UT 1E37B 3CALA 3SQEE 3TK9A 4UFDH 5L30H 1QA7A 1OWHA 4K8BA 2CKUA 2NU2E 2QGRA 1KTSB 3SN8A 2AFQB 1F92A 5DP7A 2CGAA 3SGQE 1W0ZU 1D4PB 1HAHH 5J4QA 1NESE 5E0JA 5HM2A 1AZ8A 1VJ9U 1G2LA 1A46H 3O8EB 4X1PU 4XBBA 3DFLA 2M5TA 5EXMA 4K1SA 1WQSA 2GDDA 1C1VH 1TPGA 1NRSH 4IW4E 2VIWA 1KTTB 1WSSH 1O35A 1FN8A 1E5GA 3QX5H 5C2ZA 3RC4A 3FFGA 6GCHF 3RXSA 1XKAC 4WJG2 5GIBA 1N8OB 1LVYA 1F0SA 1PYTC 1QCPA 1VVCA 1UK3A 2C90B 3RXIA 3GCTG 2B5TB 4H6SB 4O03A 2BM2A 4ISOA 2OBQA 4J2YB 4GCHG 2BQ7B 1UVOA 3EGKH 1K21H 2B5ID 3T5OA 3SOSA 4DIIH 3MOCA 4VGCB 2Q6GA 1K28D 1JOUB 1EPTA 4CR5A 2RLPA 1OJYA 1MZDA 4BXSA 4LOYH 4Y76A 2A7CA 5JBAS 5T6DA 5A0BA 1BRCE 3IWMA 3RXQA 1K1NA 1S0QA 4KELA 2BZAA 3CENA 1ID5H 1SR5C 1CT0E 3A7VA 1HXEH 1XVOA 2CHAC 3QN7A 3A7ZA 1T8MA 1BB0B 3UWJH 3ZZ5A 2R0KA 3M7TA 1GI9B 2TIOA 1O2LA 1V6DA 3SU6A 3LGTA 2ZFQH 4WXVA 1OK1A 1V2PT 4FVDA 3ZZ9A 1HAPH 4MUCA 1GBTA 1V2ST 3RXMA 1EB1H 4NFEA 1CA8B 1DICA 5L2ZH 2W7SA 2FEQH 2GVFA 5E8EH 1THSH 3V0XA 4GPGA 2ZDKA 5FHTA 3M5MA 4LXBH 4AYDA 2TGTA 1Y3WA 4DY7B 1CBWC 4D76A 1TNJA 1GMDF 3A8AA 3EA9A 4X0WU 1UTNA 1Q31A 3F9GA 4DVAU 3DD2H 2TGAA 1CO7E 1VZQH 3UIRA 3MNXA 1HXFH 2C8ZB 1YKTA 2O39C 3QWCH 3SGAE 4I8GA 1GBHA 3QGJA 2XC5A 2KAIB 3O8DA 4NZQA 1K1MA 1J16A 1O3PB 1DY9A 1F0TA 5A0AE 5GWZA 1FY4A 1QQUA 4OS4A 1FNIA 1H2QP 1WTGH 4I8HA 4UFEH 1VITF 2C8YB 2PSXA 2WPMS 3RU4T 4B2AA 2A4GA 2ODYB 2QY0B 1SS2A 2ZDMA 3BF6H 4D8NA 5FPTA 4IMQA 3PV4A 1CQQA 2V35A 1XUJA 2UWLA 1O3IA 1FDPA 4NIVA 1HUTH 1CHOG 4ZKRU 3U8TH 3OY6U 1SOTA 3UOUA 1EZXC 3MI4A 1SHHB 5CHAB 1XM1A 1O2YA 1P2JA 1P01A 3M5LA 2G55A 3M7UA 1FPCH 2EHFA 1GGDC 1PPZA 4H42U 1NS3A 3SNAA 3ZVGA 3GY6A 2ZCHP 2UUJB 4QT8C 1O2RA 2RA3A 1HAXB 1W13U 1BTXA 2GT7A 3EQ0H 2H1UA 1GJ7B 2HPPH 2VWNA 3KHVA 1VCQA 2FX6A 3ZYDA 2QF3A 3MU1A 3ATLA 1GVLA 1MZAA 2Z94A 1TIOA 2AMDA 2P95A 3TVJB 3K6ZA 5FO8C 1GI1A 3UWIA 3E6PH 4B76A 2VH6A 3BG8A 1X7AC 1BCUH 2FOBA 1B0EA 1MUEB 1LDTT 1UTMA 4B1TA 1H04P 2VVCA 3VB6A 2AMPA 3C1KA 2CHAB 3P17H 4IBLH 1GJCB 4KKDA 1OP0A 1ELCA 1L0ZA 4X1RU 4RSPA 3SI4H 4TY7A 1FAKH 1RS0A 4BNRA 1P2QA 3O8BA 1OWJA 3IG6B 2ZGHA 2TPIZ 4JYVH 1M9UA 2J9NA 1C5YB 2VIQA 1YC0A 4WMDA 1ZTKA 3ZV8A 1QRXA 1TNHA 5ESBA 1WUNH 3SU0A 1ZTLA 1TA2A 1TNKA 1TOMH 1SSXA 2MCZA 2ZHFH 2BD8A 5HM9A 2ULLA 1Z8IB 2SNWA 1WAYB 5F8TA 4OS5A 6CHAC 4WY3A 1QR3E 3SO3A 2ZTZA 1OYTH 1AGJA 5HYOA 2YNBA 5C1XA 1QL9A 2V0BA 4YM9A 2JKHA 4H6TA 1AE5A 1H9LB 1O5CB 3OY5U 4OS1A 3FZZA 3RXVA 1NT1A 1KYNA 2WUCA 4U01A 1UOTP 1KXAA 2KAIA 3LH1A 4A92A 1O2SA 1TX7A 3IITA 4UD9H 1UTKA 3KXVA 1P03A 2FIRH 1GBDA 1W2KH 7GCHF 3MU0A 1MQ5A 3EJHA 1XVMA 1XX9A 2GMTC 1G30B 3SJOA 3JZ2B 4XOJA 2WPHS 3OYPA 3TH2H 1TRYA 3NXPA 2QY0A 4I8LA 1QA0A 1E8BA 2PTNA 2HGTH 1HFHA 1PPQA 2J38A 4CRDA 4GHTA 1SGYE 1NPMA 2NU0E 1EKBB 3IX0A 1A5GH 4BAOB 3SV9A 1V2QT 1GBAA 1D3TB 2ZHQH 3Q3KA 1BMLA 1BRBE 3U8OH 1KXDA 2V6NA 1GHWH 1S81A 4X2WA 2ZU4A 1YLDA 4AGJA 1IHSH 3I77A 1QO6A 4CH8B 2QA9E 1H8IH 1LHGH 2OCVB 2ERJA 3BTEE 4MG3A 3PMBB 3KQBA 2JH6D 3UNRA 3N7OA 5EQSA 4X1NU 1HJ9A 1AB9C 4Y0YE 2UWNA 1AVXA 1CT4E 3OTJE 3MU8A 4FU8A 4ABEA 3TJVA 1F5RA 1L1GA 2ZIQH 4Q7XA 1GGDB 1T31A 3TVJA 1AE8H 4YOIA 1IOEA 2OBOA 1O33A 3URDA 1O2ZA 1C5SA 2XC4A 3E90B 1TQ0B 2R3YA 4PROA 1DM4B 2F9VA 3LU9B 1OS8A 1EB2A 1TGNA 2XNIA 1HPGA 1ARBA 1HB0B 1L2EA 3MU5A 1BBRH 3E8LA 1Y3UA 3LH3A 3M5OA 1TMBH 2PKSC 5F8ZA 3MH5A 3UFAA 1AFEH 4JHSA 2FLRH 2C93B 4XFQA 1KIGH 4FUGA 1IQGA 5IDKA 3RDZA 1TMTH 3RMNH 3GOVB 4DIHH 2SNVA 2H9EH 4J1YA 1DWBH 1WCZA 1ZMJA 1QBNA 3AW1A 1UTLM 4JCNA 4R0IA 3W95A 4YESB 3SNCA 5DKMA 2FS8A 3QDZB 2A5KA 2ZF0H 3RXPA 2XBXA 2XXLA 5PTPA 4ABFA 2AIPA 1TBQH 1K9OE 1JRSA 3EA8A 2EEKA 2O8WA 3EAJA 1K1JA 2ZU3A 2ESTE 3B23B 1TPPA 3DA9B 6CHAB 1LVOA 5K7RA 1YCPH 3F1SB 2Z3CA 1O2KA 1PPEE 3R62A 2GP9B 1HAIH 1C1MA 1T8NA 2ANMH 2OINA 4HGCA 1GI4A 1V2WT 4NCYA 2LNCA 4OS2A 3FAOA 1E36B 3A8DA 2SGEE 4I31A 1C2GA 1O3NA 2GZ7A 1SGDE 1FONA 1OWDA 1FPHH 1GI6A 1UTJA 2FP7B 1F0RA 1C5RA 1EQ9A 5SGAE 4FUHA 4Q7YA 5EOKA 3SU3A 8ESTE 2XWJI 2UUKB 4GVUA 1YF4A 4K3JA 3CP7A 1HAYB 1IQKA 3TH4H 2AGGX 4DJZB 1IQHA 1AHTH 3SGBE 4SGAE 5FXLA 1SFQB 4NA8A 1LHEH 1UVUH 1P06A 3S9CA 1TBRH 1MH0A 4BAKB 2BDAA 8LPRA 4SGBE 2ODQA 4I33A 1SBWA 2QXIA 1GDUA 5DPAA 1MTSA 1UK2A 1AB9B 4FUDA 1ZHRA 3U8RH 4YOJA 1MKXK 1ZHMA 1BTPA 1DOJA 1GJDB 4BXWA 1YPJH 4JZFH 1TAWA 2F9NA 4X6PA 3E1XB 1UVPA 1IQFA 1XXFA 4KTCA 1P2OA 3AAUA 2EA3A 3M36A 9ESTA 4O9VA 4Y79A 5EGMA 1ELAA 2W81A 5I0QB 1QUBA 1ETTH 1B0FA 4CSYA 1FN6A 1F7ZA 4DGJA 2WV4A 1XKBC 3NPSA 3OP8A 1C1ZA 2Y81A 1AY6H 4Y0ZE 1P04A 2PKSB 1GJ4H 3GDVA 