1MDAH

Crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
368
structure length
368
Chain Sequence
EKSKVAGSAAAASAAAASDGSSCDHGPGAISRRSHITLPAYFAGTTENWVSCAGCGVTLGHSLGAFLSLAVAGHSGSDFALASTSFARSAKGKRTDYVEVFDPVTFLPIADIELPDAPRFSVGPRVHIIGNCASSACLLFFLFGSSAAAGLSVPGASDDQLTKSASCFHIHPGAAATHYLGSCPASLAASDLAAAPAAAGIVGAQCTGAQNCSSQAAQANYPGMLVWAVASSILQGDIPAAGATMKAAIDGNESGRKADNFRSAGFQMVAKLKNTDGIMILTVEHSRSCLAAAENTSSVTASVGQTSGPISNGHDSDAIIAAQDGASDNYANSAGTEVLDIYDAASDQDQSSVELDKGPESLSVQNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
total genus 57
structure length 368
sequence length 368
chains with identical sequence J
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 1992-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1mdaH00
4U1EI 4J87A 3UR4A 4J73A 3RFGA 4JSNC 5TDHB 4FWWA 2HKRA 2IUPA 3IJ0A 3A0FA 3I7NA 2PM9A 1B9XA 3VA6A 3I7LA 1PBYB 5I5JA 2IUVA 3UVNA 4CC9A 3I7HA 3JZGA 3OKYB 5JWZA 4PNKB 2H9LA 5EARA 4J0XA 1JMZB 3EI1A 2Z2OA 3PVUB 5FA5B 4QQEA 2CO0C 2B4EA 4PSXB 4O3TB 5HQGA 3EI4A 2H47A 4LGNA 2YNOA 5CYKB 3L4OD 4J82A 3SBPA 4GMBA 4FA9D 4LG8A 3EI1B 5SXMA 3OKWA 4CI8A 3KRWB 5FQDA 3IIWA 5H1MA 4GGDA 5EAMA 3V5WB 2B5LA 2YB8B 5HE0B 3FRXA 3ULEC 1S4UX 4CI1A 4K3ID 2AGLA 2H6NA 1NEXB 2I0SA 5HE3B 3VH0A 2I3SA 1RI6A 5EALA 3OTTA 3EI2A 5HE1B 5IT9g 4Y5RD 3I89A 1U4CA 5CXBA 2H6KA 3DWLC 2I3TA 2J57G 5EMJB 3DM0A 3OKTA 5FKRA 3V9FA 2H9NA 3MMYA 1B9YA 5A2Qg 2YBAA 3SBRA 3PSLA 3IIYA 4JSVC 1U2VC 2QC5A 3UVLA 5FKSA 1VYHC 2AGZA 2YNNA 2IURA 3K27A 2OVRB 1MDAH 3I7KA 4ZOYA 4ES0A 2G9AA 2P9SC 3BWSA 3SWSD 3UVMA 3HFQA 1PEVA 1GOTB 4A0BA 3PXWD 4NSXA 2TRCB 5EM2A 1K8KC 3SHFA 2BBKH 3SLED 3IKOA 2H14A 5IJ7E 4L3GD 3AL8A 4EWRA 4IMMA 1OMWB 4A2MA 5B4WA 2AH1A 4GQ2P 5HYNB 2H3XA 3OL2A 3MKSB 5GXIA 2UZXB 5C2VB 5EMMB 3EI3B 2B5NA 3VGZA 4OZUA 2Z2PA 2OK6A 5TEEA 1XKSA 1JMXB 1N6DA 4IA9A 3RMZD 2IWFA 4GGCA 4BUJC 2PBIB 2HJ4A 4BH6A 3AL8B 4QL1A 4ERZA 4FB1D 1JJUB 4CZXA 3JRPA 3MKQA 4JXMA 3SBQA 1MG3A 4GZ8A 4X61B 3RLMD 3ZWLB 2OVPB 4GQ1A 2G99A 4CY3A 3FGBA 3RSEC 2CE9A 2IAAA 2XYIA 2HESX 4L3HD 3SCYA 5I5IA 3JZNA 5KDOB 5HE2B 5EMKB 3KRXB 4TZ4A 3K26A 3U4YA 2GNQA 3OW8A 3UKRC 2XU7A 1FWXA 4BL0A 4A0AA 5I5MA 3J80g 2HJBA 3F3PA 2Q7QA 3N0EA 4JD2C 4D0KA 4CZVA 5CYKA 4L1QD 4CY5A 3C5MA 5GMKn 1XIPA 4J0WA 3C9CA 3PE7A 5IC7A 3FM0A 5FKQA 4FHLA 3AH8B 4J81A 3NVQA 3EG6A 4UI9R 2CN2A 1JOFA 2CO0A 3JZHA 2P9UC 2PM9B 2P9IC 4N14A 2AGXA 4O1QD 3DXKC 4QT8A 1GG2B 1SQ9A 2W18A 4CI3A 4FA4D 2XL2A 2P9PC 5C9ZB 3V7DB 3UVOA 3BG1A 5AMSA 4AOWA 4CI2A 3OL2B 4A08A 2PM7B 3EWEA 4R7AB 3IJ1A 2Z2NA 2MTAH 4GGAA 2I0TA 4J78A 3SMRA 2UZYB 3N0DA 4O3UB 5TEFA 4Y7RA 3EI3A 4E54A 2CNXA 3RRMC 3CFSB 4PXWA 4G56B 3DXMC 4FAND 4JSPC 3C75H 5IGQA 4A7JA 3JROA 3EI2B 4OWRA 4H5JA 3GFCA 3UVKA 5AFU3 2IUQA 5CXCB 5FLXg 1N6FA 4A08B 3I8CA 1P22A 3NVXA 4ERQA 2AGWA 5GSAA 1L0QA 2BCJB 4L9OA 3MXXA 2GC7A 3ORVD 2OJYA 3I7PA 1TYQC 4PBYA 4A11B 1K32A 5K1CC 2H68A 3F3FA 4J84A 4FAVD 3PSCB 1SHYB 3SJLD 3CIKB 4FA1D 1TBGA 4YVDA 4MK0B 3OKYA 1MG2A 3EMHA 1A0RB 3F3GA 4X3EA 4A2LA 4K3JB 3AL9A 2EBSA 3JPXA 5AJAA 3EU7A 4J79A 5IJ8E 4GQBB 3SFZA 5EAPA 4X60B 4U7AA 5CXBB 1PI6A 4CZYA 5IGOA 4J8GA 4CY1A 2YNPA 2H9PA 5H14A 2CE8A 3E0CA 3W15A 4GM9A 4A11A 1GXRA 3MZKA 3JB9L 5K19A 2XL3A 4JT6C 4A0AB 4CY2A 4E5ZA 3I8EA 1NR0A 3AFCA 4H5IA 2OIZA 2J56H 4JSXC 3RFHA 5CXCA 2PM6B 3GREA 2H6QA 2H9MA 5THAA 4J86A 3PXSD 3EI4B 4A09A 3J81g 4J77A 4XYHA 2HYEA 4ERYA 4D6VA 1OLZA 3NVNA 2H13A 3SXTD 3C99A 4J8BA 2HXCA 4XEIC 3P4FA 4HDJA 3PXTD 4PSWB 2I0RA 4E54B 2HKMA 1R5MA 4ESGA 2CN3A 3PVWB 4PC0A 3MZLA 5H17A 3DSMA 4ZN4A 4QRJA 2P9KC 5FKTA 4PBZA 4ZOZA 4O45A 1N6EA 1Q47A 2P9NC 4ZOXA 5EM2B 4GM3A 5EMLB 1ERJA 3ODTA 2B5MA 3BG0A 4X63B 5C2WB 3UKUC 3I2NA 2QXVA 1QNIA 2IWKA 1PGUA 4GM8A 5FXYA 2AH0A 2OVQB 1YFQA 3B7FA 2P9LC 3I7OA 4I79A 2J55H 4A09B 3RN1D 5GXHA 4ZOVA 3RN0D 1XHMA 3CFVA 2AGYA 3L4MD 4FA5D 2OK4A 2YMUA 4Z8LA 3SN6B 3SVWD 3IJCA 4JT5C 4E5ZB 1SQJA 2O9KA 4LG9A 2AQ5A 4A0BB 2GC4A 4AEZA 5TF2A 1GP2B 3JAMg 4KFMB 4XYIA 4O9DA
