1MDLA

Mandelate racemase mutant k166r co-crystallized with (r)-mandelate
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
357
structure length
357
Chain Sequence
EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTRIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANDELATE RACEMASE
publication title Mechanism of the reaction catalyzed by mandelate racemase: structure and mechanistic properties of the K166R mutant.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 122
structure length 357
sequence length 357
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 1996-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1mdlA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1mdlA01
1E9IA 5EU9A 4ZCWA 2P8BA 3V3WA 1ELSA 5FJTA 5FJRA 2ONEA 4K2SA 5IDZA 5FJPA 3DG3A 4MGGA 3N4EA 3DEQA 3DESA 1IYXA 2AKMA 3BOXA 1L8PA 2OQYA 1XS2A 4DWDA 2PU1A 2GGGA 2FKPA 1XPYA 3EKGA 5FJOA 1WUFA 5J04A 3N6JA 3R0KA 1ECQA 3RCYA 4GGHA 1W6TA 2MUCA 3MY9A 3ZLGA 3ZLFA 2PTYA 2HXUA 2PP3A 2AKZA 2GGIA 2HXTA 4GFIA 3DIPA 1FHVA 3DGBA 3PWGA 4J1OA 5ENLA 1TKKA 3SSZA 3H8AA 3V4BA 3FJ4A 4ZA0A 4DX3A 2GDQA 3ZVHA 3T9PA 1JPDX 3ES8A 2PTXA 3H7VA 4E6MA 3MSYA 3I6TA 3D46A 3ZVIA 4E4UA 3T8QA 3VDGA 4ENLA 3IJIA 3I6EA 1BQGA 3PFRA 1TE6A 3MUCA 3KUMA 3FYYA 3QN3A 2PA6A 3ZLHA 3BSMA 2XH0A 4IP5A 3NXLA 3TJ4A 3UXKA 3I4KA 3QKEA 3K1GA 3V5FA 3VC6A 3JW7A 3P0WA 2GGHA 3SN1A 1TZZA 3OZMA 3GO2A 3QLDA 3BJSA 2OLAA 2HZGA 3CB3A 4IHCA 3IJQA 2PMQA 3RGTA 1KKRA 5BOEA 3SJNA 4IL2A 3OTRA 4KT2A 4ROPA 2OG9A 2PP1A 3TTEA 3UJEA 1PDZA 2MNRA 3DFHA 4G8TA 3GY1A 2CHRA 3QPEA 3OW1A 2PGWA 4Z1YA 3CYJA 4GGBA 3R1ZA 4K1WA 2POZA 2XGZA 2PTWA 4HCDA 4HYRA 3JZUA 3SQSA 3FV9A 3OPSA 2XH7A 4MKSA 2DW6A 2NQLA 3MZNA 3IK4A 2OFJA 4DXKA 3FXGA 2O56A 4DN1A 3DFYA 1EBHA 3STPA 3FVDA 2QDDA 3T4WA 3MWCA 2AL2A 4K8GA 2PSNA 1MRAA 4FI4A 3UJFA 4YWSA 4G7FA 3VCNA 4X2PA 3R11A 1WUEA 4HN8A 3OP2A 3Q45A 1ONEA 2OKTA 3B97A 2XSXA 1PDYA 3DERA 4KWSA 3IJLA 1MUCA 2PGEA 2GL5A 3UCDA 2PP0A 4HCHA 2PS2A 1OEPA 1SJCA 2QJMA 4MMWA 2ZC8A 3QTPA 2XH2A 4KPLA 2PCEA 1JCTA 4M6UA 3RRAA 4JN7A 3ENLA 4A35A 4GYPC 1BKHA 1P43A 5BOFA 4E4FA 2OZTA 2PU0A 4HCLA 3NFUA 3VCCA 2FYMA 3GC2A 2QGYA 4DHGA 1EC8A 4J3ZA 1P48A 2AL1A 1KCZA 2I5QA 2ZADA 3UGVA 3N4FA 4JN8A 4IL0A 3H12A 3P93A 4IP4A 3TCSA 1NU5A 1FHUA 3ZVHB 1EC7A 4H19A 2OO6A 3TWAA 3V5CA 3PWIA 4DYEA 3TJIA 3R0UA 1SJBA 1MNSA 1YEYA 3EEZA 1JPMA 4JHMA 4H1ZA 3UXLA 2OZ8A 5FJUA 4H83A 3RR1A 2GGJA 2PPGA 3TWBA 1F9CA 1MDRA 3U4FA 3UJ2A 1EC9A 2P0IA 3GD6A 4HNLA 2GSHA 1R6WA 3RITA 3NZGA 1DTNA 4KEMA 3S5SA 3PK7A 3Q4DA 4HNCA 2QJJA 3UJRA 3HPFA 3TOYA 1RVKA 2GGEA 3UCCA 3CXOA 1KD0A 4IZGA 3U9IA 3UJSA 4M0XA 3R10A 3CAWA 4HPNA 3N6HA 2P88A 3SBFA 7ENLA 4A6GA 4E5TA 3JVAA 3VFCA 3SN4A 2PTZA 3VC5A 1R0MA 3THUA 3RO6A 3CK5A 3OZYA 3FCPA 4GIRA 3TQPA 2PODA 3MKCA 1SJAA 2QDEA 2P3ZA 1SJDA 4E8GA 2QVHA 2HNEA 3DG6A 2OQHA 3T6CA 4Z17A 2RDXA 3NO1A 2DW7A 4GMEA 3MQTA 1NELA 3D47A 1KKOA 2OX4A 3DG7A 3R25A 4FP1A 2QJNA 4GYPA 3ES7A 2QQ6A 2OPJA 3TW9A 1EBGA 3P3BA 6ENLA 2XH4A 4H2HA 3SN0A 3DDMA 4A3RA 1MDLA 1JDFA 2OVLA 4IT1A 2P8CA 4F4RA 4EWJA 4GISA 3CT2A 3H70A 2AL2B 3VA8A 3S47A 2OZ3A
chains in the Genus database with same CATH superfamily
3ISIX 1XYFA 3R13A 5EU9A 1AD4A 3SRHA 3L7RA 1EPVA 3CU2A 1H0IA 2D73A 5CLWA 1G4SA 3KOYA 1W1IE 1VEOA 4N42A 2E4TA 5C2GA 2PBGA 4MGGA 4BY3A 1JIBA 2WJFA 4IMEA 2GJNA 3AMLA 4S3KA 4DQWA 5E9AA 3H6OA 2OQYA 1XS2A 4LUIA 1V6TA 1VHNA 3LOTA 4GG9A 3WELA 3OZOA 2VVSA 8XIMA 4DAIA 1FP8A 3DZ1A 1JDEA 3N6JA 3R0KA 2RDTA 3IJ8A 4F0LA 4PFHA 1AUSL 5AHIA 5I06A 1EGVA 2ZE3A 4DBEA 1PEZA 1JDDA 5E0KA 2FVMA 3PY2A 2HXTA 3KL5A 3F4CA 3E0LA 4LUSB 3DIPA 2ZOXA 3L66A 2ZZ6A 3PWGA 1E1CA 4CU7A 2OB3A 4R7JA 1O12A 1DWIM 4S1FA 1VRDA 4HNNA 1UD3A 4WGXA 1UUQA 4LANA 3DOPA 4JQAA 4ZA0A 3BW4A 1HNYA 3R43A 2VZSA 4AD1A 5BMWA 3QR1A 2Z1SA 2OCZA 3M0ZA 1FOBA 4TOQA 3GB6A 3OODA 1N61C 3VM7A 4RV3A 5HPCA 3QC0A 1TPEA 3PZOA 2DT3A 1HJVA 3SQLA 1KFKA 3DC0A 3BAIA 4O16A 5CBBA 3IACA 3T09A 1DWGM 1VAHA 2XVGA 1HO4A 1U30A 3NNTA 2PA6A 3NPVA 4OECA 5E5CA 4IP5A 4LRTA 1PKYA 5ABTA 5IHRA 1P0NA 1HKWA 4ML4A 1HP5A 4JTKA 2E7FA 1C9DA 3NYDA 3SI9A 2O9RA 1ONRA 3W1AA 1I60A 1W3KA 4JNZA 2NX1A 2W62A 3KOWA 4LC8A 4MOZA 5AECA 1DJYA 4EWND 1Q7QA 1N82A 3AHXA 3CLWA 4FNQA 1UQZA 3FLUA 1UD6A 4JAWA 3FNDA 4YU1A 1NDVA 1B5TA 1HQTA 4LCQA 3GIQA 2W54A 2QMKA 4CKQA 3UZJA 4K68A 2H6RA 1WV2A 4MADA 1TV7A 3BQ5A 5HNTA 3PFMA 3RMJA 2PF8A 4JTIA 2J74A 3R4IA 3LCLA 1YPIA 4NSBA 5AHFA 2WKJA 4MYXA 5ABFA 1XYZA 3BARA 1R30A 3VNMA 2DDXA 4XD3A 1L2QA 2JALA 4P7OA 3MI6A 3B3DA 3OVPA 2WW5A 2VR2A 5AYZA 3VNDA 2XN0A 3UR5A 1IWAA 2FVLA 1FWDC 4GYFA 4M24A 3EDEA 3OVGA 1HUVA 4F0SA 1PBGA 1GVIA 1MRAA 1XDJA 5I2UA 2B0MA 2JBMA 4S38A 1STZA 2BP1A 2GVYA 3QPZA 