1MD7A

Monomeric structure of the zymogen of complement protease c1r
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
328
structure length
304
Chain Sequence
DCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGAHDLRFVRLPVANPQACENWLDVFSQNMFCAGHPSLKQDACQGDAGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C1R COMPLEMENT SERINE PROTEASE
publication title Monomeric structures of the zymogen and active catalytic domain of complement protease c1r: further insights into the c1 activation mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 304
sequence length 328
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1md7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md7A03
1KIGH 5F8TA 3PM3A 3GISB 1ZJKA 2BD7A 4F4OC 1BRCE 2F9BH 1ZJDA 1GGDC 4RKJB 4UFEH 2B7DH 1P2QA 2QV1A 3GOVA 1ZRKA 3MYWA 4ABHA 5C20A 1GMDG 1Y5AT 1P2KA 1L0ZA 3IX0A 1SI5H 3L89M 1LVOA 1FNIA 4KKDA 3AW0A 4X8UH 1SGNE 1ETTH 2WIIC 1O5BB 2XWJI 1QFKH 2NU4E 4Y8YA 4D7GA 1GBFA 2ZQ2A 5HYTB 3OY6U 4VGCB 5BPEA 4GCHF 4R0IA 2BD8A 3MNXA 2YBYA 1SMFE 1LPGB 3K6YA 1HBTH 1Y3UA 5K7RA 5J4SA 4XBCA 2VJ1A 1WAYB 2ANWA 1DICA 3SW0X 4O97A 4I8GA 4Y10E 2GVFA 1EX3A 2BOHB 1S85A 4AB8A 3SO3A 2W81A 4WMFA 1O2QA 1LDTT 4XDEA 1C2EA 1ELTA 1ZYOA 4FVDA 2NWNA 1SBWA 2LNCA 1P8VC 3JZ1B 5C1XA 3PB1E 3W94A 1O3IA 1BITA 3EYDA 4X6NA 3I78A 2FI5E 1TNGA 1C2DA 1GI3A 4FUBA 2BDYA 4IMZA 2Y80A 2VB0A 2HPQH 5L30H 1GHYH 3TITA 1DWBH 3RP2A 5A2MH 1V2ST 3L33A 2AMPA 3LDXH 1EAUA 1KXCA 4X0WU 2ZGJA 1N8OB 5F8XA 2D8WA 4ASHA 1A4WH 1V2TT 4FUHA 4XE4A 5EXLA 1NRPH 1P3CA 1O37A 3A7ZA 3E8LA 4NZLA 1RTKA 4IC5A 3KF2A 2F9PA 1C5WB 1PPBH 5EG4A 1SQOA 3VB4A 5CHAC 1K9OE 3A7VA 2ZP0H 4YO9A 3MO6A 4MPUA 3W95A 2YNBA 1ID5H 2BDBA 1TMBH 4ZKOU 1PYTD 2KAIB 5EW2H 2ZTYA 3UPEA 1EZUC 3SJIA 1TPAE 3ZVEA 2J9NA 2THFB 1UCYE 4K1SA 1Y3XA 1XKAC 1AO5A 4BAMB 4LOSA 3NPSA 2XC5A 2JH0D 1H2PP 1SLXB 2J34A 1HCCA 2K1QA 3MU1A 1HLTH 2ZGHA 5AF9H 1GHVH 1GJ7B 1YKTA 2RA0A 1RTFB 1LVBA 3O8CA 3Q3YA 1QBOA 1BB0B 1B0EA 2VIWA 2QGRA 1A7SA 1NT1A 2XNIA 5EODA 1PQAA 3ATIA 3WY8A 4FVBA 4GHTA 1YM0A 4K8BA 1O3MA 1TPOA 3BTKE 2HWLB 4IGDA 1P2MA 4NSVA 1XUJA 3O8RA 1AN1E 3ODDA 1C5ZB 3KIDU 4OGYA 1G3EA 1RTLA 3LIWA 4SGBE 3D65E 5G4BA 2IN2A 4CSYA 3DFJA 4WXIA 4FXGG 1C5XB 1G3BA 4D8NA 3LJJA 1LVMA 5LPRA 2QC2A 2QAAA 1PQ5A 4ZHLU 4K1EA 2G4UA 5JB8S 2ZDLA 5FXLA 2FP7B 4K8YA 2JETB 4UEHH 3TH2H 3VPKA 1QBVH 1AE5A 3HKIB 4K3JA 5JPMG 2FO9A 3SU3A 1O39A 1V2MT 1K1IA 3U69H 1GCTC 3S7HB 4NFFA 3A8DA 3INBC 3LGYA 2A55A 4FUEA 1OK3A 4NZQA 1TMUH 4TY7A 7KMEH 2TIOA 3UNRA 1ZOMA 1GHZA 5C5OA 4Y7AA 4CRFA 1C2IA 1P2OA 4J2YB 4X1PU 2VVVA 3MO9A 3QGJA 3RU4D 1XXFA 2OCVB 4H42U 2A45B 5FX5A 4I32A 4A6LA 2ALPA 3QUMP 1AFQC 1EB1H 2ZPRA 1FDPA 3KGPA 2FOCA 1F5LA 2F83A 1O3KA 3SQEE 3P6ZB 7LPRA 2G7IA 1HJ8A 4KELA 1Y3YA 4TY6A 2V3HH 4Y7BA 2R2MB 1TB6H 1YCPM 2WV4A 1YPMH 1VITF 2BVXH 1MQ5A 5ETXA 1A0JA 5AFYH 4ABIA 1EJAA 3HATH 5EU8A 2ZGCA 5A09A 1QL9A 2XWBI 1JIMA 4BTIB 1GJ4H 1O2IA 3U9AH 1L2EA 2AIQA 4B2SA 1LVYA 4UD9H 4AG2A 1CU1A 1QURH 1PPQA 1GI7B 3ITIA 3NKKA 2CKUA 1SGYE 2BLOA 2C93B 3RXQA 1TA6A 3GCTF 5BRRE 1QB9A 3EE0B 1AKSA 4U01A 3MH5A 1GBLA 1WSSH 3MFJA 3KQDA 2OD3B 1AB9B 3ZYDA 4K2YA 1UTMA 3GOVB 4ABBA 1GI6A 2R2WU 1O3PB 5E8EH 2H5CA 3B9FH 2FODA 4GCHG 1KSNA 1GHWH 1QA0A 4ZKNU 1Z1JA 2AS9A 1TWXB 1E0FD 2BTCE 2PTNA 1L1GA 1TQ0B 1EATA 5EQRA 5GDSH 2J94A 1TALA 1WTGH 2NU2E 2ZDMA 1WUNH 1XMNB 3VB5A 3ZZDA 2GTBA 1ZSLA 2FOHA 4OS1A 3ZZBA 4QT8C 1IQMA 4CREA 2FMJA 4ZMAH 1YGCH 2VIOA 8KME2 3KQBA 3M5LA 1EAWA 1TLDA 3MU0A 3S9CA 2AEIH 2G8TA 3GY2A 1DANH 4ABGA 1EXFA 3R0FA 2H5DA 1Y5UT 2TGDA 1FAKH 4E7RG 1VR1H 1AE8H 1GVZA 2P3UB 5LPFA 1CHGA 2FOBA 2GMTC 1YC0A 2HRVA 1A1RA 3RXJA 1ANEA 1UO6A 1J16A 5C1YA 3LH1A 4D7FA 3U1IB 3VEQB 1SRZA 3CALA 2FZZA 1C5TA 1EASA 3SQHE 3EDXB 3SNEA 1A3EH 2GCHF 1J17T 2PHBA 4MVNA 3S9BA 1S0RA 1UJ1A 5DP8A 3MHWU 2GCTC 2AMQA 1GCDA 3A85A 1G37A 2D26C 1Q3XA 1BJUA 2A32A 1DE7H 3RC5A 2P94A 1HXFH 2EI8A 1HDTH 1JOUB 1TNIA 2GDDA 3RXMA 4BAKB 1T4UH 4NSYA 4YNXA 3ZZ3A 1HUTH 1U6QA 1GBDA 1E37B 1LTOA 2PLXA 1S6HA 2GP9B 3TLOA 2RA3A 1A0HB 1O3LA 2A31A 1GJDB 4XOJA 4ZHMU 5HYOA 2VVCA 1VGCB 1UTLM 2PSXA 3P92A 3SV8A 1KLIH 3NCLA 3U8OH 2BB4A 2ZFPH 3M35A 3M3VA 3P8OA 1BOQA 2A4OA 2RDLA 4HFPB 1G3DA 4XSKU 4B73A 1OWJA 3D23A 2R0KA 3QWCH 5GJ4B 3ZVDA 1SGQE 4Q7YA 1C9PA 4UFGH 1Y59T 4MNXA 2SNVA 1F2SE 3ZVFA 2H9EH 4JYTA 1DSTA 1QJ1B 2OQ5A 1UVSH 2Z3DA 2A1DB 1E36B 4OGXA 3M36A 2QXHA 1FIWA 3SV9A 3RXBA 3AAVA 1SGTA 1P57B 3ZZ5A 1KTSB 2W5EA 3NZIA 1NU7B 4PROA 4X2XA 3B8JA 2PWXA 1EJMA 2DE8A 1GJ8B 1VZQH 1OP8A 3SV7A 3RXEA 3HPTB 4Y0YE 3KHVA 2M5TA 2OC8A 2CF8H 3PMAB 3FZZA 2VNTA 1IQJA 3BTME 4X8VH 1P09A 2V35A 3DT0H 2CXVA 4I7YH 1SLUB 1IQHA 2ZA5A 4ZAEA 1GBIA 3PTBA 4X6MA 5JDUB 4DGJA 4WVPE 4A5WB 1C1RA 3SGBE 1HJAC 1TNLA 1FV9A 2RCEA 5DKMA 1NFWA 1DPOA 4I8KA 3TJOA 1Y8TA 1P9UA 3STJA 1SS2A 2GZ7A 1C5PA 2PR3A 3M7UA 1C1TA 1H2QP 4MTBA 1MD8A 1IHTH 3RLWH 1CT2E 3ZZ6A 3S0NA 1BTXA 1JXPA 1NESE 1W12U 1RRKA 1QY6A 5EQQA 1GI0A 2ZHWH 2EA3A 2GZ9A 1A3BH 4JZ1A 2AFQB 4AYMA 3QTVH 1H4WA 2GGVB 1P05A 3AVZA 1QO6A 2J92A 2EC3A 4ZH1D 1KDQB 2GDEH 1QJ6B 4DJZB 3A7WA 3E3TA 3OSYA 1VITG 4WY3A 2LOJA 2W80A 1TABE 1QRWA 1TOCB 2VWMA 