1MDKA

High resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human nfkb (residues 56-68 of the p50 subunit of nfkb)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Solution structure of human thioredoxin in a mixed disulfide intermediate complex with its target peptide from the transcription factor NF kappa B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (electron transport/peptide)
total genus 21
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1995-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1mdkA00
1SYXA 4Q5NA 2GVPA 2H01A 4JR6A 4GSNA 2YJ7A 1XWKA 4ECBA 3CSJA 2CT6A 3J7Yk 5D96A 4O7HA 1Z9HA 2PN8A 3ZIVA 1OC3A 1F3AA 2BJXA 2H1AA 2HZFA 4RQXA 8GSSA 2CQ9A 3F3RA 5E59A 4MH3A 2J23A 2XBQA 5AIVA 1J0FA 11GSA 3ZIJA 1EV4A 2FGXA 3LXTA 2DLXA 4LLRA 1E2YA 4L8EA 2AV4A 17GSA 1BYEA 1H75A 5DAKB 1NSWA 3KMOA 1JLVA 4ZB9A 2I9HA 4HEA2 1A24A 4OFMA 2JACA 2VM1A 3TRXA 1K0NA 2GT6A 5ECLB 3D22A 1ZZYA 1T3BA 1XPVA 4HJ2A 2LSTA 2B1LA 5B7CA 3FYGA 4OWYA 4MP4A 5DJMA 1BAYA 1NHYA 2I1UA 2NDOA 2LKUA 1EWXA 4FYCA 1R5AA 4FYBA 2CZ3A 3KM6A 3IHQA 1O81A 1BX9A 2OJLA 5F05A 5JWQB 2L4CA 3EVIA 3HVVA 2YNXA 1GSDA 1UC7A 2VLTA 4OO5A 3HD5A 3IA1A 4RI6A 2CX3A 2WDUA 3ED3A 3LQ7A 5CREA 3M1GA 1TRSA 2R6KA 3ZLPA 1A8YA 2H73A 1TXXA 1G6WA 3BCIA 1QXHA 2PBJA 3HYPA 3WT2A 3FZ9A 2HLSA 12GSA 3ZFLA 4ECIA 1THOA 2KLXA 3ME7A 6GSSA 3HJMA 3HJOA 1M9BA 2NPBA 3GYKA 3UARA 2YANA 1GSQA 5IPGA 3ZREA 1UN2A 4V1Ap 3M0FA 1X9MB 1YJ6A 3ZL5A 1ZL9A 1GLQA 2F8AA 4N10A 4N11A 3TOTA 3ZITA 3JCML 2XHFA 1HNCA 4ID0A 4ZBAA 1O6JA 2NVLA 3APSA 2FNOA 3CXGA 5IMFA 5A4VA 3ZRDA 1G0TA 3CTGA 5IO2A 2PWJA 2M80A 3H93A 4POMA 3LSZA 3E9JB 3FR9A 5D8IA 5AISA 2B6MA 2V1MA 5JCGA 3GL5A 5A4UA 5HR3A 3WYWA 4K1FA 4EC0A 4DEJA 3ZVJD 3DRNA 1YZXA 3MNGA 3RDWA 1VF4A 3DWVA 4MJBA 1T4ZA 1V9WA 2FUG2 4IELA 2KUCA 1WWJA 2B5XA 3KGKA 1TTZA 3QR6A 2XPDA 3PH9A 3APOA 2CAIA 1PSQA 2IMDA 4K0NA 2E2GA 2VUPA 2C0EA 1WJKA 3TJKA 5A4WA 3DMLA 3GKXA 4F0BA 3CRUA 2D2ZA 3M8NA 3UJ1A 4E8EA 4KSOA 4KNDA 4ZXGA 2HRNA 2VO4A 3PGTA 4I2TA 3N5OA 3BBYA 2H8LA 5HFGA 3L78A 2GDRA 4O92A 1GSSA 4ZBBA 3NZNA 4PQIA 2XC2A 4PX1A 2C0FA 4GLTA 2KHPA 4TXOB 1THXA 2VAFA 4MJEA 2JL4A 1TU8A 4HOJA 2RUEA 1FAAA 1OVNA 5IM9A 4ECCA 1SK1A 2LTKA 4PXOA 4JEDA 1WE0A 3WD6A 4K9ZA 2CA8A 3TJFA 4LL4B 3QAWA 3A2VA 3G7IA 3FZ4A 3UVTA 2OKAA 2GZYA 4PNGA 2VCTA 1O8XA 13GSA 1GSEA 3KTLA 2TIRA 3QFBC 2GS3A 1M7TA 3QAGA 1SKSB 4GCIA 4TW5A 4EL1A 3LXZA 1PKZA 2A2RA 1HD2A 1GLPA 1X5EA 4ECJA 1KNGA 3KJYA 4L0UA 3GHAA 1VF3A 2EIQA 4KDUA 5ENUA 2H76A 4RUVA 5DCHA 2BTOT 1FHEA 2E7PA 1PL1A 1TK8B 5HQPA 4G2EA 2YPMA 4TVEA 1QUWA 1SENA 5GAPD 3HHVA 1S3AA 3D21A 1J08A 4EE0A 1NW2A 5CRDA 5ECIB 3DKSA 4GSSA 1HNBA 2PVQA 2VIMA 3GFKA 2OBIA 3KP9A 1SD9A 4WBRD 2L6CA 2GSQA 5E4WA 4RI7A 5ABRA 1U87A 1W89A 3F6FA 3WGEA 1G7OA 3PINA 3TCOA 3HZ4A 1MDJA 1ZGNA 18GSA 2L59A 2VCVA 1U3AA 2QKEA 3A2XA 3BCKA 4P3YB 4EVMA 3LFLA 5ID2B 2H72A 3TKSA 4YQMA 2R37A 1JLWA 3GTUA 4MA9A 2HNLA 3UBLA 2Z9SA 1CQHA 3FY7A 1IYHA 1R7HA 3LG6A 2GLRA 2TRXA 4H86A 3C1SA 4E8HA 2JZRA 3CTFA 1XWCA 2K18A 2RUFA 1RW1A 2MYGA 1USBA 3KTBA 3MAKA 5G31A 1DE1A 1EV9A 3D5JA 5C00A 1Z7PA 5ELAA 1XFLA 1YKAA 1GSUA 3KH9A 4K6XA 1ON4A 2A2SA 2H75A 3MWHA 5IOXA 3GH9A 4GXZA 10GSA 22GSA 5CRHA 1FVJA 2WULA 2LQOA 2BMXA 3LJRA 3PR8A 3VPTA 1HNAA 4MMMA 5CRWA 5G1KA 3GRXA 4EF0A 1GUHA 1GUKA 4F9ZA 5IPHA 3C1RA 3LEFA 2VCQA 4GF0A 3VPQA 1OKDA 2YWIA 2J9HA 3TRQA 1NHOA 1AQWA 2K6VA 4OMVA 2O87A 2KP2A 4ISDA 1HQOA 3CBUA 2H74A 1FW1A 4IS0A 2YWMA 2WCIA 3UVHA 1G6YA 2HZEA 5H5SA 5LNKe 2DJ0A 2HSYA 4NV2A 2VLVA 3F4TA 4HQZA 1C72A 4IP1A 4MLYA 1Z3EA 2MMAA 4MF7A 1DBYA 4MH2A 2M72A 1V40A 4HI7A 2GQLA 1GNWA 1NM3A 1URMA 2RIIA 3TKQA 2DSAA 3F8UA 4K7OA 1M9AA 3IXRA 4LL1B 3C73A 2FD3A 2V41A 3ZMLA 4X1UA 1JFUA 4IQ1A 3IAS2 5JCWA 5CO3A 2V6OA 4J56E 5DQYA 4EDZA 1ACVA 1GWCA 2HXKA 1QMVA 2PUKC 3TJGA 6GSTA 1B8XA 1JZRA 4QL9A 5IMAA 3IDVA 4KGIA 1PGTA 3KCMA 5ECNB 4X0XA 3VK9A 4XIHA 7GSSA 2DIZA 1FO5A 1X0RA 3Q6OA 1BG5A 3DXBA 3GL3A 1XOBA 4PQHA 3CSIA 1ZYEA 5F07A 3UEMA 1OC9A 2DMMA 4KCAA 3A3TA 2M46A 4MDCA 2WRTA 1V57A 2VCWA 2WZ9A 2H1GA 1B4QA 3IR4A 1TK5B 2H0GA 4HU9A 2ES7A 1KEBA 4YQVA 3SBCA 4KH7A 2LUSA 1EOGA 3KXOA 3FEUA 5IQYA 4L0WA 1PA3A 5B8AA 2TRCP 3FHKA 3IE3A 4TKYA 3KZQA 3VURA 4MZCA 4TR3A 3TDGA 3TKSC 1X9WB 5ECKB 4L5LA 3TJBA 3P2AA 4KAEA 3EC3A 4PQ1A 1OYJA 3UAPA 5EL8A 4F82A 3VWUA 5HR0A 1TKDB 2ON5A 1QQ2A 3H79A 5COHA 1TK0B 1JZOA 2L4QA 1FOVA 4ZB8A 3DYRA 4PUFC 2AYTA 2JSZA 3L9VA 4WR4A 3DIEA 3DVWA 1WOUA 4K8MA 3GURA 1SU9A 3ZYWA 2MBSA 2I4AA 4DSQA 1VF1A 4EXJA 3L9UA 1KBNA 4MJCA 3A2WA 5H5QA 3F4SA 1PQNA 1XZOA 1SK2A 2CAQA 5KN1A 3W8JA 4I2UA 4V2NA 1E6BA 1SKRB 4WKWA 4GSTA 2E2MA 2MMZA 1K3OA 2GQKA 3D4TA 1XVWA 1EOHA 1G7EA 4TR4A 4GQFA 5D9XA 3EE2A 2LJRA 19GSA 5IO0A 5IOWA 4TR1A 5D9TA 1MEKA 4OO4A 1AQXA 2K8SA 4PURA 2GGTA 3L9SA 4NPBA 2X99A 4XTSA 4KX4A 4ZL9A 3BJ5A 3APQA 4BVYA 2YJHA 4K2DA 1JZDA 2H0HA 1YEPA 3LYKA 4IP6A 3Q74A 4NMUA 1SJIA 1GL8A 3WGXA 1A2JA 2P5QA 3IK7A 4ZBDA 5INYA 3ZZXA 5DDLA 3EWLA 2VCXA 1LU4A 1VF2A 5J5NA 1K0BA 4ZILA 5KN0A 3NOFA 4HZ2A 4KCEA 2X8GA 2G2QA 2IFQB 3KP8A 1LBKA 2R4VA 2B5YA 1OAZA 1XWGA 3G7YA 1GNEA 3G9BA 3GV1A 4MCUA 3TKSE 1Z6MA 2F9SA 3HJPA 1TJDA 3RPNA 2IN3A 4O5RA 2LRTA 1FVKA 4WR5A 5ECQB 3TGZA 2LS5A 3O6TA 3RAZA 3CYNA 4AF2A 4FH8A 4O32A 4XS6A 4EUYA 2AAWA 5AN1A 4ZL7A 5AIXA 4IQAA 5LCZA 4GTUA 1OE7A 1N2AA 1EZKA 3GTUB 1K3YA 3DEXA 5LD0A 1YY7A 2H66A 4D73B 3FW2A 2CVBA 4JZQA 3CRTA 1A23A 2PMTA 1YEXA 3GIXA 4IJ3A 9GSSA 3ME8A 4HQSA 2IPAA 2CX4A 2CVDA 3GKMA 4EO3A 1XW6A 4JE1A 3P7XA 1ML6A 1FG4A 2V2GA 3I6AA 2CZ2A 4NHZA 1JZWA 2O8VB 2DJJA 4RQRA 4IN0A 2GTUA 2X8HA 4DSSB 1IYIA 1RQMA 5CRGA 3DGQA 4TOPA 4J2FA 4KDYA 1Q4JA 5DALA 1SL2B 4XS1A 2YV9A 4Z7XA 1T8EB 4Q5QA 1PX7A 1WPIA 4POLA 2WFCA 4V2MA 1GH2A 5J9BA 4FYUA 5G2ZA 5ECRB 1A2MA 4QL7A 1SK0A 4IVFA 3A5WA 2JZTA 3G7JA 4XRAA 4AJ6A 1TP9A 14GSA 4HS1A 3U6VA 2XBIA 1FB6A 2HZEB 3TOUA 2ZNMA 3BOAA 3O76A 1YDKA 5J41A 4V2LA 1GP1A 2HFDA 3HKRA 4NV5A 1F9MA 3US3A 4KUNA 2YN1A 3C71A 3HA9A 1B4PA 1GSFA 1B9XC 1O7UA 3M9KA 2ON7A 2I3YA 1TDIA 2FWGA 2P0GA 4NWYA 4IKHA 1SL0B 2DC5A 5IIZA 1EEMA 5J4UA 1XOAA 2MMOA 2YP6A 2DIYA 4HZ4A 3UL3A 1ZYQB 2LJAA 2C3QA 3GUSA 4EDYA 1T00A 1TW9A 4AJ7A 1AIUA 1R5PA 1FB0A 1HYUA 4GQCA 2MBTA 2DJ2A 4OD7A 5IMZA 1A0RP 1AUCA 2C80A 2H70A 3VI7A 1F37A 2NBSA 5ELGA 1BQ7A 2LRNA 2RM5A 4TXOA 4F0CA 2L57A 4FO5A 1EP8A 5CYYA 4NAXA 2FWFA 5ECOB 1J9BA 1OKTA 3F0IA 4IHUA 2R3XA 5KN3A 1X9SB 1TRVA 2JZSA 1M2AA 1PD21 4K0GA 5KEJA 3D0ZA 5FWGA 3P90A 2YV7A 2FWEA 1X5CA 2QC7A 4V1Ag 1YQ1A 1W4VA 3ERFA 2VD1A 4DSRA 5A5KA 3TUEA 2OADA 5J9CA 4MJAA 3EU3A 1XBSA 2GSTA 3EMXA 2C3NA 5C04A 2C1YA 2B7KA 3FRCA 3BD2A 4PUAA 2OE1A 3HZ8A 1UA5A 5JWRB 3IRAA 3Q19A 4WBJA 5HFIA 1BEDA 4DVCA 3QFAC 2A4VA 1CQGA 3NIVA 3HCZA 3F9UA 4TR0A 1YF1A 3VWXA 2VL2A 2EC4A 1AW9A 4PGTA 4MK3A 2IIYA 2I81A 1Z6NA 4JBBA 3ZVJA 1M2BA 3N9JA 4I8BA 4MABA 2C3TA 2REMA 2H1DA 4N0VA 1KTEA 2YZHA 3LWAA 5EVOA 3GX0A 1U3IA 1TRUA 3I43A 1SJ6A 1S3DA 1TRWA 2IL3A 5EY6A 2LNTA 4CW9A 1ILOA 5D93A 1PN9A 1JHBA 4LMWA 16GSA 2GSRA 5GSSA 2GT5A 3ZFBA 1V2AA 1YF0A 2WJUA 4ML1A 4JU5A 4I6XA 4NHWA 1MDKA 3HY2A 1F3BA 1F6MC 4TR1B 1F2EA 2N5FA 2GZPA 4I97A 1O73A 3WT1A 3LGCA 4KSMA 3FK8A 3F63A 5G5FA 2OA7A 3LYPA 4HJMA 4HDEA 6GSYA 1RK4A 3GSSA 1N8JA 4XS4A 2LEGA 2OE0A 1X5DA 3QD9A 1DSBA 3F3QA 3C8EA 4ILFA 2R2JA 3L0HA 3MDKA 5KN2A 2YWNA 1B9YC 2PPTA 1MD4A 4BA7A 3P8WA 1GTBA 3QAVA 4JR4A 3GMFA 3CMIA 4F2IA 2AJQB 4YAVA 5AGYA 4BWQA 4NXIA 2PU9C 1WMJA 4ULXA 4TN8A 1AAZA 2IMEA 1A0FA 5JWOB 2H6XA 5F8BA 3QMXA 4I5QA 2YWOA 3HVXA 3IAM2 5ECMB 2MMNA 2O7KA 3TJJA 4TXVA 2CVKA 1SKWB 1ST9A 2JU5A 5D9VA 4ZL8A 3HVSA 1OC8A 5DCGA 4AGSA 3KEBA 1OE8A 3IPZA 1XXUA 2FLSA 1QFNA 1Q98A 1EP7A 3CSHA 4K7NA 1DUGA 1SD8A 3Q18A 2VM2A 4N30A 2K9FA 1BJXA 4TRXA 2VCZA 1XWAA 2KOKA 1GTUA 3IV4A 6GSXA 3VLNA 4WXTA 2O89A 4KA0A 3L4NA 2H19A 2B1KA 2ZUPA 3H4KA 3RBTA 3EMPA 1GSYA 3QDNA 1LJRA 5FHIA 2DBCA 2H0IA 3QPMA 4YAPA 3U5RE 5D9WA 1MDIA 2F3MA 3H1NA 1AXDA 2KP1A 3W8SA 2WS2A 4Q5FA 2C0GA 5B8BA 2LRCA 2GSSA 3M9JA 3QCPA 2N5BA 3WGDA 1TU7A 2HE3A 3TRPA 3IK9A 5HR1A 1B48A 3GN3A 3GKKA 1ERVA 4WF4A 1V98A 2FCHA 2DJ1A 5DALB 5CNWA 4OCEA 5FT3A 6GSVA 5DBQA 5HR2A 2FY6A 2DJKA 2RLIA 2VL2C 1WP0A 1S3CA 3RHCA 2ZCTA 1T4YA 1XCCA 1M0UA 4MPGA 5DAKA 2OACA 2H1BA 2QSIA 3D4MA 4EKZA 3RHBA 4OFNA 4L5OA 5B6MA 1ZMAA 2LJKA 3I69A 1TI3A 1ERTA 3DVXA 20GSA 1U88A 4XHMA 4LMVA 5L71A 1GTAA 3HDCA 2C0DA 1ERUA 3KIJA 3EURA 4MZBA 2B7JA 2YZUA 3ERGA 2LQQA 3ISOA 1EGOA 5F06A 3UMAA 2N5AA 2IMKA 4YH2A 2JSYA 4MF5A 2X64A 1K0OA 4WF5A 2G0FA 6GSWA 4GWRA 4ML6A 5J3RA 4KDXA 5H5RA 5G1LA 4J57E 2GZZA 1M99A 1GUMA 1XWBA 4FIWA 1XW5A 4G9HA 1O85A 1PX6A 1TOFA 4POBA 1A8LA 3ZMKA 5GZZB 3KH7A 2HYXA 1QK8A 5GSTA 1M2DA 3GX8A 4N0ZA 1Y6EA 2L5LA 3AY8A 2LV3A 2CV4A 2H6ZA 1K0CA 4G19A 2XPEA 3E0UA 5IMVA 2OE3A 5CAXA 3QOUA 2IJYA 1K0AA 2FWHA 3TB2A 3GA4A 4YQUA 5HFKA 2E0QA 4HUAA 3F4RA 5G5EA 4BL7A 5B6NA 1YKCA 2K8VA 4ACSA 3C7MA 3K8NA 3FR6A 1U6TA 1ZOFA 1XIYA 1XW9A 2ALBA 2AHEA 3FKFA 1UVZA 1O8WA 2F51A 2PVOC 4KE3A 2P31A 2MZCA 4XRDA 1ABAA 1PKWA 3IC4A 1ERWA 2YOIA 2VD0A 1XVQA 2L6DA 2IMIA 2B3SA 1VGLA 4MPFA 2IFQA 3UBKA 2PERA 1H4OA 4KW6A 1GULA 2HSHA 2H6YA 5DJLA 3KD0A 3GKNA 2H71A 4XCSA 5GAND 1WRYA 3UIWA 4BWSA 2FA8A 5G30A 4OCFA 2C4JA 3IOSA 5DVBA 3VI5A 4MZWA 3TKRA 2X8CA 3EYTA 4AJ8A 4IGJA 2HT9A 3GSTA 2FA4A 1AC1A 3SWLA 3ZTLA 2PGTA 1T7PB 2H30A 2AUVA 2V32A 3E3EA 3R2QA 1R4WA 5JCUA 1QGVA 5D73A 3DD3A 2NTOA 1R26A 4HU7A 4D73A 3UOMA 1Y25A 3KMNA 1PMTA 2DMLA 2IWTA 2V6KA 3VWWA 4BVXA 4K7IA 1GRXA 3W6GA 5IMDA 1T1VA 1K3LA 3EU4A 5EPFA 1OC9B 5CP1A 4QQ7A 1K0MA 1V58A 3VWVA 4IJIA 3S9FA 4WETA 2JADA 2O85A 2HI7A 2VL3A 4GRFA 4XS4B 3OR5A 3HXSA 2VLUA 2WB9A 4IBPA 2OBKA 3FZ5A 1EEJA 4WEYA 4ZB6A 4DSSA 1GTIA 2F8FA 4KB3A 3O3TA 5IMCA 5DQSA 2EIOA 6GSUA 2DJ3A 4PNFA 1K0DA 2GQMA 2IMFA 3RPPA 1VRSD 3FZAA 4ZIJA 3ERWA 1WIKA 2R5GA 2P5RA 3FR3A 1Z7RA 2FHEA 4BPYA 1I5GA 1DE2A 1EGRA 4CHSA 4IW9A 3MSZA 3J7Yb 1ZCPA 2C8UA 1PRXA 5ECHB 1TI1A 3IBHA 3LORA 2VL9A 1AQVA 3I9V2 4LA1A 4POKA 2QGVA 4Q5RA 2AB6A 3GNJA 3F6DA 4CDOA 5ECSA 2WGRA 1SL1B 1PL2A 3V1WA 1A2LA 2VOCA 4G10A 3GH6A 1SYRA 1Z5YE 3M3MA 4JRRA 5ID2A 2RM6A 1SJZA 4X43A 2YCDA 2B5EA 1MTCA 3D6IA 4F03A 3TKPA 1I9DA 3EINA 5ECPB 2EIRA 3H8QA 1MD3A 4OFTA 4MF6A 3VFIA 2L5OA 2HRFA 2LNSA 5F0GA