3I3DA 5HPOA 2CHNA 4W85A 1EF3A 1XG4A 3NQ7A 2J79A 4F0RA 3BDKA 4GZIA 4QFUA 4FB7A 1QUMA 3BO9A 4KCTA 5AHLA 5FAJA 2FJKA 1O68A 4PR4A 3JRKA 4W7WA 1ZJIA 1EXPA 1G7VA 1N60C 1U1UA 1XLIA 4HPGA 4PZVA 5LNSA 4WGHA 7CGTA 1GVFA 4M6UA 1UWTA 1BKHA 2G3IA 2WPEA 3QHOA 1I4NA 3UETA 4GX8A 1NAL1 4DY1A 2G95A 3WMCA 1FCVA 4IFKB 2QKFA 4P7LA 5K7JA 1QW9A 2WQDA 2PDGA 1YXDA 1X8FA 1PTGA 1G4TA 1TJRA 4B3KA 1JZ7A 5FF0A 3WJZA 2ZADA 3UGVA 4E4PA 4Q4RA 2R1KA 1Q1WA 4HGXA 3S2CA 2YA1A 1N63C 1Z7AA 3TSMA 1FFUC 4GRSA 1PIFA 1ZJBA 1JYWA 2UY3A 1P6WA 1SJBA 4UQ9A 4URIA 3CO4A 4RX0A 1XYMA 4RPQA 4POCA 5DQPA 4AZCB 4YVPA 1OX5A 2HDJA 3E49A 2FJUB 1E71M 3TQ0A 3SCWA 2PPGA 4PUJA 2I5IA 3OVRA 1V79A 3V5OA 2WQPA 3WLMA 4F3HA 1LTDA 4GJIA 2HQMA 2EQDA 4HHPA 1GWJA 1GONA 1R6WA 1KCLA 1ZZMA 4DYKA 3SGGA 3HPFA 1KFLA 3W3OA 2CIPA 3B0VC 3WD0A 2W92A 4Z1BA 3ZS4A 1Q65A 4L4MA 5XIMA 3F4WA 2D3LA 1O1HA 2EPLX 3N6HA 1V0KA 2Y63A 3DECA 3U3HA 1RPXA 1PKNA 3L4UA 3SGZA 1PZ2A 2CW6A 1NH6A 1TUFA 3KX6A 1LT8A 4MWAB 4PBFA 3F5JA 1QXLA 1CYGA 4L6HA 1KM6A 4GXPA 1FWAC 1KN0A 2PDKA 3ZJ8A 4AWTA 2PODA 1YQZA 5EMYA 3LHZA 2E40A 4JFVA 2VT0A 2VELA 1RLDA 2ZX7A 2YOCA 1EOKA 5HUOA 3R25A 1TJ1A 3VU2A 5HAOA 4Y8EA 2V81A 3AIVA 4WY0A 2Y5SA 3GWQA 4M1BA 5EY5A 4ZMGA 4N0RA 1KWGA 3GD3A 5AZ0A 1Z69A 1RM6B 3IIVA 5CJNA 4KWUA 1XDIA 1ZCOA 2XIMA 2PD9A 1SVDA 4EMJA 5A6JA 3MV11 3MO7A 2ZFAA 3SSJA 2JKPA 5JIWA 2FZMA 1V51A 5FMHA 1B9BA 4RKAA 3UCQA 2YPIA 1HKIA 3UESA 1UA3A 2PI6A 5E9XA 1TIMA 2VFEA 5AVNA 3SUSA 1TRIA 3T0BA 2V5BA 2V3EA 3KXQA 5F7UA 4D71A 2W0UA 4AWSA 1N7KA 1R38A 2EG8A 1HT6A 4FSAA 5FJOA 3TSDA 4WX2A 3CUZA 1DP0A 3M64A 3G1FA 2X8RA 3H2CA 4LVBA 5IHSA 1O5QA 3G1DA 2PTYA 4IQDA 2PP3A 1KXQA 1XPGA 3LNMA 4TX9A 3JU2A 1HF6A 1XBZA 4PCSA 3W86A 4P7NA 4GRTA 4W8BA 4O0ZA 4IIFA 2QS8A 3VKCA 4XAFA 4O0KA 5A1AA 2OKOA 1KFCA 3HOJA 1P0DA 4FA3A 2W3RA 2JKAA 2Y70A 4LIIA 2C0AA 1TA3A 1WX0A 3S1GA 1V02A 1Q6RA 3ERPA 3GXFA 3QGKC 4U3CA 1A5OC 1ICSA 5MF5A 1AQHA 3EDFA 3AHZA 1H7XA 1PZ3A 4KIEA 1NWTA 2OGJA 1UOZA 3HB9A 1RQEA 2PWGA 5DEZA 1XQKA 1XINA 3QKEA 2CBJA 3WD4A 2WSPA 2VX5A 1WDSA 3OLGA 1JJKA 4H9YA 1J4EA 3SN1A 2PCQA 2PFHA 3OZMA 5C9UA 2CLPA 3AMKA 3FN9A 4DJDA 3A3XA 4MLJA 3RG6A 1X1NA 4LCRA 3NQFA 5CZ0A 5LIWX 3DHDA 2JIWA 2Z29A 3CNYA 3LPGA 3ELFA 3WX7A 4R88A 4WJEA 1NOWA 5C6MA 4RDYA 1E70M 4DLFA 2H9AA 3L8KA 5CC5A 2XN2A 4H4UA 3DFHA 3W1XA 3UWQA 3LS9A 3T1GA 4LV4A 1RBLA 4Z1YA 4I7UA 3EDJA 2HJPA 4K1WA 1OGSA 2C1HA 1Q4NX 1I8JA 1VFLA 3UXAA 4QQUA 1N5WC 1W3IA 1CTNA 1JRPA 2EXOA 4JY8A 1VRXA 2Y24A 4Z1DA 3HU7A 1BKSA 5I7GA 4JTJA 3W7CA 4CQCA 3BGJA 3ABZA 4NX5A 3KHDA 1NWRA 1QWGA 2XTKA 3EXTA 4KKXA 4AZ5A 2QCDA 4M80A 1EBDA 1FDYA 3VKJA 4Q6JA 1NEYA 3W7PA 3OYXA 4QS6A 1Q6GA 3HM7A 3PHAA 1WKYA 4M3PA 2QCLA 4PMOA 1FQ0A 3KBWA 3N2CA 1F6PA 1Z89A 4OT7A 3DYOA 4LBUA 5T9BG 4D6GA 3U8GA 2QPSA 3E2QA 4NZ5A 4H4QA 4XX6A 3V0UA 3WL1A 4MJ4A 4G7FA 2NW0A 3VFLA 3NSXA 4KESA 4F0HA 3OP2A 4ADSA 5I3IA 3CT7A 3W7OA 1GSNA 4JIPA 4KWSA 2ZVIA 2HBVA 4JTTA 2XPKA 4J27A 1ONXA 2PP0A 2PS2A 1G01A 2ZC8A 4O50A 1BYDA 1GVRA 2PCEA 3EXRA 3QFAA 2G0WA 2VC5A 1VJIA 4C7FA 2YL8A 4PC8A 5M1TA 4RE2A 2X1RA 3QV8A 4QNWA 4PCNA 1D3GA 4MDOA 3NO5A 1RV8A 3B0YA 3QFEA 4PRWA 1BF2A 1JGIA 3JR2A 2X1IA 2F5ZA 2CLIA 4ADWA 4ONVA 5ABEA 4KGLA 5BW6A 1CZ1A 2R14A 1CECA 1ZX9A 2V38A 2XISA 4NRSA 1SZEA 3H12A 3P93A 2NVDA 5CSUA 2X0HA 3OGRA 3TTQA 4IQEA 3TIMA 2QUVA 4XSMA 3SCUA 2ZXAA 1POKA 1R5YA 4DYEA 1SW3A 1N8FA 4QCEA 1P7TB 1XL9A 1GEQA 4S3FA 1YEYA 3TTYA 3HZ3A 4A3HA 1GT8A 3NRZB 1OFAA 3E0IA 1FVPA 3RR1A 3EX3A 1Y0EA 4FXJA 3TE9A 5BNKA 4DJED 4FLRA 3U4FA 4J5NA 5E0CA 3HMCA 1WAWA 3EPNA 4CCZA 4WOQA 2V0TA 1KRCC 1GOMA 4L1XA 1NF7A 4FAMA 1GORA 1CCWB 3A3WA 3CXOA 2OR2A 3U9IA 4IH3A 4C1NA 4HHLA 1T8QA 1O6IA 2WZEA 3G5EA 4QJ1A 4WEVX 2ZYFA 4B15A 2Z2AA 1ZJHA 5DY2A 3PF3A 4CQBA 1F3TA 3NEHA 4DM2A 3MV01 5DT5A 2DUXA 3VKKA 4ZBCA 3V0TA 2FHFA 4TMBA 3TLQA 1ZLPA 4W93A 4P8VA 4XBSA 3W1MA 5LIUX 2W67A 4IUOA 5F2LA 3VI2A 1O5KA 5DX7A 5BYWA 2DVUA 3IIPA 5A95A 4OOUA 4J9JA 2C15A 3DK9A 3MQTA 2Q02A 5H8PA 1VQZA 3GTIA 3OEXA 3EWXA 2W0HA 3TOPA 3VD7A 5XIAA 2QJNA 3TW6A 4D9PA 1JUEA 4M29A 2WVUA 3H22A 6ENLA 4H2HA 4CU8A 3A3HA 5D2XA 4NIRA 4IT1A 2P8CA 4QR6A 4EWJA 1IHIA 3VGBA 4CVUA 4AFYA 2WOWA 5LYRA 3LCXA 5HJXA 1FWTA 4XZIA 1BAGA 2PURA 4V15A 4XZLX 1QI3A 2A79A 3RF9A 4LS0A 1E9IA 1GXFA 2VNCA 2P8BA 3GH4A 3N15A 4HTYA 3PBUA 4LNCA 1GKRA 5GPRA 1ZJAA 3OBAA 2BC1A 4UFKA 4G1KA 3M0VA 1P0BA 5A8QA 3CMFA 5FIPA 1JGMA 4L7ZA 1FFVC 4MY9A 3TYAA 2BMBA 3CWHA 5HNUA 2YZ5A 3N13A 3ARTA 4QITA 4OUIA 3WLNA 2QDGA 3QVQA 1HKVA 3P61A 2J8TA 1KBLA 2I14A 4HK6A 2CYGA 1OZQA 2WHKA 3CHFA 3FA5A 3S1UA 5BZAA 3B8WA 3M0LA 1QWKA 4H8NA 4JTSA 3ZT7A 4TMCA 4J3WA 2A3CA 3KP0A 1A53A 3VX1A 2OX1A 4MIMA 4H9TA 1TKKA 1L8NA 4O11A 4AY8A 4Q3MA 1TTQA 2CDUA 2X0YA 2VFFA 1ZS2A 