1GMCF 1U5MA 1ZPCA 4YTAA 1RGQA 1VJ9U 3V0XA 3OY5U 1MH0A 5EOKA 1O2VA 2FOGA 3GYLB 8LPRA 5HM2A 3A8BA 1O35A 1MTNC 3E6PH 2STAE 4TWYA 3U98H 1RIWB 5EPNA 3M7PA 3GCTG 2FDAA 3Q76A 3H7TA 4I33A 3KXVA 2P8OC 4AFZA 1DLEA 3A7XA 1O3JA 2WYGA 4WWYA 1GL0E 3GY8A 1C4U2 4FXGH 3QDZB 3UY9A 3VGCB 2FYRA 3OP8A 2G4TA 1A5HA 2QF0A 1TGSZ 3EGKH 2GD4B 3GICB 3ZZ4A 1OWHA 1A61H 4BXWA 1O32A 2O8WA 2GZ8A 2ODYB 1NS3A 2JH6D 2H2ZA 5I46H 5LPEA 1P2NA 1GWAA 1LKBA 2ZGXH 1C5UA 3Q3KA 2AERH 3EQ0H 1TX6A 1OKXA 1PYTC 5AFZH 1DXWA 1EPTB 2FEQH 1SFQB 1VCPA 3A87A 5HMAA 1LCYA 3E0NB 3SHAH 3NFPI 2ZFSA 4FUDA 2ZU2A 1HAPH 6CHAB 2Y5HA 1YPKH 1BUIA 1MTSA 1HV7A 2I6QA 1D9IA 2Y7ZA 1ELEE 4K5ZA 1O30A 2IOTA 1C2GA 2HALA 3PLBA 1A5GH 1FXYA 4KP0A 2P3FH 1ZR0A 1GG6B 3FP8E 2VIDA 1ORFA 3C1KA 4D9RA 3ERBA 1OJYA 1O2GH 3SBKA 3RXRA 1V2RT 2GCHG 2VWOA 1EQ9A 2BXUH 4CHAB 5C1UA 3TJNA 2I6SA 2BQWB 1PPFE 4NWLA 2PUXB 5SGAE 1GKNA 1SSXA 2Q6DA 4AYVB 2BY5X 1GJ5H 3FP7E 1UTQA 3MH7A 1W11U 1N1LA 3PO1B 4THNH 1N6YA 2AYWA 2ZHDA 1OJVA 4RSPA 3P95A 2ZDAH 1JRTA 5JBBS 1FPHH 4A1TA 5E2OA 1TFXA 3LGUA 5T6FA 2SNWA 1HXEH 1ESTA 3ZVBA 1H9IE 1O2KA 4CH8B 3OU0A 1N6XA 1G32B 2Z3CA 3ZZ7A 3P8FA 2A4GA 4X1NU 4YT7H 1HAHH 3TGJE 4CRGA 1O5CB 4DOQA 5DJ7A 1CA0C 1V2WT 1CHOF 4MNYA 2C8XB 4NA8A 1H04P 3HKJB 1TX7A 2RKYA 1ZRBA 3P17H 4LOYH 3TU7H 1XX9A 1C5LH 3FFGA 2GX4A 3D62A 4ABAA 1BMAA 1HAVB 2Z9IA 1YLCA 1MUEB 2BDCA 3RUOA 2ILNA 3M5NA 1DY8A 2C3SA 1BRBE 3UNQA 1GL1A 1C5RA 2O8LA 1W0YH 1ZTKA 3CS7A 1BTWA 1C1ZA 4LOTA 2HNTE 1QNJA 3PLPA 1FY8E 1TONA 2JRAA 1BTYA 4ZXYH 3BF6H 2WV5A 1BDAA 1DVAH 3TH3H 6LPRA 4YM9A 3V12A 3SGQE 3BTQE 3FAOA 1GMHF 4AGKA 2B5ID 1BMLA 2LPRA 3LPRA 2XWBF 4M7GA 3SW2B 5TJXA 1ELBA 2EI7A 1LMWB 4DT7B 4O3TA 9ESTA 2J4IA 3TGIE 1TBZH 3IG6B 1C1NA 1GBJA 1LHEH 1KXAA 3LJOA 2BY8X 1HAYB 5L6NH 1G36A 1XUFA 1ACBE 1T8OA 2WPJS 2NU1E 2STBE 3MH6A 4AOQA 1O3DA 1SG8B 3BTWE 1ABIH 3KQCA 1Y5BT 1ZGVA 3MTYA 3DFLA 4X2YA 3SJOA 3TJUA 2G52A 5ESTE 2VIPA 1GI5A 1JMOH 3GCHC 4GAWA 3TPIZ 1RJXB 4JZIA 4Y8XA 1ZMJA 3RXIA 2V3OH 1A46H 1M9UA 1SOZA 4D9QA 1JWTA 1ZSJA 3OTJE 2XTTB 5CHAB 3ZV9A 1OXGA 2VWLA 5FX6A 4A92A 3MWIU 3QZRA 1O2LA 2FTLE 3TVJA 1OP2A 5L2ZH 2ZPQA 1GMCG 4F49A 4CRAA 1FI8A 2D1JA 2QCYA 4MG3A 3E0PB 4E05H 3F9HA 4ZUHA 5C67A 4YLQH 2UUKB 4UONA 1UTOA 3RMMH 4ABFA 2XC0A 3SNCA 2ZTZA 1EZXC 1HAIH 1O5DH 3GY6A 3RXCA 2ANYA 2KMSA 2BD9A 3ATLA 1NO9H 4MQAA 2F9VA 1ANBA 3MU8A 5J4QA 1THRH 1AY6H 1EAXA 3K6ZA 4NG9H 5A8XA 1SC8U 1XVOA 1O5EH 2PKAA 4U30A 1LHCH 4HI3A 2VVUA 3AW1A 2Y7XA 1O2TA 1GBMA 2FI4E 2CHAC 3ZVCA 3F9GA 3SU6A 2O8MA 2MCZA 2Z7FE 2BY7X 5I0QB 1H8DH 1THPB 3M37A 3LOXA 1FMGA 4HZHA 3BTHE 1FN8A 1ZZZA 3O8BA 1C4Y2 1RS0A 1KXBA 4A1VA 3OXUD 1ESBA 1ARBA 3SHCH 4YOJA 4CR9A 2P93A 2Y5GA 1DDJA 1J8AA 2WPHS 5DP7A 3PLKA 1JRSA 1UTNA 1GHXH 1O3GA 1BMNH 5A0CA 4MDSA 1SHHB 7GCHF 1GI1A 1HFHA 1MU8B 4Q2KA 2BQ7B 4AG1A 2R0LA 1W13U 3E1XB 4JZFH 1AFEH 1GCTB 3F68H 3M7QA 3ZD2A 5ESBA 2GV7A 1EKBB 3MH4A 5LH8A 2OXSA 4NIYA 3LGIA 1AVGH 1BHXF 5T6GA 4X6OA 5EQSA 5GXPA 1ZHRA 2ZFTA 2EEKA 1TPPA 3RXOA 1UCYK 1O3AA 1QB1A 1NN6A 3V3MA 1LPKB 2FPZA 1MZAA 1C1OA 2TGAA 1VITH 1AFQB 5FAHA 4ONTD 5EXNA 2R3UA 1O33A 1GJCB 4WH6A 4K12A 1CBWC 5DG6A 2RL0A 1GBHA 1TNHA 1HAOH 2GKVE 2G55A 1IQKA 2R9PA 3KEEA 5HM9A 2FOEA 4U32A 1IOEA 1C2LA 1NRQH 1ELGA 4Q7XA 1CE5A 1O5GH 1BMMH 3SU2A 2Y5FA 2D2DA 1D3PB 2ZU5A 3GDSA 3A84A 1KTTB 4AYYB 1P9SA 3ELAH 1ELVA 3D49H 1FY4A 3ZZ9A 2XYAA 1Z7KA 3F6UH 5JBTA 4A1XA 1QUBA 1OOKB 1DUEA 1P11E 1CHOG 3MO3A 2FOAA 1Y3VA 2OQUA 2ESTE 2ZCLP 1SGCA 1C1PA 2ZDVH 1AGJA 3HK3B 1GJ6A 1K1MA 3A89A 3UOUA 2BVRH 1O2PA 4D76A 1V2OT 3M61U 1SB1H 3VFEA 3RM2H 3QLPH 1GHBF 2ODPA 1TRMA 2BY6X 1KY9A 2YRAA 2PKSC 3ZRZA 1GBCA 4CRCA 1UCYH 1UVOA 5F8ZA 4JZDH 1NTPA 3S7KB 1X7AC 4X8SH 2RLPA 2ZHFH 1FIZA 1TPSA 2BYAX 3A8AA 1GJAB 1GMHG 2UWLA 2ZEBA 4ISLA 4ZXXH 4BNRA 5DPAA 4NFEA 4U2WA 1O3FA 1SQAA 1LQEA 1UTJA 2ZPSA 1F0RA 3R62A 1MTVA 4CR5A 2GMTB 1O2JA 1S84A 4A5TS 5EW1H 4IMQA 2BD2A 1B0FA 3HK6B 1PJPA 1AB9C 1GVKB 2A4QA 4UFDH 4DG4A 2ZO3H 2EC9H 5DP6A 5C5NA 4IBLH 3M5OA 1VVCA 4H6TA 4KTUA 4JK5A 4B74A 3M3SA 4JHSA 2GCTB 1ELAA 3ENSB 1MCTA 1NPMA 2ASUB 3LGVA 4DIIH 3BEUA 1W7XH 3TK6A 2O39C 1GI8B 1P0SH 2XBYA 3UUZA 1MBMA 3T62A 1THSH 1T4VH 2A7JA 4A7IB 2O9QA 2VH6A 2QXJA 2AIPA 2OBQA 4CBOA 1NRNH 2AMDA 5TCCA 1DUAA 1QQUA 2ZCHP 2ZG0H 4JK6A 3T2NA 3RDZA 3VXFH 1KXEA 1TBQH 2XBXA 2B0FA 3PYHA 2FTMA 1G3CA 1GVLA 1O38A 1C1MA 3P70B 1MAXA 4CH2B 1K1LA 2Z6BD 1PQ7A 1DY9A 1TGNA 1GI9B 1Q31A 2TGTA 3O8EB 4AB9A 4RKOB 1BRUP 2Q1JA 1VVDA 5LGOA 1W0ZU 4BAHB 2PFEA 3URDA 2GT7A 5DP3A 4DVAU 2FI3E 1ANCA 4BANB 3UWJH 5E2PA 2Z9JA 2BOKA 1CGIE 1QHRB 1VCQA 4TWWA 1SVPA 1FONA 1BBRK 2ZGBH 5GCHF 1SGPE 1K21H 3QO6A 3RMOH 1SHYA 1YPGH 3QTOH 1OSSA 3RXHA 3BTGE 5HZPB 2IPHA 3PMBB 1OJWA 1TYNA 1OWEA 1DX5M 3A83A 3M5MA 5IYTA 2GV6A 4IW4E 2QXIA 2H6MA 3DA9B 4TYDA 3A7TA 3EJHA 2Z9LA 1ZMNA 7GCHG 1DWDH 1SLWB 4Q7ZA 2BD3A 1B5GH 1Y3WA 2Y6TA 4Z6AH 1GPZA 3OEDC 4INLA 1OP0A 1HJAB 1YCPK 1CGJE 4ZROA 2QN5T 2A2XH 3QX5H 4O3UA 1QJ7B 3RU4T 4R8TB 3RMNH 4WF8A 4I8JA 5JB9S 4B2RA 2C4FH 1QGFA 1HAXB 3BG4C 2IZ3A 4WMEA 3SV6A 1YLDA 1OK9A 3B23B 3FP6E 1NFYA 2OLGA 1Z6EA 3UQVA 2SGEE 1GDNA 1J14A 2IJOB 2WPLS 1MTUA 1SGFA 3UR9A 1D3QB 3RXUA 1O31A 