chains in the Genus database with same CATH superfamily
4U1EI 4J87A 3UR4A 4J73A 3RFGA 4JSNC 5TDHB 2BKLA 4FWWA 2HKRA 2IUPA 3IJ0A 3A0FA 2VDOA 1VZ2A 1GOFA 3I7NA 3O4HA 5M5UA 2PM9A 1B9XA 3VA6A 3I7LA 1JV2A 1PBYB 5I5JA 2IUVA 3UVNA 1GOGA 3I7HA 3JZGA 3OKYB 4CC9A 4PNKB 5JWZA 2H9LA 5EARA 4J0XA 1JMZB 3EQ9A 3EI1A 2Z2OA 3PVUB 5FA5B 4QQEA 3IJEA 2WQ8A 2CO0C 2B4EA 4PSXB 4O3TB 5HQGA 3EI4A 2H47A 4LGNA 2YNOA 5CYKB 3L4OD 3FCUA 4J82A 3SBPA 4GMBA 4FA9D 4LG8A 1H2ZA 3EI1B 5SXMA 3OKWA 3ZDYA 2VDNA 4CI8A 3KRWB 5FQDA 3IIWA 5H1MA 4GGDA 5EAMA 3V5WB 2VDPA 2B5LA 2YB8B 5HE0B 3FRXA 3ULEC 1S4UX 4CI1A 5M5RA 4K3ID 3MVDK 2AGLA 1NEXB 2H6NA 2I0SA 5HE3B 3VH0A 2I3SA 1RI6A 5EALA 3OTTA 3EI2A 5HE1B 5IT9g 4Y5RD 3I89A 1U4CA 5CXBA 2H6KA 3DWLC 2I3TA 2J57G 5EMJB 2VDKA 3DM0A 3OKTA 5FKRA 3V9FA 2H9NA 3MMYA 2EIDA 3VI3A 1B9YA 5A2Qg 2YBAA 1O6GA 3SBRA 4DNUA 3PSLA 3IIYA 4JSVC 1U2VC 2QC5A 3UVLA 5FKSA 1VYHC 2AGZA 2YNNA 2IURA 4G1MA 3K27A 2OVRB 1MDAH 4JHPC 3I7KA 4WK2A 4AN0A 4ZOYA 4ES0A 2G9AA 2P9SC 3BWSA 3K71A 3SWSD 3UVMA 3HFQA 1PEVA 3ZDZA 1GOTB 4A0BA 3PXWD 4NSXA 2TRCB 4BCBA 5EM2A 1K8KC 3SHFA 2BBKH 3SLED 3IKOA 2H14A 5IJ7E 2QR5A 4L3GD 3IUMA 3ZE2A 3AL8A 3EQ7A 4EWRA 3IUNA 4MMYA 4IMMA 1OMWB 4A2MA 5B4WA 2AH1A 4GQ2P 5HYNB 2H3XA 4WK4A 3OL2A 3MKSB 4BCCA 5GXIA 4Z7NA 2UZXB 5C2VB 3O4IA 5EMMB 3EI3B 2B5NA 3VGZA 4Z7QA 4OZUA 2Z2PA 2OK6A 4AX4A 5TEEA 1XKSA 1UOQA 1JMXB 5C92A 1N6DA 4IA9A 3RMZD 2IWFA 4GGCA 4BUJC 2XZGA 2PBIB 2HJ4A 4BH6A 3AL8B 4QL1A 3ZE0A 3ZE1A 1JTDB 4ERZA 4FB1D 1JJUB 2JKXA 1GOHA 3JRPA 3MKQA 4JXMA 3SBQA 1MG3A 4CZXA 4GZ8A 4X61B 1E8MA 3RLMD 3ZWLB 2OVPB 3NIDA 4GQ1A 4Z7OA 3KCIA 2G99A 1VE7A 4CY3A 3FGBA 3RSEC 2CE9A 3QI0A 2IAAA 2XYIA 2HESX 4L3HD 3SCYA 5I5IA 3JZNA 5KDOB 1TYEA 5HE2B 5EMKB 3KRXB 3K72A 4TZ4A 3NIFA 3K26A 3U4YA 2GNQA 3IVMA 3OW8A 3UKRC 2XU7A 1FWXA 1A12A 5C86A 3V4PA 4BL0A 4IRZA 3MUOA 3O4GA 4A0AA 3V4VA 5I5MA 5M5TA 3J80g 2HJBA 3F3PA 1UOOA 2Q7QA 4O2WA 3N0EA 3MUNA 5FFOA 4JD2C 1QFMA 4D0KA 2EIEA 4NENA 4CZVA 3VI4A 5CYKA 4L1QD 4CY5A 3C5MA 5GMKn 1XIPA 4J0WA 3C9CA 3PE7A 2XE4A 3GC3B 4UM8A 3FM0A 5IC7A 5FKQA 4BCDA 4FHLA 3AH8B 1QFSA 4J81A 3NVQA 3EG6A 4UI9R 2EIBA 2CN2A 1JOFA 2CO0A 3JZHA 3IUJA 2P9UC 2PM9B 2P9IC 1C9IA 1L5GA 2AGXA 4N14A 4O1QD 3DXKC 4QT8A 5E6RA 1GG2B 4BP9A 1SQ9A 2W18A 4CI3A 4FA4D 2XL2A 2P9PC 5C9ZB 3DDUA 3FCSA 2HU8A 1VE6A 2QZPA 3V7DB 3UVOA 3BG1A 4DNVA 5AMSA 4AOWA 3NIGA 4CI2A 3OL2B 4A08A 5E6SA 2PM7B 3EWEA 4AN1A 4R7AB 3IJ1A 2Z2NA 2MTAH 4GGAA 2I0TA 3OF7A 4J78A 1H2YA 3SMRA 2UZYB 2VDMA 3N0DA 4O3UB 4O02A 5TEFA 4Y7RA 3EI3A 4RE6A 2VZ3A 4E54A 2CNXA 3RRMC 3CFSB 4PXWA 4G56B 4UM9A 3DXMC 4FAND 1BPOA 4JSPC 5M5SA 3ZDXA 3C75H 5IGQA 1C9LA 4A7JA 3EQ8A 3K6SA 4JHNA 2VDQA 3JROA 4NBMA 3EI2B 4OWRA 4H5JA 3GFCA 3T3PA 1M1XA 1E5TA 3UVKA 5AFU3 5FFGA 3GD1I 2IUQA 5CXCB 5FLXg 1N6FA 4A08B 3I8CA 4AMZA 1P22A 3NVXA 4ERQA 2AGWA 4L1MA 5GSAA 1L0QA 2BCJB 4L9OA 3MXXA 2GC7A 3ORVD 2OJYA 3I7PA 1TYQC 4PBYA 4A11B 1K32A 5K1CC 1UOPA 2H68A 