1VFTA 4PMJA 3NDZA 3TAKA 2PWFA 4N9DA 2ZX5A 4C6NA 4UQDA 4RNHA 2NLYA 2VQTA 1UP3A 3DFOA 1LWIA 1JPDX 2V3BA 3SRDA 3W2UA 1T96A 3DFNA 4AEOA 2Y6ZA 1BSIA 1REQA 2DFAA 4JNMA 2GUUA 3KE0A 1IE7C 1M01A 1H1YA 4NF7A 4B3LA 4NAFA 3SADA 3I7SA 5I78A 1IGSA 1VFUA 2DIEA 3W82A 4ROQA 9XIMA 1IT7A 2XH0A 1MUWA 4PMRA 1NDYA 4PGLA 4TVCA 4EACA 4O4WA 2C1IA 2YL6A 1W3TA 3K1GA 3RCNA 1PCKA 3QTGA 1E55A 3GDBA 3P0WA 1GGOA 1QNVA 2O7SA 1TZZA 4RZ6A 2BDQA 4AHPA 4REQA 2ICSA 3RO8A 3AMCA 2EF9A 1BVZA 1F6YA 1W9XA 4RE0A 3URAA 4NQ1A 4C6FA 3CB3A 2QNEA 1DIDA 2FGZA 4QX4A 1KKRA 4V28A 2GLKA 4BV6A 1XISA 3WEZA 4GBDA 1S46A 4PE8A 1MVYA 3E02A 2GK1A 2PP1A 4AC1X 2MNRA 4G9PA 3A6OA 3FKKA 5C2XA 4YCPA 4AD2A 1R46A 5A6BD 1UYQA 4NAEA 3AWOA 3VNKA 4US6A 1HXJA 2A3LA 3HJZA 4Y7EA 1L6SA 5BXPA 1S3HA 3N3MA 4PUNA 1R2TA 2CBVA 3NJ3A 1SZFA 2XH7A 1JUBA 3W85A 1PO9A 1LROA 3VDCA 2DSWA 1LPFA 2A3AA 3GG1A 4NZCA 3TQKA 3TXZA 1A0EA 3B8UA 4WRHA 3GXPA 1FO4A 4U31A 4GYKA 4K8GA 5LGZA 1JUKA 3RN6A 3W24A 3F03K 4FI4A 1DOSA 1J6PA 4QG6A 4BEUA 4GJ1A 4B4FA 1GOWA 2FHCA 3H7UA 5DMNA 4NEWA 3OG2A 3IJLA 1TJ2A 2Z27A 1V8EA 3CZJA 3W87A 3GUWA 4HT3A 5FAGA 4BZYA 2J7CA 3PUEA 1OEPA 5I09A 3GH7A 1XIIA 2ZKMX 2PRLA 4YXGA 4KPLA 1KM3A 4OE7A 3B9NA 2FGBA 2ESCA 1KW1A 1XDLA 3VNZA 4AZ7A 4PMVA 1P43A 5HMDA 4A4AA 3D0CA 5G5GB 3C2FA 3F2CA 3VCCA 1AD1A 1ICPA 5T8GA 3EWCA 4JHOA 1WCGA 1QNPA 3IIXA 3EPMA 1YNYA 1NFGA 1XLAA 1UZHA 2WMFA 2OWCA 4JQ2A 4JIHA 4Q4SA 1TJPA 3CGTA 5GQBA 1GRHA 4Q4PA 1A5LC 5CJMA 4M6VA 4M6QA 3USZA 4N4PA 3TCSA 5D8ZA 1ME8A 1NU5A 4JDRA 5BU6A 4LAZA 3NPWA 1E6ZA 2VGIA 3C0SA 4UTKA 1ZFJA 4Q8VA 3LHYA 1KC7A 2E9BA 1UR4A 4LVFA 3V5CA 1RK6A 1EKOA 4AVOA 2OXNA 4EMIA 2VC7A 4YYFA 3P7YA 4EKJA 3RXZA 1YYAA 5BXRA 3VGFA 6REQA 3CPUA 2QULA 1PL9A 4CQDA 1A4MA 2VX7A 1TO3A 3TJXA 3XINA 1SGJA 4HMCA 4F2UA 4QXIA 4JTFA 2D0GA 3AI0A 1NDAA 1GTEA 3BAWA 2D24A 4F0MA 6TAAA 2HTMA 3QOMA 1UR3M 4DWSD 4H7CA 4ECLA 4KQNA 4CD6A 2VYOA 1R9ZA 3Q67A 4H9VA 4GABA 4NUWA 3TFCA 2DQXA 3LSBA 2CETA 3WQGA 3ZWTA 1E0WA 1D7YA 4OU1A 2HK0A 4E2VA 2ZZ2A 4O1AA 2IPGA 2QUMA 2REQB 2J9ZA 3VZXA 1H5VA 2E6AA 4B16A 4FS9A 5I00A 5ER0A 1XF0A 1TIWA 2BHZA 3IC9A 4Q8UA 1JYNA 3F2BA 1AA1B 1ZBCA 3H2EA 5LIKX 3RX3A 4F8XA 1YDNA 2BNJA 4XAGA 4HZ6A 4R85A 4XZ9A 3W0KA 4AIUA 3W1RA 3ITGA 2JQXA 1H4PA 1ME7A 1XC6A 1M3UA 2G3JA 4FZIA 3M1ZA 2VWSA 1H5YA 3A22A 2PC8A 4LS2A 1V93A 3N12A 1EIXA 3APTA 3BH4A 2XJ7A 3N2MA 4A3RA 1X1OA 5KZDA 1AVAA 1ZALA 1E5JA 4L4OA 4JD4A 4KWWA 3UY7A 2I16A 3TYBA 4LEQA 3WLTA 2NWRA 3NR0A 3SCNA 1J0HA 2E3TA 3LI0A 4FX9A 3VUPA 4F2BA 2I17A 2CESA 1NHSA 1J0YA 4HA3A 2VJXA 3QY6A 1H1ZA 4X3ZA 3O2LA 2O4MA 2O9PA 2PDCA 1YX1A 2AOSA 3IJ6A 5TQLA 3DESA 4K8HA 5AC4A 2PRMA 1ISXA 4H9MA 3GDRA 2P53A 5K4XA 1VQTA 4Q7BA 2JF6A 1RCQA 3GUGA 3P62A 3EKGA 1PZ0A 1XWYA 3KWSA 3RCYA 3NOYA 5F2MA 1YBQB 2XGBA 3V1HA 3ZJKA 4AD3A 3B0UX 5DCDA 3DFSA 2R1MA 1SM9A 1C92A 2BWGA 3PG8A 1PHWA 4JKLA 3MO4A 4N7QA 2J7BA 3M07A 3W6MA 4E2BA 1IZKA 3OGVA 3V4BA 4QE4A 1U5JA 4HU0A 1GUVA 3R8GA 4ZVJA 4D1IA 3FJ4A 3FAXA 4QAIA 4LYPA 1X7IA 3H54A 1GEUA 2ZUWA 2Z28A 4XVDA 2Q3RA 3W1UA 3R6IA 4AF0B 4HNUA 1MEWA 3CIWA 2CKSA 2Z2BA 1XCXA 3KBNA 3QMTA 3GNXA 4WZHA 1VJSA 4MY1A 1M7XA 4YVXA 2VHLA 1I2NA 1DWAM 3CZGA 3IAPA 3G77A 3CGDA 1IEVA 2C18A 2VEKA 2NPXA 4IQJA 1BQGA 4W88A 1XSJA 2VL4A 2Z6IA 4DWSC 5I3HA 5A8OA 3NQ6A 4QTGA 3MUIA 2YSWA 3UYCA 1KBKA 3M7SA 4DJFD 3UXKA 5IFTA 3UR2A 4PRRA 1LYXA 1E4IA 3V5FA 3VC6A 3DYMA 2WPFA 3B04A 1JQXA 5FF2A 3QM3A 1F4HA 2QEZA 4DRSA 4LVGA 2F2KA 4S3AA 5MHBA 5AYXA 3KLJA 2WVVA 4IJBA 1UA7A 2E68A 5PTDA 4O8RA 4MZYA 4NHVA 4P2VA 3IGHX 1A5CA 3TJLA 4B90A 2AGTA 1PDZA 1TPH1 5JBFA 2R1LA 1J5SA 1S5TA 4DEFA 1L2UA 1ZAJA 3OG3A 4NP7A 1ONWA 1RHCA 4JTAA 1B1YA 2YFNA 3AMDA 5D30A 1VIWA 3GNPA 2XGZA 2PTWA 4C90A 1A5NC 1SZRA 4Q6XA 4HMNA 3JZUA 1V03A 3RM9A 3PZQA 3EAOA 4NEVA 3KVLA 5H1WA 5GJMA 4IOTA 1C9WA 3HQ1A 3ZWSA 3QQWA 5AC8A 5AOUA 2IUZA 2RFGA 3BLFA 5MKGA 4EQXA 2PDUA 3B9JB 2X41A 1CGUA 1QFEA 1EIBA 4A2RA 3ITCA 3UZYA 3CZ8A 3WJXA 3P2VA 1DQWA 3W02A 1E0UA 5FJJA 1QW8A 3BLIA 3H7RA 5RUBA 3MTWA 2GDVA 1EWEA 3EZ4A 3GTNA 3W7LA 1OFDA 5JU6A 1WZKA 4GH1A 3GSMA 1J8VA 4QGCA 3V35A 1OJTA 2R9RA 3LCHA 3H21A 4Q4QA 1F07A 1BTCA 2YCLA 4MLRA 3UT0A 5TNVA 3M5VA 1XH2A 1VHCA 5AHNA 2HROA 4FIQA 3S6OA 2UZ9A 1TPFA 3U5YA 3UZXA 3OU8A 4QSHA 4V27A 1OFBA 3FJNA 7TIMA 4O1DA 3KAOA 5C5YA 5DT7A 2WJDA 1UH3A 3W7HA 1GQIA 4N9EA 2VR5A 2B81A 3MANA 1LBMA 3PPFA 4MPQA 1ZRQA 4KRTA 1JD9A 3LMZA 5K9XA 1E1CB 2ZXBA 3OQEA 4PYSA 1TX2A 4C6OA 2OQLA 3IVSA 1VBJA 4P7QA 4XG1A 1K77A 4QJ5B 6CGTA 3SCVA 1FHUA 3ANYA 4BFAA 4QBXA 4TVWA 2QAPA 4KF1A 4AZGA 3H4WA 1V7YA 1VBHA 2A2IA 1EX5A 1P1MA 3GW3A 1DYSA 6XIAA 2P1FA 1XLMA 3QYSA 5A6SA 4TO8A 4Z2LA 3PPCA 4WDWA 1GG1A 4IPLA 1BLIA 3LRKA 2WSQA 3UVIA 1W1YA 4FPSA 1E56A 3SIZA 1KR0A 5HK4A 