2A7CA 3T29A 4JYUH 3GY7A 3Q00A 1FY5A 1OX1A 1V6DA 3EAJA 3GDUA 1K28D 2ZDNA 3LC3A 2JGWA 5FCKA 3SORA 4GLYA 1BHXB 1EB2A 1BBRH 1F92A 1K1PA 3IWMA 4X2VA 3T5FH 5AHGH 3RXFA 1MTNB 1G4GA 2MCYA 1IHSH 4WXVA 4FUCA 1NROH 1GBKA 3RLYH 4E06H 1AZ8A 2P8OB 4X1RU 1WU1A 1EUFA 3GYMA 2B5TB 4JMYA 2QA9E 4C16A 3UFAA 2ZC9H 3M3TA 2Q6FA 1CSOE 1FY1A 2OC1A 2FLRH 1WV7H 5C2ZA 2AGGX 1MBQA 1NU9A 5JYIA 1V2NT 2BHGA 4AFUA 1C1SA 2NU3E 4YZUA 1D3TB 1YCPH 1MD7A 5L2YH 1BQYA 1TRNA 1GHBG 2ANMH 4WH8A 1EOJA 3SU0A 5IDKA 1ZTJA 2EI6A 2XW9A 2C90B 1L1NA 1YPEH 1HCGA 2HNTC 4TPYA 2B8OH 2F9NA 4FUIA 1HIAA 1CT0E 3AAUA 1E5GA 2C8YB 3GXEA 3H7OA 1JBUH 1NRSH 1AKSB 1DFPA 1V3XA 3ZV8A 5K0HA 3DHKH 2Z3EA 3SU4A 2UWPA 5PTPA 3L3TA 4WJG2 2DUCA 3RC6A 1ELFA 1ABJH 4Y71A 1RIWC 1PPHE 1TQ7B 3BEFB 1MMJN 1TOMH 1OWDA 2UUJB 1K1JA 4X1QU 2OP9A 2UUYA 2ANKH 1K1NA 1F0UA 2ZIQH 4DW2U 1WTHD 1GI4A 2B9LA 1V2LT 1G30B 1GJBB 1C5YB 3G01A 1XUGA 2G00A 1LY2A 2Z9GA 1NFXA 3AASA 4LZ1H 1TE0A 1TMTH 1WOFA 3PMHB 3TH4H 1DOJA 3VXEH 1O2MA 1SGEE 4Y0ZE 2ZNKH 2CV3A 1OPHB 4OS7A 4YESB 4NA7A 1A2CH 1EPTC 2ZI2H 3V13A 3KL6A 4CRBA 2VGCB 4XFQA 4AGJA 1TPNA 1GI2A 2V0BA 1ZTLA 2QY0A 2CMYA 4YLUA 5C3NA 1YPHE 3NXPA 1MKXK 1Q2WA 1O3NA 1YPJH 2TGPZ 1E34B 4GHQA 4B2AA 4X1SU 3E16B 1CGHA 1CA0B 1HFIA 1QTFA 2FS9A 3EA9A 1V2UT 1BCUH 1GGDB 2RG3A 3QGNB 1BTHH 1XM1A 1RFNA 1T8LA 2AGIX 1Z8RA 1GHAF 1OWIA 1J9CH 3RXDA 1EP6A 4J38B 2VIVA 1FN6A 1PPEE 4X8TH 4RN6A 1IQGA 1K22H 1FLEE 2AH4X 1MAYA 1F5RA 5T3HA 1AWHB 5GCHG 4NIVA 3SUEA 3ZVAA 1K1OA 2FIRH 1C5QA 2ZKSA 5FPYA 1O3EA 3SJ9A 4ZKSU 5FO8C 3A80A 3KCGH 2XQWC 5DP4A 2ZFRH 4AORA 2F91A 1Z8IB 2XRBA 1P2IA 1D3DB 1D4PB 1P01A 5TCAA 3UWIA 3UREA 3MNCA 5E0GA 1WQSA 1JIRA 1C4V2 1ZPZA 4AYEA 2FS8A 4DCDA 1C2HA 4X2WA 1T7CA 4Q80A 1UHBA 2CG6A 1TNKA 4B75A 1IAUA 4KTCA 3PWBA 4DIHH 1C9TA 3BTDE 2WYJA 2FLBH 3BN9A 3TGKE 1GHQB 1QIXB 2UWOA 1E35B 2CF9H 5E0HA 1SGFG 3NUMA 1BRAA 1Z71A 4NA9H 1YPLH 2ZZUH 3A7YA 1BIOA 3LKWA 3BIVH 1AQ7A 1TIOA 2HPPH 1MKXH 1QRZA 1OK1A 4IC6A 1P3EA 2XCNA 3GCHB 1O34A 4B1TA 8GCHF 1D6WA 2H9HA 1NFUA 3UIRA 1INCA 1PQ8A 2OINA 1KYNA 1C2JA 1UVPA 2HVXA 4VGCC 1C2MA 3NWUA 2FOMB 3LT3A 1YBWA 3UR6A 2J2UA 1XUIA 2UUFB 2ZU1A 5ABWA 1O3OA 3QN7A 1T8MA 4DY7B 3SOSA 1C5VA 2ZFQH 3IITA 4AX9H 4IN1A 5FBEA 2VINA 1UMAH 2ALVA 2W3KA 4NCYA 3SUGA 2XCFA 2ZU3A 3LU9B 1C1WH 1MKWK 4NIXA 1CT4E 1IQNA 1YYY1 3K65B 1C1QA 1VCWA 2WUBA 2PGQB 2FOFA 2A5KA 5T6DA 1AMHA 3TIUA 3M7TA 3LC5A 1QRXA 2BDIA 2WPMS 1BA8B 3NK8A 3A8CA 2SGDE 4MPVA 3ZZ8A 4MLFB 2GT8A 1VJAU 1F0SA 2CG7A 1AU8A 3Q77A 2CHAB 1GKGA 4BTUB 3SU1A 3JZ2B 2BM2A 4WMDA 1GBBA 2ZHEH 1F5KU 4Y79A 1V2QT 2XRDA 1N8OC 3I77A 4H6SB 4IS5A 2OBOA 3KQEA 3RXAA 2HLCA 5FCRA 3TK9A 2Y82A 3E90B 4K60A 3ZYEA 2PTCE 1G9IE 1NC6A 4O9VA 2WINI 4FU8A 1W7GH 1PPCE 5EPYA 9LPRA 3QZQA 3MMGA 2BXTH 1E38B 1UTPA 3A86A 1PFXC 2W7UA 2SGQE 4BOHA 2BY9X 1SLVB 1NRRH 2ZU4A 2Z94A 2ZDKA 1Z92B 4MPXA 1HIAB 5F03A 1IQLA 3RU4E 1LHDH 2CGAA 1L4ZA 4OS6A 4FU7A 1V2JT 4ABEA 1S81A 3K9XB 2Z9KA 2XC4A 1GBTA 1MKWH 3UQOA 3S69A 1ANDA 1HGTH 2BVSH 1TGBA 2QYIA 1CQQA 3SN8A 1CBWB 2Y81A 1C5SA 4B71A 4ZH8A 1HNEE 2QXGA 1C1VH 1TBRH 5EGMA 1T31A 1UK3A 2V8EA 1HFDA 3IU3I 2ZHQH 5FHTA 4Y11E 2G5NA 1FUJA 1S6FA 2PV9B 3C27B 5I25A 8ESTE 1H8IH 2BMGB 1SQTA 1V2PT 1FBRA 1SGRE 1O2NA 1O2HA 2Q6GA 4UDWH 3SUDA 2HNTF 2BX3A 3T26A 1XKBC 4AN7A 2C8ZB 2A2QH 1P03A 5HYUB 2BX4A 2JETC 2F9OA 2H9TH 2C8WB 3SUFA 1GHAG 1CKLA 2QY0B 3P8GA 1KDQA 4HTCH 4JYVH 4DJZA 2XRCA 1G2LA 4I31A 3BV9B 3FZDA 3RXKA 4AFSA 2BDAA 1W14U 3RXTA 1T8NA 1AIXH 3MNBA 2J38A 4IN2A 3KN2A 2O8UA 3TNTA 3RXGA 1QBNA 1FJSA 2PKSB 5HGGA 1H9HE 2VIQA 5DO4H 1LO6A 3SJ8A 2BDHA 4BTTB 4J1YA 4OS5A 1YF4A 4YOGA 2FESH 1G4FA 2FX6A 3O8DA 1P10A 1O36A 6GCHF 3VB3A 2G51A 1SPJA 1O3CA 5HYPA 2PUQH 1WBGB 4ABJA 1P04A 2ZTXA 1IQEA 1C2KA 1E8BA 5GIBA 1XUKA 1L4DA 4GSOA 1DWEH 2OTVA 1XXDA 5CMXH 3N7OA 3UOPA 1FPCH 3MQLA 3SJKA 1WYKA 4YT6H 1HAZB 1MZDA 1KLJH 3HGNA 3SNBA 2HGTH 5DP5A 2QIQA 2XXLA 1EPTA 2V6NA 1MTWA 1UHBB 3K2UA 1AHTH 2ULLA 3UTUH 2A5AA 4JCNA 4OS4A 4OS2A 1UK4A 8GCHG 1FZZA 1ARCA 1SGIB 2ZWLH 2BLVA 1D6RA 2P59A 3ATMA 1S83A 1UTKA 3KNXA 3RJ3D 2WPIS 4B76A 1HRTH 1WQVH 3CS0A 2BLWA 3I29A 3LONA 1SGDE 4CRDA 2ZF0H 4H4FA 1NM6A 4Y76A 5F6MA 3QK1A 1T32A 1BTPA 1ZHPA 1NY22 2EHFA 2TBSA 1ELDE 1UVUH 1XVMA 3GDVA 1MQ6A 1LHGH 1QB6A 2OC0A 3F1SB 1QR3E 1RD3B 1OYQA 4ZKRU 3GY5A 1UK2A 2F9UA 5A8YA 3PWCA 1K2I1 1BTZA 4B2BA 1QL8A 5DK1A 1KXDA 1BBRE 1QA7A 4NWKA 3BSQA 4LZ4B 1O0DH 1NWVA 1P02A 5AVDA 2PGBB 2SFAA 2VH0A 1DWCH 1XUHA 3ZZCA 3U1JB 4Y8ZA 2ERJA 4AYIA 1BZXE 1DXPA 1J15A 3T28A 2G5VA 4SGAE 3TVJB 1O3HA 3ODFA 2QF3A 3F9FA 1Z1IA 6ESTA 3EA8A 3ZZAA 1TGCA 1ZMLA 3TK5A 1C5MD 1QQ4A 2RLQA 3MU4A 4KGAA 1SOTA 2BD4A 1KLTA 1P06A 4MNVA 1B7XB 1HPGA 3T5OA 4I8HA 1G2MA 5JBAS 1EZQA 1HAGE 2R3YA 1C2FA 3BTEE 3VB6A 2PKAB 1CVWH 1DM4B 5FBIA 2IZ4A 1ESAA 1HAVA 1LKAA 2TPIZ 1ZHMA 1NZQH 4GPGA 4E7NA 1ZSKA 1IQIA 2FM2A 1UOTP 1FQ3A 1ETRH 3PTNA 3GCNA 4UFFH 2KRIA 2OC7A 1BT7A 1ELCA 1GBAA 1W2KH 1E88A 2A7HA 1VGCC 1MU6B 1DT2A 2BD5A 3LGWA 1GMDF 1O2YA 3RXVA 3RXLA 4CBNA 4JZEH 1KXFA 3BG4B 1DSUA 1FY3A 3T25A 1Z8GA 1UVTH 1O9AA 1O5FH 4K69A 3R3GB 1ZPBA 5A0BA 3FVFB 1DLKB 2ZCKP 3Q3XA 5B6OA 3BEIB 3ZD1A 2UWNA 4BXSA 1F0TA 2P95A 4AYDA 