3UY9A 3GOVA 2A4QA 2ZFFH 1GVKB 2W26A 1DWEH 1NFWA 5A09A 1GBLA 1S5SA 4YO9A 1OJWA 1J8AA 4X8VH 4UONA 1RRKA 1GBKA 1NM6A 2FDAA 4AORA 4RKOB 1SVPA 1C5VA 1P2MA 5C1UA 1O5GH 3H7OA 1Z71A 5DP5A 2KRIA 1BJVA 1C5QA 1DVAH 4WH6A 2OQUA 1OPHB 1JXPA 2FOMB 1UVTH 2FXRA 3NUMA 4ZHLU 2A45B 1SQAA 2HWLB 2BX3A 1VITH 2ANYA 5DP4A 1GJ9B 4UFGH 4ASHA 1AZZA 2ZGCA 3MO3A 2A7JA 1SGFA 2VIPA 3UR6A 4B73A 5I46H 4O3UA 4WH8A 4AYEA 4U30A 2CF9H 3E3TA 3RU4D 1PPCE 1EP5A 1Y5UT 1MCVA 4K60A 3H7TA 3EDXB 1W0YH 1YCPM 3Q00A 2EC9H 4X6NA 4LZ4B 2GT8A 5DP6A 2WPKS 2ZECA 1TRNA 4NIYA 2A1DB 3TK6A 3D49H 2W3KA 2ZDAH 4FXGG 4AFQA 4OGXA 2O8TA 3Q77A 3RXLA 1NRNH 4JK6A 1C1QA 2Z3DA 3KL6A 1XUIA 3OEDC 4DJZA 1P2KA 1O2WA 2AH4X 1FJSA 1O32A 1TOCB 3F9HA 4B2BA 5B6OA 4DT7B 1FY5A 2HALA 2BD2A 4ISNA 2QIQA 3SBKA 4LOSA 2WPIS 3A87A 4Y8XA 1K1PA 1W8BH 2BVSH 2WV5A 3AASA 1UJ1A 3SV2H 5JB8S 1IQNA 1BZXE 2AMQA 4AFSA 1L4DA 1TABE 3ZV9A 4BANB 1O2NA 1Y8TA 4U32A 3UR9A 2BB4A 1O5EH 2ZCLP 4X6OA 2CF8H 3F9EA 1GMHF 1A0HB 2ZGXH 3PLKA 2LOJA 3M37A 4GUXA 2JGXA 2O8MA 4BTTB 1DLEA 1JBUH 1BBRK 2BD9A 3NK8A 2G4TA 3EA7A 1QBOA 2A4OA 1O2QA 2PLXA 3LC3A 1MAXA 4ABGA 4KTUA 5E0HA 6ESTA 3T28A 3A86A 1SOZA 1C1SA 2FLBH 3U69H 3EYDA 4AB8A 2F9BH 5CHAC 1RTKA 1A3BH 1RXPA 2RLQA 2JH0D 1C2KA 1YPKH 3UNQA 2RL0A 1AIXH 1C5TA 3SNBA 1CA0C 2BLVA 2FOEA 4K1EA 1ESAA 1KSNA 3MU4A 3TK5A 5TCAA 2XC0A 2ILNA 2Y7XA 1P05A 1SLXB 5EU8A 2XCFA 3BTWE 1UHBB 1JIMA 1O5FH 1SRZA 1P0SH 3SU5A 3ATMA 1B5GH 1H4WA 1YCPK 1GJAB 1DWCH 1GBMA 3F6UH 3RLWH 2Z9IA 1SGNE 2ZHEH 4FUEA 2HRVA 2BVRH 3ZD1A 3V7TA 3M7QA 5A0CA 3DT0H 1FMGA 4AN7A 1GJBB 1GKNA 1AVGH 3MO6A 1EAUA 5E2OA 3HKIB 1ORFA 1C5ZB 5JPMG 3QLPH 3SUEA 3LJOA 1BRUP 1SGCA 1CGHA 1FI8A 4YLQH 4ZROA 4C16A 3RUOA 3TJUA 1IQLA 2ZC9H 4INLA 1BTYA 4AGKA 5F03A 1ZR0A 4ZH8A 1P2NA 2J2UA 2A7HA 3MNBA 2IN2A 4NSVA 1GBCA 2F91A 2Y7ZA 4MPXA 1UMAH 1DUAA 5HYTB 1FIZA 2GCTC 3A8BA 3BG4B 3RXHA 2BYAX 4F4OC 2XRDA 1K1IA 3M3VA 2QV1A 5DO4H 4Y71A 2Q1JA 3R3GB 1HAVB 3W94A 2R9PA 1G37A 2ODPA 1BIOA 1G3EA 1PPBH 1G2MA 2IZ4A 1GL0E 1O31A 1LHDH 2UWOA 1ANDA 1GHAF 1ZMNA 2ZQ1A 1O3OA 1AMHA 1CGIE 2FI5E 2Y5HA 3KZJA 3LOXA 1DITH 1OK9A 1ELDE 1MBMA 3KCGH 1SPJA 1GI2A 2G4UA 2J95A 1P3CA 1QURH 1NU9A 1ZPCA 2R3UA 3K2UA 1O5DH 4ZKOU 3KF2A 2A2QH 1ELGA 1GJ8B 2ASUB 1NZQH 2TGPZ 1N1LA 3GY3A 2O8UA 4K1TA 4XDEA 4AOQA 3MHWU 2SGQE 4JMYA 2STBE 5HMAA 4ABAA 2V3OH 3SUGA 3LGYA 3A80A 1L4ZA 1TPNA 2QAAA 4Y11E 5DP9A 2BLWA 3BTQE 1DLKB 3UTUH 1MBQA 1RFNA 1SLWB 2A4RA 1MU6B 1C2FA 2BZMA 3G01A 1WQVH 1L1JA 2JH5D 1OP2A 2BDBA 1G36A 4BTUB 1GBJA 2V3HH 1NN6A 1ANCA 5EG4A 2DE8A 5ETXA 1CA0B 2P94A 5JBCS 1UHBA 4ISIH 1PQ8A 2DE9A 1KLIH 2ZNKH 1N6XA 3K9XB 1VVDA 3F68H 2A32A 2H9HA 1DANH 1JIRA 1W11U 5FX5A 4CREA 5LPEA 2AYWA 1H8DH 2P59A 2FS9A 1QRZA 1OJVA 1NO9H 1TYNA 2YRAA 2VINA 1JMOH 2NU3E 1O3GA 1P12E 2CV3A 1XXDA 2ZP0H 3ZZAA 4PZ5A 2QXHA 1Q3XA 2BXUH 5FX6A 3D62A 2FOFA 1GMCG 1EOLA 2JGWA 1MKXH 1EOJA 3IU3I 1ACBE 3A85A 1XUKA 2G7IA 1TALA 2RDLA 2F9PA 2ZHDA 5G4BA 2VIDA 1O0DH 3GY7A 2WPLS 1TNGA 1DT2A 2Z9KA 2VU8E 5HXFA 1FY8E 1NTPA 3ZVBA 3HGPA 3UQOA 3ITIA 1O30A 1U5MA 5GXPA 2TBSA 2W7UA 3T29A 3S69A 5GCHG 1C2HA 2FOHA 1ELBA 1ANBA 1AU8A 1OK3A 1BTWA 2WINI 1GHQB 3PM3A 2OUAA 1Z8JB 1DWDH 2PUQH 1S6FA 3DHKH 2ZKSA 3BTFE 3M3TA 1HAVA 4OS6A 1PYTD 1O3EA 4Q2KA 3HGNA 3M35A 2AERH 2GCTB 3AW0A 4AZ2B 4CRAA 2P16A 1C2JA 1EAXA 3PLBA 3GXEA 1T8OA 1SL3A 3SZNA 1CHGA 1V2JT 3TJOA 2BD3A 1RIWC 4X8SH 1MTNB 1OWIA 1O3BA 1ZSKA 1SGTA 4GSOA 1DDJA 1QFKH 2XWBI 1V2MT 3TGIE 4TPYA 1Z6JH 3ZZ8A 3E16B 1XUGA 2R0LA 3VXFH 1HDTH 2SGFE 4ZMAH 3MNSA 8GCHF 1EATA 1WOFA 1TNIA 3L6PA 4HI3A 1Z1JA 2GV7A 1ZGVA 6GCHG 1FQ3A 2FPZA 3V3MA 1TMUH 5C5NA 3EE0B 1C5OH 1DE7H 1O5BB 4B2CA 3H5CB 2A0QB 1NFXA 4FU9A 2WYJA 3UQVA 2OXSA 2GCHF 1O2TA 4ONTD 4FUIA 1MAYA 2P3TB 3E91A 1MCTA 3L33A 4XBDA 1MQ6A 3QZQA 1EP6A 1PJPA 3BIVH 1H03P 2OC7A 2WIIC 1LKAA 3A81A 4CRGA 3V12A 5E2PA 2H6MA 3A7WA 1BQYA 2D26C 2EI7A 4UDWH 3LJJA 2QC2A 4NSYA 1HRTH 6LPRA 3AAVA 2FYRA 1Z92B 2PUXB 3ENSB 3U98H 2F9UA 2G52A 3P70B 1HFIA 3SNEA 4JZ1A 1V2OT 4MVNA 2RKYA 2ZA5A 1Y3YA 1C2MA 1NRRH 3S0NA 1C4Y2 1YYY1 3BTKE 4X2VA 5F6MA 2AEIH 3P8NA 1G3BA 1SG8B 2C8WB 2FI3E 1A1RA 3D23A 3GCOA 4MNVA 2WYGA 1TWXB 1LKBA 3K65B 1AQ7A 3GY2A 1NFYA 1O2XA 1GBFA 1EAWA 3SHCH 1TPAE 4ISLA 1S82A 1YLCA 2WUBA 4FUBA 1O2UA 1S83A 1LTOA 2A5IA 1C1NA 1TGCA 1P3EA 4GHQA 1D3PB 1YBWA 4K69A 1UVSH 4NA9H 5H4IB 1V2VT 3QO6A 4ZH1D 1QB1A 2ZTYA 3SNDA 3SUDA 2FOAA 1PQAA 3OSYA 4D9QA 2VH0A 5E0GA 1HIAB 1F0UA 1HV7A 3ZZ4A 3F9FA 3RXJA 3GDUA 1O2JA 1QTFA 3ZZCA 7ESTE 