3TNOA 3XIMA 3STFA 1GETA 2PWVA 2A7RA 2QJJA 3WDJA 2CLMA 1W1ZA 1QU4A 2D2JA 2DZAA 2WZTA 4Q33A 3VE9A 3L4VA 5H8UA 4JPGA 1RH9A 3W7DA 2GOKA 2GRTA 3UERA 2P88A 5LXEA 4NXKA 5A8PA 1VFSA 2XM2A 2NSOA 1LG2A 3MYPA 3BMXA 4E3VA 7ENLA 1TCDA 4Q4MA 5H8MA 4OTKA 2EQ6A 2R82A 1KBBA 1H7OA 2VFHA 2AGKA 3TA6A 5JCMA 4UBPC 3C52A 3VC5A 2ZRVA 1Z8AA 4Y90A 2A6NA 4HOWA 3WNNA 3PUOA 3RR4A 1UD5A 2Y62A 3W72A 3E0VA 5AY7A 5B7ZA 5A94A 2J4GA 2BXVA 2DGAA 1CLVA 2J24A 2RGLA 3WNOA 3TVAA 1QJWA 5D03A 5AZ1A 2CHOA 2E28A 3V7PA 5ABFB 1TQJA 3W1PA 2G5WA 5JBEA 3QSTA 1GOOA 3DKLA 2QQ6A 3K4DA 5LXXA 3P3BA 3SFWA 7TAAA 3NTYA 1MYRA 3P8JA 3R8RA 3TCEA 4NG3A 4YWIA 1VENA 1YW1A 5C9XA 1WQ5A 2J7EA 2OYLA 3E3HA 1W56A 3E2SA 3R79A 1BEUA 4S3JA 3TXVA 4LYRA 4QEHA 2QJHA 3BE7A 1F5ZA 2ODOA 3WBYA 3VD4A 1UMLA 2EEXA 4HSOA 5HNNA 3W6YA 1ICQA 1BF6A 4ZQPA 1MXDA 4UTLA 5FJRA 2XSAA 4WJ8A 1XUUA 4S3DA 1Q7MA 2CWXA 3WEMA 1CEOA 4MWAC 2PAJA 4O28A 3UD6A 1BZLA 2DP3A 1EZWA 4OIFA 2ZUMA 1WDDA 4PMZA 3GU1A 1IYXA 5AB3A 3UWYA 3G0UA 1YE6A 1SSGA 4B9ZA 3DBPA 3LV6A 4DAFA 3GTFA 4FF7A 2OYMA 3GKFA 3MI2A 1BVWA 1IZCA 2E77A 3HIJA 1KM1A 2C71A 2Q01A 3QEZA 3IUIA 1LVLA 1Q5MA 3W83A 2ZXQA 4A2SA 2PWDA 3LK6A 2GJRA 4PMYA 5C8BB 3DGZA 4MJMA 4CNTA 2FMNA 3LTPA 3ZLFA 4WCJA 4UXDA 4QCFA 2ZZ3A 1T40A 1U83A 2F6UA 5KZEA 4E2OA 1QCWA 3CTLA 2GSEA 4GQGA 4YLWA 3UNDA 3HPZA 1GW9A 1WOAA 4F66A 1MOKA 3KDOA 4AHQA 2ABAA 1V0NA 1M9HA 4LRSA 3PNUA 3LUTA 3A47A 1KFJA 4I9JA 4ZO9A 3WK3A 3VUSA 3DYPA 5HXMA 3UWWA 2PTXA 2WBAA 4XD4A 1FCBA 1A0CA 1W31A 5JCIA 4XWUA 3IRDA 1C7TA 2NVCA 4DF1A 3GRSA 1N55A 3AIWA 1WYIA 4LAKA 1GJWA 2X2YA 2OT0A 4AIBA 3UXDA 3ARUA 4L1WA 2VEGA 5I5RA 1R86A 3RCMA 3W53A 1XBXA 5C9WA 1TSIA 4PTWA 1EFZA 4O1CA 1US0A 1BYAA 5I3DA 1TREA 5FSDC 4UTFA 4EM3A 3O6DA 3C8NA 1R47A 4L4LA 4QLKA 3EYPA 2VD9A 4FOKA 3VD5A 3EB4A 4AD5A 2Z26A 3S83A 2DUZA 4JTUA 3TDFA 2GGHA 3AUJA 3BOLA 2V9DA 3UG8A 3IJDA 4H8UA 1XH1A 2CLHA 1SR0A 3L0KA 1K8YA 1J79A 1XFCA 1LUCA 5KVHA 3T8LA 1I45A 1XGEA 2BV9A 4WF7A 3PPGA 2PDLA 4ADTA 5TD4A 2ZRYA 4LY4A 1WBHA 5A5WA 3UNTA 1T7LA 1FWFC 1SW7A 4AY1A 3ZR4A 4C6IA 4G8TA 4GWEA 3LB0A 3NVTA 2PGWA 1CBGA 1GQKA 4UIOA 1CGWA 2DZXA 4F2TA 3CGCA 4MB3A 4WY0B 4AYSA 4LBSA 3GR8A 3ZZ1A 2I9EA 3TONA 4WKFA 2JK6A 1UR2A 4Z1CA 4CEXC 3B4YA 4H8HA 1EJTC 4AX7A 2QVNA 1FY6A 2EKGA 1EP3A 1XM3A 1A3WA 1U33A 4O15A 4X0NA 5HQMA 3AO0A 2NT1A 1CGVA 1S2TA 2WNZA 3STPA 4Q8WA 3SIMA 3JZEA 4Z42C 1VCFA 1KM4A 1PTDA 1LZOA 3TU9A 2Z6JA 1UWAA 3UJFA 3WH7A 3UZZA 3TROA 2JEQA 3PN8A 2PZ0A 2V68A 2RJHA 2WCSA 3L23A 1UH2A 3Q45A 1PKLA 1ADSA 3A7UA 5I3KA 4OQVA 3S2JA 3WYZA 2VWTA 3BURA 3FGCA 2C0HA 2VGFA 1SJCA 3WK1A 3URQA 3HGRA 3GTHA 2HRWA 4S3GA 4OKDA 3WLQA 2ON3A 1P1XA 3WL0A 3RU8X 1G69A 1UP2A 3LHVA 1TYPA 3CBWA 1V3MA 3CEPA 4AIOA 3CQHA 2GYIA 1XW8A 4K8DA 4KWOA 1H49A 2XU2A 1H50A 2NV2A 3A5VA 4LX4A 1VDVA 3N14A 1ODZA 4UMBA 2I5GA 2O55A 2YW3A 4JY9A 1C8YA 1F8MA 3G8RA 1JF6A 4IMDA 3TYEA 1SR9A 2ZA1A 5HMEA 1KCZA 3KTCA 5LA1A 5K9DA 1SW0A 3QW3A 2GR1A 5FF7A 5I3JA 1B3XA 4GQ0A 6TIMA 3T40A 1ISZA 1ZY9A 1EC7A 4UTTC 3WQCA 3IIZA 4Z2IA 1XBYA 1EJSC 4NZ1A 1ZNNA 4O57A 3MW7A 1JZ4A 3N9SA 4FEZA 4GUIA 2OO0A 5HWJA 2VKZG 1TA3B 4Q8PA 1EA9C 2WWCA 4QDWA 3URHA 3POCA 3NQCA 1ITUA 4U28A 4GVIA 4RNFA 1JDAA 3G24A 4DPQA 3VD3A 2IMRA 4GINA 1PX3A 4KEMA 4G6CA 3K46A 2ZWZA 1GYMA 1EGZA 1E43A 4NASA 1V3JA 4JTGA 5FCZA 1YRRA 1XIGA 2INZA 3HFYA 2D2HA 1LF1A 3RPDA 1VP5A 1W5QA 1MQPA 4JTCA 3G1SA 5DBTA 3GK0A 1RY0A 1VPYA 3POHA 3TFXA 1AH3A 4A6GA 1GTHA 3VGGA 1W0MA 4ACYA 3GR7A 5FESA 1MXGA 2YVFA 4OZOA 2H9AB 2E6YA 4IMFA 1KBJA 4H4RA 4DUXA 2E9LA 2I9UA 5T9CE 2H8XA 5M5DA 4X9YA 2OWXA 1PTAA 3EOUA 4HZ8A 2E5AA 3WLLA 1ME9A 2HNEA 3BLDA 2EPKX 2ZTKA 4Z17A 2CLKA 3E96A 4C6QA 2BVDA 3W7JA 3EKLA 1OB0A 3VIIA 1BQCA 2QCMA 1RBAA 5ABGA 5G4HC 4GYPA 1KB3A 4W86A 4Q22A 2QCDB 3CGBA 1JCYA 5T26A 1FEBA 3O07A 1PXGA 3DDMA 3IIOA 3UU0A 4IGNA 1EGMA 1QDSA 2QF8A 2EKCA 4JKKA 4EOUA 1TV2A 2QF7A 4QDPA 3V0SA 1DHPA 4ZCWA 2H8ZA 1EP2A 1WA3A 4BCEA 4UMCA 1K6WA 1JI1A 1XGDA 2DQWA 4C7DA 5C71A 4I3GA 2FB2A 3EOOA 2E1WA 4IF2A 4X63A 1OABA 3KLLA 1IT0A 4CN4A 2A3EA 5BRQA 4YTQA 3W4RA 1SFSA 1QVBA 4PB5A 4L6DA 3WSUA 4O8AA 1W3JA 5KMYA 4MB4A 3G1RA 1GVQA 4AXNA 4PULA 1LLOA 2CZVA 2WC4A 3GFXA 1E6RA 1CGYA 1KGWA 1JL8A 1CXEA 3PZIA 1QHZA 1O60A 2YCIX 1X98A 5J04A 2WXDM 3W38A 4F79A 3LBCA 1MO0A 1GHSA 1TWSA 2YLLA 4O10A 4UOJA 2VEMA 2OEJA 3BV7A 4I5RA 3ZIZA 4ZB5A 4MUZA 1V3HA 3O15A 4X22A 4G5DA 4XZHA 3S3GA 3IGUA 5KSWA 3MBDA 3RPMA 2YXGA 4YTSA 4M81A 2JGYA 1ZMDA 3QQ1A 3VAVA 1UR0A 3LGEA 4DX3A 3ETRB 2GDQA 4OVXA 1LBFA 4A3QA 3ZJ7A 1EDGA 1EF2A 3LI1A 4TIMA 4MSSA 3T9PA 4KEZA 4RE4A 3GU2A 3RNDA 4OJYA 2JK2A 1JZ6A 3RJYA 4O0QA 4WKHA 1K8ZA 4W5ZA 3S1VA 3SURA 2VQUA 2A3HA 2GZXA 1G0CA 4HU4A 1C93A 5FEWA 3W29A 3TJ4A 1QI4A 3FX4A 3A4XA 3O1NA 4RXFA 