1IQFA 4BAOB 1A0LA 3EA7A 1C1UH 1OWKA 2WPKS 3CENA 5FPTA 3URCA 4KTSA 4GVUA 3PV4A 5FPSA 1ZLRA 3SGAE 1SFIA 4YOIA 1DS2E 1BJVA 1GJ9B 1W8BH 5JBCS 3A88A 2W26A 1W10U 1YPHC 2FYQA 3MU5A 3ATKA 4ESTE 5HXFA 1AWFH 3DD2H 1ZGIA 4MUCA 1LQDB 3PMJA 3RM0H 1TRYA 3BG8A 5DGJA 4PZ5A 1QGBA 3U8RH 2AGEX 2O8TA 2FXRA 5A8ZA 2OUAA 1AUJA 3V7TA 3L6PA 3LGTA 2HOBA 1H9LB 7ESTE 1W3CA 5DP9A 3RC4A 2ZQ1A 3S9AA 3HGPA 2BZ6H 2BLQA 1TAWA 1AVWA 5CE1A 1BTUA 1O2XA 1HYLA 3UNSA 3BTTE 1S0QA 1WCZA 4K1TA 3A81A 2BQ6B 4HGCA 3ZVGA 4ISIH 2A4RA 4ISOA 2KAIA 2J95A 3FANA 4Y6DA 1SL3A 2W7SA 3H5CB 6GCHG 1S5SA 1C5NH 1L1JA 2SGAA 5GPIB 3SV2H 1CA8B 1LHFH 1TA2A 4B2CA 4LXBH 1V2KT 1GDQA 1O2ZA 3SNDA 1P2JA 1A5IA 2TRMA 3ATWA 3F9EA 1PPGE 1TGTA 1EJNA 2CN0H 1TX8A 2VU8E 1TNJA 3T27A 2JKHA 4XBBA 2CJIA 1GBEA 2DE9A 1EP5A 1AUTC 1P12E 4I8LA 1AZZA 2YNAA 2F3CE 4GUXA 4FUFA 5E0JA 3GY4A 1OS8A 2PSYA 1H03P 3U8TH 3SU5A 4INKA 2RKZA 1HJ9A 2SGPE 2W3IA 1O3BA 3PROA 2ODQA 3DUXH 2XBWA 3E91A 5GWZA 4UE7H 1O2WA 3STIA 2BDGA 4LK4A 5JPMH 2P3TB 4MPWA 1TPMA 4DURA 4INHA 3P8NA 3VGCC 3OYPA 1F7ZA 1Z6JH 1RXPA 4NGAH 3GCOA 4O03A 3ESTA 3KZJA 1AI8H 4BAQB 1EZSC 4FUGA 1O2RA 3LH3A 4NIWA 3SI4H 1MCVA 2A0QB 1AVXA 2BZAA 5A0AE 1C5OH 2XBVA 3SZNA 2SGFE 1EAIA 2PW8H 1O2SA 1SR5C 1QCPA 3MNSA 5EXMA 3BTFE 3MOCA 1ETSH 3TJVA 2WUCA 2ZFFH 6CHAC 3MI4A 3RXPA 3OX7U 3RXSA 1LPZB 3RMLH 1O5AB 1DITH 2H1UA 4ABDA 1PPZA 3VB7A 4Z0KA 1YP9A 1QL7A 1OYTH 2FWWA 2XWAA 2G81E 4AZ2B 2P16A 3SI3H 1HB0B 1GG6C 2JH5D 4FU9A 3CP7A 2A5IA 4ISNA 1S82A 2FX4A 1GDUA 4X6PA 4CHAC 2YOLA 1CO7E 4XBDA 2BZMA 1TPGA 3GY3A 2NU0E 4AFQA 4MNWA 1FAXA 1EOLA 1H1BA 3TNSA 2VGCC 3A82A 5H4IB 1AD8H 2JGXA 1O2UA 1OK2A 1Z8JB 2VWNA 1V2VT 3PO1C 4ZHAA 3SNAA 1O2OA 4FUJA 2ZECA 4ISHH 3BIUH 4TPIZ
chains in the Genus database with same CATH superfamily
1KIGH 5F8TA 3PM3A 3GISB 5CHBA 1ZJKA 2BD7A 4F4OC 1BRCE 2F9BH 1ZJDA 1GGDC 4RKJB 4UFEH 2B7DH 1P2QA 2QV1A 3GOVA 1ZRKA 3MYWA 4ABHA 5C20A 1GMDG 1Y5AT 1P2KA 1L0ZA 3AK5A 3IX0A 1W0JD 1SI5H 3L89M 1LVOA 1FNIA 4KKDA 3AW0A 4X8UH 1SGNE 1ETTH 2WIIC 1O5BB 2XWJI 1QFKH 2NU4E 4Y8YA 4D7GA 1GBFA 1WXRA 2ZQ2A 5KEDA 5HYTB 2VBCA 3OY6U 4VGCB 5BPEA 4GCHF 4R0IA 2BD8A 3MNXA 2YBYA 1SMFE 1LPGB 3K6YA 1HBTH 1Y3UA 5K7RA 5J4SA 4XBCA 2VJ1A 1WAYB 2ANWA 1DICA 3SW0X 4O97A 4I8GA 4Y10E 2GVFA 1EX3A 2BOHB 1S85A 4AB8A 3SO3A 2W81A 4WMFA 1O2QA 1LDTT 4XDEA 1C2EA 1ELTA 1ZYOA 4FVDA 2NWNA 1SBWA 2LNCA 1P8VC 2QF5A 3JZ1B 5C1XA 3PB1E 3W94A 1O3IA 1BITA 3EYDA 4X6NA 3I78A 2FI5E 1TNGA 1C2DA 1GI3A 4FUBA 2BDYA 4IMZA 2Y80A 2VB0A 2HPQH 1VKYA 1E1RD 5L30H 1GHYH 3TITA 1DWBH 3RP2A 5A2MH 1V2ST 3L33A 2AMPA 3LDXH 1EAUA 1KXCA 4X0WU 2ZGJA 1N8OB 5F8XA 2JJ2D 2D8WA 4ASHA 1A4WH 1V2TT 4FUHA 4XE4A 5EXLA 1NRPH 1P3CA 1O37A 3NJAA 3A7ZA 3E8LA 4NZLA 1RTKA 4IC5A 3KF2A 2F9PA 1C5WB 1PPBH 5EG4A 1SQOA 3VB4A 5CHAC 1K9OE 3A7VA 2ZP0H 4YO9A 3MO6A 4MPUA 3W95A 2YNBA 1ID5H 2BDBA 1TMBH 4ZKOU 1PYTD 2KAIB 5EW2H 2ZTYA 3UPEA 1EZUC 3SJIA 1TPAE 3ZVEA 4ASUD 2J9NA 2THFB 4M9FA 1UCYE 4K1SA 1Y3XA 1XKAC 1AO5A 4BAMB 4LOSA 3NPSA 2XC5A 2JH0D 1H2PP 1SLXB 2J34A 1HCCA 2K1QA 3MU1A 1HLTH 5HIZA 2ZGHA 5AF9H 1GHVH 1GJ7B 1YKTA 2RA0A 1RTFB 1LVBA 3O8CA 3Q3YA 1QBOA 1BB0B 1B0EA 2KX4A 2VIWA 2QGRA 1A7SA 1NT1A 2XNIA 5EODA 1PQAA 3ATIA 3WY8A 4FVBA 4GHTA 1YM0A 4K8BA 1O3MA 4ACBA 1TPOA 3BTKE 2HWLB 4IGDA 1P2MA 4NSVA 1XUJA 3O8RA 1AN1E 3ODDA 1C5ZB 3KIDU 4OGYA 1G3EA 1RTLA 1SKYE 3LIWA 4SGBE 3D65E 5G4BA 2IN2A 4CSYA 3DFJA 4WXIA 4FXGG 4Z1MD 1C5XB 1G3BA 4D8NA 3LJJA 1LVMA 5LPRA 2QC2A 2QAAA 1PQ5A 4ZHLU 4K1EA 2G4UA 5JB8S 2ZDLA 5FXLA 2FP7B 4K8YA 2JETB 4UEHH 4P00A 3TH2H 3VPKA 1QBVH 1AE5A 3HKIB 4K3JA 5JPMG 2FO9A 3F0OA 1O39A 1V2MT 1K1IA 3SU3A 3U69H 1GCTC 3S7HB 4NFFA 3DSGA 3A8DA 3INBC 3LGYA 2A55A 4FUEA 1OK3A 4NZQA 1TMUH 4TY7A 7KMEH 2TIOA 3UNRA 1ZOMA 1GHZA 5C5OA 4Y7AA 4CRFA 1C2IA 1P2OA 4J2YB 4X1PU 2VVVA 3MO9A 3QGJA 3RU4D 1XXFA 2OCVB 4H42U 2A45B 5FX5A 4I32A 4A6LA 2ALPA 3QUMP 1AFQC 1EB1H 2J5UA 2ZPRA 1YLNA 1FDPA 3KGPA 2FOCA 1F5LA 2F83A 1O3KA 3SQEE 5DN4A 3P6ZB 7LPRA 2G7IA 1HJ8A 2W6ID 4KELA 1Y3YA 4TY6A 2V3HH 3KQ5A 4Y7BA 2R2MB 1TB6H 1YCPM 2WV4A 1YPMH 1VITF 2BVXH 1MQ5A 5ETXA 1A0JA 5AFYH 5F53A 4ABIA 1EJAA 3HATH 5EU8A 2ZGCA 5A09A 1QL9A 2XWBI 1JIMA 4BTIB 1GJ4H 1O2IA 3U9AH 1L2EA 2AIQA 4B2SA 1LVYA 2M2AA 4UD9H 1CU1A 1QURH 4AG2A 1PPQA 1GI7B 3ITIA 3NKKA 2CKUA 1SGYE 2BLOA 2C93B 3RXQA 1TA6A 3GCTF 5BRRE 1QB9A 3EE0B 1AKSA 4U01A 3MH5A 1GBLA 1WSSH 3MFJA 3KQDA 2OD3B 1AB9B 3ZYDA 4K2YA 1UTMA 3GOVB 4ABBA 1GI6A 2R2WU 1O3PB 5E8EH 2H5CA 3B9FH 2FODA 4GCHG 1KSNA 1GHWH 1YY3A 1QA0A 2XOKD 4ZKNU 3FGTA 1Z1JA 2AS9A 1TWXB 1E0FD 2BTCE 3DSPA 2PTNA 1L1GA 1TQ0B 1EATA 2KM0A 5EQRA 5GDSH 2J94A 1TALA 1WTGH 2NU2E 2ZDMA 1WUNH 1XMNB 3VB5A 3ZZDA 2GTBA 1ZSLA 2FOHA 4OS1A 3ZZBA 4QT8C 1IQMA 4CREA 2FMJA 4ZMAH 1YGCH 2VIOA 8KME2 3U28C 3KQBA 3M5LA 1EAWA 1TLDA 3MU0A 3S9CA 2AEIH 2G8TA 3GY2A 1DANH 4ABGA 1EXFA 3R0FA 2H5DA 1Y5UT 2TGDA 1FAKH 4E7RG 1VR1H 1AE8H 1GVZA 2P3UB 1E79D 5LPFA 1CHGA 2FOBA 2GMTC 1YC0A 2HRVA 1A1RA 2WSSD 2V7QD 5KGOA 3RXJA 1ANEA 1UO6A 1J16A 1MABB 5C1YA 3CI0J 3LH1A 4D7FA 3U1IB 3VEQB 1SRZA 3CALA 2FZZA 1C5TA 1EASA 3SQHE 3EDXB 3SNEA 1A3EH 2GCHF 1J17T 2PHBA 4MVNA 3S9BA 1S0RA 1UJ1A 5DP8A 3MHWU 2GCTC 