3F3FA 4J84A 4FAVD 3PSCB 1SHYB 4WJKA 3SJLD 3CIKB 4FA1D 1H2XA 1TBGA 4YVDA 4MK0B 5E6UA 3OKYA 1MG2A 3EMHA 1A0RB 3F3GA 4X3EA 4A2LA 4K3JB 3AL9A 2EBSA 3JPXA 5AJAA 3EU7A 4AMYA 4J79A 5IJ8E 4GQBB 3SFZA 5EAPA 4U7AA 4X60B 5CXBB 1PI6A 4CZYA 5IGOA 2HU5A 1K3IA 4J8GA 4CY1A 2YNPA 2H9PA 5H14A 2CE8A 3E0CA 3W15A 4GM9A 4A11A 1GXRA 3MZKA 4NAAA 3JB9L 5K19A 2XL3A 4JT6C 4A0AB 4CY2A 4E5ZA 1VZ3A 3I8EA 1NR0A 4BP8A 3AFCA 4H5IA 2OIZA 2VC2A 2J56H 4JSXC 3RFHA 5CXCA 3T3MA 2PM6B 3GREA 2H6QA 2H9MA 5THAA 2XDWA 3PXSD 4J86A 5HDBA 3EI4B 4A09A 4G55A 1T2XA 3J81g 4J77A 1YR2A 4XYHA 2HYEA 1I2MB 4ERYA 4D6VA 4D9SA 1OLZA 3NVNA 2H13A 3SXTD 2VZ1A 3C99A 4J8BA 2HXCA 4XEIC 5M61A 1E8NA 3IULA 2EICA 3P4FA 4HDJA 3O4JA 3PXTD 4PSWB 1UTCA 2I0RA 1H2WA 4WK0A 2HKMA 4E54B 1R5MA 4ESGA 3IURA 2CN3A 3PVWB 4PC0A 3MZLA 5H17A 3DSMA 4ZN4A 4QRJA 2P9KC 4QAMA 5FKTA 4PBZA 4DNWA 4ZOZA 1O6FA 4O45A 1N6EA 1Q47A 2P9NC 4ZOXA 5EM2B 4GM3A 5EMLB 1ERJA 3ODTA 2B5MA 3BG0A 4X63B 5C2WB 3UKUC 3I2NA 4MMZA 2QXVA 1QNIA 2IWKA 1PGUA 4GM8A 5FXYA 2AH0A 2OVQB 3IUQA 4RE5A 1YFQA 3B7FA 2P9LC 2HU7A 3I7OA 2J55H 4I79A 4NC4A 2VDLA 3RN1D 4A09B 5GXHA 4ZOVA 5M5VA 2VDRA 3RN0D 1XHMA 3CFVA 2AGYA 3QHYB 3L4MD 4FA5D 2OK4A 2YMUA 4Z8LA 3SN6B 3SVWD 3IJCA 4MMXA 4JT5C 4E5ZB 1SQJA 2O9KA 4LG9A 1U8CA 2AQ5A 4A0BB 2GC4A 4AEZA 5TF2A 1GP2B 4G1EA 3JAMg 4KFMB 4XYIA 4O9DA
chains in the Genus database with same CATH topology
4U1EI 4J87A 3UR4A 4J73A 3RFGA 4JSNC 5TDHB 4FWWA 2HKRA 2IUPA 3IJ0A 3A0FA 3I7NA 2PM9A 1B9XA 3VA6A 3I7LA 1PBYB 5I5JA 2IUVA 3UVNA 4CC9A 3I7HA 3JZGA 3OKYB 5JWZA 4PNKB 2H9LA 5EARA 4J0XA 1JMZB 3EI1A 2Z2OA 3PVUB 5FA5B 4QQEA 2CO0C 2B4EA 4PSXB 4O3TB 5HQGA 3EI4A 2H47A 4LGNA 2YNOA 5CYKB 3L4OD 4J82A 3SBPA 4GMBA 4FA9D 4LG8A 3EI1B 5SXMA 3OKWA 4CI8A 3KRWB 5FQDA 3IIWA 5H1MA 4GGDA 5EAMA 3V5WB 2B5LA 2YB8B 5HE0B 3FRXA 3ULEC 1S4UX 4CI1A 4K3ID 2AGLA 2H6NA 1NEXB 2I0SA 5HE3B 3VH0A 2I3SA 1RI6A 5EALA 3OTTA 3EI2A 5HE1B 5IT9g 4Y5RD 3I89A 1U4CA 5CXBA 2H6KA 3DWLC 2I3TA 2J57G 5EMJB 3DM0A 3OKTA 5FKRA 3V9FA 2H9NA 3MMYA 1B9YA 5A2Qg 2YBAA 3SBRA 3PSLA 3IIYA 4JSVC 1U2VC 2QC5A 3UVLA 5FKSA 1VYHC 2AGZA 2YNNA 2IURA 3K27A 2OVRB 1MDAH 3I7KA 4ZOYA 4ES0A 2G9AA 2P9SC 3BWSA 3SWSD 3UVMA 3HFQA 1PEVA 1GOTB 4A0BA 3PXWD 4NSXA 2TRCB 5EM2A 1K8KC 3SHFA 2BBKH 3SLED 3IKOA 2H14A 5IJ7E 4L3GD 3AL8A 4EWRA 4IMMA 1OMWB 4A2MA 5B4WA 2AH1A 4GQ2P 5HYNB 2H3XA 3OL2A 3MKSB 5GXIA 2UZXB 5C2VB 5EMMB 3EI3B 2B5NA 3VGZA 4OZUA 2Z2PA 2OK6A 5TEEA 1XKSA 1JMXB 1N6DA 4IA9A 3RMZD 2IWFA 4GGCA 4BUJC 2PBIB 2HJ4A 4BH6A 3AL8B 4QL1A 4ERZA 4FB1D 1JJUB 4CZXA 3JRPA 3MKQA 4JXMA 3SBQA 1MG3A 4GZ8A 4X61B 3RLMD 3ZWLB 2OVPB 4GQ1A 2G99A 4CY3A 3FGBA 3RSEC 2CE9A 2IAAA 2XYIA 2HESX 4L3HD 3SCYA 5I5IA 3JZNA 5KDOB 5HE2B 5EMKB 3KRXB 4TZ4A 3K26A 3U4YA 2GNQA 3OW8A 3UKRC 2XU7A 1FWXA 4BL0A 4A0AA 5I5MA 3J80g 2HJBA 3F3PA 2Q7QA 3N0EA 4JD2C 4D0KA 4CZVA 5CYKA 4L1QD 4CY5A 3C5MA 5GMKn 1XIPA 4J0WA 3C9CA 3PE7A 5IC7A 3FM0A 5FKQA 4FHLA 3AH8B 4J81A 3NVQA 3EG6A 4UI9R 2CN2A 1JOFA 2CO0A 3JZHA 2P9UC 2PM9B 2P9IC 4N14A 2AGXA 4O1QD 3DXKC 4QT8A 1GG2B 1SQ9A 2W18A 4CI3A 4FA4D 2XL2A 2P9PC 5C9ZB 3V7DB 3UVOA 3BG1A 5AMSA 4AOWA 4CI2A 3OL2B 4A08A 2PM7B 3EWEA 4R7AB 3IJ1A 2Z2NA 2MTAH 4GGAA 2I0TA 4J78A 3SMRA 2UZYB 3N0DA 4O3UB 5TEFA 4Y7RA 3EI3A 4E54A 2CNXA 3RRMC 3CFSB 4PXWA 4G56B 3DXMC 4FAND 4JSPC 3C75H 5IGQA 4A7JA 3JROA 3EI2B 4OWRA 4H5JA 3GFCA 3UVKA 5AFU3 2IUQA 5CXCB 5FLXg 1N6FA 4A08B 3I8CA 1P22A 3NVXA 4ERQA 2AGWA 5GSAA 1L0QA 2BCJB 4L9OA 