1SB1H 4WXIA 3NKKA 1CE5A 1T7CA 2XWAA 1FLEE 1HAZB 3SQHE 4AFZA 3TU7H 4ZUHA 3LGUA 5JBTA 1LY2A 1GI3A 3PWCA 1PFXC 1PPFE 4YLUA 3HK6B 3MFJA 3U1IB 3MQLA 2YNAA 1AWHB 2P93A 3HPTB 3AVZA 4LOTA 1O2OA 1UTQA 2SGDE 1RIWB 3BEFB 4Y7BA 1SGQE 1FXYA 1BTUA 1UCYE 4UEHH 1S85A 4CRFA 2VJ1A 1EJAA 2BD4A 3Q76A 3PO1B 3GCTF 1ARCA 3KIDU 1QNJA 2TRMA 1A7SA 1HJ8A 1GHYH 2B7DH 2Y82A 2H2ZA 4GCHF 3SV7A 2QXGA 1G3DA 4X1SU 3RXGA 1DFPA 1V3XA 1HJAC 5EW1H 1C5UA 1O3DA 1PQ7A 1VCWA 4ZHMU 1GHBG 1TX8A 5FPYA 2GV6A 4E06H 1LCYA 4ISHH 5DP8A 1O9AA 2QF0A 2QCYA 1Z6EA 3BN9A 1K1LA 4TWWA 3ZZDA 4AG2A 2K1QA 1T4VH 1Y3XA 3UNSA 5DJ7A 4KTSA 3P95A 3RXKA 1FAXA 1RGQA 4A7IB 1BT7A 3HATH 4JZDH 3GYMA 1DX5M 4GAWA 1O3JA 1HAGE 4Y10E 2FM2A 3A84A 3GCNA 3KQEA 1O3HA 5FBEA 2QYIA 2HOBA 4YNXA 3RM2H 3UREA 1PPGE 1FY3A 4HTCH 5EPNA 3SU4A 4FUCA 5HYPA 1D3QB 1K22H 1MTWA 1H1BA 1P9UA 4INKA 4XSKU 1O34A 1KXFA 3CS0A 4A1XA 1QJ6B 4OS7A 1GBIA 2ZFRH 1TGBA 2HNTE 2BDCA 3L89M 4AYYB 1HCCA 1O3AA 1T4UH 3FP7E 2FWWA 1INCA 4TWYA 2XTTB 1QGFA 3DFJA 2FTLE 1G32B 4NWLA 4B2SA 5JB9S 1PQ5A 3NCLA 4ABJA 1OWKA 1BJUA 1HLTH 1Y5BT 5CMXH 2PV9B 5EW2H 1VCPA 1YPEH 4HFPB 5HZPB 3VGCB 2BY8X 5A8ZA 1QGBA 2FODA 1NY22 4I32A 2XRBA 2UUFB 4ABIA 3RC5A 3UPEA 3ERBA 2BOKA 1HIAA 1YPMH 3A8CA 4THNH 2C3SA 3RM0H 2IJOB 4K8YA 4AX9H 3SORA 2BLOA 5DP3A 1GKGA 4ABHA 2CXVA 1BUIA 4RKJB 2ANKH 1YGCH 4UFFH 2J4IA 4U2WA 1WBGB 1XUFA 4F49A 5AF9H 7GCHG 4DCDA 4CHAB 2W3IA 1P09A 3RXRA 4YT7H 4ZKNU 2NU1E 4X6MA 3RXAA 2ZG0H 4X1QU 2RG3A 4D7GA 4YZUA 3KNXA 2FI4E 2VVUA 3P6ZB 2BDHA 1SC8U 4TY6A 1P10A 1EJMA 3SJIA 3P8FA 1ZHPA 3S7KB 1CHOF 3BTME 1OP8A 3SJ8A 4IMZA 4NFFA 3ZVCA 5FAHA 3ZZ6A 2ZCKP 1KXBA 5TCCA 5FPSA 4MNYA 1HNEE 1E34B 2P8OB 3RXOA 3M5NA 4XE4A 5DK1A 3ZVDA 2ZU1A 2JRAA 1A0LA 5L6NH 1YM0A 2JETC 2GZ8A 4BTIB 2VGCB 3BG4C 3V13A 4JYUH 1AO5A 2FYQA 1MKWH 3PB1E 3Q3XA 4X2YA 5DG6A 4ZXYH 2J92A 1MD7A 1HJAB 1MTUA 5GDSH 3SW2B 1ANEA 1C1RA 1TB6H 4ABBA 5C20A 1GMCF 1EXFA 1GVZA 3OX7U 2Z6BD 1J15A 1GCTB 5ESTE 2XQWC 3TJNA 3BEUA 1LHFH 2BX4A 1SMFE 2BDYA 4B2RA 1KXEA 2W5EA 3VEQB 2BQWB 1SLVB 3HK3B 5GJ4B 2CG7A 1D6RA 2TGDA 3SUFA 4O97A 1GG6C 1P57B 1OYQA 3S7HB 3A7YA 2O8LA 4AYIA 1C9PA 1DY8A 2R2WU 1BTHH 1ELEE 3VFEA 2BY5X 4H4FA 3MH6A 1GI0A 2B8OH 4AYVB 5T6GA 3RXTA 3ATWA 1C1UH 2G8TA 2KMSA 4LZ1H 1Z1IA 3K6YA 1RTFB 2I6SA 3O8RA 1G4FA 3VPKA 1SGPE 4CH2B 2EI8A 2D8WA 1J17T 1IQMA 4BAHB 1VJAU 3QK1A 2Z9LA 1LVBA 1C1TA 1TA6A 1DSTA 1TLDA 3NZIA 1ZRKA 1GL1A 2LPRA 4AYMA 2VIVA 3M7PA 2R2MB 3STIA 1JRTA 2XW9A 3KQDA 3ZYEA 3TITA 4MNXA 1GWAA 1TONA 1ZYOA 1AFQC 1BDAA 4ZKSU 2PHBA 2SGAA 4FVBA 2H5CA 3PWBA 2GTBA 1TQ7B 2BZ6H 1GDNA 1RD3B 2PGQB 2QXJA 3E0PB 1O38A 2D2DA 1AN1E 1P11E 1A2CH 2ZPRA 4BAQB 2ZPQA 2CJIA 3MNCA 1U6QA 2GZ9A 1RJXB 1SLUB 4I8KA 1ESTA 1BTZA 1H2PP 1J9CH 3T62A 2C4FH 1S6HA 3BTGE 2G81E 1GI5A 4NZLA 1A0JA 1FV9A 2B0FA 2STAE 1ZSLA 1AVWA 1A5HA 1RTLA 2ZI2H 5HGGA 1GI7B 3P8GA 4A6LA
chains in the Genus database with same CATH superfamily
4ZAEA 3SW0X 1SHYA 1LO6A 2QF4A 1Z8RA 2JETB 3ZIAD 3NFPI 5A8YA 1C5NH 3A7TA 4JK5A 4AB9A 2IOTA 1MTNC 2XBYA 3GCHB 4WF8A 1BITA 1BMNH 1BMAA 2Z3EA 2XNDD 1UK4A 4FXGH 4Y7AA 2SFAA 5FBIA 4ESTE 1LHCH 2ZEBA 1A3EH 3I78A 3INBC 2G51A 5ABWA 2H5DA 1ELTA 1C5XB 1O2IA 4D9RA 1GHVH 1QB6A 3BIUH 4Y8ZA 1CT2E 1AD8H 3MMGA 4NIWA 1GG6B 1XUHA 2ZPSA 4MPUA 3FANA 2BD5A 1AKSB 1E35B 1HGTH 2CG6A 2ZTXA 1TPOA 3TPIZ 1S0RA 2ZFPH 5EXNA 5A2MH 2RA0A 1LPZB 2ZFTA 3VB7A 2GX4A 2GD4B 3T5FH 7LPRA 3HKJB 1XMNB 2AGEX 5C67A 2MCYA 1F5LA 1GHXH 1EX3A 3DUXH 1Y5AT 4A5WB 4JZEH 4A1TA 4K12A 4AG1A 1O2GH 4Q80A 3MH4A 4M7GA 1AUTC 2OD3B 3FVFB 2ZQ2A 3LKWA 2PFEA 1GI8B 3TGKE 1TRMA 3LPRA 3MWIU 3UOPA 7KMEH 1GPZA 2Y5FA 1THRH 2ZZUH 4DOQA 3TIUA 4KGAA 2ZDVH 5T6FA 3UUZA 1G3CA 1NFUA 4K5ZA 1SGFG 1P02A 4MDSA 5C1YA 2ZU2A 2J98B 2HVXA 3ESTA 1QIXB 4DURA 1S84A 1TGSZ 3QTVH 1QY6A 4TT3D 4CRCA 2A2XH 1AFQB 1MU8B 2IZ3A 1AUJA 4INHA 4IN1A 1GHBF 1ZMLA 4X2XA 1BHXB 4YTAA 1MTVA 2Z9JA 2PW8H 3ODFA 1O37A 4FUJA 3O8CA 2PR3A 1WV7H 1MD8A 2KX4A 5I25A 2A5AA 2CMYA 1MKWK 1FIWA 4XD7D 4WMFA 4MPWA 1J14A 2PWXA 4I7YH 3ZVEA 1ETSH 1DUEA 1NROH 2NU4E 4YT6H 3LGIA 3MYWA 1GBEA 2H9TH 1KXCA 2THFB 2HPQH 1A61H 2OLGA 4R8TB 1TE0A 3GISB 5JPMH 3UB0A 3LT3A 3RC6A 1TGTA 3SI3H 1FBRA 4CBNA 1C1PA 2ANWA 2FX4A 4LK4A 3KN2A 1IQIA 2BQ6B 2QN5T 1GMHG 3SJ9A 3T2NA 1NU7B 1SFIA 4B75A 2VIOA 2PKAB 2OTVA 1PPHE 4TYDA 3ZD2A 1WYKA 2J94A 3KGPA 3ODDA 4ZXXH 1C5PA 3GICB 2FOCA 2PSYA 3JZ1B 3R0FA 4Q63A 1C2IA 3SHAH 1THPB 1D6WA 3PO1C 3STJA 3VXEH 4ZHAA 1NWVA 2FMJA 3TLOA 3FN8A 1ESBA 2OC1A 5KGOA 3TNTA 