chains in the Genus database with same CATH superfamily
1SYXA 4Q5NA 2GVPA 2H01A 4JR6A 4GSNA 2YJ7A 1XWKA 4BVYB 4ECBA 3CSJA 2CT6A 3J7Yk 5D96A 4O7HA 1Z9HA 2PN8A 3ZIVA 1OC3A 1F3AA 2BJXA 2H1AA 2HZFA 4RQXA 8GSSA 2CQ9A 3F3RA 5E59A 4MH3A 2J23A 2XBQA 5AIVA 1J0FA 11GSA 3ZIJA 1EV4A 2FGXA 3LXTA 2DLXA 4LLRA 1E2YA 4L8EA 2AV4A 17GSA 1BYEA 1H75A 5DAKB 1NSWA 3KMOA 1JLVA 4G0KA 4ZB9A 2I9HA 4HEA2 1A24A 4OFMA 2JACA 2VM1A 3TRXA 1K0NA 2GT6A 5ECLB 3D22A 1ZZYA 1T3BA 1XPVA 4HJ2A 2LSTA 2B1LA 5B7CA 3FYGA 4OWYA 4MP4A 5DJMA 1BAYA 1NHYA 2I1UA 2NDOA 2LKUA 1EWXA 4FYCA 1R5AA 4FYBA 2CZ3A 3KM6A 3IHQA 1O81A 1BX9A 2OJLA 5F05A 5JWQB 2L4CA 3EVIA 3HVVA 2YNXA 1GSDA 1UC7A 2VLTA 4OO5A 3HD5A 4Z2RA 3IA1A 4RI6A 2CX3A 2WDUA 3ED3A 3LQ7A 5CREA 3M1GA 1TRSA 2R6KA 3ZLPA 1A8YA 2H73A 1TXXA 1G6WA 3BCIA 1QXHA 2UZ8A 2PBJA 3HYPA 3WT2A 3FZ9A 2HLSA 12GSA 3ZFLA 4ECIA 1THOA 2KLXA 3ME7A 6GSSA 3HJMA 3HJOA 1M9BA 2NPBA 3GYKA 3UARA 2YANA 1GSQA 5IPGA 3ZREA 1UN2A 4V1Ap 3M0FA 1X9MB 1YJ6A 3ZL5A 1ZL9A 1GLQA 2R0PA 4N10A 2F8AA 4N11A 3TOTA 3ZITA 3JCML 2XHFA 1HNCA 3PPUA 4ID0A 4ZBAA 1O6JA 2NVLA 3APSA 2FNOA 3CXGA 5IMFA 5A4VA 3ZRDA 1G0TA 3CTGA 5IO2A 2PWJA 2M80A 2DKHA 3H93A 4POMA 3LSZA 3E9JB 3FR9A 5D8IA 4BIKA 5AISA 2B6MA 2V1MA 5JCGA 3GL5A 5A4UA 5HR3A 3WYWA 4K1FA 4EC0A 4DEJA 3ZVJD 3DRNA 1YZXA 3MNGA 3RDWA 1VF4A 3DWVA 4MJBA 1T4ZA 1V9WA 2FUG2 4IELA 2KUCA 1WWJA 2B5XA 3KGKA 1TTZA 3QR6A 2XPDA 3PH9A 3APOA 2CAIA 1PSQA 2IMDA 4K0NA 2E2GA 2VUPA 2C0EA 1WJKA 3TJKA 5A4WA 3DMLA 3GKXA 4F0BA 3CRUA 2D2ZA 3M8NA 3UJ1A 4E8EA 4KSOA 4KNDA 4ZXGA 2HRNA 2VO4A 3PGTA 4I2TA 3N5OA 3BBYA 2H8LA 5HFGA 3L78A 2GDRA 4O92A 1GSSA 4ZBBA 3NZNA 4PQIA 2XC2A 4BVXB 4PX1A 2C0FA 4GLTA 2KHPA 4TXOB 1THXA 2VAFA 4K2XA 4MJEA 2JL4A 1TU8A 4HOJA 2RUEA 1FAAA 1OVNA 5IM9A 4ECCA 1SK1A 2LTKA 4PXOA 4JEDA 1WE0A 3WD6A 4K9ZA 2CA8A 3TJFA 4LL4B 3QAWA 3A2VA 3G7IA 3FZ4A 3UVTA 2OKAA 2GZYA 4PNGA 2VCTA 1O8XA 13GSA 1GSEA 3KTLA 2TIRA 3QFBC 2GS3A 1M7TA 3QAGA 1SKSB 4GCIA 4TW5A 4EL1A 3LXZA 1PKZA 2A2RA 1HD2A 1GLPA 1X5EA 4ECJA 1KNGA 3KJYA 4L0UA 3GHAA 2A4HA 1VF3A 2EIQA 4KDUA 5ENUA 2H76A 4RUVA 5DCHA 2BTOT 1FHEA 2E7PA 1PL1A 1TK8B 5HQPA 4G2EA 2YPMA 4TVEA 1QUWA 1SENA 5GAPD 3HHVA 1S3AA 3D21A 1J08A 4EE0A 1NW2A 5CRDA 5ECIB 3DKSA 4GSSA 1HNBA 2PVQA 2VIMA 3GFKA 2OBIA 3KP9A 1SD9A 4WBRD 2L6CA 2GSQA 5E4WA 4RI7A 5ABRA 1U87A 1W89A 3F6FA 3WGEA 1G7OA 3PINA 3TCOA 3HZ4A 1MDJA 1ZGNA 18GSA 2L59A 2VCVA 1U3AA 2QKEA 3A2XA 3BCKA 4P3YB 4EVMA 3LFLA 5ID2B 2H72A 3TKSA 2R37A 3GTUA 1JLWA 4YQMA 4MA9A 2HNLA 3UBLA 2Z9SA 1CQHA 3FY7A 1IYHA 1R7HA 3LG6A 2GLRA 2TRXA 4H86A 3C1SA 4E8HA 2JZRA 3CTFA 1XWCA 2K18A 2RUFA 1RW1A 2MYGA 1USBA 3KTBA 3MAKA 5G31A 1DE1A 1EV9A 3D5JA 5C00A 1Z7PA 5ELAA 2A2PA 1XFLA 1YKAA 1GSUA 3KH9A 4K6XA 1ON4A 2A2SA 2H75A 3MWHA 5IOXA 3GH9A 4GXZA 10GSA 22GSA 5CRHA 4YKFA 1FVJA 2WULA 2LQOA 2BMXA 3LJRA 3PR8A 3VPTA 1HNAA 4MMMA 5CRWA 5G1KA 3GRXA 4EF0A 1GUHA 1GUKA 4F9ZA 5IPHA 3C1RA 3LEFA 2VCQA 1ZYNA 4GF0A 3VPQA 1OKDA 2YWIA 5KOXA 2J9HA 3TRQA 1NHOA 1AQWA 2K6VA 4OMVA 2O87A 2HRAA 2KP2A 4ISDA 1HQOA 3CBUA 2H74A 1FW1A 4IS0A 1S3RA 2YWMA 2WCIA 3UVHA 1G6YA 2HZEA 5H5SA 5LNKe 2DJ0A 2HSYA 4NV2A 2VLVA 3F4TA 4HQZA 1C72A 4IP1A 4MLYA 1Z3EA 2MMAA 4MF7A 1DBYA 4MH2A 2M72A 1V40A 4HI7A 2GQLA 3R3EA 1GNWA 1NM3A 1URMA 2RIIA 3TKQA 2DSAA 3F8UA 4K7OA 1M9AA 3IXRA 4LL1B 3C73A 2FD3A 2V41A 3ZMLA 4X1UA 1JFUA 4IQ1A 3IAS2 5JCWA 5CO3A 2V6OA 4J56E 5DQYA 3A5IA 4EDZA 1ACVA 1GWCA 2HXKA 1QMVA 2PUKC 3TJGA 6GSTA 1B8XA 1JZRA 4QL9A 5IMAA 3IDVA 4KGIA 1PGTA 3KCMA 5ECNB 4X0XA 3VK9A 4XIHA 7GSSA 2DIZA 1FO5A 1X0RA 3Q6OA 1BG5A 3DXBA 3GL3A 1XOBA 4PQHA 3CSIA 1ZYEA 5F07A 3UEMA 1OC9A 2DMMA 4KCAA 3A3TA 2M46A 5BMUA 4MDCA 2WRTA 1V57A 2VCWA 2WZ9A 2H1GA 4USSA 4X4JA 1B4QA 3IR4A 1TK5B 2H0GA 3FMWA 4HU9A 2ES7A 1KEBA 4YQVA 3SBCA 4KH7A 2LUSA 1EOGA 3KXOA 4A5PA 3FEUA 5IQYA 4L0WA 1PA3A 5B8AA 2TRCP 3FHKA 3IE3A 4TKYA 3KZQA 3VURA 4MZCA 4TR3A 3TDGA 3TKSC 1X9WB 5ECKB 4L5LA 3TJBA 3P2AA 4KAEA 3EC3A 4PQ1A 1OYJA 3UAPA 5EL8A 4F82A 3VWUA 5HR0A 1TKDB 2ON5A 1QQ2A 3H79A 5COHA 1TK0B 1JZOA 2L4QA 1FOVA 4ZB8A 3DYRA 4PUFC 2AYTA 2JSZA 3L9VA 4WR4A 3DIEA 3DVWA 1WOUA 4K8MA 3GURA 1SU9A 3ZYWA 2MBSA 2I4AA 4DSQA 1VF1A 4EXJA 3L9UA 1KBNA 4MJCA 3A2WA 5H5QA 5KOWA 3F4SA 1PQNA 1XZOA 1SK2A 2CAQA 5KN1A 3W8JA 4I2UA 4V2NA 1E6BA 1SKRB 4WKWA 4GSTA 2E2MA 2MMZA 1K3OA 2GQKA 3D4TA 1XVWA 1EOHA 1G7EA 4TR4A 4GQFA 5D9XA 3EE2A 2R0GA 2LJRA 19GSA 5IO0A 5IOWA 4TR1A 5D9TA 1MEKA 4OO4A 1AQXA 2K8SA 4BL7B 4PURA 2GGTA 3L9SA 4NPBA 2X99A 4XTSA 4KX4A 4ZL9A 3BJ5A 3APQA 4BVYA 2YJHA 4K2DA 1JZDA 2H0HA 1YEPA 4CY8A 3LYKA 4IP6A 3Q74A 4NMUA 1SJIA 1GL8A 3WGXA 1A2JA 2P5QA 3IK7A 4ZBDA 5INYA 3ZZXA 5DDLA 3EWLA 2VCXA 1LU4A 1VF2A 5J5NA 1K0BA 4ZILA 5KN0A 3NOFA 4HZ2A 4KCEA 2X8GA 2G2QA 2IFQB 3KP8A 1LBKA 2R4VA 2B5YA 1OAZA 1XWGA 3G7YA 1GNEA 3G9BA 3GV1A 4MCUA 3TKSE 1Z6MA 2F9SA 3HJPA 1TJDA 3RPNA 2IN3A 4O5RA 2LRTA 1FVKA 4KF9A 4WR5A 5ECQB 3TGZA 2LS5A 3O6TA 3RAZA 3CYNA 4AF2A 4FH8A 4O32A 4G0IA 4XS6A 4EUYA 2AAWA 5AN1A 4ZL7A 5AIXA 4IQAA 5LCZA 4GTUA 1OE7A 1N2AA 1EZKA 3GTUB 1K3YA 3DEXA 5LD0A 1YY7A 2H66A 4D73B 3FW2A 2CVBA 4JZQA 3CRTA 1A23A 2PMTA 1YEXA 3GIXA 4IJ3A 4O5UA 9GSSA 3ME8A 4HQSA 2IPAA 2CX4A 2CVDA 3GKMA 4EO3A 1XW6A 4JE1A 3P7XA 1ML6A 1FG4A 2V2GA 3I6AA 2CZ2A 4NHZA 1JZWA 2O8VB 2DJJA 2QA2A 4RQRA 4IN0A 2GTUA 2X8HA 4DSSB 1IYIA 1RQMA 5CRGA 3DGQA 4TOPA 4J2FA 4KDYA 1Q4JA 5DALA 1SL2B 4XS1A 2YV9A 4Z7XA 1T8EB 4Q5QA 1PX7A 1WPIA 4POLA 2WFCA 4V2MA 1GH2A 5J9BA 4FYUA 5G2ZA 5ECRB 1A2MA 4QL7A 1SK0A 4IVFA 3A5WA 2JZTA 3G7JA 4XRAA 4AJ6A 1TP9A 14GSA 4HS1A 3U6VA 4Z2TA 2XBIA 1FB6A 2HZEB 3TOUA 2ZNMA 3BOAA 3O76A 1YDKA 5J41A 4V2LA 1GP1A 2HFDA 3HKRA 4NV5A 1F9MA 3US3A 4KUNA 2YN1A 3C71A 3HA9A 1B4PA 1GSFA 1B9XC 1O7UA 3M9KA 2ON7A 2I3YA 1TDIA 2FWGA 2P0GA 4NWYA 4IKHA 1SL0B 2DC5A 5IIZA 1EEMA 5J4UA 1XOAA 2MMOA 2YP6A 2DIYA 4HZ4A 1FOHA 3UL3A 1ZYQB 2LJAA 2C3QA 3GUSA 4EDYA 1T00A 1TW9A 4AJ7A 1AIUA 1R5PA 1FB0A 1HYUA 1PFOA 4GQCA 2MBTA 2DJ2A 4OD7A 5IMZA 1A0RP 1AUCA 2C80A 2H70A 3VI7A 1F37A 2NBSA 5ELGA 1BQ7A 2LRNA 4YKGA 2RM5A 4TXOA 4F0CA 2L57A 4FO5A 1EP8A 5CYYA 1ZYPA 4NAXA 2FWFA 5ECOB 1J9BA 1OKTA 3F0IA 4IHUA 2R3XA 5KN3A 1X9SB 1TRVA 2JZSA 1M2AA 1PD21 2HSMA 4K0GA 5KEJA 3D0ZA 4O5QA 5FWGA 3P90A 2YV7A 2FWEA 1X5CA 2QC7A 4V1Ag 1YQ1A 1W4VA 3ERFA 4Z2UA 2VD1A 4DSRA 5A5KA 4G0LA 3TUEA 2OADA 3MYDA 1PN0A 5J9CA 4MJAA 3EU3A 1XBSA 2GSTA 3EMXA 2C3NA 5C04A 2C1YA 2B7KA 3FRCA 3BD2A 4PUAA 2OE1A 3HZ8A 1UA5A 5JWRB 3IRAA 3Q19A 4WBJA 5HFIA 1BEDA 2R0CA 4DVCA 3QFAC 2A4VA 1CQGA 3NIVA 3HCZA 3F9UA 4TR0A 1YF1A 3VWXA 2VL2A 2EC4A 1AW9A 4PGTA 4MK3A 2IIYA 2I81A 1Z6NA 4JBBA 3ZVJA 1M2BA 3N9JA 4I8BA 4MABA 2C3TA 2REMA 2H1DA 4N0VA 1KTEA 2YZHA 3LWAA 5EVOA 3GX0A 1U3IA 1TRUA 3I43A 1SJ6A 1S3DA 1TRWA 2IL3A 5EY6A 2LNTA 4CW9A 1ILOA 5D93A 1PN9A 1JHBA 4LMWA 16GSA 2GSRA 5GSSA 2GT5A 3ZFBA 1V2AA 1YF0A 2WJUA 4ML1A 4JU5A 4I6XA 4NHWA 1MDKA 3HY2A 1F3BA 1F6MC 4PTSA 4TR1B 1F2EA 2N5FA 2GZPA 4I97A 1O73A 3WT1A 3LGCA 4KSMA 3FK8A 3F63A 2QA1A 5G5FA 2OA7A 3LYPA 4HJMA 4HDEA 6GSYA 1RK4A 3GSSA 1N8JA 4XS4A 2LEGA 2OE0A 1X5DA 3QD9A 1DSBA 3F3QA 3C8EA 4ILFA 2R2JA 3L0HA 3MDKA 5KN2A 2YWNA 1B9YC 2PPTA 1MD4A 4BA7A 3P8WA 1GTBA 3QAVA 4JR4A 3GMFA 3CMIA 4F2IA 2AJQB 4YAVA 5AGYA 4BWQA 4NXIA 2PU9C 1WMJA 4ULXA 4TN8A 2X49A 1AAZA 2IMEA 1A0FA 5JWOB 2H6XA 5F8BA 3QMXA 2DKIA 2YWOA 4I5QA 4FQUA 3HVXA 3IAM2 5ECMB 3MIXA 2MMNA 2O7KA 3TJJA 4TXVA 2CVKA 1SKWB 1ST9A 2JU5A 5D9VA 4ZL8A 3HVSA 1OC8A 5DCGA 4AGSA 3KEBA 4MNNA 1OE8A 3IPZA 1XXUA 2FLSA 1QFNA 1Q98A 1EP7A 3CSHA 4K7NA 1DUGA 1SD8A 3Q18A 2VM2A 4N30A 2K9FA 1BJXA 4TRXA 2VCZA 1XWAA 2KOKA 1GTUA 3IV4A 6GSXA 3VLNA 4WXTA 2O89A 4KA0A 3L4NA 2H19A 2B1KA 2ZUPA 3H4KA 3RBTA 3EMPA 1GSYA 3QDNA 1LJRA 5FHIA 2DBCA 2H0IA 3QPMA 4YAPA 3U5RE 5D9WA 1MDIA 2F3MA 3H1NA 1AXDA 2KP1A 3W8SA 2WS2A 4Q5FA 2C0GA 5B8BA 2LRCA 2GSSA 3M9JA 3QCPA 2N5BA 3WGDA 1TU7A 2HE3A 3LW9A 3TRPA 3IK9A 5HR1A 1B48A 3GN3A 3GKKA 1ERVA 4WF4A 1V98A 2FCHA 2DJ1A 5DALB 5CNWA 4OCEA 5FT3A 6GSVA 5DBQA 5HR2A 2FY6A 3EPTA 4K5RA 2DJKA 2RLIA 2VL2C 1WP0A 1S3CA 3RHCA 2ZCTA 1T4YA 1XCCA 1M0UA 4MPGA 5DAKA 2OACA 2H1BA 2QSIA 3D4MA 4EKZA 3RHBA 4OFNA 4L5OA 5B6MA 1ZMAA 2LJKA 3I69A 1TI3A 1ERTA 3DVXA 20GSA 1U88A 4XHMA 4LMVA 5L71A 1GTAA 3HDCA 2C0DA 1ERUA 3KIJA 3EURA 4MZBA 2B7JA 2YZUA 3ERGA 2LQQA 3ISOA 1EGOA 5F06A 3UMAA 2N5AA 2IMKA 4YH2A 2JSYA 4MF5A 1M3JA 2X64A 1K0OA 4WF5A 2G0FA 6GSWA 4GWRA 4ML6A 5J3RA 4KDXA 5H5RA 5G1LA 4J57E 2GZZA 1M99A 1GUMA 1XWBA 4FIWA 1XW5A 4G9HA 1O85A 1PX6A 1TOFA 4POBA 1A8LA 3ZMKA 5GZZB 3KH7A 2HYXA 1QK8A 5GSTA 1M2DA 3GX8A 4EIQA 4N0ZA 1Y6EA 2L5LA 3AY8A 2LV3A 2CV4A 2H6ZA 1K0CA 4G19A 2XPEA 3E0UA 5IMVA 2OE3A 5CAXA 3IC8A 3QOUA 