2AMQA 1GCDA 3A85A 3WWBA 1G37A 2D26C 1Q3XA 1BJUA 4FOUC 2A32A 1DE7H 3RC5A 2P94A 1HXFH 2EI8A 1HDTH 1JOUB 1TNIA 2GDDA 3RXMA 4BAKB 1T4UH 2PP6A 4NSYA 4YNXA 3ZZ3A 1HUTH 1U6QA 1GBDA 1E37B 1LTOA 2PLXA 1S6HA 2GP9B 3TLOA 2RA3A 1A0HB 1O3LA 2A31A 2JIZD 1GJDB 4XOJA 4ZHMU 5HYOA 2VVCA 1VGCB 1UTLM 2PSXA 3P92A 3SV8A 1KLIH 3NCLA 3U8OH 2BB4A 2ZFPH 3M35A 3M3VA 3P8OA 1BOQA 2YMSC 2A4OA 2RDLA 4HFPB 1K0HA 1G3DA 4XSKU 4B73A 1OWJA 3D23A 2F4LA 2R0KA 3QWCH 5GJ4B 3ZVDA 1SGQE 4Q7YA 1C9PA 4UFGH 1Y59T 4MNXA 2SNVA 1F2SE 3ZVFA 2H9EH 4JYTA 1DSTA 1QJ1B 2OQ5A 1UVSH 2Z3DA 2A1DB 1E36B 4OGXA 3M36A 2QXHA 1FIWA 3SV9A 3RXBA 3AAVA 1SGTA 1P57B 3ZZ5A 1KTSB 2W5EA 3NZIA 1NU7B 4PROA 4X2XA 3ZIAD 3B8JA 2PWXA 1EJMA 2DE8A 1GJ8B 1VZQH 1OP8A 3SV7A 3RXEA 3HPTB 4Y0YE 3KHVA 2M5TA 2OC8A 2CF8H 3PMAB 3FZZA 2VNTA 1IQJA 3BTME 4X8VH 1P09A 2V35A 3DT0H 2CXVA 4I7YH 1SLUB 1IQHA 2ZA5A 4ZAEA 1GBIA 3PTBA 4X6MA 5JDUB 2KCAA 4DGJA 4WVPE 4A5WB 1C1RA 3SGBE 1HJAC 1TNLA 1FV9A 2RCEA 5DKMA 1NFWA 1DPOA 4I8KA 3TJOA 1Y8TA 1P9UA 3STJA 4B6EA 1SS2A 2GZ7A 1C5PA 2PR3A 3M7UA 1C1TA 1H2QP 4MTBA 1MD8A 1IHTH 3RLWH 1CT2E 3ZZ6A 3S0NA 1BTXA 1JXPA 1NESE 1W12U 1RRKA 1QY6A 5EQQA 1GI0A 2ZHWH 2EA3A 2GZ9A 1A3BH 4JZ1A 2AFQB 5KECA 4AYMA 3QTVH 1H4WA 2GGVB 1P05A 3AVZA 1QO6A 2J98B 2J92A 2EC3A 4ZH1D 1KDQB 2GDEH 1QJ6B 4DJZB 3A7WA 3E3TA 3OSYA 1VITG 4WY3A 2LOJA 2W80A 1TABE 1QRWA 1TOCB 2VWMA 1GMCF 1U5MA 1ZPCA 3PV2A 4YTAA 1RGQA 1VJ9U 3V0XA 3OY5U 1MH0A 5EOKA 1O2VA 2FOGA 3GYLB 8LPRA 5HM2A 3A8BA 1O35A 1MTNC 3E6PH 2STAE 4TWYA 3U98H 1RIWB 5EPNA 3M7PA 3GCTG 2FDAA 3Q76A 3H7TA 2WZQA 4I33A 3KXVA 2P8OC 4AFZA 1DLEA 3A7XA 1O3JA 2WYGA 4WWYA 1GL0E 3GY8A 2W6JD 1C4U2 4FXGH 3QDZB 3UY9A 3VGCB 2FYRA 3OP8A 2G4TA 1A5HA 2QF0A 1TGSZ 3EGKH 2GD4B 3GICB 3ZZ4A 1OWHA 1A61H 4BXWA 1O32A 2O8WA 2GZ8A 2ODYB 1NS3A 2JH6D 2H2ZA 5I46H 5LPEA 1P2NA 1GWAA 1LKBA 2ZGXH 1C5UA 4XRNA 3Q3KA 2AERH 4AC9A 3EQ0H 1TX6A 1OKXA 1PYTC 5AFZH 1DXWA 1EPTB 2FEQH 1OHHD 1SFQB 1VCPA 3A87A 5HMAA 1LCYA 3E0NB 3SHAH 3NFPI 2ZFSA 4FUDA 2ZU2A 1HAPH 6CHAB 2Y5HA 1YPKH 1BUIA 1MTSA 1HV7A 2I6QA 1D9IA 2Y7ZA 1ELEE 4K5ZA 1O30A 2IOTA 1C2GA 2HALA 3PLBA 1A5GH 1FXYA 4KP0A 2P3FH 1ZR0A 1GG6B 3FP8E 2VIDA 1ORFA 3C1KA 4D9RA 3ERBA 1OJYA 1O2GH 3SBKA 3RXRA 1V2RT 2GCHG 2VWOA 1EQ9A 2BXUH 4CHAB 5C17A 3TJNA 5C1UA 2I6SA 2BQWB 1PPFE 4NWLA 2PUXB 5SGAE 1GKNA 1SSXA 2Q6DA 4AYVB 2BY5X 1GJ5H 3FP7E 1UTQA 3MH7A 1W11U 1N1LA 3PO1B 4THNH 1N6YA 2AYWA 2L6OA 2ZHDA 1OJVA 4RSPA 3P95A 2ZDAH 1JRTA 5C94A 5JBBS 1FPHH 4A1TA 5E2OA 1TFXA 3LGUA 5T6FA 2SNWA 1HXEH 1ESTA 3ZVBA 1H9IE 1O2KA 4CH8B 3OU0A 1N6XA 1G32B 4APLA 2Z3CA 3ZZ7A 3P8FA 4YXWD 2A4GA 4X1NU 4YT7H 1HAHH 3TGJE 4CRGA 1O5CB 4DOQA 5DJ7A 1CA0C 3VG8A 1V2WT 4F55A 1CHOF 4MNYA 2C8XB 4NA8A 1H04P 3HKJB 1TX7A 2RKYA 1ZRBA 3P17H 4LOYH 3TU7H 1XX9A 1C5LH 3FFGA 2GX4A 3D62A 4ABAA 1BMAA 1HAVB 2Z9IA 1YLCA 1MUEB 2BDCA 3RUOA 2ILNA 3VWOA 3M5NA 1DY8A 2C3SA 1BRBE 3UNQA 1GL1A 1C5RA 2O8LA 1W0YH 1ZTKA 3CS7A 1BTWA 1C1ZA 4LOTA 2HNTE 1QNJA 3PLPA 1FY8E 1TONA 2JRAA 3FO8D 1BTYA 4ZXYH 3BF6H 2WV5A 1BDAA 1DVAH 3TH3H 6LPRA 4YM9A 3V12A 5EJLA 3BTQE 3FAOA 3SGQE 1GMHF 4AGKA 2B5ID 1BMLA 2LPRA 3LPRA 2XWBF 4M7GA 3SW2B 5TJXA 1ELBA 2EI7A 1LMWB 4DT7B 4O3TA 9ESTA 5EIYA 2J4IA 3TGIE 1TBZH 3IG6B 1C1NA 1GBJA 1RLHA 1KXAA 1LHEH 3LJOA 2BY8X 1HAYB 5L6NH 1G36A 1XUFA 1ACBE 1T8OA 2WPJS 2NU1E 2STBE 3MH6A 4AOQA 1O3DA 1SG8B 3BTWE 1ABIH 3KQCA 1Y5BT 1ZGVA 3MTYA 3DFLA 4X2YA 3SJOA 3TJUA 2G52A 5ESTE 2VIPA 1GI5A 1JMOH 3GCHC 4GAWA 3TPIZ 1RJXB 4JZIA 4Y8XA 1ZMJA 3RXIA 2V3OH 1A46H 1M9UA 1SOZA 5EJZA 4D9QA 1JWTA 1ZSJA 3OTJE 2XTTB 5CHAB 3ZV9A 1OXGA 2VWLA 5FX6A 4A92A 3MWIU 3QZRA 1O2LA 2AHME 2FTLE 3TVJA 1OP2A 5L2ZH 2ZPQA 1GMCG 4F49A 1S6LA 4CRAA 1FI8A 2D1JA 2QCYA 4MG3A 3E0PB 4E05H 3F9HA 4ZUHA 5C67A 4YLQH 2UUKB 3WSXA 4UONA 1UTOA 3RMMH 4ABFA 2XC0A 3SNCA 2ZTZA 1EZXC 1HAIH 3KYFA 1O5DH 3GY6A 3RXCA 2ANYA 2KMSA 2BD9A 3ATLA 1NO9H 4MQAA 2F9VA 1ANBA 3MU8A 5J4QA 1THRH 1AY6H 1EAXA 3K6ZA 4NG9H 1NBME 5A8XA 1SC8U 1XVOA 1O5EH 2PKAA 2WPDD 4U30A 1LHCH 4HI3A 2VVUA 3AW1A 3MQKC 2Y7XA 1O2TA 1GBMA 2FI4E 2CHAC 3ZVCA 3F9GA 3SU6A 2O8MA 2MCZA 2Z7FE 2BY7X 5B6LA 5I0QB 1H8DH 1THPB 3M37A 3LOXA 1FMGA 4HZHA 3BTHE 1FN8A 1ZZZA 3O8BA 1C4Y2 1RS0A 1KXBA 4A1VA 5IK2D 3OXUD 1ESBA 1ARBA 3SHCH 4YOJA 4CR9A 2P93A 2Y5GA 1DDJA 1J8AA 2WPHS 5DP7A 3PLKA 1JRSA 1UTNA 1GHXH 1O3GA 1BMNH 5A0CA 4MDSA 1SHHB 7GCHF 1GI1A 1HFHA 1MU8B 4Q2KA 2BQ7B 4AG1A 2R0LA 1W13U 3E1XB 4JZFH 1AFEH 1GCTB 3F68H 3M7QA 3ZD2A 5ESBA 2GV7A 1EKBB 3MH4A 5LH8A 2OXSA 4NIYA 3LGIA 1AVGH 1BHXF 5T6GA 4X6OA 5EQSA 5GXPA 1ZHRA 2ZFTA 2EEKA 1TPPA 3RXOA 1UCYK 1O3AA 1QB1A 1NN6A 3V3MA 1LPKB 2FPZA 1MZAA 1C1OA 2IJD1 2TGAA 1VITH 1AFQB 5FAHA 4ONTD 1NBMD 5EXNA 2R3UA 1O33A 1GJCB 4WH6A 4K12A 1CBWC 5DG6A 2RL0A 1GBHA 1TNHA 1HAOH 2WV9A 2GKVE 2G55A 1IQKA 2R9PA 3KEEA 5HM9A 2FOEA 4U32A 1IOEA 1C2LA 3OE7D 1NRQH 1ELGA 3F6KA 4B6FA 4Q7XA 4PO7A 1CE5A 1O5GH 1BMMH 3SU2A 2Y5FA 2D2DA 1D3PB 2ZU5A 3GDSA 3A84A 1KTTB 4AYYB 1P9SA 3ELAH 1ELVA 3D49H 1FY4A 3ZZ9A 2XYAA 1Z7KA 3F6UH 5JBTA 4A1XA 1QUBA 1OOKB 1DUEA 1P11E 1CHOG 3MO3A 1W0KD 2FOAA 2OK5A 1Y3VA 2OQUA 2ESTE 2ZCLP 1SGCA 1C1PA 3N7EA 4OM9A 2ZDVH 1AGJA 3HK3B 1GJ6A 1K1MA 3A89A 3UOUA 