1ABIH 3PTNA 1YP9A 2SGPE 1AKSA 3F2HA 3ELAH 1CBWB 3ZRZA 1C5LH 2P3UB 2PP6A 2FO9A 1SGIB 5EJZA 1C1OA 3KQCA 2XBVA 3ATKA 1ELFA 4MTBA 3TH3H 1AWFH 3NWUA 1OXGA 3H09A 4IS5A 5J4SA 1C4U2 2VWLA 5EQRA 2VB0A 1C9TA 1C4V2 2A31A 8KME2 2OP9A 4ABDA 4RN6A 4AFUA 1ELVA 3E0NB 5HIYA 4DG4A 1VGCC 3QUMP 5CE1A 1WTHD 3PLPA 1OKXA 2Z9GA 3Q3YA 2BLQA 2BMGB 2C8XB 1UCYH 1P2IA 4J38B 1KLJH 1QL8A 3SZEA 2QE7D 1T8LA 2HNTC 2J98A 2YOLA 4XBCA 4HZHA 3WY8A 3ZZ7A 1CVWH 1C5WB 1YPGH 1HYLA 2BY9X 1ZJDA 1BOQA 3OXUD 1GDQA 1NRQH 1BHXF 4A5TS 3CS7A 1ZGIA 1O2HA 1C2DA 2G00A 1QJ1B 2ZFSA 4K2YA 5AFZH 1O2VA 3VGCC 2G5NA 1UTPA 3GDSA 1KDQB 1CSOE 4KP0A 3FGTA 1TNLA 3URCA 5AHGH 3ZZBA 1F5KU 2FZZA 1V2KT 1P9SA 1ZSJA 4NGAH 1GBBA 5DGJA 2Q6FA 2UWPA 1O36A 2V8EA 1V2TT 2B9LA 4UE7H 1LQEA 5JYIA 3LGVA 2Y6TA 1GMDG 3SJKA 1BA8B 1GHAG 5LPRA 4NIXA 1FX0B 1ZRBA 3VWOA 2FTMA 2IPHA 5BRRE 3VB3A 2J97A 3ZZ3A 1Z7KA 4CHAC 1EASA 1YPHC 3RXCA 3VB5A 1ZOMA 1C1WH 1TFXA 2ZHWH 1QB9A 2O9QA 1O2PA 2EI6A 2WPJS 1HFDA 1FY1A 3D65E 4NG9H 2PKAA 3A88A 1SQOA 2AIQA 2BVXH 1LPGB 1SGEE 2XCNA 3LC5A 4TPIZ 1VITG 2Q6DA 1Z8GA 1KLTA 1E38B 1JWTA 2CN0H 1OWEA 4DW2U 1E88A 2XYAA 1BRAA 4CRBA 1UTOA 3U9AH 1UO6A 5C0UA 1IAUA 4WVPE 2FESH 4CR9A 5C5OA 5DN5A 1GHZA 2VVVA 3P8OA 4O3TA 1SQTA 1QRWA 2P8OC 1EPTC 4MLFB 1E0FD 1EAIA 5GPIB 1N6YA 2A55A 2XBWA 2CK3D 1LMWB 2VGCC 1Q2WA 2NWNA 3RMOH 3ZVFA 3T25A 3WW7A 3VB4A 1GJ6A 1QL7A 1ETRH 3BEIB 1DPOA 3MH7A 2UUYA 2KR7A 4E05H 2D1JA 5A8XA 1ZTJA 2FOGA 1GCTC 3A82A 3FZDA 4MQAA 3S9BA 2GMTB 3GY5A 4Y8YA 1K2I1 4IC5A 3LGWA 1K1OA 3OU0A 2BHGA 2DUCA 2Y80A 1VGCB 3LIWA 2PTCE 1W10U 2ZWLH 1TBZH 2GGVB 3GY4A 1CU1A 3A7XA 2ZDNA 4FUFA 2Z7FE 3M3SA 1V2NT 3RJ3D 2ZGBH 3PMJA 2VWOA 1MMJN 4IGDA 3BV9B 2ZDLA 5JBBS 2OQ5A 4BOHA 5BPEA 1QBVH 2G5VA 2ZGJA 3BSQA 3RXDA 3FP8E 3RP2A 1AI8H 4MPVA 1BBRE 5FCKA 2Y5GA 3A83A 1H9HE 1LQDB 2XRCA 3BTDE 2ALPA 1DXPA 1NC6A 1NBMD 3RXEA 4Q7ZA 5T3HA 3M61U 1QQ4A 3QZRA 1W7XH 5L2YH 1O3LA 2RKZA 1V2LT 1BMMH 3PYHA 5LH8A 1TPMA 4E7RG 3B9FH 4BWCA 5C0TA 2BD7A 5F8XA 3S9AA 4FU7A 1A5IA 4GLYA 2YBYA 2W80A 1KDQA 1O3FA 1ABJH 1W14U 2EC3A 1Y59T 2OC8A 5EQQA 1KY9A 4MNWA 5HYUB 1IHTH 1O3KA 1VR1H 3C27B 4WWYA 2F3CE 2AGIX 2BTCE 1F2SE 9LPRA 3T27A 4B71A 1EZUC 4HG6A 1TPSA 1A4WH 3PTBA 4BAMB 1OX1A 3TGJE 3ATIA 4CBOA 3RMLH 1DS2E 2GDEH 3P92A 4NA7A 1OK2A 2ZU5A 4IN2A 3TNSA 1D3DB 3RU4E 1OSSA 1N8OC 2BXTH 2LP6A 2PGBB 5LPFA 4B74A 4WMEA 3WSYA 4A1VA 2ZO3H 2JJ2D 1EJNA 3OAAD 4OGYA 1HBTH 1SI5H 3QGNB 1LVMA 2F83A 1G4GA 8GCHG 1GCDA 1W7GH 3SU2A 5JDUB 1IQEA 1O39A 1C2EA 3FP6E 2ZYCA 3PROA 1YPHE 1ZLRA 1TX6A 4VGCC 4JYTA 5EODA 1CGJE 5AFYH 1E1QD 1O3CA 5FCRA 2I2LA 4ZCNA 3ZVAA 1Y3VA 2GKVE 5IYTA 4Z6AH 2F9OA 2XWBF 1EUFA 2GCHG 3SU1A 3RLYH 1C2LA 3RMMH 3LDXH 5TJXA 3RXUA 1QHRB 1FZZA 2ALVA 2I6QA 3T26A 1HAOH 1EPTB 3LONA 3I29A 3KYFA 1DSUA 1P8VC 1ZPBA 1OOKB 1W12U 2BDIA 3MTYA 1HCGA 1FUJA 4X8TH 2HLCA 1L1NA 5K0HA 2AS9A 3GY8A 2J34A 3B8JA 4E7NA 5LGOA 3BTHE 4JZIA 2BDGA 3QTOH 1WU1A 1G9IE 4Z0KA 3A89A 3N99A 3RXFA 1GJ5H 4D7FA 1W3CA 1DXWA 1UCYK 3GCHC 4FETA 5C3NA 3RXBA 3PMAB 5EPYA 1ZPZA 1O5AB 3EE7A 1LPKB 1T32A 1D9IA 4I8JA 2BY7X 1ZJKA 2VNTA 4NWKA 1O2MA 5DN4A 3MO9A 1YPLH 1C5MD 4Y6DA 2BOHB 1O3MA 1V2RT 4P00A 3U1JB 2HNTF 1H9IE 1IQJA 4IC6A 2RCEA 2OC0A 2BY6X 1QJ7B 4YOGA 1EFRD 2VWMA 5GCHF 1EZSC 3BTTE 1SGRE 1B7XB 3GYLB 3L3TA 3NJAA 3SV8A 1NRPH 3SV6A 5AVDA 1EZQA 1CKLA 3PMHB 4X8UH 5EXLA 1ZZZA 2P3FH 3KEEA 1V2UT 1E37B 3CALA 3SQEE 3TK9A 4UFDH 5L30H 2YMSB 1QA7A 1OWHA 4K8BA 2CKUA 2NU2E 2QGRA 1KTSB 3SN8A 2AFQB 1F92A 5DP7A 2CGAA 3SGQE 1W0ZU 1D4PB 1HAHH 5J4QA 1NESE 5E0JA 5HM2A 1AZ8A 3DSGA 1VJ9U 1G2LA 1A46H 3O8EB 4X1PU 4XBBA 3DFLA 2M5TA 5EXMA 4K1SA 1WQSA 5CDFE 2GDDA 1C1VH 1TPGA 1NRSH 2WSSD 4IW4E 2VIWA 3U28C 1KTTB 1WSSH 1O35A 1FN8A 1E5GA 3QX5H 5C2ZA 3RC4A 3FFGA 6GCHF 3RXSA 1XKAC 4WJG2 5GIBA 1N8OB 1LVYA 1F0SA 1PYTC 1QCPA 1VVCA 1UK3A 2C90B 3RXIA 3GCTG 2B5TB 4H6SB 4O03A 2BM2A 4ISOA 2OBQA 4J2YB 4GCHG 2BQ7B 1UVOA 3EGKH 1K21H 2B5ID 3T5OA 3SOSA 4MSLA 4DIIH 3MOCA 4VGCB 2Q6GA 1K28D 1JOUB 3N7EA 1EPTA 4CR5A 2RLPA 1OJYA 1MZDA 4BXSA 4LOYH 4Y76A 2A7CA 5JBAS 5T6DA 5A0BA 1BRCE 3IWMA 3RXQA 1K1NA 1S0QA 4KELA 2BZAA 3CENA 1ID5H 1SR5C 1CT0E 3OE7D 3A7VA 1HXEH 1XVOA 2CHAC 2VBCA 3F2GA 3QN7A 3A7ZA 1T8MA 1BB0B 3UWJH 3ZZ5A 2R0KA 3M7TA 1GI9B 2TIOA 1O2LA 1V6DA 3SU6A 3LGTA 2ZFQH 4WXVA 1OK1A 1V2PT 4FVDA 2X2ZA 3ZZ9A 1HAPH 4MUCA 1GBTA 3CI0J 1V2ST 3RXMA 1EB1H 4NFEA 1CA8B 1DICA 5L2ZH 2W7SA 2FEQH 4B6FA 2GVFA 5E8EH 1THSH 3V0XA 4GPGA 2ZDKA 3WWBA 4F48B 5FHTA 3M5MA 4LXBH 4AYDA 2TGTA 1Y3WA 