4IISA 4IX0A 1G7UA 4C1NB 3T42A 1XIMA 5C9ZA 3CV6A 1FKXA 2R8WA 4ZTYA 3G22A 4XBKA 1K3UA 1E4NA 3TA9A 4JTLA 1B2YA 4W5UA 2Q8LA 3L4XA 1E0VA 1M7PA 1S7MA 4CN6A 3BICA 4ROPA 1HJSA 3GTXA 4LVDA 1KM0A 1UOKA 2HMCA 4FXRA 1Y65A 3SECA 4ERIA 5CG0A 5BU9A 1OADA 3G1XA 3LMYA 3CYJA 2NUYA 1KFBA 3R1ZA 4UTJA 2NVAA 3WQEA 3LY0A 1WPCA 1E6PA 1GPFA 1A80A 1FTXA 3WBEA 3WBWA 3K4WA 2G37A 3EWYA 3PULA 3I3EA 5HANA 3GM8A 2DW6A 2Y1HA 2V69A 2PDFA 2R94A 4DXKA 3BC9A 4C6EA 5HMFA 3DFYA 3DXIA 4GC3A 1FA2A 3AAMA 5TIMA 1IR1A 3BZGA 2IQTA 5LKYA 1L6FA 1ALDA 2PDBA 1EX1A 3SCSA 5HQEA 1RVGA 1QHOA 1Z3NA 2W27A 4GQRA 1S38A 1MNZA 1KFWA 1LLZA 1A50A 2W91A 5DXXA 1ZMCA 2XSXA 5DFAA 3N6QA 2V5JA 2CCRA 2P3EA 1KGUA 2QJMA 3O0HA 4N4QA 4MMWA 3BW3A 4HYVA 3PZTA 3PG6A 3CUHA 5HR6A 1QHPA 1TQXA 1GQNA 4X60A 1AQFA 1OHLA 2BVTA 3TZFA 2Y8UA 3GZAA 1XLGA 1J11A 3ZQ9A 2YL9A 3GHRA 4B5UA 3G6MA 1PS9A 1EYEA 4W7UA 2X50A 2Z25A 1ZSXA 2ZVRA 1A5BA 3AHYA 4JN8A 4QSFA 3DFTA 4WSHA 3THAA 3S5ZA 3FDKA 3ZFHA 1ISWA 1TZ9A 4H19A 3WQPA 4Q8QA 2WJZA 4JTEA 1SFJA 3WH5A 2VRKA 3TEVA 4ZR8A 4JTQA 2VFIA 1MNSA 4YS1A 1REQB 3T07A 1IXNA 3OBEA 4UTWC 4NAFB 1C90A 2GVGA 3LHTA 1A5UA 4ZQRA 4M56A 1OFPA 2WMIA 1F9CA 2ZDRA 1BXNA 4FXSA 4Y9PA 1K4GA 3LD5A 4MHBA 4TU1A 1KO0A 5G2IA 3OJGA 1MZHA 1PWMA 4ZOAA 4REQB 1WKDA 4AEEA 4IZGA 2YXXA 2WLYA 4ZE4A 1Q63A 4AQLA 2VOMA 3WDPP 3DBNA 1H7NA 3QKZA 3ALGA 3M43A 3L5MA 2KAUC 1VH7A 3JVAA 4GQQA 1A5MC 4GACA 3WKZA 1W1TA 2GK1B 1R9XA 4PTMA 4PCTA 4IPIA 2QLYA 2Z7KA 1R9YA 1KQZA 3U5UA 2DSVA 1NTHA 4GIRA 4NAEB 4MZ8A 4RDVA 4S3EA 1SJAA 2TRSA 2NUXA 1KV8A 4JZ5A 3LYEA 2I56A 4JDBA 2P3ZA 1XLBA 4H4ZA 1RLCL 3DG6A 1DPMA 3TLLA 3VIKA 4DWSA 3QR0A 2CITA 2J7DA 4H3DA 3UZ5A 3QPYA 4W87A 1EBGA 1M6IA 2DZWA 1ITXA 1W8GA 4IP7A 3PJXA 1RY8A 1RAKA 2A7PA 4OHQA 1R87A 4BI7A 2QGHA 4MKNA 5JCLA 1XCFA 1DBTA 1CDGA 2WNWA 2YR1A 4K38A 4Y9OA 2QMJA 2BOEX 4CD7A 4ZOEA 2Z2UA 2IKIA 3TNBA 2I1OA 3SCOA 1CXFA 1CENA 3TH6A 1F8IA 3OLEA 5BRPA 2IQ0A 4APNA 4H6RA 3ITVA 4Q7NA 4QEEA 3P5ZA 1OINA 4J3TA 3NSMA 1F4AA 3B0XA 2ISSA 3VDHA 2WM1A 3NOEA 3GE7A 3BOXA 1Q4WA 1PVNA 1CB2A 3CWNA 4U2YA 3ARQA 3WLHA 5J5RA 4DZIA 1V3KA 4C6CA 2NUWA 4KERA 1QI0A 3VM5A 1YKWA 3FAWA 1V5XA 4DBSA 3CHDA 9XIAA 1OC6A 4O52A 1IF2A 3GFZA 5CQ1A 2AQWA 2V2HA 5FS8A 4GY7A 3MMWA 1Q6EA 3Q37A 3B4UA 3AHVA 1MQQA 4XUYA 1N8IA 3A64A 2CLEA 4L6OA 5CEWA 5IFPA 1B9ZA 3PZVA 4B5VA 4GNVA 3RLVA 3VYLA 5CSYA 1FWEC 4CGTA 3ZVHA 3NZ1A 2A85A 3D3FA 3VDBA 5A3HA 4M5PA 1KV5A 1Z41A 6REQB 5F4SA 4H4WA 1A5AA 1Z9AA 3SO7A 4ENLA 2ISFA 3GVRA 4ZEPA 4CQAA 3CQIA 4JYDA 2F9RA 4R3UA 1XCWA 4MM1A 3K2GA 3PFRA 3GZ3A 1R2SA 3AZTA 3BSMA 2V5LA 4EF9A 2WMHA 3WH9A 1G67A 4BEQA 3K13A 1OBAA 2RDWA 5CH9A 5A6MA 3GS6A 1TB3A 2J7GA 4JGDA 3GO2A 4AY7A 1HP4A 5D04C 3EXSA 3GG8A 1LOSA 4F40A 3DCPA 2PDNA 1B3VA 3SAZA 3IJQA 3DN5A 3KBSA 3MP3A 3RGTA 3DKJA 1OJXA 1AG1O 1H2JA 4KEUA 2POTA 1C8VA 1YTKA 1SQ7A 2X8GA 3B8DA 2GVEA 2OG9A 3EDKA 2HV5A 4DO6A 3A4WA 2Y8KA 2G97A 4ATWA 1WDQA 1Z32X 5E6ZA 1L6YA 3M6DA 5EMJA 5D9MA 3B9DA 4LPCA 1W2VA 1X8CA 1EUNA 1V6VA 3E12A 3WNPA 2E8YA 3M47A 1NM9A 1NHPA 4R33A 3QZAA 4B3ZA 2OT1A 4UOQA 4XVEA 2OOGA 4MPKA 2KZHA 1F76A 3OA3A 1CXLA 2RUSA 3UPBA 3FVDA 5JUVA 3UGRA 3WFLA 2AL2A 1H7RA 1NHQA 2JEPA 5E70A 3VOIA 3MB9A 4IXXA 3R11A 1A3XA 1PJ9A 4HN8A 4GR1A 4D6IA 2F38A 1QO2A 2OKTA 4DF2A 3B97A 4LTSA 4H4VA 1KR1A 4AISA 2WNQA 2PGEA 4BA0A 4DZ5A 2FDMA 1AH4A 4AZCA 3UP8A 5DRIA 3RU6A 1ZTVA 1QPKA 2BS9A 2ISVA 1KBIA 3NQGA 3FEQA 2ZUTA 4KGJA 4ZOHB 3PBMA 2YBUA 1JQVA 4QQ3A 5HWNA 4Z2GA 1ZGDA 4CN1A 3K5XA 4I90A 2W9MA 3R8HA 1VBUA 2FTPA 3BOFA 3WF3A 1QNSA 3K8LA 5CPOA 1DVJA 1FKWA 2E0PA 2G50A 2G3NA 1W37A 4BHYA 1XRSA 5M17A 3CJPA 3BSGA 4YPJA 3WMSA 5B7YA 3WN6A 4FK9A 3O63A 4TV5A 1MRQA 1UQYA 2TODA 2PEVA 1XP3A 3N2BA 1OIFA 3MCMA 3YPIA 1DIOA 4EPEC 3VPLA 2J8GA 1R3VA 1ZKQA 3MI3A 2UV8G 3IAQA 1VEPA 4OOZA 5KTLA 1ZL1A 3AYSA 1TV4A 2OZ8A 4UWMA 4NILA 5F2GA 3FOKA 1DIEA 1X97A 4JL1A 1OCJA 2Y2WA 3GNDA 3AS2A 2GR2A 1RA0A 2IKGA 2OEKA 1FWIC 2P0IA 2QCCA 3BG3A 1X39A 1DQUA 2J77A 4EXAA 2OZ0A 4ICNA 4PMDA 3U0HA 4HIBA 5IDIA 4EM4A 3M46A 4RNIA 3S5NA 3UYIA 4H4SA 3B40A 3S42A 1HO1A 2XVLA 2PDIA 5CJ5A 2O4QA 1GESA 3PM6A 3CAWA 2VCBA 4WXZA 3VIGA 3P8IA 1B30A 2WVVB 5D2VA 4F9DA 4RZ5A 1F74A 4NJIA 2BGNE 2V63A 5BXSA 4PTVA 1EWDA 3BCFA 3NVZB 1OF6A 3MJYA 4XZNX 1KXVA 3KBVA 5CG7A 2GPTA 2J9YA 1UR1A 2XFWA 3ABSA 4CUCA 3EMZA 4JNYA 3W1LA 4PMNA 1RD6A 1JULA 1GCYA 1B3WA 4JS3A 3VMNA 3GXDA 3MC5A 5A2AA 1JZ8A 1E4MM 2FFIA 4QNEA 1IXPA 5EMUA 1KKOA 1BXBA 5C2CA 3TC7A 3NVDA 4PUUA 1I2QA 1UG6A 4H9XA 3KHJA 4HHHA 1DJWA 3T0AA 5MKGB 3RMEA 3EPOA 3R0DA 3CGEA 4EAMA 3T05A 4EANA 3DFQA 4L61A 3AU6A 3J7HA 4PBEA 3FK4A 3LGDA 2XG9A 1ENUA 4S3CA 3VA8A 5K4ZA 3QHMA 2UY4A 4X2RA 5HOSA 1DEDA 2DIKA 4BURA 1MXSA 4TXEA 3VOCA 3VE7A 1HGYA 4K2SA 5GNYA 