2BVRH 1O2PA 4D76A 1V2OT 3M61U 1SB1H 3PV5A 3VFEA 3RM2H 3QLPH 1SQRA 1GHBF 2ODPA 1TRMA 5DN6D 2BY6X 1KY9A 2YRAA 2PKSC 3ZRZA 1GBCA 4CRCA 1UCYH 1UVOA 5F8ZA 4JZDH 3WW7A 1NTPA 3S7KB 1X7AC 4X8SH 2RLPA 2ZHFH 1FIZA 1TPSA 2BYAX 3A8AA 1GJAB 1GMHG 2UWLA 2ZEBA 4ISLA 4ZXXH 4BNRA 5DPAA 4NFEA 4U2WA 1O3FA 1SQAA 1LQEA 1UTJA 2ZPSA 1F0RA 3R62A 1MTVA 4CR5A 2GMTB 1O2JA 1S84A 4A5TS 5EW1H 4IMQA 2BD2A 1B0FA 3HK6B 3NRLA 1PJPA 1AB9C 1GVKB 2A4QA 4UFDH 4DG4A 2ZO3H 2EC9H 5DP6A 5C5NA 4IBLH 3M5OA 1VVCA 4H6TA 4KTUA 4JK5A 4B74A 3M3SA 4JHSA 2GCTB 1ELAA 3ENSB 1MCTA 1NPMA 2ASUB 3LGVA 4DIIH 3BEUA 1W7XH 3TK6A 2O39C 1GI8B 1P0SH 2XBYA 3UUZA 1MBMA 3T62A 1THSH 1T4VH 1EFRD 2A7JA 4A7IB 2O9QA 2VH6A 2QXJA 4Q63A 2AIPA 2OBQA 4CBOA 1NRNH 2AMDA 4HG6A 5TCCA 1DUAA 1QQUA 2ZCHP 2EY4C 2ZG0H 4JK6A 3T2NA 3RDZA 3VXFH 1KXEA 1TBQH 2XBXA 2B0FA 3PYHA 2FTMA 1G3CA 1GVLA 1O38A 1C1MA 2YMSB 3P70B 1MAXA 5GNDA 4CH2B 1K1LA 2Z6BD 1PQ7A 1DY9A 1QZ8A 1TGNA 1GI9B 1Q31A 2TGTA 3O8EB 4AB9A 4RKOB 1BRUP 2Q1JA 1VVDA 5LGOA 1W0ZU 4BAHB 2PFEA 3URDA 2GT7A 5DP3A 4DVAU 2FI3E 1ANCA 4BANB 3UWJH 5E2PA 2Z9JA 2BOKA 1CGIE 1QHRB 1VCQA 4TWWA 1SVPA 4F48B 1FONA 1BBRK 2ZGBH 5GCHF 1SGPE 1K21H 3QO6A 3RMOH 1SHYA 1YPGH 3QTOH 1OSSA 3RXHA 3BTGE 5HZPB 1KMHB 2IPHA 3PMBB 1OJWA 1TYNA 1OWEA 1DX5M 3A83A 3M5MA 5IYTA 2GV6A 4IW4E 2QXIA 2H6MA 3DA9B 4TYDA 3A7TA 3EJHA 4DT4A 4BWCA 2Z9LA 1ZMNA 7GCHG 1DWDH 1SLWB 4Q7ZA 2BD3A 1B5GH 1Y3WA 2Y6TA 4Z6AH 1GPZA 3OEDC 4INLA 1OP0A 1HJAB 1YCPK 1CGJE 4ZROA 2QN5T 2A2XH 2KCYA 2JDID 3QX5H 4O3UA 1QJ7B 4MSLA 3RU4T 4R8TB 3RMNH 4WF8A 4I8JA 5JB9S 4B2RA 2C4FH 1QGFA 1HAXB 3BG4C 2IZ3A 4WMEA 3SV6A 1YLDA 1OK9A 3B23B 3FP6E 1NFYA 2OLGA 1Z6EA 3UQVA 2SGEE 1GDNA 1J14A 2IJOB 2WPLS 1MTUA 1SGFA 3UR9A 1D3QB 3RXUA 1O31A 2A7CA 3T29A 4JYUH 3GY7A 3Q00A 2V3MA 1FY5A 1OX1A 1V6DA 3EAJA 3F0PA 3GDUA 1K28D 2ZDNA 3LC3A 2JGWA 5FCKA 3SORA 4GLYA 1BHXB 1EB2A 1BBRH 1F92A 1K1PA 3IWMA 4X2VA 3T5FH 2HLDD 2ZYCA 5AHGH 3RXFA 1MTNB 1G4GA 2MCYA 1IHSH 4WXVA 4FUCA 1NROH 1GBKA 3RLYH 4E06H 1AZ8A 2JJ1D 2Y8RA 2P8OB 4X1RU 1WU1A 1EUFA 3GYMA 2B5TB 4JMYA 2QA9E 4C16A 3UFAA 2ZC9H 3M3TA 3FGRA 2Q6FA 1CSOE 1FY1A 3FOAA 2OC1A 1WV7H 2FLRH 5C2ZA 2AGGX 1MBQA 1NU9A 5JYIA 1V2NT 2BHGA 4AFUA 1C1SA 2NU3E 4YZUA 4ACAA 1D3TB 1YCPH 1MD7A 2J97A 5L2YH 1BQYA 1TRNA 1GHBG 2ANMH 4WH8A 1EOJA 3SU0A 2WHXA 1ZTJA 2EI6A 5IDKA 3N99A 2XW9A 2C90B 1L1NA 1YPEH 1HCGA 2HNTC 4TPYA 1COWD 2B8OH 2F9NA 4FUIA 1HIAA 3WWFA 1CT0E 3AAUA 1E5GA 2C8YB 3GXEA 3H7OA 1JBUH 1NRSH 1AKSB 1DFPA 1V3XA 3ZV8A 5K0HA 3DHKH 2Z3EA 3SU4A 4RI0A 5C0UA 2UWPA 5PTPA 3L3TA 4WJG2 2DUCA 3RC6A 1ELFA 1ABJH 2F43B 4Y71A 4ZCNA 3PRBA 1RIWC 1PPHE 1BMFD 5DN5A 1TQ7B 3BEFB 1MMJN 1TOMH 1OWDA 2UUJB 1K1JA 4X1QU 2OP9A 2UUYA 2ANKH 1K1NA 1F0UA 2ZIQH 4DW2U 1WTHD 1GI4A 2B9LA 1V2LT 1G30B 1GJBB 1C5YB 2CK3D 3G01A 1XUGA 2G00A 1LY2A 2Z9GA 1NFXA 3AASA 4LZ1H 1TE0A 1TMTH 1WOFA 5C0TA 3PMHB 3TH4H 1DOJA 3VXEH 1O2MA 1SGEE 3OEHD 4Y0ZE 2ZNKH 2CV3A 1OPHB 4OS7A 4YESB 4NA7A 1A2CH 1EPTC 2ZI2H 3V13A 3KL6A 4CRBA 2VGCB 4XFQA 4AGJA 1TPNA 1GI2A 2V0BA 1ZTLA 2QY0A 2CMYA 4YLUA 5DSFA 5C3NA 1YPHE 3NXPA 1MKXK 1Q2WA 1O3NA 1YPJH 2KFWA 1E34B 2TGPZ 4GHQA 4B2AA 4X1SU 3E16B 1CGHA 1CA0B 1HFIA 1QTFA 2FS9A 3EA9A 1V2UT 1BCUH 1GGDB 2RG3A 3QGNB 4YIZA 1BTHH 1WDIA 1XM1A 1RFNA 1T8LA 2AGIX 1Z8RA 1GHAF 1OWIA 1J9CH 3RXDA 1EP6A 4J38B 2VIVA 1FN6A 1PPEE 4X8TH 4RN6A 1IQGA 1K22H 1FLEE 2AH4X 1MAYA 1F5RA 5T3HA 1AWHB 5GCHG 4NIVA 3SUEA 3ZVAA 1K1OA 2FIRH 1C5QA 2ZKSA 5FPYA 1O3EA 3SJ9A 4ZKSU 4P02A 5FO8C 3A80A 3KCGH 2XQWC 5DP4A 2ZFRH 4AORA 2F91A 1Z8IB 2XRBA 1P2IA 1D3DB 3ZLEA 1D4PB 1P01A 5TCAA 3UWIA 3SZEA 3UREA 3MNCA 5E0GA 1WQSA 1JIRA 3UAIC 1C4V2 1ZPZA 4AYEA 2FS8A 4DCDA 1C2HA 1FX0B 4X2WA 1T7CA 4Q80A 1UHBA 2CG6A 1TNKA 4B75A 1IAUA 4KTCA 3PWBA 4DIHH 1C9TA 3BTDE 2WYJA 2FLBH 3BN9A 3TGKE 4RT0A 1GHQB 1QIXB 5FL7D 2UWOA 1E35B 2CF9H 5E0HA 1SGFG 3NUMA 1BRAA 1Z71A 4NA9H 1YPLH 2ZZUH 3A7YA 1BIOA 3LKWA 3BIVH 1AQ7A 1TIOA 2HPPH 1MKXH 1QRZA 1OK1A 4IC6A 1P3EA 2XCNA 3GCHB 1O34A 4B1TA 8GCHF 1D6WA 2H9HA 1NFUA 3UIRA 1INCA 3K3TA 1PQ8A 2OINA 1KYNA 1C2JA 1UVPA 2HVXA 4VGCC 1C2MA 3NWUA 2FOMB 3LT3A 1YBWA 3UR6A 2J2UA 1XUIA 2UUFB 2ZU1A 5ABWA 1O3OA 3QN7A 1T8MA 4DY7B 3SOSA 1C5VA 2ZFQH 3IITA 4AX9H 4IN1A 5FBEA 2VINA 1UMAH 2ALVA 2W3KA 4NCYA 3SUGA 2XCFA 2ZU3A 3LU9B 1C1WH 1MKWK 4NIXA 1CT4E 1IQNA 1YYY1 3K65B 1C1QA 1VCWA 2GJGA 3F2FA 2WUBA 2PGQB 2FOFA 2A5KA 5T6DA 1AMHA 3TIUA 3M7TA 3LC5A 1QRXA 2BDIA 2WPMS 1BA8B 3NK8A 3A8CA 2SGDE 4MPVA 3ZZ8A 4MLFB 2GT8A 1VJAU 1F0SA 2CG7A 3OFND 1AU8A 3Q77A 2CHAB 1GKGA 4BTUB 3SU1A 3JZ2B 2BM2A 4WMDA 1GBBA 2ZHEH 1F5KU 4Y79A 1V2QT 2XRDA 1N8OC 3I77A 4H6SB 3DCLA 4IS5A 2OBOA 3KQEA 3RXAA 2HLCA 1H8ED 5FCRA 3TK9A 2Y82A 3E90B 4K60A 3ZYEA 2PTCE 1G9IE 1NC6A 4O9VA 2WINI 4FU8A 1W7GH 1PPCE 4TSFD 5EPYA 9LPRA 3QZQA 3MMGA 2BXTH 1E38B 1UTPA 3A86A 1PFXC 2W7UA 2SGQE 4BOHA 2BY9X 2X2ZA 1SLVB 1NRRH 2ZU4A 2Z94A 2ZDKA 1Z92B 4MPXA 1HIAB 5F03A 1IQLA 3RU4E 1LHDH 2CGAA 1L4ZA 4OS6A 4FU7A 1V2JT 4ABEA 1S81A 3K9XB 3WSYA 2Z9KA 3EE7A 2XC4A 1GBTA 1MKWH 3UQOA 3S69A 1ANDA 1HGTH 2BVSH 1TGBA 2QYIA 1CQQA 3SN8A 1CBWB 2Y81A 1C5SA 4B71A 4ZH8A 1HNEE 2QXGA 1C1VH 1TBRH 3F2HA 4TT3D 5EGMA 1T31A 1UK3A 