3MXXA 2GC7A 3ORVD 2OJYA 3I7PA 1TYQC 4PBYA 4A11B 1K32A 5K1CC 2H68A 3F3FA 4J84A 4FAVD 3PSCB 1SHYB 3SJLD 3CIKB 4FA1D 1TBGA 4YVDA 4MK0B 3OKYA 1MG2A 3EMHA 1A0RB 3F3GA 4X3EA 4A2LA 4K3JB 3AL9A 2EBSA 3JPXA 5AJAA 3EU7A 4J79A 5IJ8E 4GQBB 3SFZA 5EAPA 4X60B 4U7AA 5CXBB 1PI6A 4CZYA 5IGOA 4J8GA 4CY1A 2YNPA 2H9PA 5H14A 2CE8A 3E0CA 3W15A 4GM9A 4A11A 1GXRA 3MZKA 3JB9L 5K19A 2XL3A 4JT6C 4A0AB 4CY2A 4E5ZA 3I8EA 1NR0A 3AFCA 4H5IA 2OIZA 2J56H 4JSXC 3RFHA 5CXCA 2PM6B 3GREA 2H6QA 2H9MA 5THAA 4J86A 3PXSD 3EI4B 4A09A 3J81g 4J77A 4XYHA 2HYEA 4ERYA 4D6VA 1OLZA 3NVNA 2H13A 3SXTD 3C99A 4J8BA 2HXCA 4XEIC 3P4FA 4HDJA 3PXTD 4PSWB 2I0RA 4E54B 2HKMA 1R5MA 4ESGA 2CN3A 3PVWB 4PC0A 3MZLA 5H17A 3DSMA 4ZN4A 4QRJA 2P9KC 5FKTA 4PBZA 4ZOZA 4O45A 1N6EA 1Q47A 2P9NC 4ZOXA 5EM2B 4GM3A 5EMLB 1ERJA 3ODTA 2B5MA 3BG0A 4X63B 5C2WB 3UKUC 3I2NA 2QXVA 1QNIA 2IWKA 1PGUA 4GM8A 5FXYA 2AH0A 2OVQB 1YFQA 3B7FA 2P9LC 3I7OA 4I79A 2J55H 4A09B 3RN1D 5GXHA 4ZOVA 3RN0D 1XHMA 3CFVA 2AGYA 3L4MD 4FA5D 2OK4A 2YMUA 4Z8LA 3SN6B 3SVWD 3IJCA 4JT5C 4E5ZB 1SQJA 2O9KA 4LG9A 2AQ5A 4A0BB 2GC4A 4AEZA 5TF2A 1GP2B 3JAMg 4KFMB 4XYIA 4O9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U1E I;  4J87 A;  3UR4 A;  4J73 A;  3RFG A;  4JSN C;  5TDH B;  4FWW A;  2HKR A;  2IUP A;  3IJ0 A;  3A0F A;  3I7N A;  2PM9 A;  1B9X A;  3VA6 A;  3I7L A;  1PBY B;  5I5J A;  2IUV A;  3UVN A;  4CC9 A;  3I7H A;  3JZG A;  3OKY B;  5JWZ A;  4PNK B;  2H9L A;  5EAR A;  4J0X A;  1JMZ B;  3EI1 A;  2Z2O A;  3PVU B;  5FA5 B;  4QQE A;  2CO0 C;  2B4E A;  4PSX B;  4O3T B;  5HQG A;  3EI4 A;  2H47 A;  4LGN A;  2YNO A;  5CYK B;  3L4O D;  4J82 A;  3SBP A;  4GMB A;  4FA9 D;  4LG8 A;  3EI1 B;  5SXM A;  3OKW A;  4CI8 A;  3KRW B;  5FQD A;  3IIW A;  5H1M A;  4GGD A;  5EAM A;  3V5W B;  2B5L A;  2YB8 B;  5HE0 B;  3FRX A;  3ULE C;  1S4U X;  4CI1 A;  4K3I D;  2AGL A;  2H6N A;  1NEX B;  2I0S A;  5HE3 B;  3VH0 A;  2I3S A;  1RI6 A;  5EAL A;  3OTT A;  3EI2 A;  5HE1 B;  5IT9 g;  4Y5R D;  3I89 A;  1U4C A;  5CXB A;  2H6K A;  3DWL C;  2I3T A;  2J57 G;  5EMJ B;  3DM0 A;  3OKT A;  5FKR A;  3V9F A;  2H9N A;  3MMY A;  1B9Y A;  5A2Q g;  2YBA A;  3SBR A;  3PSL A;  3IIY A;  4JSV C;  1U2V C;  2QC5 A;  3UVL A;  5FKS A;  1VYH C;  2AGZ A;  2YNN A;  2IUR A;  3K27 A;  2OVR B;  1MDA H;  3I7K A;  4ZOY A;  4ES0 A;  2G9A A;  2P9S C;  3BWS A;  3SWS D;  3UVM A;  3HFQ A;  1PEV A;  1GOT B;  4A0B A;  3PXW D;  4NSX A;  2TRC B;  5EM2 A;  1K8K C;  3SHF A;  2BBK H;  3SLE D;  3IKO A;  2H14 A;  5IJ7 E;  4L3G D;  3AL8 A;  4EWR A;  4IMM A;  1OMW B;  4A2M A;  5B4W A;  2AH1 A;  4GQ2 P;  5HYN B;  2H3X A;  3OL2 A;  3MKS B;  5GXI A;  2UZX B;  5C2V B;  5EMM B;  3EI3 B;  2B5N A;  3VGZ A;  4OZU A;  2Z2P A;  2OK6 A;  5TEE A;  1XKS A;  1JMX B;  1N6D A;  4IA9 A;  3RMZ D;  2IWF A;  4GGC A;  4BUJ C;  2PBI B;  2HJ4 A;  4BH6 A;  3AL8 B;  4QL1 A;  4ERZ A;  4FB1 D;  1JJU B;  4CZX A;  3JRP A;  3MKQ A;  4JXM A;  3SBQ A;  1MG3 A;  4GZ8 A;  4X61 B;  3RLM D;  3ZWL B;  2OVP B;  4GQ1 A;  2G99 A;  4CY3 A;  3FGB A;  3RSE C;  2CE9 A;  2IAA A;  2XYI A;  2HES X;  4L3H D;  3SCY A;  5I5I A;  3JZN A;  5KDO B;  5HE2 B;  5EMK B;  3KRX B;  4TZ4 A;  3K26 A;  3U4Y A;  2GNQ A;  3OW8 A;  3UKR C;  2XU7 A;  1FWX A;  4BL0 A;  4A0A A;  5I5M A;  3J80 g;  2HJB A;  3F3P A;  2Q7Q A;  3N0E A;  4JD2 C;  4D0K A;  4CZV A;  5CYK A;  4L1Q D;  4CY5 A;  3C5M A;  5GMK n;  1XIP A;  4J0W A;  3C9C A;  3PE7 A;  5IC7 A;  