4DY7B 1CBWC 4D76A 1TNJA 1GMDF 3A8AA 3EA9A 4X0WU 1UTNA 1Q31A 3F9GA 4DVAU 3DD2H 2TGAA 1CO7E 1VZQH 3UIRA 3MNXA 1HXFH 2C8ZB 1YKTA 2O39C 3QWCH 3SGAE 4I8GA 1GBHA 3QGJA 2XC5A 2KAIB 3O8DA 4NZQA 2Y8TA 1K1MA 1J16A 5CHBA 1O3PB 1DY9A 1F0TA 5A0AE 5GWZA 1FY4A 1QQUA 4OS4A 1FNIA 1H2QP 1WTGH 4I8HA 4UFEH 1VITF 2C8YB 2PSXA 2WPMS 3RU4T 4B2AA 2A4GA 2ODYB 2QY0B 3N7DA 1SS2A 1OHHD 2ZDMA 3BF6H 4D8NA 5FPTA 4IMQA 1SQRA 3PV4A 5GNDA 1CQQA 2V35A 1XUJA 2UWLA 1O3IA 1FDPA 4NIVA 1HUTH 1CHOG 4ZKRU 3U8TH 3OY6U 1SOTA 3UOUA 2OK5A 1EZXC 3MI4A 1SHHB 5CHAB 1XM1A 1O2YA 1P2JA 1P01A 3M5LA 2G55A 3M7UA 1FPCH 2EHFA 1GGDC 1PPZA 4H42U 1NS3A 2HVYB 3SNAA 3ZVGA 3GY6A 2ZCHP 2UUJB 4QT8C 1O2RA 2RA3A 1HAXB 1W13U 4F55A 1BTXA 2GT7A 3EQ0H 2H1UA 1GJ7B 2HPPH 2VWNA 3KHVA 1VCQA 2FX6A 3ZYDA 2QF3A 3MU1A 3ATLA 1GVLA 1MZAA 2Z94A 1TIOA 2AMDA 2P95A 3TVJB 4YXWD 3K6ZA 5FO8C 1GI1A 3UWIA 3E6PH 4B76A 2VH6A 3BG8A 1X7AC 1BCUH 2FOBA 1B0EA 1MUEB 1LDTT 1UTMA 4B1TA 2GJGA 2AHME 1H04P 2VVCA 3VB6A 2AMPA 3C1KA 3VG8A 2CHAB 3P17H 4IBLH 1GJCB 4KKDA 1OP0A 1ELCA 1L0ZA 4X1RU 4RSPA 3SI4H 4TY7A 1FAKH 1RS0A 4BNRA 1P2QA 3O8BA 1OWJA 3IG6B 2ZGHA 2TPIZ 4JYVH 1M9UA 2J9NA 1C5YB 2VIQA 1YC0A 4WMDA 1ZTKA 3ZV8A 1QRXA 1TNHA 5ESBA 1WUNH 3SU0A 1ZTLA 1TA2A 1TNKA 1TOMH 1SSXA 2MCZA 2ZHFH 2BD8A 5HM9A 2ULLA 1Z8IB 2SNWA 1WAYB 3F0PA 5F8TA 4OS5A 6CHAC 4WY3A 1QR3E 3SO3A 2ZTZA 1OYTH 1AGJA 5HYOA 2YNBA 5C1XA 1QL9A 3OEED 2V0BA 4YM9A 2JKHA 1H8ED 1AE5A 1H9LB 4H6TA 5C17A 1O5CB 3OY5U 4OS1A 3FZZA 3RXVA 1NT1A 4APLA 1KYNA 2WUCA 4U01A 1UOTP 1KXAA 2KAIA 3LH1A 4A92A 1O2SA 1TX7A 3IITA 4UD9H 1UTKA 3KXVA 1P03A 4ACBA 2FIRH 1GBDA 1W2KH 4I86A 7GCHF 3MU0A 1MQ5A 3EJHA 1XVMA 1XX9A 2GMTC 1G30B 3SJOA 3JZ2B 4XOJA 2WPHS 3OYPA 3TH2H 1MABB 1TRYA 3NXPA 2QY0A 4I8LA 1QA0A 1E8BA 2PTNA 2HGTH 1HFHA 1PPQA 2J38A 4CRDA 4GHTA 1SGYE 1NPMA 2NU0E 1EKBB 3IX0A 1A5GH 4BAOB 3SV9A 1V2QT 1GBAA 1D3TB 2ZHQH 3Q3KA 1BMLA 1BRBE 3U8OH 1KXDA 2V6NA 1GHWH 1S81A 4X2WA 5IK2D 2ZU4A 1YLDA 4AGJA 1IHSH 3I77A 1QO6A 4CH8B 2QA9E 1H8IH 1LHGH 2OCVB 2ERJA 3BTEE 4MG3A 3PMBB 3KQBA 2JH6D 3UNRA 3N7OA 5EQSA 4X1NU 3FO8D 1HJ9A 1AB9C 4Y0YE 2UWNA 1AVXA 1CT4E 3OTJE 3MU8A 4FU8A 4ABEA 3TJVA 1F5RA 1L1GA 2ZIQH 4Q7XA 1GGDB 1T31A 3TVJA 1AE8H 4YOIA 1IOEA 2OBOA 2WZQA 1W0KD 1O33A 5FL7D 3URDA 3MQKC 1O2ZA 1C5SA 2XC4A 3E90B 1TQ0B 2R3YA 4PROA 1DM4B 2F9VA 3LU9B 1E1RD 2IPQX 1OS8A 1EB2A 1TGNA 2XNIA 1HPGA 1ARBA 1HB0B 1L2EA 3MU5A 1BBRH 3E8LA 1Y3UA 3LH3A 3M5OA 1TMBH 2PKSC 5F8ZA 3MH5A 3UFAA 1AFEH 4JHSA 2FLRH 2Y8RA 2C93B 4XFQA 1KIGH 4FUGA 1IQGA 3OEHD 5IDKA 3RDZA 1TMTH 1SKYE 3RMNH 3GOVB 4DIHH 2SNVA 2H9EH 4J1YA 1DWBH 1WCZA 1ZMJA 3F0OA 1QBNA 3AW1A 1UTLM 4JCNA 4R0IA 3W95A 4YESB 3SNCA 5DKMA 2FS8A 3QDZB 2A5KA 2ZF0H 3RXPA 2XBXA 2XXLA 5PTPA 4ABFA 2AIPA 1TBQH 1K9OE 1JRSA 3EA8A 2EEKA 2O8WA 3EAJA 1K1JA 2ZU3A 2ESTE 3B23B 1TPPA 3DA9B 5F53A 6CHAB 5HKKD 1LVOA 5K7RA 1YCPH 3F1SB 2Z3CA 2KM0A 2W6ID 1O2KA 1PPEE 3R62A 2GP9B 1HAIH 1C1MA 1T8NA 2ANMH 2OINA 4HGCA 1GI4A 1NBME 1V2WT 4NCYA 2LNCA 4OS2A 4RT0A 4FOUC 3FAOA 2J5UA 1E36B 3A8DA 2SGEE 4I31A 2IJD1 1C2GA 1O3NA 2GZ7A 1SGDE 1FONA 3F2FA 1OWDA 1FPHH 1GI6A 1UTJA 4DT4A 2FP7B 1F0RA 1C5RA 1EQ9A 1YWUA 5SGAE 4FUHA 5KEDA 4Q7YA 5EOKA 3SU3A 8ESTE 2XWJI 2UUKB 4GVUA 1YF4A 4K3JA 3CP7A 1HAYB 1IQKA 3TH4H 2AGGX 4DJZB 1IQHA 1AHTH 3SGBE 4SGAE 5FXLA 1SFQB 4NA8A 1LHEH 1UVUH 1P06A 3S9CA 1TBRH 2YMSC 1MH0A 4BAKB 2BDAA 8LPRA 4SGBE 2ODQA 4I33A 3OFND 1SBWA 2QXIA 1GDUA 5DPAA 1MTSA 1UK2A 1AB9B 4FUDA 1ZHRA 3U8RH 4YOJA 1MKXK 1ZHMA 1BTPA 1DOJA 1GJDB 4BXWA 1YPJH 4JZFH 1TAWA 2F9NA 4X6PA 3OTPA 3E1XB 1UVPA 1IQFA 1XXFA 4KTCA 1P2OA 3AAUA 2EA3A 3M36A 2M2AA 9ESTA 4O9VA 4Y79A 5EGMA 1ELAA 2W81A 5I0QB 1QUBA 1ETTH 1B0FA 4CSYA 1FN6A 1F7ZA 4DGJA 2WV4A 1XKBC 3NPSA 3OP8A 1C1ZA 2EQNA 2Y81A 1AY6H 4Y0ZE 1P04A 2PKSB 1GJ4H 3GDVA 3UY9A 3GOVA 2A4QA 2ZFFH 1GVKB 2W26A 1DWEH 1NFWA 2K0QA 5A09A 1GBLA 1S5SA 4YO9A 1OJWA 1J8AA 2RFKC 4X8VH 4UONA 1RRKA 1GBKA 1NM6A 2FDAA 4AORA 4RKOB 1SVPA 1C5VA 1P2MA 5C1UA 1O5GH 3H7OA 1Z71A 5DP5A 2KRIA 1BJVA 1C5QA 1DVAH 3W1EA 4WH6A 2OQUA 1OPHB 1JXPA 1S6LA 4Z1MD 2FOMB 1UVTH 2FXRA 3NUMA 4ZHLU 2A45B 1SQAA 5C94A 2HWLB 3FOAA 2BX3A 1VITH 2ANYA 5DP4A 1GJ9B 4UFGH 4ASHA 1AZZA 2ZGCA 3MO3A 2A7JA 1SGFA 2VIPA 3UR6A 4B73A 5I46H 4O3UA 4WH8A 4AYEA 4U30A 2CF9H 3E3TA 3RU4D 1PPCE 1EP5A 1Y5UT 1MCVA 4K60A 3H7TA 3EDXB 1W0YH 1YCPM 3Q00A 2EC9H 4X6NA 4LZ4B 2GT8A 5DP6A 2WPKS 2ZECA 1TRNA 4NIYA 2A1DB 3TK6A 3D49H 2W3KA 2ZDAH 4FXGG 4AFQA 4OGXA 2O8TA 3Q77A 3RXLA 1NRNH 4JK6A 1C1QA 2Z3DA 