2IJYA 1K0AA 2FWHA 3TB2A 3GA4A 4YQUA 5HFKA 2E0QA 4HUAA 3F4RA 5G5EA 4BL7A 5B6NA 1YKCA 2K8VA 4ACSA 3C7MA 3K8NA 3FR6A 1U6TA 1ZOFA 1XIYA 1XW9A 1M3IA 2ALBA 2AHEA 3FKFA 1UVZA 1O8WA 2F51A 2PVOC 4KE3A 2P31A 2MZCA 4XRDA 1ABAA 3CQFA 1PKWA 3IC4A 1ERWA 2YOIA 2VD0A 1XVQA 2L6DA 2IMIA 2B3SA 1VGLA 4MPFA 2IFQA 5BRTA 3UBKA 2PERA 1H4OA 4KW6A 4CY6A 1GULA 3HVNA 2HSHA 2H6YA 5DJLA 3KD0A 3GKNA 2H71A 4XCSA 5GAND 1WRYA 3UIWA 4BWSA 2FA8A 5G30A 4OCFA 2C4JA 3IOSA 5DVBA 3VI5A 4MZWA 3TKRA 2X8CA 3EYTA 4AJ8A 4IGJA 2HT9A 3GSTA 1XG8A 2FA4A 1AC1A 3SWLA 3ZTLA 2PGTA 1T7PB 2H30A 4K5SA 2AUVA 2V32A 3E3EA 3R2QA 1R4WA 5JCUA 1QGVA 5D73A 3DD3A 2NTOA 1R26A 2HRKA 4HU7A 4D73A 3UOMA 1Y25A 3KMNA 1PMTA 2DMLA 2IWTA 2V6KA 3VWWA 4BVXA 4K7IA 1GRXA 3W6GA 5IMDA 1T1VA 1K3LA 3EU4A 5EPFA 1OC9B 5CP1A 4QQ7A 1K0MA 1V58A 3VWVA 4IJIA 3S9FA 4WETA 2JADA 2O85A 2HI7A 2VL3A 4GRFA 4XS4B 3OR5A 3HXSA 2VLUA 2WB9A 4IBPA 2OBKA 3FZ5A 1EEJA 4WEYA 4ZB6A 3IHGA 4DSSA 1GTIA 2F8FA 4KB3A 3O3TA 5IMCA 5DQSA 2EIOA 6GSUA 2DJ3A 4PNFA 1K0DA 2GQMA 2IMFA 3RPPA 1VRSD 3FZAA 4ZIJA 3ERWA 1WIKA 2R5GA 2P5RA 3FR3A 1Z7RA 2FHEA 4BPYA 1I5GA 1DE2A 4EIPA 1EGRA 4CHSA 4IW9A 3MSZA 3J7Yb 1ZCPA 2C8UA 1PRXA 5ECHB 2X4AA 1TI1A 3IBHA 3LORA 2VL9A 1AQVA 3I9V2 4LA1A 4POKA 2QGVA 4Q5RA 2AB6A 3GNJA 3F6DA 4HSCX 4CDOA 5ECSA 2WGRA 1SL1B 1PL2A 3V1WA 1A2LA 2VOCA 4ICYA 4G10A 3GH6A 1SYRA 1Z5YE 3M3MA 4JRRA 5ID2A 2RM6A 1SJZA 4X43A 2YCDA 2B5EA 1MTCA 3D6IA 4F03A 3TKPA 1I9DA 3EINA 5ECPB 2EIRA 3H8QA 1MD3A 4OFTA 4MF6A 3VFIA 2L5OA 2HRFA 2LNSA 5F0GA
chains in the Genus database with same CATH topology
1SYXA 4Q5NA 2GVPA 2H01A 4JR6A 4GSNA 2YJ7A 1XWKA 4BVYB 4ECBA 3CSJA 2CT6A 3J7Yk 5D96A 4O7HA 1Z9HA 2PN8A 3ZIVA 1OC3A 1F3AA 2BJXA 2H1AA 2HZFA 4RQXA 8GSSA 2CQ9A 3F3RA 5E59A 4MH3A 2J23A 2XBQA 5AIVA 1J0FA 11GSA 3ZIJA 1EV4A 2FGXA 3LXTA 2DLXA 4LLRA 1E2YA 4L8EA 2AV4A 17GSA 1BYEA 1H75A 5DAKB 1NSWA 3KMOA 1JLVA 4G0KA 4ZB9A 2I9HA 4HEA2 1A24A 4OFMA 2JACA 2VM1A 3TRXA 1K0NA 2GT6A 5ECLB 3D22A 1ZZYA 1T3BA 1XPVA 4HJ2A 2LSTA 2B1LA 5B7CA 3FYGA 4OWYA 4MP4A 5DJMA 1BAYA 1NHYA 2I1UA 2NDOA 2LKUA 1EWXA 4FYCA 1R5AA 4FYBA 2CZ3A 3KM6A 3IHQA 1O81A 1BX9A 2OJLA 5F05A 5JWQB 2L4CA 3EVIA 3HVVA 2YNXA 1GSDA 1UC7A 2VLTA 4OO5A 3HD5A 4Z2RA 3IA1A 4RI6A 2CX3A 2WDUA 3ED3A 3LQ7A 5CREA 3M1GA 1TRSA 2R6KA 3ZLPA 1A8YA 2H73A 1TXXA 1G6WA 3BCIA 1QXHA 2UZ8A 2PBJA 3HYPA 3WT2A 3FZ9A 2HLSA 12GSA 3ZFLA 4ECIA 1THOA 2KLXA 3ME7A 6GSSA 3HJMA 3HJOA 1M9BA 2NPBA 3GYKA 3UARA 2YANA 1GSQA 5IPGA 3ZREA 1UN2A 4V1Ap 3M0FA 1X9MB 1YJ6A 3ZL5A 1ZL9A 1GLQA 2R0PA 4N10A 2F8AA 4N11A 3TOTA 3ZITA 3JCML 2XHFA 1HNCA 3PPUA 4ID0A 4ZBAA 1O6JA 2NVLA 3APSA 2FNOA 3CXGA 5IMFA 5A4VA 3ZRDA 1G0TA 3CTGA 5IO2A 2PWJA 2M80A 2DKHA 3H93A 4POMA 3LSZA 3E9JB 3FR9A 5D8IA 5AISA 2B6MA 2V1MA 5JCGA 3GL5A 5A4UA 5HR3A 3WYWA 4K1FA 4EC0A 4DEJA 3ZVJD 3DRNA 1YZXA 3MNGA 3RDWA 1VF4A 3DWVA 4MJBA 1T4ZA 1V9WA 2FUG2 4IELA 2KUCA 1WWJA 2B5XA 3KGKA 1TTZA 3QR6A 2XPDA 3PH9A 3APOA 2CAIA 1PSQA 2IMDA 4K0NA 2E2GA 2VUPA 2C0EA 1WJKA 3TJKA 5A4WA 3DMLA 3GKXA 4F0BA 3CRUA 2D2ZA 3M8NA 3UJ1A 4E8EA 4KSOA 4KNDA 4ZXGA 2HRNA 2VO4A 3PGTA 4I2TA 3N5OA 3BBYA 2H8LA 5HFGA 3L78A 2GDRA 4O92A 1GSSA 4ZBBA 3NZNA 4PQIA 2XC2A 4BVXB 4PX1A 2C0FA 4GLTA 2KHPA 4TXOB 1THXA 2VAFA 4K2XA 4MJEA 2JL4A 1TU8A 4HOJA 2RUEA 1FAAA 1OVNA 5IM9A 4ECCA 1SK1A 2LTKA 4PXOA 4JEDA 1WE0A 3WD6A 4K9ZA 2CA8A 3TJFA 4LL4B 3QAWA 3A2VA 3G7IA 3FZ4A 3UVTA 2OKAA 2GZYA 4PNGA 2VCTA 1O8XA 13GSA 1GSEA 3KTLA 2TIRA 3QFBC 2GS3A 1M7TA 3QAGA 1SKSB 4GCIA 4TW5A 4EL1A 3LXZA 1PKZA 2A2RA 1HD2A 1GLPA 1X5EA 4ECJA 1KNGA 3KJYA 4L0UA 3GHAA 2A4HA 1VF3A 2EIQA 4KDUA 5ENUA 2H76A 4RUVA 5DCHA 2BTOT 1FHEA 2E7PA 1PL1A 1TK8B 5HQPA 4G2EA 2YPMA 4TVEA 1QUWA 1SENA 5GAPD 3HHVA 1S3AA 3D21A 1J08A 4EE0A 1NW2A 5CRDA 5ECIB 3DKSA 4GSSA 1HNBA 2PVQA 2VIMA 3GFKA 2OBIA 3KP9A 1SD9A 4WBRD 2L6CA 2GSQA 5E4WA 4RI7A 5ABRA 1U87A 1W89A 3F6FA 3WGEA 1G7OA 3PINA 3TCOA 3HZ4A 1MDJA 1ZGNA 18GSA 2L59A 2VCVA 1U3AA 2QKEA 3A2XA 3BCKA 4P3YB 4EVMA 3LFLA 5ID2B 2H72A 3TKSA 4YQMA 2R37A 1JLWA 3GTUA 4MA9A 2HNLA 3UBLA 2Z9SA 1CQHA 3FY7A 1IYHA 1R7HA 3LG6A 2GLRA 2TRXA 4H86A 3C1SA 4E8HA 2JZRA 3CTFA 1XWCA 2K18A 2RUFA 1RW1A 2MYGA 1USBA 3KTBA 3MAKA 5G31A 1DE1A 1EV9A 3D5JA 5C00A 1Z7PA 5ELAA 2A2PA 1XFLA 1YKAA 1GSUA 3KH9A 4K6XA 1ON4A 2A2SA 2H75A 3MWHA 5IOXA 3GH9A 4GXZA 10GSA 22GSA 5CRHA 4YKFA 1FVJA 2WULA 2LQOA 2BMXA 3LJRA 3PR8A 3VPTA 1HNAA 4MMMA 5CRWA 5G1KA 3GRXA 4EF0A 1GUHA 1GUKA 4F9ZA 5IPHA 3C1RA 3LEFA 2VCQA 1ZYNA 4GF0A 3VPQA 1OKDA 2YWIA 5KOXA 2J9HA 3TRQA 1NHOA 1AQWA 2K6VA 4OMVA 2O87A 2HRAA 2KP2A 4ISDA 1HQOA 3CBUA 2H74A 1FW1A 4IS0A 2YWMA 2WCIA 3UVHA 1G6YA 2HZEA 5H5SA 5LNKe 2DJ0A 2HSYA 4NV2A 2VLVA 3F4TA 4HQZA 1C72A 4IP1A 4MLYA 1Z3EA 2MMAA 4MF7A 1DBYA 4MH2A 2M72A 1V40A 4HI7A 2GQLA 3R3EA 1GNWA 1NM3A 1URMA 2RIIA 3TKQA 2DSAA 3F8UA 4K7OA 1M9AA 3IXRA 4LL1B 3C73A 2FD3A 2V41A 3ZMLA 4X1UA 1JFUA 4IQ1A 3IAS2 5JCWA 5CO3A 2V6OA 4J56E 5DQYA 3A5IA 4EDZA 1ACVA 1GWCA 2HXKA 1QMVA 2PUKC 3TJGA 6GSTA 1B8XA 1JZRA 4QL9A 5IMAA 3IDVA 4KGIA 1PGTA 3KCMA 5ECNB 4X0XA 3VK9A 4XIHA 7GSSA 2DIZA 1FO5A 1X0RA 3Q6OA 1BG5A 3DXBA 3GL3A 1XOBA 4PQHA 3CSIA 1ZYEA 5F07A 3UEMA 1OC9A 2DMMA 4KCAA 3A3TA 2M46A 5BMUA 4MDCA 2WRTA 1V57A 2VCWA 2WZ9A 2H1GA 4USSA 4X4JA 1B4QA 3IR4A 1TK5B 2H0GA 3FMWA 4HU9A 2ES7A 1KEBA 4YQVA 3SBCA 4KH7A 2LUSA 1EOGA 3KXOA 4A5PA 3FEUA 5IQYA 4L0WA 1PA3A 5B8AA 2TRCP 3FHKA 3IE3A 4TKYA 3KZQA 3VURA 4MZCA 4TR3A 3TDGA 3TKSC 1X9WB 5ECKB 4L5LA 3TJBA 3P2AA 4KAEA 3EC3A 4PQ1A 1OYJA 3UAPA 5EL8A 4F82A 3VWUA 5HR0A 1TKDB 2ON5A 1QQ2A 3H79A 5COHA 1TK0B 1JZOA 2L4QA 1FOVA 4ZB8A 3DYRA 4PUFC 2AYTA 2JSZA 3L9VA 4WR4A 3DIEA 3DVWA 1WOUA 4K8MA 3GURA 1SU9A 3ZYWA 2MBSA 2I4AA 4DSQA 1VF1A 4EXJA 3L9UA 1KBNA 4MJCA 3A2WA 5H5QA 5KOWA 3F4SA 1PQNA 1XZOA 1SK2A 2CAQA 5KN1A 3W8JA 4I2UA 4V2NA 1E6BA 1SKRB 4WKWA 4GSTA 2E2MA 2MMZA 1K3OA 2GQKA 3D4TA 1XVWA 1EOHA 1G7EA 4TR4A 4GQFA 5D9XA 3EE2A 2R0GA 2LJRA 19GSA 5IO0A 5IOWA 4TR1A 5D9TA 1MEKA 4OO4A 1AQXA 2K8SA 4BL7B 4PURA 2GGTA 3L9SA 4NPBA 2X99A 4XTSA 4KX4A 4ZL9A 3BJ5A 3APQA 4BVYA 2YJHA 4K2DA 1JZDA 2H0HA 1YEPA 4CY8A 3LYKA 4IP6A 3Q74A 4NMUA 1SJIA 1GL8A 3WGXA 1A2JA 2P5QA 3IK7A 4ZBDA 5INYA 3ZZXA 5DDLA 3EWLA 2VCXA 1LU4A 1VF2A 5J5NA 1K0BA 4ZILA 5KN0A 3NOFA 4HZ2A 4KCEA 2X8GA 2G2QA 2IFQB 3KP8A 1LBKA 2R4VA 2B5YA 1OAZA 1XWGA 3G7YA 1GNEA 3G9BA 3GV1A 4MCUA 3TKSE 1Z6MA 2F9SA 3HJPA 1TJDA 3RPNA 2IN3A 4O5RA 2LRTA 1FVKA 4KF9A 4WR5A 5ECQB 3TGZA 2LS5A 3O6TA 3RAZA 3CYNA 4AF2A 4FH8A 4O32A 4G0IA 4XS6A 4EUYA 2AAWA 5AN1A 4ZL7A 5AIXA 4IQAA 5LCZA 4GTUA 1OE7A 1N2AA 1EZKA 3GTUB 1K3YA 3DEXA 5LD0A 1YY7A 2H66A 4D73B 3FW2A 2CVBA 4JZQA 3CRTA 1A23A 2PMTA 1YEXA 3GIXA 4IJ3A 4O5UA 9GSSA 3ME8A 4HQSA 2IPAA 2CX4A 2CVDA 3GKMA 4EO3A 1XW6A 4JE1A 3P7XA 1ML6A 1FG4A 2V2GA 3I6AA 2CZ2A 4NHZA 1JZWA 2O8VB 2DJJA 2QA2A 4RQRA 4IN0A 2GTUA 2X8HA 4DSSB 1IYIA 1RQMA 5CRGA 3DGQA 4TOPA 4J2FA 4KDYA 1Q4JA 5DALA 1SL2B 4XS1A 2YV9A 4Z7XA 1T8EB 4Q5QA 1PX7A 1WPIA 4POLA 2WFCA 4V2MA 1GH2A 5J9BA 4FYUA 5G2ZA 5ECRB 1A2MA 4QL7A 1SK0A 4IVFA 3A5WA 2JZTA 3G7JA 4XRAA 4AJ6A 1TP9A 14GSA 4HS1A 3U6VA 4Z2TA 2XBIA 1FB6A 2HZEB 3TOUA 2ZNMA 3BOAA 3O76A 1YDKA 5J41A 4V2LA 1GP1A 2HFDA 3HKRA 4NV5A 1F9MA 3US3A 4KUNA 2YN1A 3C71A 3HA9A 1B4PA 1GSFA 1B9XC 1O7UA 3M9KA 2ON7A 2I3YA 1TDIA 2FWGA 2P0GA 4NWYA 4IKHA 1SL0B 2DC5A 5IIZA 1EEMA 5J4UA 1XOAA 2MMOA 2YP6A 2DIYA 4HZ4A 1FOHA 3UL3A 1ZYQB 2LJAA 2C3QA 3GUSA 4EDYA 1T00A 1TW9A 4AJ7A 1AIUA 1R5PA 1FB0A 1HYUA 4GQCA 2MBTA 2DJ2A 4OD7A 5IMZA 1A0RP 1AUCA 2C80A 2H70A 3VI7A 1F37A 2NBSA 5ELGA 1BQ7A 2LRNA 4YKGA 2RM5A 4TXOA 4F0CA 2L57A 4FO5A 1EP8A 5CYYA 1ZYPA 4NAXA 2FWFA 5ECOB 1J9BA 1OKTA 3F0IA 4IHUA 2R3XA 5KN3A 1X9SB 1TRVA 2JZSA 1M2AA 1PD21 2HSMA 4K0GA 5KEJA 3D0ZA 4O5QA 5FWGA 3P90A 2YV7A 2FWEA 1X5CA 2QC7A 4V1Ag 1YQ1A 1W4VA 3ERFA 4Z2UA 2VD1A 4DSRA 5A5KA 4G0LA 3TUEA 2OADA 3MYDA 1PN0A 5J9CA 4MJAA 3EU3A 1XBSA 2GSTA 3EMXA 2C3NA 5C04A 2C1YA 2B7KA 3FRCA 3BD2A 4PUAA 2OE1A 3HZ8A 1UA5A 5JWRB 3IRAA 3Q19A 4WBJA 5HFIA 1BEDA 2R0CA 4DVCA 3QFAC 2A4VA 1CQGA 3NIVA 3HCZA 3F9UA 4TR0A 1YF1A 3VWXA 2VL2A 2EC4A 1AW9A 4PGTA 4MK3A 2IIYA 2I81A 1Z6NA 4JBBA 3ZVJA 1M2BA 3N9JA 4I8BA 4MABA 2C3TA 2REMA 2H1DA 4N0VA 1KTEA 2YZHA 3LWAA 5EVOA 3GX0A 1U3IA 1TRUA 3I43A 1SJ6A 1S3DA 1TRWA 2IL3A 5EY6A 2LNTA 4CW9A 1ILOA 5D93A 1PN9A 1JHBA 4LMWA 16GSA 2GSRA 5GSSA 2GT5A 3ZFBA 1V2AA 1YF0A 2WJUA 4ML1A 4JU5A 4I6XA 4NHWA 1MDKA 3HY2A 1F3BA 1F6MC 4PTSA 4TR1B 1F2EA 2N5FA 2GZPA 4I97A 1O73A 3WT1A 3LGCA 4KSMA 3FK8A 3F63A 2QA1A 5G5FA 2OA7A 3LYPA 4HJMA 4HDEA 6GSYA 1RK4A 3GSSA 1N8JA 4XS4A 2LEGA 2OE0A 1X5DA 3QD9A 1DSBA 3F3QA 3C8EA 4ILFA 2R2JA 3L0HA 3MDKA 5KN2A 2YWNA 1B9YC 2PPTA 1MD4A 4BA7A 3P8WA 1GTBA 3QAVA 4JR4A 3GMFA 3CMIA 4F2IA 2AJQB 4YAVA 5AGYA 4BWQA 4NXIA 2PU9C 1WMJA 4ULXA 4TN8A 2X49A 1AAZA 2IMEA 1A0FA 5JWOB 2H6XA 5F8BA 3QMXA 2DKIA 2YWOA 4I5QA 4FQUA 3HVXA 3IAM2 5ECMB 3MIXA 2MMNA 2O7KA 3TJJA 4TXVA 2CVKA 1SKWB 1ST9A 2JU5A 5D9VA 4ZL8A 3HVSA 1OC8A 5DCGA 4AGSA 3KEBA 4MNNA 1OE8A 3IPZA 1XXUA 2FLSA 1QFNA 1Q98A 1EP7A 3CSHA 4K7NA 1DUGA 1SD8A 3Q18A 2VM2A 4N30A 2K9FA 1BJXA 4TRXA 2VCZA 1XWAA 2KOKA 1GTUA 3IV4A 6GSXA 3VLNA 4WXTA 2O89A 4KA0A 3L4NA 2H19A 2B1KA 2ZUPA 3H4KA 3RBTA 3EMPA 1GSYA 3QDNA 1LJRA 5FHIA 2DBCA 2H0IA 3QPMA 4YAPA 3U5RE 5D9WA 1MDIA 2F3MA 3H1NA 1AXDA 2KP1A 3W8SA 2WS2A 4Q5FA 2C0GA 5B8BA 2LRCA 2GSSA 3M9JA 3QCPA 2N5BA 3WGDA 1TU7A 2HE3A 3LW9A 3TRPA 3IK9A 5HR1A 1B48A 3GN3A 3GKKA 1ERVA 4WF4A 1V98A 2FCHA 2DJ1A 5DALB 