3FM0 A;  5FKQ A;  4FHL A;  3AH8 B;  4J81 A;  3NVQ A;  3EG6 A;  4UI9 R;  2CN2 A;  1JOF A;  2CO0 A;  3JZH A;  2P9U C;  2PM9 B;  2P9I C;  4N14 A;  2AGX A;  4O1Q D;  3DXK C;  4QT8 A;  1GG2 B;  1SQ9 A;  2W18 A;  4CI3 A;  4FA4 D;  2XL2 A;  2P9P C;  5C9Z B;  3V7D B;  3UVO A;  3BG1 A;  5AMS A;  4AOW A;  4CI2 A;  3OL2 B;  4A08 A;  2PM7 B;  3EWE A;  4R7A B;  3IJ1 A;  2Z2N A;  2MTA H;  4GGA A;  2I0T A;  4J78 A;  3SMR A;  2UZY B;  3N0D A;  4O3U B;  5TEF A;  4Y7R A;  3EI3 A;  4E54 A;  2CNX A;  3RRM C;  3CFS B;  4PXW A;  4G56 B;  3DXM C;  4FAN D;  4JSP C;  3C75 H;  5IGQ A;  4A7J A;  3JRO A;  3EI2 B;  4OWR A;  4H5J A;  3GFC A;  3UVK A;  5AFU 3;  2IUQ A;  5CXC B;  5FLX g;  1N6F A;  4A08 B;  3I8C A;  1P22 A;  3NVX A;  4ERQ A;  2AGW A;  5GSA A;  1L0Q A;  2BCJ B;  4L9O A;  3MXX A;  2GC7 A;  3ORV D;  2OJY A;  3I7P A;  1TYQ C;  4PBY A;  4A11 B;  1K32 A;  5K1C C;  2H68 A;  3F3F A;  4J84 A;  4FAV D;  3PSC B;  1SHY B;  3SJL D;  3CIK B;  4FA1 D;  1TBG A;  4YVD A;  4MK0 B;  3OKY A;  1MG2 A;  3EMH A;  1A0R B;  3F3G A;  4X3E A;  4A2L A;  4K3J B;  3AL9 A;  2EBS A;  3JPX A;  5AJA A;  3EU7 A;  4J79 A;  5IJ8 E;  4GQB B;  3SFZ A;  5EAP A;  4X60 B;  4U7A A;  5CXB B;  1PI6 A;  4CZY A;  5IGO A;  4J8G A;  4CY1 A;  2YNP A;  2H9P A;  5H14 A;  2CE8 A;  3E0C A;  3W15 A;  4GM9 A;  4A11 A;  1GXR A;  3MZK A;  3JB9 L;  5K19 A;  2XL3 A;  4JT6 C;  4A0A B;  4CY2 A;  4E5Z A;  3I8E A;  1NR0 A;  3AFC A;  4H5I A;  2OIZ A;  2J56 H;  4JSX C;  3RFH A;  5CXC A;  2PM6 B;  3GRE A;  2H6Q A;  2H9M A;  5THA A;  4J86 A;  3PXS D;  3EI4 B;  4A09 A;  3J81 g;  4J77 A;  4XYH A;  2HYE A;  4ERY A;  4D6V A;  1OLZ A;  3NVN A;  2H13 A;  3SXT D;  3C99 A;  4J8B A;  2HXC A;  4XEI C;  3P4F A;  4HDJ A;  3PXT D;  4PSW B;  2I0R A;  4E54 B;  2HKM A;  1R5M A;  4ESG A;  2CN3 A;  3PVW B;  4PC0 A;  3MZL A;  5H17 A;  3DSM A;  4ZN4 A;  4QRJ A;  2P9K C;  5FKT A;  4PBZ A;  4ZOZ A;  4O45 A;  1N6E A;  1Q47 A;  2P9N C;  4ZOX A;  5EM2 B;  4GM3 A;  5EML B;  1ERJ A;  3ODT A;  2B5M A;  3BG0 A;  4X63 B;  5C2W B;  3UKU C;  3I2N A;  2QXV A;  1QNI A;  2IWK A;  1PGU A;  4GM8 A;  5FXY A;  2AH0 A;  2OVQ B;  1YFQ A;  3B7F A;  2P9L C;  3I7O A;  4I79 A;  2J55 H;  4A09 B;  3RN1 D;  5GXH A;  4ZOV A;  3RN0 D;  1XHM A;  3CFV A;  2AGY A;  3L4M D;  4FA5 D;  2OK4 A;  2YMU A;  4Z8L A;  3SN6 B;  3SVW D;  3IJC A;  4JT5 C;  4E5Z B;  1SQJ A;  2O9K A;  4LG9 A;  2AQ5 A;  4A0B B;  2GC4 A;  4AEZ A;  5TF2 A;  1GP2 B;  3JAM g;  4KFM B;  4XYI A;  4O9D A; 
#chains in the Genus database with same CATH topology
 4U1E I;  4J87 A;  3UR4 A;  4J73 A;  3RFG A;  4JSN C;  5TDH B;  2BKL A;  4FWW A;  2HKR A;  2IUP A;  3IJ0 A;  3A0F A;  2VDO A;  1VZ2 A;  1GOF A;  3I7N A;  3O4H A;  5M5U A;  2PM9 A;  1B9X A;  3VA6 A;  3I7L A;  1JV2 A;  1PBY B;  5I5J A;  2IUV A;  3UVN A;  1GOG A;  3I7H A;  3JZG A;  3OKY B;  4CC9 A;  4PNK B;  5JWZ A;  2H9L A;  5EAR A;  4J0X A;  1JMZ B;  3EQ9 A;  3EI1 A;  2Z2O A;  3PVU B;  5FA5 B;  4QQE A;  3IJE A;  2WQ8 A;  2CO0 C;  2B4E A;  4PSX B;  4O3T B;  5HQG A;  3EI4 A;  2H47 A;  4LGN A;  2YNO A;  5CYK B;  3L4O D;  3FCU A;  4J82 A;  3SBP A;  4GMB A;  4FA9 D;  4LG8 A;  1H2Z A;  3EI1 B;  5SXM A;  3OKW A;  3ZDY A;  2VDN A;  4CI8 A;  3KRW B;  5FQD A;  3IIW A;  5H1M A;  4GGD A;  5EAM A;  3V5W B;  2VDP A;  2B5L A;  2YB8 B;  5HE0 B;  3FRX A;  3ULE C;  1S4U X;  4CI1 A;  5M5R A;  4K3I D;  3MVD K;  2AGL A;  1NEX B;  2H6N