3G6LA 1NDZA 2F6XA 4RE3A 2X0SA 3WJWA 4IIHA 2YCLB 3O6AA 2VZVA 3S6DA 1BTMA 4RDZA 5D37A 4JYEA 4O14A 4BS0A 3CLMA 4HNOA 2GWNA 1L8PA 3NG3A 3QY7A 4HBKA 4XIMA 2VRJA 3U2CA 3BUVA 1HJWA 4NYYA 4U2ZA 3PBWA 3VKAA 2MUCA 2W4XA 1W9PA 4JIRA 1CGXA 1IR2A 3M16A 1ZUAX 4FDCB 1A3HA 1VLIA 5C54A 4TUFA 2GGIA 1BRLA 4Q8MA 1UKPA 4DUVA 4GKLA 4XD6A 3BAXA 2WAGA 3CV7A 1UASA 1QATA 4QLJA 3DGBA 2Z1KA 2QYGA 4Y9AA 2DZUA 5EGRA 2EPHA 4D6HA 3CQJA 3GVQA 1XICA 3SR7A 1GNXA 5B80A 3M41A 2HWGA 1AH0A 1UKSA 3EGJA 3HV8A 1EP1A 4UMAA 3PUDA 1Q6FA 3IJIA 2DVXA 4ML9A 3WD1A 4N9BA 3GIPA 2AAQA 2ZRZA 5CBIA 3LB8A 3R2GA 2G3FA 5EFDA 4XAPA 3IANA 1K9EA 3C3NA 4XZWA 4I9AA 3CHVA 3Q94A 1NWUA 3UA3A 3WLOA 4OV9A 1U5HA 4PH6A 4IQLA 1FEAA 2NV1A 3WDHA 4YNGA 3E74A 2GJPA 4D8ZA 1W9BM 2F2HA 3B9AA 2X8HA 3T44A 4UTTA 1GPWA 3HGOA 2QHAA 4R53A 1QMLA 4U3AA 3ARZA 1V6YA 1EJXC 2IPFA 4C6JA 1JROA 5DCEA 5LHFA 3LCFA 4Y2WA 3QPEA 1PX4A 3BMWA 1LL7A 4LYKA 3GIYA 1UD2A 2C14A 2HE5A 4CNUA 1LDCA 4LBRA 2POZA 1HKMA 2V3AA 4GIYA 3VDAA 1J18A 4QG9A 4EPBC 3V1PA 1UZDA 1OYCA 3UG3A 1W1PA 1E6SM 1OYBA 3SCRA 2NQLA 3LRMA 3SR6B 1H0GA 1XIDA 4XK2A 3S2MA 2QPUA 2BVYA 2JF7A 3KVKA 3QHNA 3KRSA 2HS8A 2DJLA 3CZEA 3EX1A 3MWCA 3CV2A 1VKFA 4KWVA 1VC4A 2OLHA 2ZRWA 5A2BA 3AXXA 1WUEA 2RJGA 4JTDA 5CAKA 2VURA 1WDWA 3DERA 3H53A 4AHOA 1W5MA 1S1PA 1DWJM 2C79A 2GL5A 3G3MA 3P6LA 1OT2A 3HGSA 1TX0A 4KRZA 4TR9A 4WD0A 1ZBVA 5J5DA 4KETA 3RRAA 3CS2A 2QXWA 1BSLA 5F2IA 5CC3A 5KZMA 3HQPA 3P74A 2DT2A 3L2LA 3BV4A 1UHVA 2ZTJA 2PWUA 1SYTA 2HK1A 2QW5A 3E5PA 4J3XA 2ZRUA 4MAVA 4MNKA 3LV5A 3UWEA 4AZ6A 3LRLA 5CPTA 1V6XA 3GXNA 1AZ2A 3NPUA 2ZE0A 1GEHA 2RKXA 1D3HA 2YDQA 2X99A 1EB3A 4XD5A 1TV3A 1XI3A 2HVOA 3WMBA 2WPGA 1B0IA 3B06A 4KFNA 4MF4A 3CUIA 1FX6A 4KIRA 4Z0SA 1K8CA 3CQKA 3MS8A 1M68A 4GVGA 4H83A 3W7MA 3CXBA 1UUOA 2VEFA 3QR3A 3TWBA 3TP4A 1HFBA 1YNPA 1FHLA 5M03A 3L67A 3NXFA 3AS1A 3OHMB 4E0CA 5JIPA 2IPJA 4RLIA 2DIJA 2C13A 3OC4A 1TMLA 5GJPA 5U25A 4ZOCA 4PB3A 3NZGA 1DTNA 4DUWA 3S5SA 1TPB1 4I5XA 1AQ0A 2V3DA 2R24A 1KXTA 2YBVA 3G2GA 4CU6A 1F3XA 4C6MA 2O0TA 1LUCB 2VD8A 2DVTA 5TBOA 4EIVA 3AJXA 3Q2DA 5I0DA 4E8DA 1DXLA 2QAEA 1DL3A 3SBFA 2J47A 3RNMA 4I8DA 3IV3A 4E38A 3G1HA 1IV8A 3WF0A 3TV8A 1LG1A 2W3ZA 4CQ9A 1U5VA 3E6EA 3PJUA 3OB8A 2AAAA 3KLKA 3HQOA 4GVHA 2WKGA 3Q58A 4RW5A 1S5MA 4UR7A 3KOFA 4Z08A 1K7FA 3GNOA 5K9CA 3VIFA 2RDXA 2ABBA 1UJPA 2GOUA 5DLCA 3BLLA 2A21A 4KRUA 1U1JA 2NQ9A 1V08A 4H9ZA 3F2DA 1RA5A 4PTNA 3ZO9A 3ES7A 1AK5A 1HJXA 3CTTA 4GY0A 3ZR6A 1RP8A 3MKVA 4LUJA 3ARVA 3TTSA 3H2AA 3W88A 3CT2A 1JOAA 1G5AA 1RJQA 2J6VA 3NSNA 3U4AA 3TKFA 4FLQA 5A69A 2ONEA 5DCBA 1UC5A 1AZ1A 1D8WA 3OA5A 3VKBA 3LXAA 2J6XA 4I6VA 1J01A 3FGCB 5LHEA 2F61A 4H7VA 4NKCA 4N6EA 1KLYA 1Z6KA 3F5LA 3PP7A 1CT5A 3W73A 4IPNB 5HULA 4WY0F 3WF4A 1BWVA 2GQ3A 3IGXA 3UR7A 4XZMX 1ECQA 2Z7GA 3EKZA 4H04A 1FFQA 1MW2A 1XRFA 4WDTA 3CC1A 3EWDA 1TZ7A 2BXZA 3T4CA 5CPNA 2OSYA 1JF5A 3EB2A 4IGMA 3THDA 4GXMA 1W1VA 3GBDA 1Z48A 1I9CB 3AS3A 4V1YA 5EBUA 1WZMA 3M7WA 1V0LA 3BWWA 3IUHA 5CC7A 2WP5A 1GRTA 2DEPA 5CXPA 4DO7A 5REQA 3R89A 2HNHA 3WNLA 1HL2A 3ZR5A 1YTEA 4E6MA 3W2NA 3G3DA 5LZLA 4DBWA 4IXHA 1D3CA 2DZPA 1EJRC 1XUZA 4R7WA 4XO6A 2XM1A 2CFYA 3CUXA 2YDAA 1HVQA 4O13A 1FIQB 1CLKA 2DH2A 4UCFA 3KS6A 4CNPA 2V82A 4RV8A 5D9PA 1QTWA 2BASA 2X05A 4OBSA 1JFHA 2EAWA 4QP0A 1P6CA 4EQSA 4MDPA 4JCMA 3WLRA 1LCOA 4DZHA 2A6LA 4NXSA 3W07A 3KM8A 3GVGA 3KW3A 4ES4A 4DNAA 1Y7VA 1TMQA 4Q8NA 5DY3A 4GPNA 2CZFA 4JYFA 3OTRA 3LBMA 3W1TA 4D2JA 4GXWA 1JG9A 5EBAA 3LSCA 4MYAA 3K1DA 2DT0A 2W61A 4UTWA 1HGWA 1X38A 3M0IA 3U2ZA 8RUCA 3GVVA 3DJJA 1XYLA 3LTSA 2OODA 4FNSA 3L5AA 3OO2A 1LOQA 4AZBA 1W5NA 5A8MA 1Q13A 2VVNA 2DT1A 2P50A 2G3MA 2FZDA 4Z2KA 3QC3A 4L9ZA 1XD0A 1KTCA 2PBOA 1AMKA 1K70A 2OFJA 4H6QA 1B57A 2BY3A 2WNNA 2O56A 1EBHA 1I0BA 3DFPA 4H00A 1KTBA 4IJRA 2J7HA 2X40A 2GUYA 3UF9A 4K7YA 1E72M 4PCPA 2BX7A 1OFRA 1EO5A 1H51A 2C16A 2P10A 4YHEA 3Q65A 2PDXA 2NT0A 1K03A 1M03A 1PDYA 1OZMA 3LPOA 3APYA 1HG3A 1CNVA 4AUBA 1GZJA 1NP0A 1M53A 1HKJA 4LOCA 3COTA 1W9DM 4L5ZA 3P80A 1JEZA 5I07A 4JN7A 4A35A 2ADAA 3WLJA 1OX4A 4PUKA 3SCQA 3DU0A 3QY8A 2CXEA 1LQ2A 4HCLA 5DF0A 1GRAA 3HQNA 3BK0A 4GZJA 1AJ0A 4RNJA 4L9XA 4J3ZA 3DH9A 3B9EA 2YFOA 3T2PA 3LGGA 3WK2A 2FH6A 4HB7A 3AZSA 1SO4A 4HVXA 1E1EA 5CSRA 4UFHA 5HINA 1B3OA 2INFA 2PDHA 4R5EA 1N8WA 3AC0A 4Y6GA 4P5UA 2MANA 2C19A 3KDNA 4R9OA 4GA8A 1LQAA 4CD4A 5D38A 3TJIA 1TUXA 2EGZA 3P14A 1R3RA 3W23A 3SY8A 3LTYA 3ZSSA 1ML1A 1JPMA 1RCOB 2PLMA 1X6UA 3GC4A 4WHBA 3UXLA 4Q7IA 1F8WA 2FVKA 5FJUA 1NSJA 1P0EA 3MA8A 1NHRA 1TR1A 1XV8A 1E3XA 2E5DA 4PBGA 3UJ2A 3NQMA 1TPC1 4P7RA 4GC4A 3GD6A 5LA2A 8XIAA 1DXFA 1OC7A 4FMVA 4QHRA 2UWFA 1HJQA 2QZRA 1FDJA 2JFEX 1KA9F 1W1A1 5EMMA 3OGSA 2GGEA 3MVTA 3JS3A 3NZPA 1Y8BA 3PB0A 4IGSA 