5CNWA 4OCEA 5FT3A 6GSVA 5DBQA 5HR2A 2FY6A 3EPTA 4K5RA 2DJKA 2RLIA 2VL2C 1WP0A 1S3CA 3RHCA 2ZCTA 1T4YA 1XCCA 1M0UA 4MPGA 5DAKA 2OACA 2H1BA 2QSIA 3D4MA 4EKZA 3RHBA 4OFNA 4L5OA 5B6MA 1ZMAA 2LJKA 3I69A 1TI3A 1ERTA 3DVXA 20GSA 1U88A 4XHMA 4LMVA 5L71A 1GTAA 3HDCA 2C0DA 1ERUA 3KIJA 3EURA 4MZBA 2B7JA 2YZUA 3ERGA 2LQQA 3ISOA 1EGOA 5F06A 3UMAA 2N5AA 2IMKA 4YH2A 2JSYA 4MF5A 2X64A 1K0OA 4WF5A 2G0FA 6GSWA 4GWRA 4ML6A 5J3RA 4KDXA 5H5RA 5G1LA 4J57E 2GZZA 1M99A 1GUMA 1XWBA 4FIWA 1XW5A 4G9HA 1O85A 1PX6A 1TOFA 4POBA 1A8LA 3ZMKA 5GZZB 3KH7A 2HYXA 1QK8A 5GSTA 1M2DA 3GX8A 4EIQA 4N0ZA 1Y6EA 2L5LA 3AY8A 2LV3A 2CV4A 2H6ZA 1K0CA 4G19A 2XPEA 3E0UA 5IMVA 2OE3A 5CAXA 3IC8A 3QOUA 2IJYA 1K0AA 2FWHA 3TB2A 3GA4A 4YQUA 5HFKA 2E0QA 4HUAA 3F4RA 5G5EA 4BL7A 5B6NA 1YKCA 2K8VA 4ACSA 3C7MA 3K8NA 3FR6A 1U6TA 1ZOFA 1XIYA 1XW9A 2ALBA 2AHEA 3FKFA 1UVZA 1O8WA 2F51A 2PVOC 4KE3A 2P31A 2MZCA 4XRDA 1ABAA 1PKWA 3IC4A 1ERWA 2YOIA 2VD0A 1XVQA 2L6DA 2IMIA 2B3SA 1VGLA 4MPFA 2IFQA 5BRTA 3UBKA 2PERA 1H4OA 4KW6A 4CY6A 1GULA 2HSHA 2H6YA 5DJLA 3KD0A 3GKNA 2H71A 4XCSA 5GAND 1WRYA 3UIWA 4BWSA 2FA8A 5G30A 4OCFA 2C4JA 3IOSA 5DVBA 3VI5A 4MZWA 3TKRA 2X8CA 3EYTA 4AJ8A 4IGJA 2HT9A 3GSTA 2FA4A 1AC1A 3SWLA 3ZTLA 2PGTA 1T7PB 2H30A 4K5SA 2AUVA 2V32A 3E3EA 3R2QA 1R4WA 5JCUA 1QGVA 5D73A 3DD3A 2NTOA 1R26A 2HRKA 4HU7A 4D73A 3UOMA 1Y25A 3KMNA 1PMTA 2DMLA 2IWTA 2V6KA 3VWWA 4BVXA 4K7IA 1GRXA 3W6GA 5IMDA 1T1VA 1K3LA 3EU4A 5EPFA 1OC9B 5CP1A 4QQ7A 1K0MA 1V58A 3VWVA 4IJIA 3S9FA 4WETA 2JADA 2O85A 2HI7A 2VL3A 4GRFA 4XS4B 3OR5A 3HXSA 2VLUA 2WB9A 4IBPA 2OBKA 3FZ5A 1EEJA 4WEYA 4ZB6A 3IHGA 4DSSA 1GTIA 2F8FA 4KB3A 3O3TA 5IMCA 5DQSA 2EIOA 6GSUA 2DJ3A 4PNFA 1K0DA 2GQMA 2IMFA 3RPPA 1VRSD 3FZAA 4ZIJA 3ERWA 1WIKA 2R5GA 2P5RA 3FR3A 1Z7RA 2FHEA 4BPYA 1I5GA 1DE2A 4EIPA 1EGRA 4CHSA 4IW9A 3MSZA 3J7Yb 1ZCPA 2C8UA 1PRXA 5ECHB 2X4AA 1TI1A 3IBHA 3LORA 2VL9A 1AQVA 3I9V2 4LA1A 4POKA 2QGVA 4Q5RA 2AB6A 3GNJA 3F6DA 4CDOA 5ECSA 2WGRA 1SL1B 1PL2A 3V1WA 1A2LA 2VOCA 4ICYA 4G10A 3GH6A 1SYRA 1Z5YE 3M3MA 4JRRA 5ID2A 2RM6A 1SJZA 4X43A 2YCDA 2B5EA 1MTCA 3D6IA 4F03A 3TKPA 1I9DA 3EINA 5ECPB 2EIRA 3H8QA 1MD3A 4OFTA 4MF6A 3VFIA 2L5OA 2HRFA 2LNSA 5F0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYX A;  4Q5N A;  2GVP A;  2H01 A;  4JR6 A;  4GSN A;  2YJ7 A;  1XWK A;  4ECB A;  3CSJ A;  2CT6 A;  3J7Y k;  5D96 A;  4O7H A;  1Z9H A;  2PN8 A;  3ZIV A;  1OC3 A;  1F3A A;  2BJX A;  2H1A A;  2HZF A;  4RQX A;  8GSS A;  2CQ9 A;  3F3R A;  5E59 A;  4MH3 A;  2J23 A;  2XBQ A;  5AIV A;  1J0F A;  11GS A;  3ZIJ A;  1EV4 A;  2FGX A;  3LXT A;  2DLX A;  4LLR A;  1E2Y A;  4L8E A;  2AV4 A;  17GS A;  1BYE A;  1H75 A;  5DAK B;  1NSW A;  3KMO A;  1JLV A;  4ZB9 A;  2I9H A;  4HEA 2;  1A24 A;  4OFM A;  2JAC A;  2VM1 A;  3TRX A;  1K0N A;  2GT6 A;  5ECL B;  3D22 A;  1ZZY A;  1T3B A;  1XPV A;  4HJ2 A;  2LST A;  2B1L A;  5B7C A;  3FYG A;  4OWY A;  4MP4 A;  5DJM A;  1BAY A;  1NHY A;  2I1U A;  2NDO A;  2LKU A;  1EWX A;  4FYC A;  1R5A A;  4FYB A;  2CZ3 A;  3KM6 A;  3IHQ A;  1O81 A;  1BX9 A;  2OJL A;  5F05 A;  5JWQ B;  2L4C A;  3EVI A;  3HVV A;  2YNX A;  1GSD A;  1UC7 A;  2VLT A;  4OO5 A;  3HD5 A;  3IA1 A;  4RI6 A;  2CX3 A;  2WDU A;  3ED3 A;  3LQ7 A;  5CRE A;  3M1G A;  1TRS A;  2R6K A;  3ZLP A;  1A8Y A;  2H73 A;  1TXX A;  1G6W A;  3BCI A;  1QXH A;  2PBJ A;  3HYP A;  3WT2 A;  3FZ9 A;  2HLS A;  12GS A;  3ZFL A;  4ECI A;  1THO A;  2KLX A;  3ME7 A;  6GSS A;  3HJM A;  3HJO A;  1M9B A;  2NPB A;  3GYK A;  3UAR A;  2YAN A;  1GSQ A;  5IPG A;  3ZRE A;  1UN2 A;  4V1A p;  3M0F A;  1X9M B;  1YJ6 A;  3ZL5 A;  1ZL9 A;  1GLQ A;  2F8A A;  4N10 A;  4N11 A;  3TOT A;  3ZIT A;  3JCM L;  2XHF A;  1HNC A;  4ID0 A;  4ZBA A;  1O6J A;  2NVL A;  3APS A;  2FNO A;  3CXG A;  5IMF A;  5A4V A;  3ZRD A;  1G0T A;  3CTG A;  5IO2 A;  2PWJ A;  2M80 A;  3H93 A;  4POM A;  3LSZ A;  3E9J B;  3FR9 A;  5D8I A;  5AIS A;  2B6M A;  2V1M A;  5JCG A;  3GL5 A;  5A4U A;  5HR3 A;  3WYW A;  4K1F A;  4EC0 A;  4DEJ A;  3ZVJ D;  3DRN A;  1YZX A;  3MNG A;  3RDW A;  1VF4 A;  3DWV A;  4MJB A;  1T4Z A;  1V9W A;  2FUG 2;  4IEL A;  2KUC A;  1WWJ A;  2B5X A;  3KGK A;  1TTZ A;  3QR6 A;  2XPD A;  3PH9 A;  3APO A;  2CAI A;  1PSQ A;  2IMD A;  4K0N A;  2E2G A;  2VUP A;  2C0E A;  1WJK A;  3TJK A;  5A4W A;  3DML A;  3GKX A;  4F0B A;  3CRU A;  2D2Z A;  3M8N A;  3UJ1 A;  4E8E A;  4KSO A;  4KND A;  4ZXG A;  2HRN A;  2VO4 A;  3PGT A;  4I2T A;  3N5O A;  3BBY A;  2H8L A;  5HFG A;  3L78 A;  2GDR A;  4O92 A;  1GSS A;  4ZBB A;  3NZN A;  4PQI A;  2XC2 A;  4PX1 A;  2C0F A;  4GLT A;  2KHP A;  4TXO B;  1THX A;  2VAF A;  4MJE A;  2JL4 A;  1TU8 A;  4HOJ A;  2RUE A;  1FAA A;  1OVN A;  5IM9 A;  4ECC A;  1SK1 A;  2LTK A;  4PXO A;  4JED A;  1WE0 A;  3WD6 A;  4K9Z A;  2CA8 A;  3TJF A;  4LL4 B;  3QAW A;  3A2V A;  3G7I A;  3FZ4 A;  3UVT A;  2OKA A;  2GZY A;  4PNG A;  2VCT A;  1O8X A;  13GS A;  1GSE A;  3KTL A;  2TIR A;  3QFB C;  2GS3 A;  1M7T A;  3QAG A;  1SKS B;  4GCI A;  4TW5 A;  4EL1 A;  3LXZ A;  1PKZ A;  2A2R A;  1HD2 A;  1GLP A;  1X5E A;  4ECJ A;  1KNG A;  3KJY A;  4L0U A;  3GHA A;  1VF3 A;  2EIQ A;  4KDU A;  5ENU A;  2H76 A;  4RUV A;  5DCH A;  2BTO T;  1FHE A;  2E7P A;  1PL1 A;  1TK8 B;  5HQP A;  4G2E A;  2YPM A;  4TVE A;  1QUW A;  1SEN A;  5GAP D;  3HHV A;  1S3A A;  3D21 A;  1J08 A;  4EE0 A;  1NW2 A;  5CRD A;  5ECI B;  3DKS A;  4GSS A;  1HNB A;  2PVQ A;  2VIM A;  3GFK A;  2OBI A;  3KP9 A;  1SD9 A;  4WBR D;  2L6C A;  2GSQ A;  5E4W A;  4RI7 A;  5ABR A;  1U87 A;  1W89 A;  3F6F A;  3WGE A;  1G7O A;  3PIN A;  3TCO A;  3HZ4 A;  1MDJ A;  1ZGN A;  18GS A;  2L59 A;  2VCV A;  1U3A A;  2QKE A;  3A2X A;  3BCK A;  4P3Y B;  4EVM A;  3LFL A;  5ID2 B;  2H72 A;  3TKS A;  4YQM A;  2R37 A;  1JLW A;  3GTU A;  4MA9 A;  2HNL A;  3UBL A;  2Z9S A;  1CQH A;  3FY7 A;  1IYH A;  1R7H A;  3LG6 A;  2GLR A;  2TRX A;  4H86 A;  3C1S A;  4E8H A;  2JZR A;  3CTF A;  1XWC A;  2K18 A;  2RUF A;  1RW1 A;  2MYG A;  1USB A;  3KTB A;  3MAK A;  5G31 A;  1DE1 A;  1EV9 A;  3D5J A;  5C00 A;  1Z7P A;  5ELA A;  1XFL A;  1YKA A;  1GSU A;  3KH9 A;  4K6X A;  1ON4 A;  2A2S A;  2H75 A;  3MWH A;  5IOX A;  3GH9 A;  4GXZ A;  10GS A;  22GS A;  5CRH A;  1FVJ A;  2WUL A;  2LQO A;  2BMX A;  3LJR A;  3PR8 A;  3VPT A;  1HNA A;  4MMM A;  5CRW A;  5G1K A;  3GRX A;  4EF0 A;  1GUH A;  1GUK A;  4F9Z A;  5IPH A;  3C1R A;  3LEF A;  2VCQ A;  4GF0 A;  3VPQ A;  1OKD A;  2YWI A;  2J9H A;  3TRQ A;  1NHO A;  1AQW A;  2K6V A;  4OMV A;  2O87 A;  2KP2 A;  4ISD A;  1HQO A;  3CBU A;  2H74 A;  1FW1 A;  4IS0 A;  2YWM A;  2WCI A;  3UVH A;  1G6Y A;  2HZE A;  5H5S A;  5LNK e;  2DJ0 A;  2HSY A;  4NV2 A;  2VLV A;  3F4T A;  4HQZ A;  1C72 A;  4IP1 A;  4MLY A;  1Z3E A;  2MMA A;  4MF7 A;  1DBY A;  4MH2 A;  2M72 A;  1V40 A;  4HI7 A;  2GQL A;  1GNW A;  1NM3 A;  1URM A;  2RII A;  3TKQ A;  2DSA A;  3F8U A;  4K7O A;  1M9A A;  3IXR A;  4LL1 B;  3C73 A;  2FD3 A;  2V41 A;  3ZML A;  4X1U A;  1JFU A;  4IQ1 A;  3IAS 2;  5JCW A;  5CO3 A;  2V6O A;  4J56 E;  5DQY A;  4EDZ A;  1ACV A;  1GWC A;  2HXK A;  1QMV A;  2PUK C;  3TJG A;  6GST A;  1B8X A;  1JZR A;  4QL9 A;  5IMA A;  3IDV A;  4KGI A;  1PGT A;  3KCM A;  5ECN B;  4X0X A;  3VK9 A;  4XIH A;  7GSS A;  2DIZ A;  1FO5 A;  1X0R A;  3Q6O A;  1BG5 A;  3DXB A;  3GL3 A;  1XOB A;  4PQH A;  3CSI A;  1ZYE A;  5F07 A;  3UEM A;  1OC9 A;  2DMM A;  4KCA A;  3A3T A;  2M46 A;  4MDC A;  2WRT A;  1V57 A;  2VCW A;  2WZ9 A;  2H1G A;  1B4Q A;  3IR4 A;  1TK5 B;  2H0G A;  4HU9 A;  2ES7 A;  1KEB A;  4YQV A;  3SBC A;  4KH7 A;  2LUS A;  1EOG A;  3KXO A;  3FEU A;  5IQY A;  4L0W A;  1PA3 A;  5B8A A;  2TRC P;  3FHK A;  3IE3 A;  4TKY A;  3KZQ A;  3VUR A;  4MZC A;  4TR3 A;  3TDG A;  3TKS C;  1X9W B;  5ECK B;  4L5L A;  3TJB A;  3P2A A;  4KAE A;  3EC3 A;  4PQ1 A;  1OYJ A;  3UAP A;  5EL8 A;  4F82 A;  3VWU A;  5HR0 A;  1TKD B;  2ON5 A;  1QQ2 A;  3H79 A;  5COH A;  1TK0 B;  1JZO A;  2L4Q A;  1FOV A;  4ZB8 A;  3DYR A;  4PUF C;  2AYT A;  2JSZ A;  3L9V A;  4WR4 A;  3DIE A;  3DVW A;  1WOU A;  4K8M A;  3GUR A;  1SU9 A;  3ZYW A;  2MBS A;  2I4A A;  4DSQ A;  1VF1 A;  4EXJ A;  3L9U A;  1KBN A;  4MJC A;  3A2W A;  5H5Q A;  3F4S A;  1PQN A;  1XZO A;  1SK2 A;  2CAQ A;  5KN1 A;  3W8J A;  4I2U A;  4V2N A;  1E6B A;  1SKR B;  4WKW A;  4GST A;  2E2M A;  2MMZ A;  1K3O A;  2GQK A;  3D4T A;  1XVW A;  1EOH A;  1G7E A;  4TR4 A;  4GQF A;  5D9X A;  3EE2 A;  2LJR A;  19GS A;  5IO0 A;  5IOW A;  4TR1 A;  5D9T A;  1MEK A;  4OO4 A;  1AQX A;  2K8S A;  4PUR A;  2GGT A;  3L9S A;  4NPB A;  2X99 A;  4XTS A;  4KX4 A;  4ZL9 A;  3BJ5 A;  3APQ A;  4BVY A;  2YJH A;  4K2D A;  1JZD A;  2H0H A;  1YEP A;  3LYK A;  4IP6 A;  3Q74 A;  4NMU A;  1SJI A;  1GL8 A;  3WGX A;  1A2J A;  2P5Q A;  3IK7 A;  4ZBD A;  5INY A;  3ZZX A;  5DDL A;  3EWL A;  2VCX A;  1LU4 A;  1VF2 A;  5J5N A;  1K0B A;  4ZIL A;  5KN0 A;  3NOF A;  4HZ2 A;  4KCE A;  2X8G A;  2G2Q A;  2IFQ B;  3KP8 A;  1LBK A;  2R4V A;  2B5Y A;  1OAZ A;  1XWG A;  3G7Y A;  1GNE A;  3G9B A;  3GV1 A;  4MCU A;  3TKS E;  1Z6M A;  2F9S A;  3HJP A;  1TJD A;  3RPN A;  2IN3 A;  4O5R A;  2LRT A;  1FVK A;  4WR5 A;  5ECQ B;  3TGZ A;  2LS5 A;  3O6T A;  3RAZ A;  3CYN A;  4AF2 A;  4FH8 A;  4O32 A;  4XS6 A;  4EUY A;  2AAW A;  5AN1 A;  4ZL7 A;  5AIX A;  4IQA A;  5LCZ A;  4GTU A;  1OE7 A;  1N2A A;  1EZK A;  