A;  2I0S A;  5HE3 B;  3VH0 A;  2I3S A;  1RI6 A;  5EAL A;  3OTT A;  3EI2 A;  5HE1 B;  5IT9 g;  4Y5R D;  3I89 A;  1U4C A;  5CXB A;  2H6K A;  3DWL C;  2I3T A;  2J57 G;  5EMJ B;  2VDK A;  3DM0 A;  3OKT A;  5FKR A;  3V9F A;  2H9N A;  3MMY A;  2EID A;  3VI3 A;  1B9Y A;  5A2Q g;  2YBA A;  1O6G A;  3SBR A;  4DNU A;  3PSL A;  3IIY A;  4JSV C;  1U2V C;  2QC5 A;  3UVL A;  5FKS A;  1VYH C;  2AGZ A;  2YNN A;  2IUR A;  4G1M A;  3K27 A;  2OVR B;  1MDA H;  4JHP C;  3I7K A;  4WK2 A;  4AN0 A;  4ZOY A;  4ES0 A;  2G9A A;  2P9S C;  3BWS A;  3K71 A;  3SWS D;  3UVM A;  3HFQ A;  1PEV A;  3ZDZ A;  1GOT B;  4A0B A;  3PXW D;  4NSX A;  2TRC B;  4BCB A;  5EM2 A;  1K8K C;  3SHF A;  2BBK H;  3SLE D;  3IKO A;  2H14 A;  5IJ7 E;  2QR5 A;  4L3G D;  3IUM A;  3ZE2 A;  3AL8 A;  3EQ7 A;  4EWR A;  3IUN A;  4MMY A;  4IMM A;  1OMW B;  4A2M A;  5B4W A;  2AH1 A;  4GQ2 P;  5HYN B;  2H3X A;  4WK4 A;  3OL2 A;  3MKS B;  4BCC A;  5GXI A;  4Z7N A;  2UZX B;  5C2V B;  3O4I A;  5EMM B;  3EI3 B;  2B5N A;  3VGZ A;  4Z7Q A;  4OZU A;  2Z2P A;  2OK6 A;  4AX4 A;  5TEE A;  1XKS A;  1UOQ A;  1JMX B;  5C92 A;  1N6D A;  4IA9 A;  3RMZ D;  2IWF A;  4GGC A;  4BUJ C;  2XZG A;  2PBI B;  2HJ4 A;  4BH6 A;  3AL8 B;  4QL1 A;  3ZE0 A;  3ZE1 A;  1JTD B;  4ERZ A;  4FB1 D;  1JJU B;  2JKX A;  1GOH A;  3JRP A;  3MKQ A;  4JXM A;  3SBQ A;  1MG3 A;  4CZX A;  4GZ8 A;  4X61 B;  1E8M A;  3RLM D;  3ZWL B;  2OVP B;  3NID A;  4GQ1 A;  4Z7O A;  3KCI A;  2G99 A;  1VE7 A;  4CY3 A;  3FGB A;  3RSE C;  2CE9 A;  3QI0 A;  2IAA A;  2XYI A;  2HES X;  4L3H D;  3SCY A;  5I5I A;  3JZN A;  5KDO B;  1TYE A;  5HE2 B;  5EMK B;  3KRX B;  3K72 A;  4TZ4 A;  3NIF A;  3K26 A;  3U4Y A;  2GNQ A;  3IVM A;  3OW8 A;  3UKR C;  2XU7 A;  1FWX A;  1A12 A;  5C86 A;  3V4P A;  4BL0 A;  4IRZ A;  3MUO A;  3O4G A;  4A0A A;  3V4V A;  5I5M A;  5M5T A;  3J80 g;  2HJB A;  3F3P A;  1UOO A;  2Q7Q A;  4O2W A;  3N0E A;  3MUN A;  5FFO A;  4JD2 C;  1QFM A;  4D0K A;  2EIE A;  4NEN A;  4CZV A;  3VI4 A;  5CYK A;  4L1Q D;  4CY5 A;  3C5M A;  5GMK n;  1XIP A;  4J0W A;  3C9C A;  3PE7 A;  2XE4 A;  3GC3 B;  4UM8 A;  3FM0 A;  5IC7 A;  5FKQ A;  4BCD A;  4FHL A;  3AH8 B;  1QFS A;  4J81 A;  3NVQ A;  3EG6 A;  4UI9 R;  2EIB A;  2CN2 A;  1JOF A;  2CO0 A;  3JZH A;  3IUJ A;  2P9U C;  2PM9 B;  2P9I C;  1C9I A;  1L5G A;  2AGX A;  4N14 A;  4O1Q D;  3DXK C;  4QT8 A;  5E6R A;  1GG2 B;  4BP9 A;  1SQ9 A;  2W18 A;  4CI3 A;  4FA4 D;  2XL2 A;  2P9P C;  5C9Z B;  3DDU A;  3FCS A;  2HU8 A;  1VE6 A;  2QZP A;  3V7D B;  3UVO A;  3BG1 A;  4DNV A;  5AMS A;  4AOW A;  3NIG A;  4CI2 A;  3OL2 B;  4A08 A;  5E6S A;  2PM7 B;  3EWE A;  4AN1 A;  4R7A B;  3IJ1 A;  2Z2N A;  2MTA H;  4GGA A;  2I0T A;  3OF7 A;  4J78 A;  1H2Y A;  3SMR A;  2UZY B;  2VDM A;  3N0D A;  4O3U B;  4O02 A;  5TEF A;  4Y7R A;  3EI3 A;  4RE6 A;  2VZ3 A;  4E54 A;  2CNX A;  3RRM C;  3CFS B;  4PXW A;  4G56 B;  4UM9 A;  3DXM C;  4FAN D;  1BPO A;  4JSP C;  5M5S A;  3ZDX A;  3C75 H;  5IGQ A;  1C9L A;  4A7J A;  3EQ8 A;  3K6S A;  4JHN A;  2VDQ A;  3JRO A;  4NBM A;  3EI2 B;  4OWR A;  4H5J A;  3GFC A;  3T3P A;  1M1X A;  1E5T A;  3UVK A;  5AFU 3;  5FFG A;  3GD1 I;  2IUQ A;  5CXC B;  5FLX g;  1N6F A;  4A08 B;  3I8C A;  4AMZ A;  1P22 A;  3NVX A;  4ERQ A;  2AGW A;  4L1M A;  5GSA A;  1L0Q A;  2BCJ B;  4L9O A;  3MXX A;  2GC7 A;  3ORV D;  2OJY A;  3I7P A;  1TYQ C;  4PBY A;  4A11 B;  1K32 A;  5K1C C;  1UOP A;  2H68 A;  3F3F