3KWXA 4GNKB 2VCAA 4O1EA 3R10A 3NGJA 3PAJA 3LBOA 4HPNA 1E15A 4Y96A 3WDIA 3PJTA 5LIYX 4N2YA 2ZZCA 1JI2A 3IJ9A 3GAYA 2ACQA 3W1NA 2BB0A 2Z00A 2WSRA 4HOXA 3N11A 3O0FA 3C86A 4WLCA 4AG0A 5LNWA 1VYRA 5EKYA 7A3HA 4K6AA 1G1YA 3MKCA 1UIOA 1EPXA 1OM0A 6XIMA 1GG0A 4Z1AA 2B31A 1OVDA 3KCJA 4QRNA 3P81A 4H50A 2QVHA 2WYSA 1S2AA 3NL5A 2VGGA 1XRTA 3CM4A 4WK9A 1NELA 2EJ1A 3N73A 3ONCA 1C29A 3QMSA 4W8AA 3ZT6A 2E5CA 1GYNA 3CHEA 5U1OA 2DZSA 4LF2A 1DXEA 4IIBA 4CVWA 2Y89A 1NFPA 4F4RA 2WANA 1TV8A 1XX1A 4ZFMA 3S9YA 4I7VA 3G1YA 3S47A 4W84A 1YXCA 3V3WA 1JCXA 1VBGA 2FZNA 3T08A 2ACRA 3IARA 3DHPA 4PL2A 2V6OA 9RUBA 2EPOA 4LF1A 3S9IA 4NVTA 5I79A 3KZSA 5IDZA 3BXWA 1HL9A 4O54A 5ECUA 2D69A 5DELA 1K7XA 3MSRA 2P76A 4JN6A 1S5NA 1UBPC 3RPTA 3PR2A 3R5EA 4CQ8A 3MBFA 3EBVA 1GKPA 4JXCA 3TYZA 4NT0A 3GR4A 2FZBA 2J8FA 1S5WA 1XJBA 3SUUA 4IX2A 4UB9A 3LLDA 3RLGA 5CZTA 1LM1A 4TX6A 3CAVA 4IFRA 1DJHA 4FR1A 4FXFA 3RX4A 1NFBA 3UFYA 2X42A 4NZ3A 5U7SA 4M82A 3EEGA 1KRBC 3NA8A 1UWUA 4CNNA 4H9UA 1VFHA 3PG9A 4EXBA 1YADA 1GZ1A 2IW0A 1UPPA 2BGQA 4HN4A 1BFNA 1Y5XA 2J3NA 1NJJA 3L2MA 4JTHA 1Q2SA 3L12A 1LOLA 1R85A 4K1GA 1OF8A 4QJ3B 4S39A 1AL8A 2ALDA 4DVOA 3H26A 3VDGA 1OK4A 2WMIB 4UUIA 4AH7A 1L6WA 3M0HA 2Z1VA 4S2BA 1AJZA 3HW2A 3A9IA 2VCCA 5EB8A 4FX8A 3FA3A 1A49A 3HGJA 1BHGA 1XIFA 3QLLA 1R3WA 4LV9A 3GHSA 3HURA 2OSWA 2QUUA 3TC6A 1QK2A 5AYYA 4C1LA 1FP9A 3ZOAA 4G56A 3II1A 3DK8A 2GSJA 3KCLA 4JEJA 1KQYA 1IXQA 3CZKA 4H2CA 3VVGA 3KRZA 2WC3A 5CGTA 4RZ4A 5L6UA 4KH2A 3HBLA 2XIBA 4YJ5A 4IIEA 4MKVA 1EXBA 3W37A 1O4UA 4IPJA 1GRFA 3A24A 2EHHA 1U1HA 4IL2A 1TTPA 1XIJA 2DPEA 3REQA 1NWSA 5K3VA 4I6KA 1DJZA 3FJ6A 3VD9A 1EDTA 2X1UA 3L65A 4P8UA 2YXOA 2CHRA 3O9NA 1TVPA 4ERGA 1OYAA 5G1MA 2C91A 3ARSA 2YKKA 3KL0A 4DWSB 1R8LA 1C3FA 3CUJA 3EUB3 3FXYA 1GV4A 1MW3A 4BQ4A 3LQLA 3NM3A 2AAMA 3DHFA 3QV7A 3W25A 3DI1A 1A47A 3IUDA 3S6TA 3EOEA 4GUJA 2E9MA 4PUEA 1SB3B 5D4YA 4L4PA 5LNRA 2OELA 4GI9A 3OPSA 1A0DA 5IM51 3L4ZA 3WJYA 2AQOA 3W75A 2VFGA 3EX2A 3G0XA 1FH9A 3MZNA 4XKYA 5KINA 3C0LA 3QW4B 4P8WA 2GFTA 1XLCA 3PTDA 4D8AA 3AXKA 2E6FA 3T4WA 3WQOA 2BOFX 2X16A 3NQ2A 1IWBA 1VPXA 1SMDA 4ACZA 3OQ8A 1JCJA 1VCGA 1DKWA 3AIQA 3E2VA 4AD0A 3OLIA 3HO8A 2PDYA 4J56A 4NU7A 3TYCA 1ZAIA 4A3YA 4ZGYA 3K4AA 3GNRA 4HCHA 1B3YA 3GH5A 1XC4A 3UPMA 1K1DA 1QPQA 3AIEA 1TTIA 3VIOA 1RXOB 3AS0A 1TVLA 4R9XA 4H01A 3PZMA 2E5BA 1SSDA 3W7NA 4NNBA 3PVFA 1VPQA 1MFUA 1VFOA 3ITTA 2VUYA 3CZLA 3NYZA 3RYSA 1I2OA 3EA3A 3C2OA 3HV9A 4C6KA 2QGYA 4PMXA 2WPBA 3WF1A 3ARWA 2AL1A 3AU2A 3U57A 3WF2A 1QR7A 1AW2A 5JVLA 1XFBA 1GRBA 1TFVA 3ANUA 2Z1WA 2QDHA 4DYJA 3STGA 3ZVHB 3EX6A 1RSCA 4Q4OA 2OU4A 3VIHA 1T99A 1O5RA 1JPIA 3R0UA 5CGMA 4GCXA 1FFRA 3S5OA 5H2ZA 5JCNA 4HMEA 1LJYA 4R34A 3UPWA 1RPKA 5FACA 3VXGA 3LDVA 1RALA 1C7SA 3WH8A 3MP5A 1MDRA 2FTYA 3PAOA 4N6FA 2NSXA 3RAOA 3GVWA 1P6BA 1G4EA 1G4PA 2FFCA 3V36A 5FKYA 3S5YA 3QZEA 2YIHA 1DWHM 1ZCCA 5BXTA 1DJQA 4NJKA 1IXOA 4DNMA 3P60A 2A1YA 3NCOA 4JKMA 3H23A 1T5AA 3BL3A 4D6DA 3AYTA 3C61A 4XIAA 5G1TA 4GI6A 7XIMA 1I2RA 4LEFA 2W5FA 1R0MA 4HYWA 2VUNA 4G1NA 3CH0A 2GVLA 4X0VA 3EOLA 3HG2A 4ZXLA 1F3EA 3LLFA 3CAQA 3M9YA 4LGXA 1PB0A 2DY3A 3ONBA 3NO1A 1VFFA 1T0OA 4HU8A 3FHQA 5AHEA 4ZOBA 1V59A 1E4LA 3DH7A 1BYBA 1R7AA 1DJNA 3B8IA 4O4VA 2XH4A 4PUDA 1TE1A 1V02E 1TWWA 3GLCA 1B4EA 1P5BA 4LVAA 5FEXA 5AVHA 3OIXA 3LZ5A 3TN5A 2GJXA 1MI3A 5HMSA 3LCWA 1H62A 4GISA 4DUOA 2AL2B 3EB3A 4UTUA 1PWLA 4WSJA 3UG4A 3CAKA 1K4QA 3K8KA 2ZZBA 1KXHA 2WB5A 1LBLA 3H2OA 1Q66A 3N2TA 1ADOA 5L9FA 1OCBA 4UTHA 1XYAA 1MZRA 1FWNA 4MFDA 3QGVA 4WVXA 3DI0A 2IS7A 1VIZA 4XAYA 1BG4A 3GW0A 2NX9A 2A8XA 3M5XA 3L5OA 4BQ3A 2BG5A 3WQ4A 2OWWA 3BAKA 3W2JA 3HJEA 2JKEA 1VGAA 1XPYA 3FG2P 1WB0A 3TMLA 4W89A 3RFAA 4R27A 1XHCA 1CX9A 4ZQCA 3O6YX 5CAHA 1JVNA 5CPMA 1SO3A 2E3ZA 4FO4A 5CSSA 1W1B1 4LCSA 2HXUA 3MUZ1 2AKZA 4KPRA 1GVYA 2VX4A 5KETA 3INPA 4GFIA 1QPOA 2AMXA 1EOMA 4J57A 3SSZA 3LLXA 2WVTA 2PDQA 3IVUA 1E9YB 1N62C 3ZT5A 2Z24A 3BJFA 4XQ6A 2YCKX 4Y8FA 3S1WA 4M8UA 3KOZA 1J0KA 4ICMA 4WDUA 4CEUC 3BAJA 1QAPA 1UJQA 4YTUA 1WAUA 4FNPA 1RJPA 4HMDA 2O7QA 3G1AA 7REQA 1YNQA 4Z2JA 1RCXB 1KRAC 5FF3A 4A05A 1GYLA 1MSSA 1OK6A 1HJUA 4LC6A 1M1BA 2ZZ1A 4QG8A 2DJXA 3PBGA 4MWAD 3MUCA 4GQBA 4B2DA 2V5CA 3MU7A 3H2FA 4JEQA 5KVIA 5CC6A 1F6KA 1H3GA 3LM3A 4A29A 3W76A 3TW7A 1PZ1A 3H2NA 1QI5A 3W71A 1PE1A 4KEVA 2DUAA 1KGXA 1GRGA 4NZJA 4GVFA 5BOEA 4QLLA 3SJNA 6A3HA 1Q6LA 4RUBA 4IG2A 1OGGA 5HQLA 4ZB0A 4PCFA 3S1XA 5KZ6A 5FS6A 3N2OA 5D32A 1IZJA 1ZY8A 4NX0A 3MCOA 2HEJA 3MHGA 4AAJA 1EQPA 3F4DA 4UQCA 2FPYA 3D6NA 1W3HA 4HNVA 2C1GA 4ZB2A 1KTNA 5G2HA 3TN3A 3MUY1 3GDKA 4TX8A 3NQAA 4WOZA 4AXKA 3EWZA 5F4XA 5A2CA 3C0QA 1Q6CA 1AW1A 3WCZA 3B8VA 2WP6A 1V97A 3QSRA 4MG4A 1BGAA 4EXQA 4AYGA 2ZXDA 5H6HA 