3F6KA 3KL6A 1XUIA 3OEDC 4DJZA 1P2KA 1O2WA 4RI0A 2AH4X 1FJSA 1O32A 1TOCB 3F9HA 4B2BA 5B6OA 4DT7B 1FY5A 2HALA 2BD2A 4ISNA 2QIQA 3SBKA 4LOSA 2WPIS 3A87A 4Y8XA 1K1PA 1W8BH 2BVSH 2WV5A 3AASA 1UJ1A 3SV2H 5JB8S 1IQNA 1BZXE 2AMQA 4AFSA 1L4DA 1TABE 3ZV9A 4BANB 1O2NA 1Y8TA 4U32A 3UR9A 2BB4A 1O5EH 2ZCLP 4X6OA 2CF8H 3F9EA 1GMHF 1A0HB 2ZGXH 3PLKA 2LOJA 3M37A 4GUXA 2JGXA 2O8MA 4BTTB 1DLEA 1JBUH 1BBRK 2BD9A 3NK8A 2G4TA 3EA7A 1QBOA 2A4OA 1O2QA 2PLXA 3LC3A 1MAXA 4ABGA 4KTUA 5E0HA 6ESTA 3T28A 3A86A 1SOZA 1C1SA 2FLBH 3U69H 3EYDA 4AB8A 2F9BH 5CHAC 1RTKA 1A3BH 1RXPA 2RLQA 2JH0D 1C2KA 1YPKH 3UNQA 2RL0A 1AIXH 1C5TA 3SNBA 1CA0C 2BLVA 2FOEA 4K1EA 1ESAA 1KSNA 3MU4A 3TK5A 5TCAA 2XC0A 2ILNA 2Y7XA 4ACAA 1P05A 2JIZD 1SLXB 5EU8A 2XCFA 3BTWE 1UHBB 1JIMA 1O5FH 1SRZA 1P0SH 3SU5A 3ATMA 1B5GH 1H4WA 1YCPK 1GJAB 1DWCH 1GBMA 3F6UH 3ZLDA 3RLWH 2Z9IA 5DN6D 1SGNE 2ZHEH 4FUEA 1VKYA 2HRVA 3KYGA 2BVRH 3ZD1A 2W6JD 3V7TA 3M7QA 5A0CA 3DT0H 1FMGA 4AN7A 1GJBB 1GKNA 1AVGH 3MO6A 1EAUA 5E2OA 3HKIB 1ORFA 3F3BA 1C5ZB 5JPMG 3QLPH 3SUEA 3LJOA 1BRUP 1SGCA 1CGHA 1FI8A 4YLQH 4ZROA 4C16A 3NRLA 3RUOA 3TJUA 1IQLA 2ZC9H 4INLA 1BTYA 4AGKA 5F03A 1ZR0A 4ZH8A 1P2NA 2J2UA 2A7HA 3MNBA 2IN2A 4NSVA 1GBCA 2F91A 2Y7ZA 4MPXA 1UMAH 2LELA 1DUAA 5HYTB 1FIZA 2GCTC 3A8BA 3BG4B 3RXHA 2BYAX 4F4OC 4Q4LA 2XRDA 1K1IA 3M3VA 2QV1A 5DO4H 4Y71A 2Q1JA 3R3GB 1HAVB 3W94A 2R9PA 1G37A 2ODPA 1BIOA 1G3EA 1PPBH 1G2MA 2IZ4A 1GL0E 4B6EA 1O31A 1LHDH 2UWOA 1ANDA 1GHAF 1ZMNA 2ZQ1A 1O3OA 1AMHA 1CGIE 2FI5E 2Y5HA 1UW7A 3KZJA 3LOXA 1DITH 1OK9A 1ELDE 1MBMA 3KCGH 1SPJA 1GI2A 2G4UA 2J95A 3FKSD 1P3CA 1QURH 1NU9A 1ZPCA 2R3UA 3K2UA 1O5DH 4ZKOU 3KQ5A 3KF2A 2A2QH 1ELGA 1GJ8B 2ASUB 1NZQH 2TGPZ 1N1LA 1W0JD 2O8UA 3GY3A 4K1TA 4XDEA 3MHWU 4AOQA 2SGQE 4JMYA 2STBE 5HMAA 4ABAA 2V3OH 4OM9A 3SUGA 3LGYA 3A80A 1L4ZA 1TPNA 2QAAA 4Y11E 5DP9A 2BLWA 3BTQE 1DLKB 3UTUH 3DSOA 1MBQA 1RFNA 1SLWB 2A4RA 1MU6B 1C2FA 2BZMA 3G01A 1WQVH 1L1JA 2JJ1D 2JH5D 1OP2A 2BDBA 1G36A 4BTUB 1GBJA 2V3HH 1NN6A 1ANCA 5EG4A 2DE8A 5ETXA 1CA0B 2P94A 5JBCS 1WXRA 1UHBA 4ISIH 1PQ8A 2DE9A 1KLIH 2ZNKH 5KECA 1N6XA 3K9XB 1VVDA 3F68H 2A32A 2H9HA 1BMFD 1DANH 1JIRA 1W11U 5FX5A 4CREA 5LPEA 2AYWA 1H8DH 2P59A 2FS9A 1QRZA 1OJVA 1NO9H 1TYNA 2YRAA 2VINA 1JMOH 2NU3E 1O3GA 1P12E 2CV3A 1XXDA 2ZP0H 3ZZAA 4PZ5A 2QXHA 1Q3XA 2BXUH 5FX6A 2XOKD 2FOFA 3D62A 1GMCG 1EOLA 2JGWA 1MKXH 1EOJA 3IU3I 1ACBE 3A85A 1XUKA 2G7IA 1TALA 2RDLA 3K3TA 2F9PA 2ZHDA 5G4BA 2VIDA 1O0DH 3GY7A 2WPLS 1TNGA 1DT2A 2Z9KA 2VU8E 5HXFA 1FY8E 1NTPA 3ZVBA 3HGPA 3UQOA 3ITIA 1O30A 1U5MA 5GXPA 1WDIA 2TBSA 2W7UA 3T29A 3S69A 1KMHB 5GCHG 1C2HA 2FOHA 1ELBA 1ANBA 1AU8A 1OK3A 1BTWA 2WINI 1GHQB 3PM3A 2OUAA 1Z8JB 1DWDH 2PUQH 1S6FA 3DHKH 2ZKSA 3BTFE 3M3TA 1HAVA 4OS6A 1PYTD 3AK5A 1O3EA 4Q2KA 3HGNA 3M35A 2AERH 2GCTB 3AW0A 4AZ2B 3PRBA 4CRAA 4RT1A 2P16A 1C2JA 1EAXA 3PLBA 3GXEA 1T8OA 1SL3A 3SZNA 1CHGA 1V2JT 3TJOA 4YIZA 2BD3A 1RIWC 4X8SH 2WPDD 1MTNB 1OWIA 3DCLA 1O3BA 1ZSKA 1SGTA 1E79D 4XRNA 4GSOA 1DDJA 2K8IA 1QFKH 2XWBI 1V2MT 3TGIE 4TPYA 1Z6JH 4TSFD 3ZZ8A 3E16B 1XUGA 2R0LA 3VXFH 1HDTH 2KZ4A 2SGFE 2QF5A 3MNSA 4ZMAH 8GCHF 1EATA 1WOFA 1YY3A 1TNIA 3L6PA 4HI3A 3DSPA 1Z1JA 2GV7A 1ZGVA 6GCHG 1FQ3A 2FPZA 3V3MA 1TMUH 5C5NA 3EE0B 1C5OH 1DE7H 1O5BB 4B2CA 3H5CB 2A0QB 1NFXA 4AC9A 4FU9A 2WYJA 3UQVA 2Y8SA 2OXSA 2GCHF 1O2TA 4ONTD 4FUIA 1MAYA 2P3TB 3E91A 1MCTA 2V7QD 3L33A 4XBDA 1MQ6A 3UAIC 3QZQA 2KFWA 1EP6A 4M9FA 1PJPA 3BIVH 1H03P 2OC7A 2WIIC 1LKAA 3A81A 4CRGA 3V12A 5E2PA 2H6MA 3A7WA 1BQYA 2D26C 2EI7A 4UDWH 3LJJA 2QC2A 4NSYA 1HRTH 6LPRA 3AAVA 2FYRA 1Z92B 2PUXB 3ENSB 3U98H 2F9UA 2G52A 3P70B 2KCPA 1HFIA 3SNEA 4JZ1A 1V2OT 4MVNA 2RKYA 2ZA5A 3SYJA 1Y3YA 1C2MA 1NRRH 3S0NA 1C4Y2 1YYY1 3BTKE 4X2VA 5F6MA 2AEIH 3P8NA 1G3BA 1SG8B 5EJ1A 2C8WB 2FI3E 1A1RA 3D23A 3GCOA 4MNVA 2WYGA 1TWXB 2KCOA 1LKBA 3K65B 1AQ7A 3GY2A 1NFYA 1O2XA 1GBFA 1EAWA 3SHCH 1TPAE 4ISLA 1S82A 1YLCA 2WUBA 4FUBA 1O2UA 1S83A 1LTOA 2A5IA 1C1NA 1TGCA 3FGRA 1P3EA 4GHQA 1D3PB 1YBWA 4K69A 1UVSH 4NA9H 5H4IB 1V2VT 1RLHA 3QO6A 4ZH1D 1QB1A 2ZTYA 3SNDA 3SUDA 2FOAA 1PQAA 3OSYA 2RDEA 4D9QA 2VH0A 5E0GA 1HIAB 1F0UA 1K0HA 1HV7A 3ZZ4A 3F9FA 3RXJA 3GDUA 1O2JA 1QTFA 3ZZCA 3PRDA 7ESTE 1SB1H 4WXIA 3NKKA 1CE5A 1T7CA 2XWAA 1FLEE 1HAZB 3CNRA 3SQHE 4AFZA 3TU7H 4ZUHA 3LGUA 5JBTA 1LY2A 1GI3A 3PWCA 1PFXC 1PPFE 4YLUA 3HK6B 3MFJA 3GS9A 3U1IB 3MQLA 2YNAA 1AWHB 2P93A 3HPTB 2L74A 5T1VA 3AVZA 4LOTA 1O2OA 1UTQA 2SGDE 1RIWB 3BEFB 4Y7BA 1SGQE 1FXYA 1BTUA 1UCYE 4UEHH 