A;  4J84 A;  4FAV D;  3PSC B;  1SHY B;  4WJK A;  3SJL D;  3CIK B;  4FA1 D;  1H2X A;  1TBG A;  4YVD A;  4MK0 B;  5E6U A;  3OKY A;  1MG2 A;  3EMH A;  1A0R B;  3F3G A;  4X3E A;  4A2L A;  4K3J B;  3AL9 A;  2EBS A;  3JPX A;  5AJA A;  3EU7 A;  4AMY A;  4J79 A;  5IJ8 E;  4GQB B;  3SFZ A;  5EAP A;  4U7A A;  4X60 B;  5CXB B;  1PI6 A;  4CZY A;  5IGO A;  2HU5 A;  1K3I A;  4J8G A;  4CY1 A;  2YNP A;  2H9P A;  5H14 A;  2CE8 A;  3E0C A;  3W15 A;  4GM9 A;  4A11 A;  1GXR A;  3MZK A;  4NAA A;  3JB9 L;  5K19 A;  2XL3 A;  4JT6 C;  4A0A B;  4CY2 A;  4E5Z A;  1VZ3 A;  3I8E A;  1NR0 A;  4BP8 A;  3AFC A;  4H5I A;  2OIZ A;  2VC2 A;  2J56 H;  4JSX C;  3RFH A;  5CXC A;  3T3M A;  2PM6 B;  3GRE A;  2H6Q A;  2H9M A;  5THA A;  2XDW A;  3PXS D;  4J86 A;  5HDB A;  3EI4 B;  4A09 A;  4G55 A;  1T2X A;  3J81 g;  4J77 A;  1YR2 A;  4XYH A;  2HYE A;  1I2M B;  4ERY A;  4D6V A;  4D9S A;  1OLZ A;  3NVN A;  2H13 A;  3SXT D;  2VZ1 A;  3C99 A;  4J8B A;  2HXC A;  4XEI C;  5M61 A;  1E8N A;  3IUL A;  2EIC A;  3P4F A;  4HDJ A;  3O4J A;  3PXT D;  4PSW B;  1UTC A;  2I0R A;  1H2W A;  4WK0 A;  2HKM A;  4E54 B;  1R5M A;  4ESG A;  3IUR A;  2CN3 A;  3PVW B;  4PC0 A;  3MZL A;  5H17 A;  3DSM A;  4ZN4 A;  4QRJ A;  2P9K C;  4QAM A;  5FKT A;  4PBZ A;  4DNW A;  4ZOZ A;  1O6F A;  4O45 A;  1N6E A;  1Q47 A;  2P9N C;  4ZOX A;  5EM2 B;  4GM3 A;  5EML B;  1ERJ A;  3ODT A;  2B5M A;  3BG0 A;  4X63 B;  5C2W B;  3UKU C;  3I2N A;  4MMZ A;  2QXV A;  1QNI A;  2IWK A;  1PGU A;  4GM8 A;  5FXY A;  2AH0 A;  2OVQ B;  3IUQ A;  4RE5 A;  1YFQ A;  3B7F A;  2P9L C;  2HU7 A;  3I7O A;  2J55 H;  4I79 A;  4NC4 A;  2VDL A;  3RN1 D;  4A09 B;  5GXH A;  4ZOV A;  5M5V A;  2VDR A;  3RN0 D;  1XHM A;  3CFV A;  2AGY A;  3QHY B;  3L4M D;  4FA5 D;  2OK4 A;  2YMU A;  4Z8L A;  3SN6 B;  3SVW D;  3IJC A;  4MMX A;  4JT5 C;  4E5Z B;  1SQJ A;  2O9K A;  4LG9 A;  1U8C A;  2AQ5 A;  4A0B B;  2GC4 A;  4AEZ A;  5TF2 A;  1GP2 B;  4G1E A;  3JAM g;  4KFM B;  4XYI A;  4O9D A; 
#chains in the Genus database with same CATH homology
 4U1E I;  4J87 A;  3UR4 A;  4J73 A;  3RFG A;  4JSN C;  5TDH B;  4FWW A;  2HKR A;  2IUP A;  3IJ0 A;  3A0F A;  3I7N A;  2PM9 A;  1B9X A;  3VA6 A;  3I7L A;  1PBY B;  5I5J A;  2IUV A;  3UVN A;  4CC9 A;  3I7H A;  3JZG A;  3OKY B;  5JWZ A;  4PNK B;  2H9L A;  5EAR A;  4J0X A;  1JMZ B;  3EI1 A;  2Z2O A;  3PVU B;  5FA5 B;  4QQE A;  2CO0 C;  2B4E A;  4PSX B;  4O3T B;  5HQG A;  3EI4 A;  2H47 A;  4LGN A;  2YNO A;  5CYK B;  3L4O D;  4J82 A;  3SBP A;  4GMB A;  4FA9 D;  4LG8 A;  3EI1 B;  5SXM A;  3OKW A;  4CI8 A;  3KRW B;  5FQD A;  3IIW A;  5H1M A;  4GGD A;  5EAM A;  3V5W B;  2B5L A;  2YB8 B;  5HE0 B;  3FRX A;  3ULE C;  1S4U X;  4CI1 A;  4K3I D;  2AGL A;  2H6N A;  1NEX B;  2I0S A;  5HE3 B;  3VH0 A;  2I3S A;  1RI6 A;  5EAL A;  3OTT A;  3EI2 A;  5HE1 B;  5IT9 g;  4Y5R D;  3I89 A;  1U4C A;  5CXB A;  2H6K A;  3DWL C;  2I3T A;  2J57 G;  5EMJ B;  3DM0 A;  3OKT A;  5FKR A;  3V9F A;  2H9N A;  3MMY A;  1B9Y A;  5A2Q g;  2YBA A;  3SBR A;  3PSL A;  3IIY A;  4JSV C;  1U2V C;  2QC5 A;  3UVL A;  5FKS A;  1VYH C;  2AGZ A;  2YNN A;  2IUR A;  3K27 A;  2OVR B;  1MDA H;  3I7K A;  4ZOY A;  4ES0 A;  2G9A A;  2P9S C;  3BWS A;  3SWS D;  3UVM A;  3HFQ A;  1PEV A;  1GOT B;  4A0B A;  3PXW D;  4NSX A;  2TRC B;  5EM2 A;  1K8K C;  3SHF A;  2BBK H;  3SLE D;  3IKO A;  2H14 A;  5IJ7 E;  4L3G D;  3AL8 A;  4EWR A;  4IMM A;  1OMW B;  