3GTU B;  1K3Y A;  3DEX A;  5LD0 A;  1YY7 A;  2H66 A;  4D73 B;  3FW2 A;  2CVB A;  4JZQ A;  3CRT A;  1A23 A;  2PMT A;  1YEX A;  3GIX A;  4IJ3 A;  9GSS A;  3ME8 A;  4HQS A;  2IPA A;  2CX4 A;  2CVD A;  3GKM A;  4EO3 A;  1XW6 A;  4JE1 A;  3P7X A;  1ML6 A;  1FG4 A;  2V2G A;  3I6A A;  2CZ2 A;  4NHZ A;  1JZW A;  2O8V B;  2DJJ A;  4RQR A;  4IN0 A;  2GTU A;  2X8H A;  4DSS B;  1IYI A;  1RQM A;  5CRG A;  3DGQ A;  4TOP A;  4J2F A;  4KDY A;  1Q4J A;  5DAL A;  1SL2 B;  4XS1 A;  2YV9 A;  4Z7X A;  1T8E B;  4Q5Q A;  1PX7 A;  1WPI A;  4POL A;  2WFC A;  4V2M A;  1GH2 A;  5J9B A;  4FYU A;  5G2Z A;  5ECR B;  1A2M A;  4QL7 A;  1SK0 A;  4IVF A;  3A5W A;  2JZT A;  3G7J A;  4XRA A;  4AJ6 A;  1TP9 A;  14GS A;  4HS1 A;  3U6V A;  2XBI A;  1FB6 A;  2HZE B;  3TOU A;  2ZNM A;  3BOA A;  3O76 A;  1YDK A;  5J41 A;  4V2L A;  1GP1 A;  2HFD A;  3HKR A;  4NV5 A;  1F9M A;  3US3 A;  4KUN A;  2YN1 A;  3C71 A;  3HA9 A;  1B4P A;  1GSF A;  1B9X C;  1O7U A;  3M9K A;  2ON7 A;  2I3Y A;  1TDI A;  2FWG A;  2P0G A;  4NWY A;  4IKH A;  1SL0 B;  2DC5 A;  5IIZ A;  1EEM A;  5J4U A;  1XOA A;  2MMO A;  2YP6 A;  2DIY A;  4HZ4 A;  3UL3 A;  1ZYQ B;  2LJA A;  2C3Q A;  3GUS A;  4EDY A;  1T00 A;  1TW9 A;  4AJ7 A;  1AIU A;  1R5P A;  1FB0 A;  1HYU A;  4GQC A;  2MBT A;  2DJ2 A;  4OD7 A;  5IMZ A;  1A0R P;  1AUC A;  2C80 A;  2H70 A;  3VI7 A;  1F37 A;  2NBS A;  5ELG A;  1BQ7 A;  2LRN A;  2RM5 A;  4TXO A;  4F0C A;  2L57 A;  4FO5 A;  1EP8 A;  5CYY A;  4NAX A;  2FWF A;  5ECO B;  1J9B A;  1OKT A;  3F0I A;  4IHU A;  2R3X A;  5KN3 A;  1X9S B;  1TRV A;  2JZS A;  1M2A A;  1PD2 1;  4K0G A;  5KEJ A;  3D0Z A;  5FWG A;  3P90 A;  2YV7 A;  2FWE A;  1X5C A;  2QC7 A;  4V1A g;  1YQ1 A;  1W4V A;  3ERF A;  2VD1 A;  4DSR A;  5A5K A;  3TUE A;  2OAD A;  5J9C A;  4MJA A;  3EU3 A;  1XBS A;  2GST A;  3EMX A;  2C3N A;  5C04 A;  2C1Y A;  2B7K A;  3FRC A;  3BD2 A;  4PUA A;  2OE1 A;  3HZ8 A;  1UA5 A;  5JWR B;  3IRA A;  3Q19 A;  4WBJ A;  5HFI A;  1BED A;  4DVC A;  3QFA C;  2A4V A;  1CQG A;  3NIV A;  3HCZ A;  3F9U A;  4TR0 A;  1YF1 A;  3VWX A;  2VL2 A;  2EC4 A;  1AW9 A;  4PGT A;  4MK3 A;  2IIY A;  2I81 A;  1Z6N A;  4JBB A;  3ZVJ A;  1M2B A;  3N9J A;  4I8B A;  4MAB A;  2C3T A;  2REM A;  2H1D A;  4N0V A;  1KTE A;  2YZH A;  3LWA A;  5EVO A;  3GX0 A;  1U3I A;  1TRU A;  3I43 A;  1SJ6 A;  1S3D A;  1TRW A;  2IL3 A;  5EY6 A;  2LNT A;  4CW9 A;  1ILO A;  5D93 A;  1PN9 A;  1JHB A;  4LMW A;  16GS A;  2GSR A;  5GSS A;  2GT5 A;  3ZFB A;  1V2A A;  1YF0 A;  2WJU A;  4ML1 A;  4JU5 A;  4I6X A;  4NHW A;  1MDK A;  3HY2 A;  1F3B A;  1F6M C;  4TR1 B;  1F2E A;  2N5F A;  2GZP A;  4I97 A;  1O73 A;  3WT1 A;  3LGC A;  4KSM A;  3FK8 A;  3F63 A;  5G5F A;  2OA7 A;  3LYP A;  4HJM A;  4HDE A;  6GSY A;  1RK4 A;  3GSS A;  1N8J A;  4XS4 A;  2LEG A;  2OE0 A;  1X5D A;  3QD9 A;  1DSB A;  3F3Q A;  3C8E A;  4ILF A;  2R2J A;  3L0H A;  3MDK A;  5KN2 A;  2YWN A;  1B9Y C;  2PPT A;  1MD4 A;  4BA7 A;  3P8W A;  1GTB A;  3QAV A;  4JR4 A;  3GMF A;  3CMI A;  4F2I A;  2AJQ B;  4YAV A;  5AGY A;  4BWQ A;  4NXI A;  2PU9 C;  1WMJ A;  4ULX A;  4TN8 A;  1AAZ A;  2IME A;  1A0F A;  5JWO B;  2H6X A;  5F8B A;  3QMX A;  4I5Q A;  2YWO A;  3HVX A;  3IAM 2;  5ECM B;  2MMN A;  2O7K A;  3TJJ A;  4TXV A;  2CVK A;  1SKW B;  1ST9 A;  2JU5 A;  5D9V A;  4ZL8 A;  3HVS A;  1OC8 A;  5DCG A;  4AGS A;  3KEB A;  1OE8 A;  3IPZ A;  1XXU A;  2FLS A;  1QFN A;  1Q98 A;  1EP7 A;  3CSH A;  4K7N A;  1DUG A;  1SD8 A;  3Q18 A;  2VM2 A;  4N30 A;  2K9F A;  1BJX A;  4TRX A;  2VCZ A;  1XWA A;  2KOK A;  1GTU A;  3IV4 A;  6GSX A;  3VLN A;  4WXT A;  2O89 A;  4KA0 A;  3L4N A;  2H19 A;  2B1K A;  2ZUP A;  3H4K A;  3RBT A;  3EMP A;  1GSY A;  3QDN A;  1LJR A;  5FHI A;  2DBC A;  2H0I A;  3QPM A;  4YAP A;  3U5R E;  5D9W A;  1MDI A;  2F3M A;  3H1N A;  1AXD A;  2KP1 A;  3W8S A;  2WS2 A;  4Q5F A;  2C0G A;  5B8B A;  2LRC A;  2GSS A;  3M9J A;  3QCP A;  2N5B A;  3WGD A;  1TU7 A;  2HE3 A;  3TRP A;  3IK9 A;  5HR1 A;  1B48 A;  3GN3 A;  3GKK A;  1ERV A;  4WF4 A;  1V98 A;  2FCH A;  2DJ1 A;  5DAL B;  5CNW A;  4OCE A;  5FT3 A;  6GSV A;  5DBQ A;  5HR2 A;  2FY6 A;  2DJK A;  2RLI A;  2VL2 C;  1WP0 A;  1S3C A;  3RHC A;  2ZCT A;  1T4Y A;  1XCC A;  1M0U A;  4MPG A;  5DAK A;  2OAC A;  2H1B A;  2QSI A;  3D4M A;  4EKZ A;  3RHB A;  4OFN A;  4L5O A;  5B6M A;  1ZMA A;  2LJK A;  3I69 A;  1TI3 A;  1ERT A;  3DVX A;  20GS A;  1U88 A;  4XHM A;  4LMV A;  5L71 A;  1GTA A;  3HDC A;  2C0D A;  1ERU A;  3KIJ A;  3EUR A;  4MZB A;  2B7J A;  2YZU A;  3ERG A;  2LQQ A;  3ISO A;  1EGO A;  5F06 A;  3UMA A;  2N5A A;  2IMK A;  4YH2 A;  2JSY A;  4MF5 A;  2X64 A;  1K0O A;  4WF5 A;  2G0F A;  6GSW A;  4GWR A;  4ML6 A;  5J3R A;  4KDX A;  5H5R A;  5G1L A;  4J57 E;  2GZZ A;  1M99 A;  1GUM A;  1XWB A;  4FIW A;  1XW5 A;  4G9H A;  1O85 A;  1PX6 A;  1TOF A;  4POB A;  1A8L A;  3ZMK A;  5GZZ B;  3KH7 A;  2HYX A;  1QK8 A;  5GST A;  1M2D A;  3GX8 A;  4N0Z A;  1Y6E A;  2L5L A;  3AY8 A;  2LV3 A;  2CV4 A;  2H6Z A;  1K0C A;  4G19 A;  2XPE A;  3E0U A;  5IMV A;  2OE3 A;  5CAX A;  3QOU A;  2IJY A;  1K0A A;  2FWH A;  3TB2 A;  3GA4 A;  4YQU A;  5HFK A;  2E0Q A;  4HUA A;  3F4R A;  5G5E A;  4BL7 A;  5B6N A;  1YKC A;  2K8V A;  4ACS A;  3C7M A;  3K8N A;  3FR6 A;  1U6T A;  1ZOF A;  1XIY A;  1XW9 A;  2ALB A;  2AHE A;  3FKF A;  1UVZ A;  1O8W A;  2F51 A;  2PVO C;  4KE3 A;  2P31 A;  2MZC A;  4XRD A;  1ABA A;  1PKW A;  3IC4 A;  1ERW A;  2YOI A;  2VD0 A;  1XVQ A;  2L6D A;  2IMI A;  2B3S A;  1VGL A;  4MPF A;  2IFQ A;  3UBK A;  2PER A;  1H4O A;  4KW6 A;  1GUL A;  2HSH A;  2H6Y A;  5DJL A;  3KD0 A;  3GKN A;  2H71 A;  4XCS A;  5GAN D;  1WRY A;  3UIW A;  4BWS A;  2FA8 A;  5G30 A;  4OCF A;  2C4J A;  3IOS A;  5DVB A;  3VI5 A;  4MZW A;  3TKR A;  2X8C A;  3EYT A;  4AJ8 A;  4IGJ A;  2HT9 A;  3GST A;  2FA4 A;  1AC1 A;  3SWL A;  3ZTL A;  2PGT A;  1T7P B;  2H30 A;  2AUV A;  2V32 A;  3E3E A;  3R2Q A;  1R4W A;  5JCU A;  1QGV A;  5D73 A;  3DD3 A;  2NTO A;  1R26 A;  4HU7 A;  4D73 A;  3UOM A;  1Y25 A;  3KMN A;  1PMT A;  2DML A;  2IWT A;  2V6K A;  3VWW A;  4BVX A;  4K7I A;  1GRX A;  3W6G A;  5IMD A;  1T1V A;  1K3L A;  3EU4 A;  5EPF A;  1OC9 B;  5CP1 A;  4QQ7 A;  1K0M A;  1V58 A;  3VWV A;  4IJI A;  3S9F A;  4WET A;  2JAD A;  2O85 A;  2HI7 A;  2VL3 A;  4GRF A;  4XS4 B;  3OR5 A;  3HXS A;  2VLU A;  2WB9 A;  4IBP A;  2OBK A;  3FZ5 A;  1EEJ A;  4WEY A;  4ZB6 A;  4DSS A;  1GTI A;  2F8F A;  4KB3 A;  3O3T A;  5IMC A;  5DQS A;  2EIO A;  6GSU A;  2DJ3 A;  4PNF A;  1K0D A;  2GQM A;  2IMF A;  3RPP A;  1VRS D;  3FZA A;  4ZIJ A;  3ERW A;  1WIK A;  2R5G A;  2P5R A;  3FR3 A;  1Z7R A;  2FHE A;  4BPY A;  1I5G A;  1DE2 A;  1EGR A;  4CHS A;  4IW9 A;  3MSZ A;  3J7Y b;  1ZCP A;  2C8U A;  1PRX A;  5ECH B;  1TI1 A;  3IBH A;  3LOR A;  2VL9 A;  1AQV A;  3I9V 2;  4LA1 A;  4POK A;  2QGV A;  4Q5R A;  2AB6 A;  3GNJ A;  3F6D A;  4CDO A;  5ECS A;  2WGR A;  1SL1 B;  1PL2 A;  3V1W A;  1A2L A;  2VOC A;  4G10 A;  3GH6 A;  1SYR A;  1Z5Y E;  3M3M A;  4JRR A;  5ID2 A;  2RM6 A;  1SJZ A;  4X43 A;  2YCD A;  2B5E A;  1MTC A;  3D6I A;  4F03 A;  3TKP A;  1I9D A;  3EIN A;  5ECP B;  2EIR A;  3H8Q A;  1MD3 A;  4OFT A;  4MF6 A;  3VFI A;  2L5O A;  2HRF A;  2LNS A;  5F0G A; 
#chains in the Genus database with same CATH topology
 1SYX A;  4Q5N A;  2GVP A;  2H01 A;  4JR6 A;  4GSN A;  2YJ7 A;  1XWK A;  4BVY B;  4ECB A;  3CSJ A;  2CT6 A;  3J7Y k;  5D96 A;  4O7H A;  1Z9H A;  2PN8 A;  3ZIV A;  1OC3 A;  1F3A A;  2BJX A;  2H1A A;  2HZF A;  4RQX A;  8GSS A;  2CQ9 A;  3F3R A;  5E59 A;  4MH3 A;  2J23 A;  2XBQ A;  5AIV A;  1J0F A;  11GS A;  3ZIJ A;  1EV4 A;  2FGX A;  3LXT A;  2DLX A;  4LLR A;  1E2Y A;  4L8E A;  2AV4 A;  17GS A;  1BYE A;  1H75 A;  5DAK B;  1NSW A;  3KMO A;  1JLV A;  4G0K A;  4ZB9 A;  2I9H A;  4HEA 2;  1A24 A;  4OFM A;  2JAC A;  2VM1 A;  3TRX A;  1K0N A;  2GT6 A;  5ECL B;  3D22 A;  1ZZY A;  1T3B A;  1XPV A;  4HJ2 A;  2LST A;  2B1L A;  5B7C A;  3FYG A;  4OWY A;  4MP4 A;  5DJM A;  1BAY A;  1NHY A;  2I1U A;  2NDO A;  2LKU A;  1EWX A;  4FYC A;  1R5A A;  4FYB A;  2CZ3 A;  3KM6 A;  3IHQ A;  1O81 A;  1BX9 A;  2OJL A;  5F05 A;  5JWQ B;  2L4C A;  3EVI A;  3HVV A;  2YNX A;  1GSD A;  1UC7 A;  2VLT A;  4OO5 A;  3HD5 A;  4Z2R A;  3IA1 A;  4RI6 A;  2CX3 A;  2WDU A;  3ED3 A;  3LQ7 A;  5CRE A;  3M1G A;  1TRS A;  2R6K A;  3ZLP A;  1A8Y A;  2H73 A;  1TXX A;  1G6W A;  3BCI A;  1QXH A;  2UZ8 A;  2PBJ A;  3HYP A;  3WT2 A;  3FZ9 A;  2HLS A;  12GS A;  3ZFL A;  4ECI A;  1THO A;  2KLX A;  3ME7 A;  6GSS A;  3HJM A;  3HJO A;  1M9B A;  2NPB A;  3GYK A;  3UAR A;  2YAN A;  1GSQ A;  5IPG A;  3ZRE A;  1UN2 A;  4V1A p;  3M0F A;  1X9M B;  1YJ6 A;  3ZL5 A;  1ZL9 A;  1GLQ A;  2R0P A;  4N10 A;  2F8A A;  4N11 A;  3TOT A;  3ZIT A;  3JCM L;  2XHF A;  1HNC A;  3PPU A;  4ID0 A;  4ZBA A;  1O6J A;  2NVL A;  3APS A;  2FNO A;  3CXG A;  5IMF A;  5A4V A;  3ZRD A;  1G0T A;  3CTG A;  5IO2 A;  2PWJ A;  2M80 A;  2DKH A;  3H93 A;  4POM A;  3LSZ A;  3E9J B;  3FR9 A;  5D8I A;  4BIK A;  5AIS A;  2B6M A;  2V1M A;  5JCG A;  3GL5 A;  5A4U A;  5HR3 A;  3WYW A;  4K1F A;  4EC0 A;  4DEJ A;  3ZVJ D;  3DRN A;  1YZX A;  3MNG A;  3RDW A;  1VF4 A;  3DWV A;  4MJB A;  1T4Z A;  1V9W A;  2FUG 2;  4IEL A;  2KUC A;  1WWJ A;  2B5X A;  3KGK A;  1TTZ A;  3QR6 A;  2XPD A;  3PH9 A;  3APO