1S85A 4CRFA 2VJ1A 1EJAA 2BD4A 3Q76A 3PO1B 3GCTF 1ARCA 3KIDU 1QNJA 2TRMA 1A7SA 1HJ8A 1GHYH 2B7DH 2Y82A 2H2ZA 4GCHF 3SV7A 2QXGA 3WSXA 1G3DA 4X1SU 3RXGA 1DFPA 1V3XA 1HJAC 5EW1H 1C5UA 1O3DA 1PQ7A 1VCWA 4ZHMU 1GHBG 1TX8A 5FPYA 2GV6A 5EIYA 4E06H 1LCYA 4ISHH 5DP8A 1O9AA 2QF0A 2QCYA 1Z6EA 3BN9A 1K1LA 4TWWA 3ZZDA 4AG2A 2K1QA 1T4VH 1Y3XA 3UNSA 5DJ7A 4KTSA 3P95A 3RXKA 1FAXA 1RGQA 4A7IB 1BT7A 3HATH 4JZDH 3GYMA 1DX5M 4GAWA 1O3JA 1HAGE 4Y10E 2FM2A 3A84A 3GCNA 3KQEA 2F43B 1O3HA 5FBEA 2QYIA 2HOBA 4YNXA 3RM2H 3UREA 1PPGE 1FY3A 4HTCH 5EPNA 3SU4A 4FUCA 2V3MA 5HYPA 1D3QB 1K22H 1MTWA 2F4LA 1H1BA 1P9UA 4INKA 4XSKU 2L6OA 1O34A 1KXFA 3CS0A 4A1XA 1QJ6B 4OS7A 1GBIA 2ZFRH 1TGBA 2HNTE 3PV2A 2BDCA 3L89M 4AYYB 1HCCA 1O3AA 1T4UH 3FP7E 2FWWA 4N7EA 1INCA 4TWYA 2XTTB 1QGFA 3DFJA 2FTLE 1G32B 4NWLA 4B2SA 5JB9S 1PQ5A 3NCLA 4ABJA 1OWKA 3ZLEA 1BJUA 1HLTH 1Y5BT 5CMXH 2PV9B 5EW2H 1VCPA 1YPEH 4HFPB 5HZPB 3VGCB 2BY8X 5A8ZA 1QGBA 2FODA 1NY22 4I32A 2XRBA 2UUFB 4ABIA 3RC5A 3UPEA 3ERBA 2BOKA 1HIAA 1YPMH 3A8CA 4THNH 2C3SA 3RM0H 2IJOB 4K8YA 4AX9H 3SORA 2BLOA 5DP3A 1GKGA 4ABHA 2CXVA 1BUIA 4RKJB 2ANKH 1YGCH 4UFFH 2J4IA 4U2WA 1WBGB 1XUFA 4F49A 5AF9H 7GCHG 2WV9A 4DCDA 4CHAB 2W3IA 1P09A 3RXRA 4YT7H 4ZKNU 2NU1E 4X6MA 3RXAA 2ZG0H 5B6LA 4X1QU 2RG3A 1COWD 4D7GA 4YZUA 3KNXA 2FI4E 2VVUA 3P6ZB 2BDHA 1SC8U 4TY6A 1P10A 1EJMA 3SJIA 3P8FA 1ZHPA 3S7KB 1CHOF 3BTME 1OP8A 3SJ8A 4IMZA 4NFFA 3ZVCA 5FAHA 2JDID 3ZZ6A 2ZCKP 1KXBA 5TCCA 5FPSA 4MNYA 1HNEE 1E34B 2P8OB 3RXOA 3M5NA 4XE4A 5DK1A 1YLNA 3ZVDA 2ZU1A 2JRAA 1A0LA 5L6NH 1YM0A 2JETC 2GZ8A 4BTIB 2VGCB 3BG4C 3V13A 4JYUH 1AO5A 2FYQA 1MKWH 3PB1E 3Q3XA 4X2YA 5DG6A 4ZXYH 2J92A 1MD7A 1HJAB 1MTUA 5GDSH 3SW2B 1ANEA 1C1RA 1H8HD 1TB6H 4ABBA 5C20A 1GMCF 1EXFA 1GVZA 2KCAA 3OX7U 2Z6BD 1J15A 1GCTB 2HLDD 5EJLA 5ESTE 2XQWC 3TJNA 3BEUA 1LHFH 2BX4A 1SMFE 2BDYA 4B2RA 1KXEA 2W5EA 3VEQB 2BQWB 1SLVB 3HK3B 5GJ4B 2CG7A 1D6RA 2TGDA 3SUFA 4O97A 1GG6C 5DSFA 1P57B 1OYQA 3S7HB 3A7YA 2O8LA 4AYIA 1C9PA 1DY8A 2R2WU 1BTHH 1ELEE 3VFEA 2BY5X 4H4FA 3MH6A 1GI0A 2B8OH 4AYVB 5T6GA 3RXTA 3ATWA 1C1UH 2G8TA 2KMSA 4LZ1H 1Z1IA 3K6YA 1RTFB 2I6SA 3O8RA 4P02A 1G4FA 3VPKA 1SGPE 4CH2B 2EI8A 2D8WA 1J17T 1IQMA 2EY4C 4BAHB 1VJAU 3QK1A 2Z9LA 1LVBA 1C1TA 1TA6A 1DSTA 1TLDA 3NZIA 1ZRKA 1GL1A 2LPRA 4AYMA 2VIVA 3M7PA 2R2MB 3STIA 1JRTA 2XW9A 2WHXA 3KQDA 3ZYEA 3TITA 4MNXA 1GWAA 5HIZA 4ASUD 1TONA 3WWFA 1ZYOA 1AFQC 1BDAA 4ZKSU 2YMSD 2PHBA 2SGAA 4FVBA 2H5CA 3PWBA 2GTBA 1TQ7B 2BZ6H 1GDNA 1RD3B 2KCYA 2PGQB 2QXJA 3PV5A 3E0PB 1O38A 2D2DA 1AN1E 1P11E 1A2CH 2ZPRA 4BAQB 2ZPQA 2CJIA 3MNCA 1U6QA 2GZ9A 1RJXB 1SLUB 4I8KA 1ESTA 1BTZA 1H2PP 1J9CH 3T62A 2C4FH 1S6HA 3BTGE 2G81E 1GI5A 4NZLA 1A0JA 1FV9A 1QZ8A 2B0FA 4PO7A 2STAE 1ZSLA 1AVWA 1A5HA 1RTLA 2ZI2H 5HGGA 1GI7B 3P8GA 4A6LA
chains in the Genus database with same CATH topology
4ZAEA 3SW0X 1SHYA 1LO6A 1Z8RA 2JETB 3NFPI 5A8YA 1C5NH 3A7TA 4JK5A 4AB9A 2IOTA 1MTNC 2XBYA 3GCHB 4WF8A 1BITA 1BMNH 1BMAA 2Z3EA 1UK4A 4FXGH 4Y7AA 2SFAA 5FBIA 4ESTE 1LHCH 2ZEBA 1A3EH 3I78A 3INBC 2G51A 5ABWA 2H5DA 1ELTA 1C5XB 1O2IA 4D9RA 1GHVH 1QB6A 3BIUH 4Y8ZA 1CT2E 1AD8H 3MMGA 4NIWA 1GG6B 1XUHA 2ZPSA 4MPUA 3FANA 2BD5A 1AKSB 1E35B 1HGTH 2CG6A 2ZTXA 1TPOA 3TPIZ 1S0RA 2ZFPH 5EXNA 5A2MH 2RA0A 1LPZB 2ZFTA 3VB7A 2GX4A 2GD4B 3T5FH 7LPRA 3HKJB 1XMNB 2AGEX 5C67A 2MCYA 1F5LA 1GHXH 1EX3A 3DUXH 1Y5AT 4A5WB 4JZEH 4A1TA 4K12A 4AG1A 1O2GH 4Q80A 3MH4A 4M7GA 1AUTC 2OD3B 3FVFB 2ZQ2A 3LKWA 2PFEA 1GI8B 3TGKE 1TRMA 3LPRA 3MWIU 3UOPA 7KMEH 1GPZA 2Y5FA 1THRH 2ZZUH 4DOQA 3TIUA 4KGAA 2ZDVH 5T6FA 3UUZA 1G3CA 1NFUA 4K5ZA 1SGFG 1P02A 4MDSA 5C1YA 2ZU2A 2HVXA 3ESTA 1QIXB 4DURA 1S84A 1TGSZ 3QTVH 1QY6A 4CRCA 2A2XH 1AFQB 1MU8B 2IZ3A 1AUJA 4INHA 4IN1A 1GHBF 1ZMLA 4X2XA 1BHXB 4YTAA 1MTVA 2Z9JA 2PW8H 3ODFA 1O37A 4FUJA 3O8CA 2PR3A 1WV7H 1MD8A 5I25A 2A5AA 2CMYA 1MKWK 1FIWA 4WMFA 4MPWA 1J14A 2PWXA 4I7YH 3ZVEA 1ETSH 1DUEA 1NROH 2NU4E 4YT6H 3LGIA 3MYWA 1GBEA 2H9TH 1KXCA 2THFB 2HPQH 1A61H 2OLGA 4R8TB 1TE0A 3GISB 5JPMH 3LT3A 3RC6A 1TGTA 3SI3H 1FBRA 4CBNA 1C1PA 2ANWA 2FX4A 4LK4A 3KN2A 1IQIA 2BQ6B 2QN5T 1GMHG 3SJ9A 3T2NA 1NU7B 1SFIA 4B75A 2VIOA 2PKAB 2OTVA 1PPHE 4TYDA 3ZD2A 1WYKA 2J94A 3KGPA 3ODDA 4ZXXH 1C5PA 3GICB 2FOCA 2PSYA 3JZ1B 3R0FA 1C2IA 3SHAH 1THPB 1D6WA 3PO1C 3STJA 3VXEH 4ZHAA 1NWVA 2FMJA 3TLOA 1ESBA 2OC1A 3TNTA 1ABIH 3PTNA 1YP9A 2SGPE 1AKSA 3ELAH 1CBWB 3ZRZA 1C5LH 2P3UB 2FO9A 1SGIB 1C1OA 3KQCA 2XBVA 3ATKA 1ELFA 4MTBA 3TH3H 1AWFH 3NWUA 1OXGA 4IS5A 