4A2M A;  5B4W A;  2AH1 A;  4GQ2 P;  5HYN B;  2H3X A;  3OL2 A;  3MKS B;  5GXI A;  2UZX B;  5C2V B;  5EMM B;  3EI3 B;  2B5N A;  3VGZ A;  4OZU A;  2Z2P A;  2OK6 A;  5TEE A;  1XKS A;  1JMX B;  1N6D A;  4IA9 A;  3RMZ D;  2IWF A;  4GGC A;  4BUJ C;  2PBI B;  2HJ4 A;  4BH6 A;  3AL8 B;  4QL1 A;  4ERZ A;  4FB1 D;  1JJU B;  4CZX A;  3JRP A;  3MKQ A;  4JXM A;  3SBQ A;  1MG3 A;  4GZ8 A;  4X61 B;  3RLM D;  3ZWL B;  2OVP B;  4GQ1 A;  2G99 A;  4CY3 A;  3FGB A;  3RSE C;  2CE9 A;  2IAA A;  2XYI A;  2HES X;  4L3H D;  3SCY A;  5I5I A;  3JZN A;  5KDO B;  5HE2 B;  5EMK B;  3KRX B;  4TZ4 A;  3K26 A;  3U4Y A;  2GNQ A;  3OW8 A;  3UKR C;  2XU7 A;  1FWX A;  4BL0 A;  4A0A A;  5I5M A;  3J80 g;  2HJB A;  3F3P A;  2Q7Q A;  3N0E A;  4JD2 C;  4D0K A;  4CZV A;  5CYK A;  4L1Q D;  4CY5 A;  3C5M A;  5GMK n;  1XIP A;  4J0W A;  3C9C A;  3PE7 A;  5IC7 A;  3FM0 A;  5FKQ A;  4FHL A;  3AH8 B;  4J81 A;  3NVQ A;  3EG6 A;  4UI9 R;  2CN2 A;  1JOF A;  2CO0 A;  3JZH A;  2P9U C;  2PM9 B;  2P9I C;  4N14 A;  2AGX A;  4O1Q D;  3DXK C;  4QT8 A;  1GG2 B;  1SQ9 A;  2W18 A;  4CI3 A;  4FA4 D;  2XL2 A;  2P9P C;  5C9Z B;  3V7D B;  3UVO A;  3BG1 A;  5AMS A;  4AOW A;  4CI2 A;  3OL2 B;  4A08 A;  2PM7 B;  3EWE A;  4R7A B;  3IJ1 A;  2Z2N A;  2MTA H;  4GGA A;  2I0T A;  4J78 A;  3SMR A;  2UZY B;  3N0D A;  4O3U B;  5TEF A;  4Y7R A;  3EI3 A;  4E54 A;  2CNX A;  3RRM C;  3CFS B;  4PXW A;  4G56 B;  3DXM C;  4FAN D;  4JSP C;  3C75 H;  5IGQ A;  4A7J A;  3JRO A;  3EI2 B;  4OWR A;  4H5J A;  3GFC A;  3UVK A;  5AFU 3;  2IUQ A;  5CXC B;  5FLX g;  1N6F A;  4A08 B;  3I8C A;  1P22 A;  3NVX A;  4ERQ A;  2AGW A;  5GSA A;  1L0Q A;  2BCJ B;  4L9O A;  3MXX A;  2GC7 A;  3ORV D;  2OJY A;  3I7P A;  1TYQ C;  4PBY A;  4A11 B;  1K32 A;  5K1C C;  2H68 A;  3F3F A;  4J84 A;  4FAV D;  3PSC B;  1SHY B;  3SJL D;  3CIK B;  4FA1 D;  1TBG A;  4YVD A;  4MK0 B;  3OKY A;  1MG2 A;  3EMH A;  1A0R B;  3F3G A;  4X3E A;  4A2L A;  4K3J B;  3AL9 A;  2EBS A;  3JPX A;  5AJA A;  3EU7 A;  4J79 A;  5IJ8 E;  4GQB B;  3SFZ A;  5EAP A;  4X60 B;  4U7A A;  5CXB B;  1PI6 A;  4CZY A;  5IGO A;  4J8G A;  4CY1 A;  2YNP A;  2H9P A;  5H14 A;  2CE8 A;  3E0C A;  3W15 A;  4GM9 A;  4A11 A;  1GXR A;  3MZK A;  3JB9 L;  5K19 A;  2XL3 A;  4JT6 C;  4A0A B;  4CY2 A;  4E5Z A;  3I8E A;  1NR0 A;  3AFC A;  4H5I A;  2OIZ A;  2J56 H;  4JSX C;  3RFH A;  5CXC A;  2PM6 B;  3GRE A;  2H6Q A;  2H9M A;  5THA A;  4J86 A;  3PXS D;  3EI4 B;  4A09 A;  3J81 g;  4J77 A;  4XYH A;  2HYE A;  4ERY A;  4D6V A;  1OLZ A;  3NVN A;  2H13 A;  3SXT D;  3C99 A;  4J8B A;  2HXC A;  4XEI C;  3P4F A;  4HDJ A;  3PXT D;  4PSW B;  2I0R A;  4E54 B;  2HKM A;  1R5M A;  4ESG A;  2CN3 A;  3PVW B;  4PC0 A;  3MZL A;  5H17 A;  3DSM A;  4ZN4 A;  4QRJ A;  2P9K C;  5FKT A;  4PBZ A;  4ZOZ A;  4O45 A;  1N6E A;  1Q47 A;  2P9N C;  4ZOX A;  5EM2 B;  4GM3 A;  5EML B;  1ERJ A;  3ODT A;  2B5M A;  3BG0 A;  4X63 B;  5C2W B;  3UKU C;  3I2N A;  2QXV A;  1QNI A;  2IWK A;  1PGU A;  4GM8 A;  5FXY A;  2AH0 A;  2OVQ B;  1YFQ A;  3B7F A;  2P9L C;  3I7O A;  4I79 A;  2J55 H;  4A09 B;  3RN1 D;  5GXH A;  4ZOV A;  3RN0 D;  1XHM A;  3CFV A;  2AGY A;  3L4M D;  4FA5 D;  2OK4 A;  2YMU A;  4Z8L A;  3SN6 B;  3SVW D;  3IJC A;  4JT5 C;  4E5Z B;  1SQJ A;  2O9K A;  4LG9 A;  2AQ5 A;  4A0B B;  2GC4 A;  4AEZ A;  5TF2 A;  1GP2 B;  3JAM g;  4KFM B;  4XYI A;  4O9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...