A;  2CAI A;  1PSQ A;  2IMD A;  4K0N A;  2E2G A;  2VUP A;  2C0E A;  1WJK A;  3TJK A;  5A4W A;  3DML A;  3GKX A;  4F0B A;  3CRU A;  2D2Z A;  3M8N A;  3UJ1 A;  4E8E A;  4KSO A;  4KND A;  4ZXG A;  2HRN A;  2VO4 A;  3PGT A;  4I2T A;  3N5O A;  3BBY A;  2H8L A;  5HFG A;  3L78 A;  2GDR A;  4O92 A;  1GSS A;  4ZBB A;  3NZN A;  4PQI A;  2XC2 A;  4BVX B;  4PX1 A;  2C0F A;  4GLT A;  2KHP A;  4TXO B;  1THX A;  2VAF A;  4K2X A;  4MJE A;  2JL4 A;  1TU8 A;  4HOJ A;  2RUE A;  1FAA A;  1OVN A;  5IM9 A;  4ECC A;  1SK1 A;  2LTK A;  4PXO A;  4JED A;  1WE0 A;  3WD6 A;  4K9Z A;  2CA8 A;  3TJF A;  4LL4 B;  3QAW A;  3A2V A;  3G7I A;  3FZ4 A;  3UVT A;  2OKA A;  2GZY A;  4PNG A;  2VCT A;  1O8X A;  13GS A;  1GSE A;  3KTL A;  2TIR A;  3QFB C;  2GS3 A;  1M7T A;  3QAG A;  1SKS B;  4GCI A;  4TW5 A;  4EL1 A;  3LXZ A;  1PKZ A;  2A2R A;  1HD2 A;  1GLP A;  1X5E A;  4ECJ A;  1KNG A;  3KJY A;  4L0U A;  3GHA A;  2A4H A;  1VF3 A;  2EIQ A;  4KDU A;  5ENU A;  2H76 A;  4RUV A;  5DCH A;  2BTO T;  1FHE A;  2E7P A;  1PL1 A;  1TK8 B;  5HQP A;  4G2E A;  2YPM A;  4TVE A;  1QUW A;  1SEN A;  5GAP D;  3HHV A;  1S3A A;  3D21 A;  1J08 A;  4EE0 A;  1NW2 A;  5CRD A;  5ECI B;  3DKS A;  4GSS A;  1HNB A;  2PVQ A;  2VIM A;  3GFK A;  2OBI A;  3KP9 A;  1SD9 A;  4WBR D;  2L6C A;  2GSQ A;  5E4W A;  4RI7 A;  5ABR A;  1U87 A;  1W89 A;  3F6F A;  3WGE A;  1G7O A;  3PIN A;  3TCO A;  3HZ4 A;  1MDJ A;  1ZGN A;  18GS A;  2L59 A;  2VCV A;  1U3A A;  2QKE A;  3A2X A;  3BCK A;  4P3Y B;  4EVM A;  3LFL A;  5ID2 B;  2H72 A;  3TKS A;  2R37 A;  3GTU A;  1JLW A;  4YQM A;  4MA9 A;  2HNL A;  3UBL A;  2Z9S A;  1CQH A;  3FY7 A;  1IYH A;  1R7H A;  3LG6 A;  2GLR A;  2TRX A;  4H86 A;  3C1S A;  4E8H A;  2JZR A;  3CTF A;  1XWC A;  2K18 A;  2RUF A;  1RW1 A;  2MYG A;  1USB A;  3KTB A;  3MAK A;  5G31 A;  1DE1 A;  1EV9 A;  3D5J A;  5C00 A;  1Z7P A;  5ELA A;  2A2P A;  1XFL A;  1YKA A;  1GSU A;  3KH9 A;  4K6X A;  1ON4 A;  2A2S A;  2H75 A;  3MWH A;  5IOX A;  3GH9 A;  4GXZ A;  10GS A;  22GS A;  5CRH A;  4YKF A;  1FVJ A;  2WUL A;  2LQO A;  2BMX A;  3LJR A;  3PR8 A;  3VPT A;  1HNA A;  4MMM A;  5CRW A;  5G1K A;  3GRX A;  4EF0 A;  1GUH A;  1GUK A;  4F9Z A;  5IPH A;  3C1R A;  3LEF A;  2VCQ A;  1ZYN A;  4GF0 A;  3VPQ A;  1OKD A;  2YWI A;  5KOX A;  2J9H A;  3TRQ A;  1NHO A;  1AQW A;  2K6V A;  4OMV A;  2O87 A;  2HRA A;  2KP2 A;  4ISD A;  1HQO A;  3CBU A;  2H74 A;  1FW1 A;  4IS0 A;  1S3R A;  2YWM A;  2WCI A;  3UVH A;  1G6Y A;  2HZE A;  5H5S A;  5LNK e;  2DJ0 A;  2HSY A;  4NV2 A;  2VLV A;  3F4T A;  4HQZ A;  1C72 A;  4IP1 A;  4MLY A;  1Z3E A;  2MMA A;  4MF7 A;  1DBY A;  4MH2 A;  2M72 A;  1V40 A;  4HI7 A;  2GQL A;  3R3E A;  1GNW A;  1NM3 A;  1URM A;  2RII A;  3TKQ A;  2DSA A;  3F8U A;  4K7O A;  1M9A A;  3IXR A;  4LL1 B;  3C73 A;  2FD3 A;  2V41 A;  3ZML A;  4X1U A;  1JFU A;  4IQ1 A;  3IAS 2;  5JCW A;  5CO3 A;  2V6O A;  4J56 E;  5DQY A;  3A5I A;  4EDZ A;  1ACV A;  1GWC A;  2HXK A;  1QMV A;  2PUK C;  3TJG A;  6GST A;  1B8X A;  1JZR A;  4QL9 A;  5IMA A;  3IDV A;  4KGI A;  1PGT A;  3KCM A;  5ECN B;  4X0X A;  3VK9 A;  4XIH A;  7GSS A;  2DIZ A;  1FO5 A;  1X0R A;  3Q6O A;  1BG5 A;  3DXB A;  3GL3 A;  1XOB A;  4PQH A;  3CSI A;  1ZYE A;  5F07 A;  3UEM A;  1OC9 A;  2DMM A;  4KCA A;  3A3T A;  2M46 A;  5BMU A;  4MDC A;  2WRT A;  1V57 A;  2VCW A;  2WZ9 A;  2H1G A;  4USS A;  4X4J A;  1B4Q A;  3IR4 A;  1TK5 B;  2H0G A;  3FMW A;  4HU9 A;  2ES7 A;  1KEB A;  4YQV A;  3SBC A;  4KH7 A;  2LUS A;  1EOG A;  3KXO A;  4A5P A;  3FEU A;  5IQY A;  4L0W A;  1PA3 A;  5B8A A;  2TRC P;  3FHK A;  3IE3 A;  4TKY A;  3KZQ A;  3VUR A;  4MZC A;  4TR3 A;  3TDG A;  3TKS C;  1X9W B;  5ECK B;  4L5L A;  3TJB A;  3P2A A;  4KAE A;  3EC3 A;  4PQ1 A;  1OYJ A;  3UAP A;  5EL8 A;  4F82 A;  3VWU A;  5HR0 A;  1TKD B;  2ON5 A;  1QQ2 A;  3H79 A;  5COH A;  1TK0 B;  1JZO A;  2L4Q A;  1FOV A;  4ZB8 A;  3DYR A;  4PUF C;  2AYT A;  2JSZ A;  3L9V A;  4WR4 A;  3DIE A;  3DVW A;  1WOU A;  4K8M A;  3GUR A;  1SU9 A;  3ZYW A;  2MBS A;  2I4A A;  4DSQ A;  1VF1 A;  4EXJ A;  3L9U A;  1KBN A;  4MJC A;  3A2W A;  5H5Q A;  5KOW A;  3F4S A;  1PQN A;  1XZO A;  1SK2 A;  2CAQ A;  5KN1 A;  3W8J A;  4I2U A;  4V2N A;  1E6B A;  1SKR B;  4WKW A;  4GST A;  2E2M A;  2MMZ A;  1K3O A;  2GQK A;  3D4T A;  1XVW A;  1EOH A;  1G7E A;  4TR4 A;  4GQF A;  5D9X A;  3EE2 A;  2R0G A;  2LJR A;  19GS A;  5IO0 A;  5IOW A;  4TR1 A;  5D9T A;  1MEK A;  4OO4 A;  1AQX A;  2K8S A;  4BL7 B;  4PUR A;  2GGT A;  3L9S A;  4NPB A;  2X99 A;  4XTS A;  4KX4 A;  4ZL9 A;  3BJ5 A;  3APQ A;  4BVY A;  2YJH A;  4K2D A;  1JZD A;  2H0H A;  1YEP A;  4CY8 A;  3LYK A;  4IP6 A;  3Q74 A;  4NMU A;  1SJI A;  1GL8 A;  3WGX A;  1A2J A;  2P5Q A;  3IK7 A;  4ZBD A;  5INY A;  3ZZX A;  5DDL A;  3EWL A;  2VCX A;  1LU4 A;  1VF2 A;  5J5N A;  1K0B A;  4ZIL A;  5KN0 A;  3NOF A;  4HZ2 A;  4KCE A;  2X8G A;  2G2Q A;  2IFQ B;  3KP8 A;  1LBK A;  2R4V A;  2B5Y A;  1OAZ A;  1XWG A;  3G7Y A;  1GNE A;  3G9B A;  3GV1 A;  4MCU A;  3TKS E;  1Z6M A;  2F9S A;  3HJP A;  1TJD A;  3RPN A;  2IN3 A;  4O5R A;  2LRT A;  1FVK A;  4KF9 A;  4WR5 A;  5ECQ B;  3TGZ A;  2LS5 A;  3O6T A;  3RAZ A;  3CYN A;  4AF2 A;  4FH8 A;  4O32 A;  4G0I A;  4XS6 A;  4EUY A;  2AAW A;  5AN1 A;  4ZL7 A;  5AIX A;  4IQA A;  5LCZ A;  4GTU A;  1OE7 A;  1N2A A;  1EZK A;  3GTU B;  1K3Y A;  3DEX A;  5LD0 A;  1YY7 A;  2H66 A;  4D73 B;  3FW2 A;  2CVB A;  4JZQ A;  3CRT A;  1A23 A;  2PMT A;  1YEX A;  3GIX A;  4IJ3 A;  4O5U A;  9GSS A;  3ME8 A;  4HQS A;  2IPA A;  2CX4 A;  2CVD A;  3GKM A;  4EO3 A;  1XW6 A;  4JE1 A;  3P7X A;  1ML6 A;  1FG4 A;  2V2G A;  3I6A A;  2CZ2 A;  4NHZ A;  1JZW A;  2O8V B;  2DJJ A;  2QA2 A;  4RQR A;  4IN0 A;  2GTU A;  2X8H A;  4DSS B;  1IYI A;  1RQM A;  5CRG A;  3DGQ A;  4TOP A;  4J2F A;  4KDY A;  1Q4J A;  5DAL A;  1SL2 B;  4XS1 A;  2YV9 A;  4Z7X A;  1T8E B;  4Q5Q A;  1PX7 A;  1WPI A;  4POL A;  2WFC A;  4V2M A;  1GH2 A;  5J9B A;  4FYU A;  5G2Z A;  5ECR B;  1A2M A;  4QL7 A;  1SK0 A;  4IVF A;  3A5W A;  2JZT A;  3G7J A;  4XRA A;  4AJ6 A;  1TP9 A;  14GS A;  4HS1 A;  3U6V A;  4Z2T A;  2XBI A;  1FB6 A;  2HZE B;  3TOU A;  2ZNM A;  3BOA A;  3O76 A;  1YDK A;  5J41 A;  4V2L A;  1GP1 A;  2HFD A;  3HKR A;  4NV5 A;  1F9M A;  3US3 A;  4KUN A;  2YN1 A;  3C71 A;  3HA9 A;  1B4P A;  1GSF A;  1B9X C;  1O7U A;  3M9K A;  2ON7 A;  2I3Y A;  1TDI A;  2FWG A;  2P0G A;  4NWY A;  4IKH A;  1SL0 B;  2DC5 A;  5IIZ A;  1EEM A;  5J4U A;  1XOA A;  2MMO A;  2YP6 A;  2DIY A;  4HZ4 A;  1FOH A;  3UL3 A;  1ZYQ B;  2LJA A;  2C3Q A;  3GUS A;  4EDY A;  1T00 A;  1TW9 A;  4AJ7 A;  1AIU A;  1R5P A;  1FB0 A;  1HYU A;  1PFO A;  4GQC A;  2MBT A;  2DJ2 A;  4OD7 A;  5IMZ A;  1A0R P;  1AUC A;  2C80 A;  2H70 A;  3VI7 A;  1F37 A;  2NBS A;  5ELG A;  1BQ7 A;  2LRN A;  4YKG A;  2RM5 A;  4TXO A;  4F0C A;  2L57 A;  4FO5 A;  1EP8 A;  5CYY A;  1ZYP A;  4NAX A;  2FWF A;  5ECO B;  1J9B A;  1OKT A;  3F0I A;  4IHU A;  2R3X A;  5KN3 A;  1X9S B;  1TRV A;  2JZS A;  1M2A A;  1PD2 1;  2HSM A;  4K0G A;  5KEJ A;  3D0Z A;  4O5Q A;  5FWG A;  3P90 A;  2YV7 A;  2FWE A;  1X5C A;  2QC7 A;  4V1A g;  1YQ1 A;  1W4V A;  3ERF A;  4Z2U A;  2VD1 A;  4DSR A;  5A5K A;  4G0L A;  3TUE A;  2OAD A;  3MYD A;  1PN0 A;  5J9C A;  4MJA A;  3EU3 A;  1XBS A;  2GST A;  3EMX A;  2C3N A;  5C04 A;  2C1Y A;  2B7K A;  3FRC A;  3BD2 A;  4PUA A;  2OE1 A;  3HZ8 A;  1UA5 A;  5JWR B;  3IRA A;  3Q19 A;  4WBJ A;  5HFI A;  1BED A;  2R0C A;  4DVC A;  3QFA C;  2A4V A;  1CQG A;  3NIV A;  3HCZ A;  3F9U A;  4TR0 A;  1YF1 A;  3VWX A;  2VL2 A;  2EC4 A;  1AW9 A;  4PGT A;  4MK3 A;  2IIY A;  2I81 A;  1Z6N A;  4JBB A;  3ZVJ A;  1M2B A;  3N9J A;  4I8B A;  4MAB A;  2C3T A;  2REM A;  2H1D A;  4N0V A;  1KTE A;  2YZH A;  3LWA A;  5EVO A;  3GX0 A;  1U3I A;  1TRU A;  3I43 A;  1SJ6 A;  1S3D A;  1TRW A;  2IL3 A;  5EY6 A;  2LNT A;  4CW9 A;  1ILO A;  5D93 A;  1PN9 A;  1JHB A;  4LMW A;  16GS A;  2GSR A;  5GSS A;  2GT5 A;  3ZFB A;  1V2A A;  1YF0 A;  2WJU A;  4ML1 A;  4JU5 A;  4I6X A;  4NHW A;  1MDK A;  3HY2 A;  1F3B A;  1F6M C;  4PTS A;  4TR1 B;  1F2E A;  2N5F A;  2GZP A;  4I97 A;  1O73 A;  3WT1 A;  3LGC A;  4KSM A;  3FK8 A;  3F63 A;  2QA1 A;  5G5F A;  2OA7 A;  3LYP A;  4HJM A;  4HDE A;  6GSY A;  1RK4 A;  3GSS A;  1N8J A;  4XS4 A;  2LEG A;  2OE0 A;  1X5D A;  3QD9 A;  1DSB A;  3F3Q A;  3C8E A;  4ILF A;  2R2J A;  3L0H A;  3MDK A;  5KN2 A;  2YWN A;  1B9Y C;  2PPT A;  1MD4 A;  4BA7 A;  3P8W A;  1GTB A;  3QAV A;  4JR4 A;  3GMF A;  3CMI A;  4F2I A;  2AJQ B;  4YAV A;  5AGY A;  4BWQ A;  4NXI A;  2PU9 C;  1WMJ A;  4ULX A;  4TN8 A;  2X49 A;  1AAZ A;  2IME A;  1A0F A;  5JWO B;  2H6X A;  5F8B A;  3QMX A;  2DKI A;  2YWO A;  4I5Q A;  4FQU A;  3HVX A;  3IAM 2;  5ECM B;  3MIX A;  2MMN A;  2O7K A;  3TJJ A;  4TXV A;  2CVK A;  1SKW B;  1ST9 A;  2JU5 A;  5D9V A;  4ZL8 A;  3HVS A;  1OC8 A;  5DCG A;  4AGS A;  3KEB A;  4MNN A;  1OE8 A;  3IPZ A;  1XXU A;  2FLS A;  1QFN A;  1Q98 A;  1EP7 A;  3CSH A;  4K7N A;  1DUG A;  1SD8 A;  3Q18 A;  2VM2 A;  4N30 A;  2K9F A;  1BJX A;  4TRX A;  2VCZ A;  1XWA A;  2KOK A;  1GTU A;  3IV4 A;  6GSX A;  3VLN A;  4WXT A;  2O89 A;  4KA0 A;  3L4N A;  2H19 A;  2B1K A;  2ZUP A;  3H4K A;  3RBT A;  3EMP A;  1GSY A;  3QDN A;  1LJR A;  5FHI A;  2DBC A;  2H0I A;  3QPM A;  4YAP A;  3U5R E;  5D9W