5J4SA 1C4U2 2VWLA 5EQRA 2VB0A 1C9TA 1C4V2 2A31A 8KME2 2OP9A 4ABDA 4RN6A 4AFUA 1ELVA 3E0NB 4DG4A 1VGCC 3QUMP 5CE1A 1WTHD 3PLPA 1OKXA 2Z9GA 3Q3YA 2BLQA 2BMGB 2C8XB 1UCYH 1P2IA 4J38B 1KLJH 1QL8A 1T8LA 2HNTC 2YOLA 4XBCA 4HZHA 3WY8A 3ZZ7A 1CVWH 1C5WB 1YPGH 1HYLA 2BY9X 1ZJDA 1BOQA 3OXUD 1GDQA 1NRQH 1BHXF 4A5TS 3CS7A 1ZGIA 1O2HA 1C2DA 2G00A 1QJ1B 2ZFSA 4K2YA 5AFZH 1O2VA 3VGCC 2G5NA 1UTPA 3GDSA 1KDQB 1CSOE 4KP0A 1TNLA 3URCA 5AHGH 3ZZBA 1F5KU 2FZZA 1V2KT 1P9SA 1ZSJA 4NGAH 1GBBA 5DGJA 2Q6FA 2UWPA 1O36A 2V8EA 1V2TT 2B9LA 4UE7H 1LQEA 5JYIA 3LGVA 2Y6TA 1GMDG 3SJKA 1BA8B 1GHAG 5LPRA 4NIXA 1ZRBA 2FTMA 2IPHA 5BRRE 3VB3A 3ZZ3A 1Z7KA 4CHAC 1EASA 1YPHC 3RXCA 3VB5A 1ZOMA 1C1WH 1TFXA 2ZHWH 1QB9A 2O9QA 1O2PA 2EI6A 2WPJS 1HFDA 1FY1A 3D65E 4NG9H 2PKAA 3A88A 1SQOA 2AIQA 2BVXH 1LPGB 1SGEE 2XCNA 3LC5A 4TPIZ 1VITG 2Q6DA 1Z8GA 1KLTA 2CN0H 1E38B 1JWTA 1OWEA 4DW2U 1E88A 2XYAA 1BRAA 4CRBA 1UTOA 3U9AH 1UO6A 1IAUA 4WVPE 2FESH 4CR9A 5C5OA 1GHZA 3P8OA 2VVVA 4O3TA 1SQTA 1QRWA 2P8OC 1EPTC 4MLFB 1E0FD 1EAIA 5GPIB 1N6YA 2A55A 2XBWA 1LMWB 2VGCC 1Q2WA 2NWNA 3RMOH 3ZVFA 3T25A 3VB4A 1GJ6A 1QL7A 1ETRH 3BEIB 1DPOA 3MH7A 2UUYA 4E05H 2D1JA 5A8XA 1ZTJA 2FOGA 1GCTC 3A82A 3FZDA 4MQAA 3S9BA 2GMTB 3GY5A 4Y8YA 1K2I1 4IC5A 3LGWA 1K1OA 3OU0A 2BHGA 2DUCA 2Y80A 1VGCB 3LIWA 2PTCE 1W10U 2ZWLH 1TBZH 2GGVB 3GY4A 1CU1A 3A7XA 2ZDNA 4FUFA 2Z7FE 3M3SA 1V2NT 3RJ3D 2ZGBH 3PMJA 2VWOA 1MMJN 4IGDA 3BV9B 2ZDLA 5JBBS 2OQ5A 4BOHA 5BPEA 1QBVH 2G5VA 2ZGJA 3BSQA 3RXDA 3FP8E 3RP2A 1AI8H 4MPVA 1BBRE 5FCKA 2Y5GA 3A83A 1H9HE 1LQDB 2XRCA 3BTDE 2ALPA 1DXPA 1NC6A 3RXEA 4Q7ZA 5T3HA 3M61U 1QQ4A 3QZRA 1W7XH 5L2YH 1O3LA 2RKZA 1V2LT 1BMMH 3PYHA 5LH8A 1TPMA 4E7RG 3B9FH 2BD7A 5F8XA 3S9AA 4FU7A 1A5IA 4GLYA 2YBYA 2W80A 1KDQA 1O3FA 1ABJH 1W14U 2EC3A 1Y59T 2OC8A 5EQQA 1KY9A 4MNWA 5HYUB 1IHTH 1O3KA 1VR1H 3C27B 4WWYA 2F3CE 2AGIX 2BTCE 1F2SE 9LPRA 3T27A 4B71A 1EZUC 1TPSA 1A4WH 3PTBA 4BAMB 1OX1A 3TGJE 3ATIA 4CBOA 3RMLH 1DS2E 2GDEH 3P92A 4NA7A 1OK2A 2ZU5A 4IN2A 3TNSA 1D3DB 3RU4E 1OSSA 1N8OC 2BXTH 5LPFA 2PGBB 4B74A 4WMEA 4A1VA 2ZO3H 1EJNA 4OGYA 1HBTH 1SI5H 3QGNB 1LVMA 2F83A 1G4GA 8GCHG 1GCDA 1W7GH 3SU2A 5JDUB 1IQEA 1O39A 1C2EA 3FP6E 3PROA 1YPHE 1ZLRA 1TX6A 4VGCC 4JYTA 5EODA 1CGJE 5AFYH 1O3CA 5FCRA 3ZVAA 1Y3VA 2GKVE 5IYTA 4Z6AH 2F9OA 2XWBF 1EUFA 2GCHG 3SU1A 3RLYH 1C2LA 3RMMH 3LDXH 5TJXA 3RXUA 1QHRB 1FZZA 2ALVA 2I6QA 3T26A 1HAOH 1EPTB 3LONA 3I29A 1DSUA 1P8VC 1ZPBA 1OOKB 1W12U 2BDIA 3MTYA 1HCGA 1FUJA 4X8TH 2HLCA 1L1NA 5K0HA 2AS9A 3GY8A 2J34A 3B8JA 4E7NA 5LGOA 3BTHE 4JZIA 2BDGA 3QTOH 1WU1A 1G9IE 4Z0KA 3A89A 3RXFA 1GJ5H 4D7FA 1W3CA 1DXWA 1UCYK 3GCHC 5C3NA 3RXBA 3PMAB 5EPYA 1ZPZA 1O5AB 1LPKB 1T32A 1D9IA 4I8JA 2BY7X 1ZJKA 2VNTA 4NWKA 1O2MA 3MO9A 1YPLH 1C5MD 4Y6DA 2BOHB 1O3MA 1V2RT 3U1JB 2HNTF 1H9IE 1IQJA 4IC6A 2RCEA 2OC0A 2BY6X 1QJ7B 4YOGA 2VWMA 5GCHF 1EZSC 3BTTE 1SGRE 1B7XB 3GYLB 3L3TA 3SV8A 1NRPH 3SV6A 5AVDA 1EZQA 1CKLA 3PMHB 4X8UH 5EXLA 1ZZZA 2P3FH 3KEEA 1V2UT 1E37B 3CALA 3SQEE 3TK9A 4UFDH 5L30H 1QA7A 1OWHA 4K8BA 2CKUA 2NU2E 2QGRA 1KTSB 3SN8A 2AFQB 1F92A 5DP7A 2CGAA 3SGQE 1W0ZU 1D4PB 1HAHH 5J4QA 1NESE 5E0JA 5HM2A 1AZ8A 1VJ9U 1G2LA 1A46H 3O8EB 4X1PU 4XBBA 3DFLA 2M5TA 5EXMA 4K1SA 1WQSA 2GDDA 1C1VH 1TPGA 1NRSH 4IW4E 2VIWA 1KTTB 1WSSH 1O35A 1FN8A 1E5GA 3QX5H 5C2ZA 3RC4A 3FFGA 6GCHF 3RXSA 1XKAC 4WJG2 5GIBA 1N8OB 1LVYA 1F0SA 1PYTC 1QCPA 1VVCA 1UK3A 2C90B 3RXIA 3GCTG 2B5TB 4H6SB 4O03A 2BM2A 4ISOA 2OBQA 4J2YB 4GCHG 2BQ7B 1UVOA 3EGKH 1K21H 2B5ID 3T5OA 3SOSA 4DIIH 3MOCA 4VGCB 2Q6GA 1K28D 1JOUB 1EPTA 4CR5A 2RLPA 1OJYA 1MZDA 4BXSA 4LOYH 4Y76A 2A7CA 5JBAS 5T6DA 5A0BA 1BRCE 3IWMA 3RXQA 1K1NA 1S0QA 4KELA 2BZAA 3CENA 1ID5H 1SR5C 1CT0E 3A7VA 1HXEH 1XVOA 2CHAC 3QN7A 3A7ZA 1T8MA 1BB0B 3UWJH 3ZZ5A 2R0KA 3M7TA 1GI9B 2TIOA 1O2LA 1V6DA 3SU6A 3LGTA 2ZFQH 4WXVA 1OK1A 1V2PT 4FVDA 3ZZ9A 1HAPH 4MUCA 1GBTA 1V2ST 3RXMA 1EB1H 4NFEA 1CA8B 1DICA 5L2ZH 2W7SA 2FEQH 2GVFA 5E8EH 1THSH 3V0XA 4GPGA 2ZDKA 5FHTA 3M5MA 4LXBH 4AYDA 2TGTA 1Y3WA 4DY7B 1CBWC 4D76A 1TNJA 1GMDF 3A8AA 3EA9A 4X0WU 1UTNA 1Q31A 3F9GA 4DVAU 3DD2H 2TGAA 1CO7E 1VZQH 3UIRA 3MNXA 1HXFH 2C8ZB 1YKTA 2O39C 3QWCH 3SGAE 4I8GA 1GBHA 3QGJA 2XC5A 2KAIB 3O8DA 4NZQA 1K1MA 1J16A 1O3PB 1DY9A 1F0TA 5A0AE 5GWZA 1FY4A 1QQUA 4OS4A 1FNIA 1H2QP 1WTGH 4I8HA 4UFEH 1VITF 2C8YB 2PSXA 2WPMS 3RU4T 4B2AA 2A4GA 2ODYB 2QY0B 1SS2A 2ZDMA 3BF6H 4D8NA 5FPTA 4IMQA 3PV4A 1CQQA 2V35A 1XUJA 2UWLA 1O3IA 1FDPA 4NIVA 1HUTH 1CHOG 4ZKRU 3U8TH 3OY6U 1SOTA