2V8EA 1HFDA 3IU3I 2ZHQH 5FHTA 4Y11E 2G5NA 1FUJA 1S6FA 2PV9B 3C27B 5I25A 8ESTE 1H8IH 2BMGB 1SQTA 1V2PT 1FBRA 1SGRE 1O2NA 1O2HA 2Q6GA 4UDWH 3SUDA 2HNTF 2BX3A 3FN8A 3T26A 1XKBC 4AN7A 2C8ZB 1YWUA 2A2QH 1P03A 5HYUB 3N7DA 2BX4A 2JETC 2F9OA 2H9TH 2C8WB 3SUFA 2J98A 1GHAG 1CKLA 2QY0B 3P8GA 1KDQA 4HTCH 4JYVH 4DJZA 2XRCA 1G2LA 4I31A 3BV9B 3FZDA 3RXKA 4AFSA 4FETA 2BDAA 3OAAD 1W14U 3RXTA 1T8NA 1AIXH 3MNBA 2J38A 2RDEA 4IN2A 3KN2A 3FKSD 2O8UA 3TNTA 3RXGA 1QBNA 1FJSA 2PKSB 5HGGA 1H9HE 2VIQA 5DO4H 1LO6A 3SJ8A 2BDHA 4BTTB 4J1YA 4OS5A 1YF4A 4YOGA 2FESH 1G4FA 2FX6A 3O8DA 1P10A 1O36A 6GCHF 3VB3A 2G51A 1SPJA 1O3CA 5HYPA 3PRDA 2PUQH 1WBGB 4ABJA 1P04A 2ZTXA 1IQEA 1C2KA 1E8BA 5GIBA 1XUKA 1L4DA 4GSOA 1DWEH 2OTVA 1XXDA 5CMXH 3N7OA 3UOPA 1FPCH 3MQLA 3SJKA 2L74A 1WYKA 4YT6H 1HAZB 1MZDA 1KLJH 3HGNA 3SNBA 2HGTH 5DP5A 2QIQA 2XXLA 1EPTA 2V6NA 1MTWA 1UHBB 3K2UA 1AHTH 2ULLA 3UTUH 2A5AA 4JCNA 4OS4A 4OS2A 1UK4A 8GCHG 1FZZA 1ARCA 1SGIB 2ZWLH 2BLVA 1D6RA 2P59A 3ATMA 1S83A 1UTKA 3KNXA 3RJ3D 2WPIS 4B76A 1HRTH 1WQVH 3CS0A 2BLWA 3I29A 3LONA 1SGDE 4CRDA 2ZF0H 4H4FA 1NM6A 4Y76A 5F6MA 3QK1A 1T32A 1BTPA 1ZHPA 2HVYB 1NY22 2EHFA 2TBSA 1ELDE 1UVUH 1XVMA 3GDVA 1MQ6A 1LHGH 2K8IA 1QB6A 2OC0A 3F1SB 1QR3E 1RD3B 1OYQA 3CNRA 4ZKRU 3GY5A 1UK2A 2F9UA 2LP6A 5A8YA 3PWCA 1K2I1 1BTZA 4B2BA 1QL8A 5DK1A 1KXDA 1BBRE 2KR7A 1QA7A 4NWKA 3BSQA 4LZ4B 1O0DH 1NWVA 1P02A 5AVDA 2PGBB 2SFAA 4N7EA 2VH0A 4XD7D 1DWCH 1XUHA 3ZZCA 3U1JB 4Y8ZA 2ERJA 4AYIA 1BZXE 1DXPA 1J15A 3T28A 4I86A 2G5VA 4SGAE 3TVJB 1O3HA 3ODFA 2QF3A 3F9FA 1Z1IA 6ESTA 5CDFE 3EA8A 3ZZAA 1TGCA 2I2LA 1ZMLA 3TK5A 1C5MD 1QQ4A 2RLQA 2EQNA 3MU4A 4KGAA 1SOTA 3W1EA 2BD4A 2XNDD 1KLTA 3ZLDA 1P06A 4MNVA 1B7XB 1HPGA 3T5OA 4I8HA 1G2MA 5JBAS 1EZQA 1HAGE 2R3YA 1C2FA 3BTEE 3VB6A 2PKAB 1CVWH 1DM4B 5FBIA 2IZ4A 1ESAA 1HAVA 1LKAA 2TPIZ 1ZHMA 1NZQH 4GPGA 4E7NA 1ZSKA 1IQIA 2FM2A 1UOTP 1FQ3A 1ETRH 3PTNA 3GCNA 4UFFH 2KRIA 2OC7A 1BT7A 1ELCA 1GBAA 1W2KH 1E88A 2A7HA 1VGCC 1MU6B 1DT2A 2BD5A 3LGWA 1GMDF 1O2YA 3RXVA 3RXLA 4CBNA 4JZEH 1KXFA 3BG4B 1DSUA 3DSOA 1FY3A 3T25A 1Z8GA 1UVTH 1O9AA 1O5FH 4K69A 3R3GB 1ZPBA 5A0BA 3FVFB 1DLKB 2ZCKP 3Q3XA 5B6OA 3BEIB 3ZD1A 2UWNA 4BXSA 4Q4LA 1F0TA 2P95A 4AYDA 1IQFA 4BAOB 2K0QA 1A0LA 2LELA 3EA7A 1C1UH 1OWKA 2WPKS 3CENA 5FPTA 3URCA 4KTSA 4GVUA 3PV4A 5FPSA 1ZLRA 3SGAE 1SFIA 4YOIA 1DS2E 1BJVA 1GJ9B 1W8BH 3H09A 5JBCS 3A88A 2W26A 1W10U 1YPHC 2FYQA 3MU5A 3ATKA 4ESTE 5HXFA 1AWFH 3DD2H 1ZGIA 4MUCA 1LQDB 3PMJA 3RM0H 1TRYA 2IPQX 3BG8A 5DGJA 4PZ5A 1QGBA 3U8RH 2AGEX 2O8TA 2FXRA 5A8ZA 2OUAA 1AUJA 3V7TA 3L6PA 3LGTA 3OTPA 2HOBA 1H9LB 7ESTE 1W3CA 5DP9A 3RC4A 2ZQ1A 3S9AA 3HGPA 2BZ6H 2BLQA 1TAWA 1AVWA 5CE1A 1BTUA 1O2XA 1HYLA 3UNSA 3BTTE 3GS9A 1S0QA 1WCZA 4K1TA 3A81A 2BQ6B 4HGCA 3ZVGA 4ISIH 2A4RA 1UW7A 4ISOA 2KAIA 2J95A 3FANA 4Y6DA 1SL3A 2W7SA 3H5CB 6GCHG 1S5SA 1C5NH 1L1JA 2SGAA 5GPIB 3SV2H 2RFKC 1CA8B 1LHFH 1TA2A 4B2CA 4LXBH 1V2KT 2Y8SA 1GDQA 1O2ZA 3SNDA 1P2JA 1A5IA 2TRMA 3ATWA 3F9EA 1PPGE 1TGTA 1EJNA 2CN0H 1TX8A 2VU8E 1TNJA 3T27A 2JKHA 4XBBA 2CJIA 2QE7D 1GBEA 2DE9A 1EP5A 1AUTC 1P12E 4I8LA 1AZZA 2QF4A 2YNAA 2F3CE 4GUXA 4FUFA 5E0JA 3GY4A 1OS8A 2PSYA 1H03P 3U8TH 3SU5A 4INKA 2RKZA 1HJ9A 2SGPE 2W3IA 1O3BA 3PROA 2ODQA 3DUXH 2XBWA 3E91A 5GWZA 4UE7H 1O2WA 3STIA 3UB0A 2BDGA 4LK4A 5JPMH 2P3TB 4MPWA 1TPMA 4DURA 4INHA 3P8NA 3VGCC 3OYPA 1F7ZA 1Z6JH 1RXPA 3F2GA 2Y8TA 4NGAH 3GCOA 4O03A 3ESTA 3KZJA 3SYJA 1AI8H 4BAQB 1EZSC 4FUGA 1O2RA 3LH3A 4NIWA 3SI4H 1MCVA 2A0QB 1AVXA 2BZAA 5A0AE 1C5OH 2XBVA 3SZNA 2SGFE 5T1VA 1EAIA 2PW8H 1O2SA 1SR5C 1QCPA 3MNSA 5EXMA 3BTFE 3MOCA 1ETSH 3F3BA 4RT1A 3TJVA 2KCPA 2WUCA 2ZFFH 6CHAC 3MI4A 5EJ1A 3RXPA 3OX7U 3RXSA 1LPZB 3RMLH 3OEED 2KCOA 5HKKD 1O5AB 1DITH 2H1UA 4ABDA 1PPZA 3VB7A 4Z0KA 1YP9A 1QL7A 1OYTH 2FWWA 2XWAA 2G81E 2YMSD 4AZ2B 2P16A 3SI3H 1HB0B 2KZ4A 1GG6C 3KYGA 2JH5D 4FU9A 3CP7A 2A5IA 4ISNA 1S82A 2FX4A 1GDUA 4X6PA 4CHAC 2YOLA 1CO7E 4XBDA 2BZMA 1TPGA 3GY3A 2NU0E 4AFQA 1H8HD 4MNWA 1FAXA 1EOLA 1H1BA 3TNSA 2VGCC 3A82A 5H4IB 1AD8H 2JGXA 1O2UA 1OK2A 1Z8JB 2VWNA 1V2VT 3PO1C 5HIYA 4ZHAA 3SNAA 1O2OA 4FUJA 2ZECA 4ISHH 3BIUH 1E1QD 4TPIZ
chains in the Genus database with same CATH topology
1KIGH 5F8TA 3PM3A 3GISB 1ZJKA 2BD7A 4F4OC 1BRCE 2F9BH 1ZJDA 1GGDC 4RKJB 4UFEH 2B7DH 1P2QA 2QV1A 3GOVA 1ZRKA 3MYWA 4ABHA 5C20A 1GMDG 1Y5AT 1P2KA 1L0ZA 3IX0A 1SI5H 3L89M 1LVOA 1FNIA 4KKDA 3AW0A 4X8UH 1SGNE 1ETTH 2WIIC 1O5BB 2XWJI 1QFKH 2NU4E 4Y8YA 4D7GA 1GBFA 2ZQ2A 5HYTB 3OY6U 4VGCB 5BPEA 4GCHF 4R0IA 2BD8A 3MNXA 2YBYA 1SMFE 1LPGB 3K6YA 1HBTH 1Y3UA 5K7RA 5J4SA 4XBCA 2VJ1A 1WAYB 2ANWA 1DICA 3SW0X 4O97A 4I8GA 4Y10E 2GVFA 1EX3A 2BOHB 1S85A 4AB8A 3SO3A 2W81A 4WMFA 1O2QA 1LDTT 4XDEA 1C2EA 1ELTA 1ZYOA 4FVDA 2NWNA 1SBWA 2LNCA 1P8VC 3JZ1B 5C1XA 3PB1E 3W94A 1O3IA 1BITA 3EYDA 4X6NA 3I78A 2FI5E 1TNGA 1C2DA 1GI3A 4FUBA 2BDYA 4IMZA 2Y80A 2VB0A 2HPQH 5L30H 1GHYH 3TITA 1DWBH 3RP2A 5A2MH 1V2ST 3L33A 2AMPA 3LDXH 1EAUA 1KXCA 4X0WU 2ZGJA 1N8OB 5F8XA 2D8WA 4ASHA 1A4WH 1V2TT 4FUHA 4XE4A 5EXLA 1NRPH 1P3CA 1O37A 3A7ZA 3E8LA 4NZLA 1RTKA 4IC5A 3KF2A 2F9PA 1C5WB 1PPBH 5EG4A 1SQOA 3VB4A 5CHAC 1K9OE 3A7VA 2ZP0H 4YO9A 3MO6A 