A;  1MDI A;  2F3M A;  3H1N A;  1AXD A;  2KP1 A;  3W8S A;  2WS2 A;  4Q5F A;  2C0G A;  5B8B A;  2LRC A;  2GSS A;  3M9J A;  3QCP A;  2N5B A;  3WGD A;  1TU7 A;  2HE3 A;  3LW9 A;  3TRP A;  3IK9 A;  5HR1 A;  1B48 A;  3GN3 A;  3GKK A;  1ERV A;  4WF4 A;  1V98 A;  2FCH A;  2DJ1 A;  5DAL B;  5CNW A;  4OCE A;  5FT3 A;  6GSV A;  5DBQ A;  5HR2 A;  2FY6 A;  3EPT A;  4K5R A;  2DJK A;  2RLI A;  2VL2 C;  1WP0 A;  1S3C A;  3RHC A;  2ZCT A;  1T4Y A;  1XCC A;  1M0U A;  4MPG A;  5DAK A;  2OAC A;  2H1B A;  2QSI A;  3D4M A;  4EKZ A;  3RHB A;  4OFN A;  4L5O A;  5B6M A;  1ZMA A;  2LJK A;  3I69 A;  1TI3 A;  1ERT A;  3DVX A;  20GS A;  1U88 A;  4XHM A;  4LMV A;  5L71 A;  1GTA A;  3HDC A;  2C0D A;  1ERU A;  3KIJ A;  3EUR A;  4MZB A;  2B7J A;  2YZU A;  3ERG A;  2LQQ A;  3ISO A;  1EGO A;  5F06 A;  3UMA A;  2N5A A;  2IMK A;  4YH2 A;  2JSY A;  4MF5 A;  1M3J A;  2X64 A;  1K0O A;  4WF5 A;  2G0F A;  6GSW A;  4GWR A;  4ML6 A;  5J3R A;  4KDX A;  5H5R A;  5G1L A;  4J57 E;  2GZZ A;  1M99 A;  1GUM A;  1XWB A;  4FIW A;  1XW5 A;  4G9H A;  1O85 A;  1PX6 A;  1TOF A;  4POB A;  1A8L A;  3ZMK A;  5GZZ B;  3KH7 A;  2HYX A;  1QK8 A;  5GST A;  1M2D A;  3GX8 A;  4EIQ A;  4N0Z A;  1Y6E A;  2L5L A;  3AY8 A;  2LV3 A;  2CV4 A;  2H6Z A;  1K0C A;  4G19 A;  2XPE A;  3E0U A;  5IMV A;  2OE3 A;  5CAX A;  3IC8 A;  3QOU A;  2IJY A;  1K0A A;  2FWH A;  3TB2 A;  3GA4 A;  4YQU A;  5HFK A;  2E0Q A;  4HUA A;  3F4R A;  5G5E A;  4BL7 A;  5B6N A;  1YKC A;  2K8V A;  4ACS A;  3C7M A;  3K8N A;  3FR6 A;  1U6T A;  1ZOF A;  1XIY A;  1XW9 A;  1M3I A;  2ALB A;  2AHE A;  3FKF A;  1UVZ A;  1O8W A;  2F51 A;  2PVO C;  4KE3 A;  2P31 A;  2MZC A;  4XRD A;  1ABA A;  3CQF A;  1PKW A;  3IC4 A;  1ERW A;  2YOI A;  2VD0 A;  1XVQ A;  2L6D A;  2IMI A;  2B3S A;  1VGL A;  4MPF A;  2IFQ A;  5BRT A;  3UBK A;  2PER A;  1H4O A;  4KW6 A;  4CY6 A;  1GUL A;  3HVN A;  2HSH A;  2H6Y A;  5DJL A;  3KD0 A;  3GKN A;  2H71 A;  4XCS A;  5GAN D;  1WRY A;  3UIW A;  4BWS A;  2FA8 A;  5G30 A;  4OCF A;  2C4J A;  3IOS A;  5DVB A;  3VI5 A;  4MZW A;  3TKR A;  2X8C A;  3EYT A;  4AJ8 A;  4IGJ A;  2HT9 A;  3GST A;  1XG8 A;  2FA4 A;  1AC1 A;  3SWL A;  3ZTL A;  2PGT A;  1T7P B;  2H30 A;  4K5S A;  2AUV A;  2V32 A;  3E3E A;  3R2Q A;  1R4W A;  5JCU A;  1QGV A;  5D73 A;  3DD3 A;  2NTO A;  1R26 A;  2HRK A;  4HU7 A;  4D73 A;  3UOM A;  1Y25 A;  3KMN A;  1PMT A;  2DML A;  2IWT A;  2V6K A;  3VWW A;  4BVX A;  4K7I A;  1GRX A;  3W6G A;  5IMD A;  1T1V A;  1K3L A;  3EU4 A;  5EPF A;  1OC9 B;  5CP1 A;  4QQ7 A;  1K0M A;  1V58 A;  3VWV A;  4IJI A;  3S9F A;  4WET A;  2JAD A;  2O85 A;  2HI7 A;  2VL3 A;  4GRF A;  4XS4 B;  3OR5 A;  3HXS A;  2VLU A;  2WB9 A;  4IBP A;  2OBK A;  3FZ5 A;  1EEJ A;  4WEY A;  4ZB6 A;  3IHG A;  4DSS A;  1GTI A;  2F8F A;  4KB3 A;  3O3T A;  5IMC A;  5DQS A;  2EIO A;  6GSU A;  2DJ3 A;  4PNF A;  1K0D A;  2GQM A;  2IMF A;  3RPP A;  1VRS D;  3FZA A;  4ZIJ A;  3ERW A;  1WIK A;  2R5G A;  2P5R A;  3FR3 A;  1Z7R A;  2FHE A;  4BPY A;  1I5G A;  1DE2 A;  4EIP A;  1EGR A;  4CHS A;  4IW9 A;  3MSZ A;  3J7Y b;  1ZCP A;  2C8U A;  1PRX A;  5ECH B;  2X4A A;  1TI1 A;  3IBH A;  3LOR A;  2VL9 A;  1AQV A;  3I9V 2;  4LA1 A;  4POK A;  2QGV A;  4Q5R A;  2AB6 A;  3GNJ A;  3F6D A;  4HSC X;  4CDO A;  5ECS A;  2WGR A;  1SL1 B;  1PL2 A;  3V1W A;  1A2L A;  2VOC A;  4ICY A;  4G10 A;  3GH6 A;  1SYR A;  1Z5Y E;  3M3M A;  4JRR A;  5ID2 A;  2RM6 A;  1SJZ A;  4X43 A;  2YCD A;  2B5E A;  1MTC A;  3D6I A;  4F03 A;  3TKP A;  1I9D A;  3EIN A;  5ECP B;  2EIR A;  3H8Q A;  1MD3 A;  4OFT A;  4MF6 A;  3VFI A;  2L5O A;  2HRF A;  2LNS A;  5F0G A; 
#chains in the Genus database with same CATH homology
 1SYX A;  4Q5N A;  2GVP A;  2H01 A;  4JR6 A;  4GSN A;  2YJ7 A;  1XWK A;  4BVY B;  4ECB A;  3CSJ A;  2CT6 A;  3J7Y k;  5D96 A;  4O7H A;  1Z9H A;  2PN8 A;  3ZIV A;  1OC3 A;  1F3A A;  2BJX A;  2H1A A;  2HZF A;  4RQX A;  8GSS A;  2CQ9 A;  3F3R A;  5E59 A;  4MH3 A;  2J23 A;  2XBQ A;  5AIV A;  1J0F A;  11GS A;  3ZIJ A;  1EV4 A;  2FGX A;  3LXT A;  2DLX A;  4LLR A;  1E2Y A;  4L8E A;  2AV4 A;  17GS A;  1BYE A;  1H75 A;  5DAK B;  1NSW A;  3KMO A;  1JLV A;  4G0K A;  4ZB9 A;  2I9H A;  4HEA 2;  1A24 A;  4OFM A;  2JAC A;  2VM1 A;  3TRX A;  1K0N A;  2GT6 A;  5ECL B;  3D22 A;  1ZZY A;  1T3B A;  1XPV A;  4HJ2 A;  2LST A;  2B1L A;  5B7C A;  3FYG A;  4OWY A;  4MP4 A;  5DJM A;  1BAY A;  1NHY A;  2I1U A;  2NDO A;  2LKU A;  1EWX A;  4FYC A;  1R5A A;  4FYB A;  2CZ3 A;  3KM6 A;  3IHQ A;  1O81 A;  1BX9 A;  2OJL A;  5F05 A;  5JWQ B;  2L4C A;  3EVI A;  3HVV A;  2YNX A;  1GSD A;  1UC7 A;  2VLT A;  4OO5 A;  3HD5 A;  4Z2R A;  3IA1 A;  4RI6 A;  2CX3 A;  2WDU A;  3ED3 A;  3LQ7 A;  5CRE A;  3M1G A;  1TRS A;  2R6K A;  3ZLP A;  1A8Y A;  2H73 A;  1TXX A;  1G6W A;  3BCI A;  1QXH A;  2UZ8 A;  2PBJ A;  3HYP A;  3WT2 A;  3FZ9 A;  2HLS A;  12GS A;  3ZFL A;  4ECI A;  1THO A;  2KLX A;  3ME7 A;  6GSS A;  3HJM A;  3HJO A;  1M9B A;  2NPB A;  3GYK A;  3UAR A;  2YAN A;  1GSQ A;  5IPG A;  3ZRE A;  1UN2 A;  4V1A p;  3M0F A;  1X9M B;  1YJ6 A;  3ZL5 A;  1ZL9 A;  1GLQ A;  2R0P A;  4N10 A;  2F8A A;  4N11 A;  3TOT A;  3ZIT A;  3JCM L;  2XHF A;  1HNC A;  3PPU A;  4ID0 A;  4ZBA A;  1O6J A;  2NVL A;  3APS A;  2FNO A;  3CXG A;  5IMF A;  5A4V A;  3ZRD A;  1G0T A;  3CTG A;  5IO2 A;  2PWJ A;  2M80 A;  2DKH A;  3H93 A;  4POM A;  3LSZ A;  3E9J B;  3FR9 A;  5D8I A;  5AIS A;  2B6M A;  2V1M A;  5JCG A;  3GL5 A;  5A4U A;  5HR3 A;  3WYW A;  4K1F A;  4EC0 A;  4DEJ A;  3ZVJ D;  3DRN A;  1YZX A;  3MNG A;  3RDW A;  1VF4 A;  3DWV A;  4MJB A;  1T4Z A;  1V9W A;  2FUG 2;  4IEL A;  2KUC A;  1WWJ A;  2B5X A;  3KGK A;  1TTZ A;  3QR6 A;  2XPD A;  3PH9 A;  3APO A;  2CAI A;  1PSQ A;  2IMD A;  4K0N A;  2E2G A;  2VUP A;  2C0E A;  1WJK A;  3TJK A;  5A4W A;  3DML A;  3GKX A;  4F0B A;  3CRU A;  2D2Z A;  3M8N A;  3UJ1 A;  4E8E A;  4KSO A;  4KND A;  4ZXG A;  2HRN A;  2VO4 A;  3PGT A;  4I2T A;  3N5O A;  3BBY A;  2H8L A;  5HFG A;  3L78 A;  2GDR A;  4O92 A;  1GSS A;  4ZBB A;  3NZN A;  4PQI A;  2XC2 A;  4BVX B;  4PX1 A;  2C0F A;  4GLT A;  2KHP A;  4TXO B;  1THX A;  2VAF A;  4K2X A;  4MJE A;  2JL4 A;  1TU8 A;  4HOJ A;  2RUE A;  1FAA A;  1OVN A;  5IM9 A;  4ECC A;  1SK1 A;  2LTK A;  4PXO A;  4JED A;  1WE0 A;  3WD6 A;  4K9Z A;  2CA8 A;  3TJF A;  4LL4 B;  3QAW A;  3A2V A;  3G7I A;  3FZ4 A;  3UVT A;  2OKA A;  2GZY A;  4PNG A;  2VCT A;  1O8X A;  13GS A;  1GSE A;  3KTL A;  2TIR A;  3QFB C;  2GS3 A;  1M7T A;  3QAG A;  1SKS B;  4GCI A;  4TW5 A;  4EL1 A;  3LXZ A;  1PKZ A;  2A2R A;  1HD2 A;  1GLP A;  1X5E A;  4ECJ A;  1KNG A;  3KJY A;  4L0U A;  3GHA A;  2A4H A;  1VF3 A;  2EIQ A;  4KDU A;  5ENU A;  2H76 A;  4RUV A;  5DCH A;  2BTO T;  1FHE A;  2E7P A;  1PL1 A;  1TK8 B;  5HQP A;  4G2E A;  2YPM A;  4TVE A;  1QUW A;  1SEN A;  5GAP D;  3HHV A;  1S3A A;  3D21 A;  1J08 A;  4EE0 A;  1NW2 A;  5CRD A;  5ECI B;  3DKS A;  4GSS A;  1HNB A;  2PVQ A;  2VIM A;  3GFK A;  2OBI A;  3KP9 A;  1SD9 A;  4WBR D;  2L6C A;  2GSQ A;  5E4W A;  4RI7 A;  5ABR A;  1U87 A;  1W89 A;  3F6F A;  3WGE A;  1G7O A;  3PIN A;  3TCO A;  3HZ4 A;  1MDJ A;  1ZGN A;  18GS A;  2L59 A;  2VCV A;  1U3A A;  2QKE A;  3A2X A;  3BCK A;  4P3Y B;  4EVM A;  3LFL A;  5ID2 B;  2H72 A;  3TKS A;  4YQM A;  2R37 A;  1JLW A;  3GTU A;  4MA9 A;  2HNL A;  3UBL A;  2Z9S A;  1CQH A;  3FY7 A;  1IYH A;  1R7H A;  3LG6 A;  2GLR A;  2TRX A;  4H86 A;  3C1S A;  4E8H A;  2JZR A;  3CTF A;  1XWC A;  2K18 A;  2RUF A;  1RW1 A;  2MYG A;  1USB A;  3KTB A;  3MAK A;  5G31 A;  1DE1 A;  1EV9 A;  3D5J A;  5C00 A;  1Z7P A;  5ELA A;  2A2P A;  1XFL A;  1YKA A;  1GSU A;  3KH9 A;  4K6X A;  1ON4 A;  2A2S A;  2H75 A;  3MWH A;  5IOX A;  3GH9 A;  4GXZ A;  10GS A;  22GS A;  5CRH A;  4YKF A;  1FVJ A;  2WUL A;  2LQO A;  2BMX A;  3LJR A;  3PR8 A;  3VPT A;  1HNA A;  4MMM A;  5CRW A;  5G1K A;  3GRX A;  4EF0 A;  1GUH A;  1GUK A;  4F9Z A;  5IPH A;  3C1R A;  3LEF A;  2VCQ A;  1ZYN A;  4GF0 A;  3VPQ A;  1OKD A;  2YWI A;  5KOX A;  2J9H A;  3TRQ A;  1NHO A;  1AQW A;  2K6V A;  4OMV A;  2O87 A;  2HRA A;  2KP2 A;  4ISD A;  1HQO A;  3CBU A;  2H74 A;  1FW1 A;  4IS0 A;  2YWM A;  2WCI A;  3UVH A;  1G6Y A;  2HZE A;  5H5S A;  5LNK e;  2DJ0 A;  2HSY A;  4NV2 A;  2VLV A;  3F4T A;  4HQZ A;  1C72 A;  4IP1 A;  4MLY A;  1Z3E A;  2MMA A;  4MF7 A;  1DBY A;  4MH2 A;  2M72 A;  1V40 A;  4HI7 A;  2GQL A;  3R3E A;  1GNW A;  1NM3 A;  1URM A;  2RII A;  3TKQ A;  2DSA A;  3F8U A;  4K7O A;  1M9A A;  3IXR A;  4LL1 B;  3C73 A;  2FD3 A;  2V41 A;  3ZML A;  4X1U A;  1JFU A;  4IQ1 A;  3IAS 2;  5JCW A;  5CO3 A;  2V6O A;  4J56 E;  5DQY A;  3A5I A;  4EDZ A;  1ACV A;  1GWC A;  2HXK A;  1QMV A;  2PUK C;  3TJG A;  6GST A;  1B8X A;  1JZR A;  4QL9 A;  5IMA A;  3IDV A;  4KGI A;  1PGT A;  3KCM A;  5ECN B;  4X0X A;  3VK9 A;  4XIH A;  7GSS A;  2DIZ A;  1FO5 A;  1X0R A;  3Q6O A;  1BG5 A;  3DXB A;  3GL3 A;  1XOB A;  4PQH A;  3CSI A;  1ZYE A;  5F07 A;  3UEM A;  1OC9 A;  2DMM A;  4KCA A;  3A3T A;  2M46 A;  5BMU A;  4MDC A;  2WRT A;  1V57 A;  2VCW A;  2WZ9 A;  2H1G A;  4USS A;  4X4J A;  1B4Q A;  3IR4 A;  1TK5 B;  2H0G A;  3FMW A;  4HU9 A;  2ES7 A;  1KEB A;  4YQV A;  3SBC A;  4KH7 A;  2LUS A;  1EOG A;  3KXO A;  4A5P A;  3FEU A;  5IQY A;  4L0W A;  1PA3 A;  5B8A A;  2TRC P;  3FHK A;  3IE3 A;  4TKY A;  3KZQ A;  3VUR A;  4MZC A;  4TR3 A;  3TDG A;  3TKS C;  1X9W B;  5ECK B;  4L5L A;  3TJB A;  3P2A A;  4KAE A;  3EC3 A;  4PQ1 A;  1OYJ A;  3UAP A;  5EL8 A;  4F82 A;  3VWU A;  5HR0 A;  1TKD B;  2ON5 A;  1QQ2 A;  3H79 A;  5COH A;  1TK0 B;  1JZO A;  2L4Q A;  1FOV A;  4ZB8 A;  3DYR A;  4PUF C;  2AYT A;  2JSZ A;  3L9V A;  4WR4 A;  3DIE A;  3DVW A;  1WOU A;  4K8M A;  3GUR A;  1SU9 A;  3ZYW A;  2MBS A;  2I4A A;  4DSQ A;  1VF1 A;  4EXJ A;  3L9U A;  1KBN A;  4MJC A;  3A2W A;  5H5Q A;  5KOW A;  3F4S A;  1PQN A;  1XZO A;  1SK2 A;  2CAQ A;  5KN1 A;  3W8J A;  4I2U A;  4V2N A;  1E6B A;  1SKR B;  4WKW A;  4GST A;  2E2M A;  2MMZ A;  1K3O A;  2GQK A;  3D4T A;  1XVW A;  1EOH A;  1G7E A;  4TR4 A;  4GQF A;  5D9X A;  3EE2 A;  2R0G A;  2LJR A;  19GS A;  5IO0 A;  5IOW A;  4TR1 A;  5D9T A;  1MEK A;  4OO4 A;  1AQX A;  2K8S A;  4BL7 B;  4PUR A;  2GGT A;  3L9S A;  4NPB A;  2X99 A;  4XTS A;  4KX4 A;  4ZL9 A;  3BJ5 A;  3APQ A;  4BVY A;  2YJH A;  4K2D A;  1JZD A;  2H0H A;  1YEP A;  4CY8 A;  3LYK A;  4IP6 A;  3Q74 A;  4NMU A;  1SJI A;  1GL8 A;  3WGX A;  1A2J A;  2P5Q A;  3IK7 A;  4ZBD A;  5INY A;  3ZZX A;  5DDL A;  3EWL A;  2VCX A;  1LU4 A;  1VF2 A;  5J5N A;  1K0B A;  4ZIL A;  5KN0 A;  3NOF A;  4HZ2 A;  4KCE A;  2X8G A;  2G2Q A;  2IFQ B;  3KP8 A;  1LBK A;  2R4V A;  2B5Y A;  1OAZ A;  1XWG A;  3G7Y A;  1GNE A;  3G9B A;  3GV1 A;  4MCU A;  3TKS E;  1Z6M A;  2F9S A;  3HJP A;  1TJD A;  3RPN A;  2IN3 A;  4O5R A;  2LRT A;  1FVK A;  4KF9 A;  4WR5 A;  5ECQ B;  3TGZ A;  2LS5 A;  3O6T A;  3RAZ A;  3CYN A;  4AF2 A;  4FH8 A;  4O32 A;  4G0I A;  4XS6 A;  4EUY A;  2AAW A;  5AN1 A;  4ZL7 A;  5AIX A;  4IQA A;  5LCZ A;  4GTU A;  1OE7 A;  1N2A A;  1EZK A;  3GTU B;  1K3Y A;  3DEX A;  5LD0 A;  1YY7 A;  2H66 A;  4D73 B;  3FW2 A;  2CVB A;  4JZQ A;  3CRT A;  1A23 A;  2PMT A;  1YEX A;  3GIX A;  4IJ3 A;  4O5U A;  9GSS A;  3ME8 A;  4HQS A;  2IPA A;  2CX4 A;  2CVD A;  3GKM A;  4EO3 A;  1XW6 A;  4JE1 A;  3P7X A;  1ML6 A;  1FG4 A;  2V2G A;  3I6A A;  2CZ2 A;  4NHZ A;  1JZW A;  2O8V B;  2DJJ A;  2QA2 A;  4RQR A;  4IN0 A;  2GTU A;  2X8H A;  4DSS B;  1IYI A;  1RQM A;  5CRG A;  3DGQ A;  4TOP A;  4J2F A;  4KDY A;  1Q4J A;  5DAL A;  1SL2 B;  4XS1 A;  2YV9 A;  4Z7X A;  1T8E B;  4Q5Q A;  1PX7 A;  1WPI A;  4POL A;  2WFC A;  4V2M A;  1GH2 A;  5J9B A;  4FYU A;  5G2Z A;  5ECR B;  1A2M A;  4QL7 A;  1SK0 A;  4IVF A;  3A5W A;  2JZT A;  3G7J A;  4XRA A;  4AJ6 A;  1TP9 A;  14GS A;  4HS1 A;  3U6V A;  4Z2T A;  2XBI A;  1FB6 A;  2HZE B;  3TOU A;  2ZNM A;  3BOA A;  3O76 A;  1YDK A;  5J41 A;  4V2L A;  1GP1 A;  2HFD A;  3HKR A;  4NV5 A;  1F9M A;  3US3 A;  4KUN A;  2YN1 A;  3C71 A;  3HA9 A;  1B4P A;  1GSF A;  1B9X C;  1O7U A;  3M9K A;  2ON7 A;  2I3Y A;  1TDI A;  2FWG A;  2P0G A;  4NWY A;  4IKH A;  1SL0 B;  2DC5 A;  5IIZ A;  1EEM A;  5J4U A;  1XOA A;  2MMO A;  2YP6 A;  2DIY A;  4HZ4 A;  1FOH A;  3UL3 A;  1ZYQ B;  2LJA A;  2C3Q A;  3GUS A;  4EDY A;  1T00 A;  1TW9 A;  4AJ7 A;  1AIU A;  1R5P A;  1FB0 A;  1HYU A;  4GQC A;  2MBT A;  2DJ2 A;  4OD7 A;  5IMZ A;  1A0R P;  1AUC A;  2C80 A;  2H70 A;  3VI7 A;  1F37 A;  2NBS A;  5ELG A;  1BQ7 A;  2LRN A;  4YKG A;  2RM5 A;  4TXO A;  4F0C A;  2L57 A;  4FO5 A;  1EP8 A;  5CYY A;  1ZYP A;  4NAX A;  2FWF A;  5ECO B;  1J9B A;  1OKT A;  3F0I A;  4IHU A;  2R3X A;  5KN3 A;  1X9S B;  1TRV A;  2JZS A;  1M2A A;  1PD2 1;  2HSM A;  4K0G A;  5KEJ A;  3D0Z A;  4O5Q A;  5FWG A;  3P90 A;  2YV7 A;  2FWE A;  1X5C A;  2QC7 A;  4V1A g;  1YQ1 A;  1W4V A;  3ERF A;  4Z2U A;  2VD1 A;  4DSR A;  5A5K A;  4G0L A;  3TUE A;  2OAD A;  3MYD A;  1PN0 A;  5J9C A;  4MJA A;  3EU3 A;  1XBS A;  2GST A;  3EMX A;  2C3N A;  5C04 A;  2C1Y A;  2B7K A;  3FRC A;  3BD2 A;  4PUA A;  2OE1 A;  3HZ8 A;  1UA5 A;  5JWR B;  3IRA A;  3Q19 A;  4WBJ A;  5HFI A;  1BED A;  2R0C A;  4DVC A;  3QFA C;  2A4V A;  1CQG A;  3NIV A;  3HCZ A;  3F9U A;  4TR0 A;  1YF1 A;  3VWX A;  2VL2 A;  2EC4 A;  1AW9 A;  4PGT A;  4MK3 A;  2IIY A;  2I81 A;  1Z6N A;  4JBB A;  3ZVJ A;  1M2B A;  3N9J A;  4I8B A;  4MAB A;  2C3T A;  2REM A;  2H1D A;  4N0V A;  1KTE A;  2YZH A;  3LWA A;  5EVO A;  3GX0 A;  1U3I A;  1TRU A;  3I43 A;  1SJ6 A;  1S3D A;  1TRW A;  2IL3 A;  5EY6 A;  2LNT A;  4CW9 A;  1ILO A;  5D93 A;  1PN9 A;  1JHB A;  4LMW A;  16GS A;  2GSR A;  5GSS A;  2GT5 A;  3ZFB A;  1V2A A;  1YF0 A;  2WJU A;  4ML1 A;  4JU5 A;  4I6X A;  4NHW A;  1MDK A;  3HY2 A;  1F3B A;  1F6M C;  4PTS A;  4TR1 B;  1F2E A;  2N5F A;  2GZP A;  4I97 A;  1O73 A;  3WT1 A;  3LGC A;  4KSM A;  3FK8 A;  3F63 A;  2QA1 A;  5G5F A;  2OA7 A;  3LYP A;  4HJM A;  4HDE A;  6GSY A;  1RK4 A;  3GSS A;  1N8J A;  4XS4 A;  2LEG A;  2OE0 A;  1X5D A;  3QD9 A;  1DSB A;  3F3Q A;  3C8E A;  4ILF A;  2R2J A;  3L0H A;  3MDK A;  5KN2 A;  2YWN A;  1B9Y C;  2PPT A;  1MD4 A;  4BA7 A;  3P8W A;  1GTB A;  3QAV A;  4JR4 A;  3GMF A;  3CMI A;  4F2I A;  2AJQ B;  4YAV A;  5AGY A;  4BWQ A;  4NXI A;  2PU9 C;  1WMJ A;  4ULX A;  4TN8 A;  2X49 A;  1AAZ A;  2IME A;  1A0F A;  5JWO B;  2H6X A;  5F8B A;  3QMX A;  2DKI A;  2YWO A;  4I5Q A;  4FQU A;  3HVX A;  3IAM 2;  5ECM B;  3MIX A;  2MMN A;  2O7K A;  3TJJ A;  4TXV A;  2CVK A;  1SKW B;  1ST9 A;  2JU5 A;  5D9V A;  4ZL8 A;  3HVS A;  1OC8 A;  5DCG A;  4AGS A;  3KEB A;  4MNN A;  1OE8 A;  3IPZ A;  1XXU A;  2FLS A;  1QFN A;  1Q98 A;  1EP7 A;  3CSH A;  4K7N A;  1DUG A;  1SD8 A;  3Q18 A;  2VM2 A;  4N30 A;  2K9F A;  1BJX A;  4TRX A;  2VCZ A;  1XWA A;  2KOK A;  1GTU A;  3IV4 A;  6GSX A;  3VLN A;  4WXT A;  2O89 A;  4KA0 A;  3L4N A;  2H19 A;  2B1K A;  2ZUP A;  3H4K A;  3RBT A;  3EMP A;  1GSY A;  3QDN A;  1LJR A;  5FHI A;  2DBC A;  2H0I A;  3QPM A;  4YAP A;  3U5R E;  5D9W A;  1MDI A;  2F3M A;  3H1N A;  1AXD A;  2KP1 A;  3W8S A;  2WS2 A;  4Q5F A;  2C0G A;  5B8B A;  2LRC A;  2GSS A;  3M9J A;  3QCP A;  2N5B A;  3WGD A;  1TU7 A;  2HE3 A;  3LW9 A;  3TRP A;  3IK9 A;  5HR1 A;  1B48 A;  3GN3 A;  3GKK A;  1ERV A;  4WF4 A;  1V98 A;  2FCH A;  2DJ1 A;  5DAL B;  5CNW A;  4OCE A;  5FT3 A;  6GSV A;  5DBQ A;  5HR2 A;  2FY6 A;  3EPT A;  4K5R A;  2DJK A;  2RLI A;  2VL2 C;  1WP0 A;  1S3C A;  3RHC A;  2ZCT A;  1T4Y A;  1XCC A;  1M0U A;  4MPG A;  5DAK A;  2OAC A;  2H1B A;  2QSI A;  3D4M A;  4EKZ A;  3RHB A;  4OFN A;  4L5O A;  5B6M A;  1ZMA A;  2LJK A;  3I69 A;  1TI3 A;  1ERT A;  3DVX A;  20GS A;  1U88 A;  4XHM A;  4LMV A;  5L71 A;  1GTA A;  3HDC A;  2C0D A;  1ERU A;  3KIJ A;  3EUR A;  4MZB A;  2B7J A;  2YZU A;  3ERG A;  2LQQ A;  3ISO A;  1EGO A;  5F06 A;  3UMA A;  2N5A A;  2IMK A;  4YH2 A;  2JSY A;  4MF5 A;  2X64 A;  1K0O A;  4WF5 A;  2G0F A;  6GSW A;  4GWR A;  4ML6 A;  5J3R A;  4KDX A;  5H5R A;  5G1L A;  4J57 E;  2GZZ A;  1M99 A;  1GUM A;  1XWB A;  4FIW A;  1XW5 A;  4G9H A;  1O85 A;  1PX6 A;  1TOF A;  4POB A;  1A8L A;  3ZMK A;  5GZZ B;  3KH7 A;  2HYX A;  1QK8 A;  5GST A;  1M2D A;  3GX8 A;  4EIQ A;  4N0Z A;  1Y6E A;  2L5L A;  3AY8 A;  2LV3 A;  2CV4 A;  2H6Z A;  1K0C A;  4G19 A;  2XPE A;  3E0U A;  5IMV A;  2OE3 A;  5CAX A;  3IC8 A;  3QOU A;  2IJY A;  1K0A A;  2FWH A;  3TB2 A;  3GA4 A;  4YQU A;  5HFK A;  2E0Q A;  4HUA A;  3F4R A;  5G5E A;  4BL7 A;  5B6N A;  1YKC A;  2K8V A;  4ACS A;  3C7M A;  3K8N A;  3FR6 A;  1U6T A;  1ZOF A;  1XIY A;  1XW9 A;  2ALB A;  2AHE A;  3FKF A;  1UVZ A;  1O8W A;  2F51 A;  2PVO C;  4KE3 A;  2P31 A;  2MZC A;  4XRD A;  1ABA A;  1PKW A;  3IC4 A;  1ERW A;  2YOI A;  2VD0 A;  1XVQ A;  2L6D A;  2IMI A;  2B3S A;  1VGL A;  4MPF A;  2IFQ A;  5BRT A;  3UBK A;  2PER A;  1H4O A;  4KW6 A;  4CY6 A;  1GUL A;  2HSH A;  2H6Y A;  5DJL A;  3KD0 A;  3GKN A;  2H71 A;  4XCS A;  5GAN D;  1WRY A;  3UIW A;  4BWS A;  2FA8 A;  5G30 A;  4OCF A;  2C4J A;  3IOS A;  5DVB A;  3VI5 A;  4MZW A;  3TKR A;  2X8C A;  3EYT A;  4AJ8 A;  4IGJ A;  2HT9 A;  3GST A;  2FA4 A;  1AC1 A;  3SWL A;  3ZTL A;  2PGT A;  1T7P B;  2H30 A;  4K5S A;  2AUV A;  2V32 A;  3E3E A;  3R2Q A;  1R4W A;  5JCU A;  1QGV A;  5D73 A;  3DD3 A;  2NTO A;  1R26 A;  2HRK A;  4HU7 A;  4D73 A;  3UOM A;  1Y25 A;  3KMN A;  1PMT A;  2DML A;  2IWT A;  2V6K A;  3VWW A;  4BVX A;  4K7I A;  1GRX A;  3W6G A;  5IMD A;  1T1V A;  1K3L A;  3EU4 A;  5EPF A;  1OC9 B;  5CP1 A;  4QQ7 A;  1K0M A;  1V58 A;  3VWV A;  4IJI A;  3S9F A;  4WET A;  2JAD A;  2O85 A;  2HI7 A;  2VL3 A;  4GRF A;  4XS4 B;  3OR5 A;  3HXS A;  2VLU A;  2WB9 A;  4IBP A;  2OBK A;  3FZ5 A;  1EEJ A;  4WEY A;  4ZB6 A;  3IHG A;  4DSS A;  1GTI A;  2F8F A;  4KB3 A;  3O3T A;  5IMC A;  5DQS A;  2EIO A;  6GSU A;  2DJ3 A;  4PNF A;  1K0D A;  2GQM A;  2IMF A;  3RPP A;  1VRS D;  3FZA A;  4ZIJ A;  3ERW A;  1WIK A;  2R5G A;  2P5R A;  3FR3 A;  1Z7R A;  2FHE A;  4BPY A;  1I5G A;  1DE2 A;  4EIP A;  1EGR A;  4CHS A;  4IW9 A;  3MSZ A;  3J7Y b;  1ZCP A;  2C8U A;  1PRX A;  5ECH B;  2X4A A;  1TI1 A;  3IBH A;  3LOR A;  2VL9 A;  1AQV A;  3I9V 2;  4LA1 A;  4POK A;  2QGV A;  4Q5R A;  2AB6 A;  3GNJ A;  3F6D A;  4CDO A;  5ECS A;  2WGR A;  1SL1 B;  1PL2 A;  3V1W A;  1A2L A;  2VOC A;  4ICY A;  4G10 A;  3GH6 A;  1SYR A;  1Z5Y E;  3M3M A;  4JRR A;  5ID2 A;  2RM6 A;  1SJZ A;  4X43 A;  2YCD A;  2B5E A;  1MTC A;  3D6I A;  4F03 A;  3TKP A;  1I9D A;  3EIN A;  5ECP B;  2EIR A;  3H8Q A;  1MD3 A;  4OFT A;  4MF6 A;  3VFI A;  2L5O A;  2HRF A;  2LNS A;  5F0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...