4MPUA 3W95A 2YNBA 1ID5H 2BDBA 1TMBH 4ZKOU 1PYTD 2KAIB 5EW2H 2ZTYA 3UPEA 1EZUC 3SJIA 1TPAE 3ZVEA 2J9NA 2THFB 1UCYE 4K1SA 1Y3XA 1XKAC 1AO5A 4BAMB 4LOSA 3NPSA 2XC5A 2JH0D 1H2PP 1SLXB 2J34A 1HCCA 2K1QA 3MU1A 1HLTH 2ZGHA 5AF9H 1GHVH 1GJ7B 1YKTA 2RA0A 1RTFB 1LVBA 3O8CA 3Q3YA 1QBOA 1BB0B 1B0EA 2VIWA 2QGRA 1A7SA 1NT1A 2XNIA 5EODA 1PQAA 3ATIA 3WY8A 4FVBA 4GHTA 1YM0A 4K8BA 1O3MA 1TPOA 3BTKE 2HWLB 4IGDA 1P2MA 4NSVA 1XUJA 3O8RA 1AN1E 3ODDA 1C5ZB 3KIDU 4OGYA 1G3EA 1RTLA 3LIWA 4SGBE 3D65E 5G4BA 2IN2A 4CSYA 3DFJA 4WXIA 4FXGG 1C5XB 1G3BA 4D8NA 3LJJA 1LVMA 5LPRA 2QC2A 2QAAA 1PQ5A 4ZHLU 4K1EA 2G4UA 5JB8S 2ZDLA 5FXLA 2FP7B 4K8YA 2JETB 4UEHH 3TH2H 3VPKA 1QBVH 1AE5A 3HKIB 4K3JA 5JPMG 2FO9A 3SU3A 1O39A 1V2MT 1K1IA 3U69H 1GCTC 3S7HB 4NFFA 3A8DA 3INBC 3LGYA 2A55A 4FUEA 1OK3A 4NZQA 1TMUH 4TY7A 7KMEH 2TIOA 3UNRA 1ZOMA 1GHZA 5C5OA 4Y7AA 4CRFA 1C2IA 1P2OA 4J2YB 4X1PU 2VVVA 3MO9A 3QGJA 3RU4D 1XXFA 2OCVB 4H42U 2A45B 5FX5A 4I32A 4A6LA 2ALPA 3QUMP 1AFQC 1EB1H 2ZPRA 1FDPA 3KGPA 2FOCA 1F5LA 2F83A 1O3KA 3SQEE 3P6ZB 7LPRA 2G7IA 1HJ8A 4KELA 1Y3YA 4TY6A 2V3HH 4Y7BA 2R2MB 1TB6H 1YCPM 2WV4A 1YPMH 1VITF 2BVXH 1MQ5A 5ETXA 1A0JA 5AFYH 4ABIA 1EJAA 3HATH 5EU8A 2ZGCA 5A09A 1QL9A 2XWBI 1JIMA 4BTIB 1GJ4H 1O2IA 3U9AH 1L2EA 2AIQA 4B2SA 1LVYA 4UD9H 4AG2A 1CU1A 1QURH 1PPQA 1GI7B 3ITIA 3NKKA 2CKUA 1SGYE 2BLOA 2C93B 3RXQA 1TA6A 3GCTF 5BRRE 1QB9A 3EE0B 1AKSA 4U01A 3MH5A 1GBLA 1WSSH 3MFJA 3KQDA 2OD3B 1AB9B 3ZYDA 4K2YA 1UTMA 3GOVB 4ABBA 1GI6A 2R2WU 1O3PB 5E8EH 2H5CA 3B9FH 2FODA 4GCHG 1KSNA 1GHWH 1QA0A 4ZKNU 1Z1JA 2AS9A 1TWXB 1E0FD 2BTCE 2PTNA 1L1GA 1TQ0B 1EATA 5EQRA 5GDSH 2J94A 1TALA 1WTGH 2NU2E 2ZDMA 1WUNH 1XMNB 3VB5A 3ZZDA 2GTBA 1ZSLA 2FOHA 4OS1A 3ZZBA 4QT8C 1IQMA 4CREA 2FMJA 4ZMAH 1YGCH 2VIOA 8KME2 3KQBA 3M5LA 1EAWA 1TLDA 3MU0A 3S9CA 2AEIH 2G8TA 3GY2A 1DANH 4ABGA 1EXFA 3R0FA 2H5DA 1Y5UT 2TGDA 1FAKH 4E7RG 1VR1H 1AE8H 1GVZA 2P3UB 5LPFA 1CHGA 2FOBA 2GMTC 1YC0A 2HRVA 1A1RA 3RXJA 1ANEA 1UO6A 1J16A 5C1YA 3LH1A 4D7FA 3U1IB 3VEQB 1SRZA 3CALA 2FZZA 1C5TA 1EASA 3SQHE 3EDXB 3SNEA 1A3EH 2GCHF 1J17T 2PHBA 4MVNA 3S9BA 1S0RA 1UJ1A 5DP8A 3MHWU 2GCTC 2AMQA 1GCDA 3A85A 1G37A 2D26C 1Q3XA 1BJUA 2A32A 1DE7H 3RC5A 2P94A 1HXFH 2EI8A 1HDTH 1JOUB 1TNIA 2GDDA 3RXMA 4BAKB 1T4UH 4NSYA 4YNXA 3ZZ3A 1HUTH 1U6QA 1GBDA 1E37B 1LTOA 2PLXA 1S6HA 2GP9B 3TLOA 2RA3A 1A0HB 1O3LA 2A31A 1GJDB 4XOJA 4ZHMU 5HYOA 2VVCA 1VGCB 1UTLM 2PSXA 3P92A 3SV8A 1KLIH 3NCLA 3U8OH 2BB4A 2ZFPH 3M35A 3M3VA 3P8OA 1BOQA 2A4OA 2RDLA 4HFPB 1G3DA 4XSKU 4B73A 1OWJA 3D23A 2R0KA 3QWCH 5GJ4B 3ZVDA 1SGQE 4Q7YA 1C9PA 4UFGH 1Y59T 4MNXA 2SNVA 1F2SE 3ZVFA 2H9EH 4JYTA 1DSTA 1QJ1B 2OQ5A 1UVSH 2Z3DA 2A1DB 1E36B 4OGXA 3M36A 2QXHA 1FIWA 3SV9A 3RXBA 3AAVA 1SGTA 1P57B 3ZZ5A 1KTSB 2W5EA 3NZIA 1NU7B 4PROA 4X2XA 3B8JA 2PWXA 1EJMA 2DE8A 1GJ8B 1VZQH 1OP8A 3SV7A 3RXEA 3HPTB 4Y0YE 3KHVA 2M5TA 2OC8A 2CF8H 3PMAB 3FZZA 2VNTA 1IQJA 3BTME 4X8VH 1P09A 2V35A 3DT0H 2CXVA 4I7YH 1SLUB 1IQHA 2ZA5A 4ZAEA 1GBIA 3PTBA 4X6MA 5JDUB 4DGJA 4WVPE 4A5WB 1C1RA 3SGBE 1HJAC 1TNLA 1FV9A 2RCEA 5DKMA 1NFWA 1DPOA 4I8KA 3TJOA 1Y8TA 1P9UA 3STJA 1SS2A 2GZ7A 1C5PA 2PR3A 3M7UA 1C1TA 1H2QP 4MTBA 1MD8A 1IHTH 3RLWH 1CT2E 3ZZ6A 3S0NA 1BTXA 1JXPA 1NESE 1W12U 1RRKA 1QY6A 5EQQA 1GI0A 2ZHWH 2EA3A 2GZ9A 1A3BH 4JZ1A 2AFQB 4AYMA 3QTVH 1H4WA 2GGVB 1P05A 3AVZA 1QO6A 2J92A 2EC3A 4ZH1D 1KDQB 2GDEH 1QJ6B 4DJZB 3A7WA 3E3TA 3OSYA 1VITG 4WY3A 2LOJA 2W80A 1TABE 1QRWA 1TOCB 2VWMA 1GMCF 1U5MA 1ZPCA 4YTAA 1RGQA 1VJ9U 3V0XA 3OY5U 1MH0A 5EOKA 1O2VA 2FOGA 3GYLB 8LPRA 5HM2A 3A8BA 1O35A 1MTNC 3E6PH 2STAE 4TWYA 3U98H 1RIWB 5EPNA 3M7PA 3GCTG 2FDAA 3Q76A 3H7TA 4I33A 3KXVA 2P8OC 4AFZA 1DLEA 3A7XA 1O3JA 2WYGA 4WWYA 1GL0E 3GY8A 1C4U2 4FXGH 3QDZB 3UY9A 3VGCB 2FYRA 3OP8A 2G4TA 1A5HA 2QF0A 1TGSZ 3EGKH 2GD4B 3GICB 3ZZ4A 1OWHA 1A61H 4BXWA 1O32A 2O8WA 2GZ8A 2ODYB 1NS3A 2JH6D 2H2ZA 5I46H 5LPEA 1P2NA 1GWAA 1LKBA 2ZGXH 1C5UA 3Q3KA 2AERH 3EQ0H 1TX6A 1OKXA 1PYTC 5AFZH 1DXWA 1EPTB 2FEQH 1SFQB 1VCPA 3A87A 5HMAA 1LCYA 3E0NB 3SHAH 3NFPI 2ZFSA 4FUDA 2ZU2A 1HAPH 6CHAB 2Y5HA 1YPKH 1BUIA 1MTSA 1HV7A 2I6QA 1D9IA 2Y7ZA 1ELEE 4K5ZA 1O30A 2IOTA 1C2GA 2HALA 3PLBA 1A5GH 1FXYA 4KP0A 2P3FH 1ZR0A 1GG6B 3FP8E 2VIDA 1ORFA 3C1KA 4D9RA 3ERBA 1OJYA 1O2GH 3SBKA 3RXRA 1V2RT 2GCHG 2VWOA 1EQ9A 2BXUH 4CHAB 5C1UA 3TJNA 2I6SA 2BQWB 1PPFE 4NWLA 2PUXB 5SGAE 1GKNA 1SSXA 2Q6DA 4AYVB 2BY5X 1GJ5H 3FP7E 1UTQA 3MH7A 1W11U 1N1LA 3PO1B 4THNH 1N6YA 2AYWA 2ZHDA 1OJVA 4RSPA 3P95A 2ZDAH 1JRTA 5JBBS 1FPHH 4A1TA 5E2OA 1TFXA 3LGUA 5T6FA 2SNWA 1HXEH 1ESTA 3ZVBA 1H9IE 1O2KA 4CH8B 3OU0A 1N6XA 1G32B 2Z3CA 3ZZ7A 3P8FA 2A4GA 4X1NU 4YT7H 1HAHH 3TGJE 4CRGA 1O5CB 4DOQA 5DJ7A 1CA0C 1V2WT 1CHOF 4MNYA 2C8XB 4NA8A 1H04P 3HKJB 1TX7A 2RKYA 1ZRBA 3P17H 4LOYH 3TU7H 1XX9A 1C5LH 3FFGA 2GX4A 3D62A 4ABAA 1BMAA 1HAVB 2Z9IA 1YLCA 1MUEB 2BDCA 3RUOA 2ILNA 3M5NA 1DY8A 2C3SA 1BRBE 3UNQA 1GL1A 1C5RA 2O8LA 1W0YH 1ZTKA 3CS7A 1BTWA 1C1ZA 4LOTA 2HNTE 1QNJA 3PLPA 1FY8E 1TONA 2JRAA 1BTYA 4ZXYH 3BF6H 2WV5A 1BDAA 1DVAH 3TH3H 6LPRA 4YM9A 3V12A 3SGQE 3BTQE 3FAOA 1GMHF 4AGKA 2B5ID 1BMLA 2LPRA 3LPRA 2XWBF 4M7GA 3SW2B 5TJXA 1ELBA 2EI7A 1LMWB 4DT7B 4O3TA 9ESTA