1Q6QA 4V1XA 3VGHA 3LZ3A 1ITCA 3RIKA 4PEEA 2L5HA 1Q45A 3NM1A 2YCEA 4DNHA 3MMTA 3GG7A 1B90A 4LT9A 1H6VA 1VR6A 1OD8A 1UIPA 3N9RA 1FWRA 1YTDA 3TYDA 4MJZA 5EFFA 5XINA 1FWGC 4KBXA 2BVWA 3FFSA 3GBEA 6ALDA 1PV8A 2VENA 3NVWB 4DXXA 5TAOA 1ZP4A 2X1SA 3N34A 3WG6A 3E1F1 3O3RA 1W3NA 3B9OA 4PMQA 3CUFA 4IICA 1R3YA 1I1WA 1WXYA 5BOFA 1UWRA 2XGIA 3M44A 3UEQA 1BRLB 1U22A 2FDSA 2NQ5A 4FNTA 1F73A 3VX0A 2HPMA 2VZOA 3LCIA 2O9OA 2WMKA 2Y85A 2I5QA 1HZYA 1FECA 1KRMA 1JZ5A 4Y9MA 2EPMX 2EQ7A 3CIXA 1PIIA 3WQDA 3USBA 1AMYA 2FLIA 4JIEA 3APGA 3LN3A 4KS0A 3V16A 3AIRA 2C3DA 3HA1A 2J66A 3A4AA 3NQ8A 3BCJA 1S5VA 5FF4A 4D6CA 5DBUA 3PBYA 4HZ7A 2GSHA 5IBXC 2FB3A 3L68A 3TOYA 1RVKA 2IQDA 4UTMA 3ZJ6A 4HPHA 4FOUA 1V77A 3UBPC 3WQ6A 3H24A 4R7OA 4NJJA 1RQHA 1CXKA 2XINA 4MB5A 1JPHA 1EQCA 2VDHA 3W28A 2A7NA 3IK2A 4W4QA 4A22A 2X30A 3NQDA 3AHTA 3TQVA 3IGSA 1TV5A 1UKQA 2D2GA 1DWFM 4GYJA 4HPJA 1POJA 2NQHA 3P0XA 4AWUA 2C6QA 1O66A 1UW9A 3WLPA 4BWLC 3C4UA 1DTUA 2OQHA 3THCA 5HNRA 2PUZA 4F9JA 4EPDC 4J40A 1UROA 2OX4A 1BXCA 3O05A 1XIHA 4A8IA 1GW1A 3SJ3A 3G1VA 1UH4A 4LJ3A 3VIPA 4HKPA 2JGQA 1TPWA 1W32A 1SFLA 2Q3OA 5E09A 1PCWA 3O8AA 3WMLA 1YIXA 2RHGA 3FW6A 3EOSA 1XQLA 3HG5A 3RX2A 2BSLA 2V30A 3S46A 5HWMA 1UMYA 3G18A 1U2YA 1ELSA 2XZ9A 1M7JA 4XO7A 2WZMA 4C5YA 4IUGA 4K39A 2CLOA 3KZPA 2CLLA 1X1ZA 1Q6DA 4RL3A 1KNWA 1LRTA 2E67A 4B5NA 4GUFA 5IXEA 3W2LA 3W7RA 3UW6A 3O7UA 2Y61A 2OLSA 3DG3A 3UQNA 1XLHA 2QAFA 3GXMA 4N9CA 3MT1A 1MUMA 4IIGA 1UD4A 2QCFA 4GUHA 3U2OA 1Q2RA 1NP2A 1C8QA 2PU1A 3ITLA 3P5YA 3VABA 5FEPA 2CBUA 1EEPA 3STEA 3ZLGA 4C6DA 4FLSA 3CUGA 1OSEA 3LPFA 3A12A 2CPUA 4WQ6A 5JXQA 3AFBA 4FX7A 2GJLA 3WLKX 3IEBA 4K7ZA 3WEOA 4JCLA 3SY1A 1W91A 1M6JA 3ARRA 3EA2A 5CPQA 2V2DA 1WBJA 2W3SA 3ICJA 2NX3A 1EHAA 3RRXA 4P8XA 1SZNA 3BANA 4UFIA 1S2CA 1XLFA 3CMGA 3EANA 1GQLA 3T78A 1F3WA 3D46A 3ZVIA 1EJUC 3W7IA 2Q09A 1EH9A 2BOGX 1OCNA 2R1PA 1VFMA 3LU2A 2XVNA 3SUVA 4N02A 1SUXA 1QOPA 2W79A 1F05A 2PGFA 4ZTXA 3BGAA 3I6RA 3FYYA 3ALFA 3ITOA 3VIMA 2PDPA 3PC0A 1O7AA 2R91A 3I4KA 3LM7A 5FEZA 4MY8A 3BG9A 5D2YA 1P0KA 1G9HA 3QLDA 2VM8A 3CASA 3WUEA 3RK8A 1M41A 3FYOA 4QJ4B 3ZMRA 2PMQA 1GQJA 4NNCA 1HIZA 2HPIA 3QQ0A 3LXBA 2X8CA 1GOXA 4O17A 1NPXA 2WBGA 1QNQA 1F3PA 2RH9A 4J2MA 4L9YA 2DZVA 4CD8A 5EPDA 4AVNA 4DBDA 4C6PA 4TTGA 1B3ZA 4J3VA 5GRTA 1Q7ZA 1XSIA 1WP6A 2PDJA 1XRVA 3QRHA 1FXPA 4Z2HA 2F7FA 3ANVA 3QFWA 1US3A 3GY1A 4XISA 3WIJA 1QOXA 3PZGA 3PS7A 1BG9A 4D6FA 1L0PA 1D2KA 5E93A 3SRFA 4AMCA 1K6AA 3CO8A 4JTRA 4UR9A 4HCDA 4B4HA 3Q6JA 4DXVA 1F2JA 3W26A 3SGUA 3WUFA 3ZSTA 3ARXA 2VDIA 5CGQA 1J10A 4MKSA 2TSYA 2XZ7A 2YYUA 3FHAA 2HQAA 3SQMA 2DSZA 4HP5A 2HS6A 2QDDA 3GQYA 2GQ8A 2Y0FA 1ZK7A 2NXIA 3W00A 1OG0A 3QH2A 2Q71A 1A5KC 4DJEC 4BI6A 3TUUA 4LAMA 3M0YA 2WHLA 4FLOA 1UB3A 2BFGA 3EMCA 5D09A 1BWLA 1KM5A 2V3GA 1MUCA 3ABQA 3STCA 2WOIA 4IPPA 1MW1A 3C0JA 4FF5A 4WSKA 1TRDA 2J9XA 3NURA 5D33A 1E9LA 2CWNA 4U5IA 4H4PA 4FIRA 1V6WA 3NQVA 3CPGA 3FEMA 2XH2A 1S2UA 4CLMA 2YLAA 2EPNA 1GOQA 3LHWA 2RABA 1UR9A 1RP9A 4GYPC 1GHRA 4C1KA 2HCVA 4K37A 2D20A 3HPXA 4MNLA 1TWDA 3WD3A 1UCWA 2PWHA 2PU0A 2ZUUA 3M0KA 3NFUA 3SB0A 2ANUA 2FYMA 2JE8A 4JFTA 3MKKA 4HTBA 5CPLA 1J93A 4TVYA 2CEQA 1R7OA 2WWDA 3MZ2A 2WOQA 3T0CA 1P48A 5D8WA 1NQ6A 2A4AA 3IWPA 3OZPA 1GVEA 2HSAA 4UR8A 3RLHA 3CWOX 2ZA2A 3L4TA 5HDRA 4IL0A 2B7OA 2XFFA 3VOHA 4IP4A 3WY1A 4PA8A 1YHTA 5F1UA 3R7MA 5REQB 1DE6A 2PB1A 8A3HA 2E25A 2OO6A 4KCWA 1GVSA 3IVTA 3TWAA 1N5XA 1AOGA 5EA9A 3MDWA 4G7EA 3AXMA 1XIBA 3SCTA 1Q6OA 3WQWA 5BWAA 2R9ZA 4AD4A 4GO9A 1G94A 1JXJA 4AB4A 1O94A 4PFMA 5KITA 1JZ3A 1BYCA 3WJSA 3BZJA 3LNPA 4H4TA 2YA2A 1O95A 4C7GA 2ZRXA 3ARPA 3VMOA 1H7WA 3W2KA 2RDUA 3XISA 1Q3NA 1EUAA 1WXZA 4ASTA 3PK7A 4HA0A 2PE4A 4NJHA 1RD5A 4XTDA 1Q1RA 4L65A 2BCPA 4QIUA 3NVVB 1KD0A 3UJSA 3L5LA 3SFKA 2E1DA 2QJGA 4TV6A 1QRQA 4EMWA 4PEKA 4XBJA 3WNKA 5HATA 3A13A 3GDTA 2C3CA 2ATSA 4M51A 3WNMA 5BRBA 4WJXA 3E5BA 3T2OA 1WKEA 1VB9A 3IPWA 4DLMA 1S1RA 4XB3A 4O1BA 3FIGA 2FZ9A 1DE5A 3NEVA 2ISWA 5D05A 2B7PA 3B8SA 2QDEA 2CKRA 4W9TA 3PPHA 1SJDA 3AN1A 4E8GA 3G0SA 4LB3A 5C9RA 3W7KA 4DELA 1OT1A 3DG7A 3TX9A 2Y5JA 4QDMA 3VCRA 2O92A 1H61A 3MCNA 1PX8A 1UR8A 2D3NA 3OOQA 8CGTA 2OVLA 2ALRA 1QW7A 4A8RA 3BLPX 4ADUA 4GZEA 5CZJA 3NUKA 4M52A 2OGYA 4GY1A 2P5NA 3WUBA 3I4EA 1Y5WA 1YPFA 4AW7A 3HG3A 3DUGA 4JR5A 2PGRA 1KM2A 5AKQA 1J12A 4Z0JA 3GRTA 2D22A 1KCKA 5J8LA 5FJPA 1HVXA 1H11A 3WH6A 2VXNA 3DEQA 1LWJA 3H4XA 4MUPA 1TG7A 2AKMA 2ACUA 4PSPA 2ZICA 5ABHA 4BKNA 4UFMA 1YQ2A 1SO6A 1XLJA 3EWBX 4S23A 1OX4B 4LUTA 1JAKA 2YDRA 4JIQA 1W6TA 3MY9A 1E40A 4XTIA 1I1XA 1UBSA 4TQTA 1EL3A 2G4FA 1LWHA 3MJMA 2WC7A 4ZO7A 5LNVA 1K9DA 2FMOA 4C65A 3FSTA 3GDMA 3GNNA 4JQ3A 1NIUA 4JFSA 1EZ2A 4J1OA 3KFTA 1OY0A 2ZZ0A 5AYBA 3UWVA 5D9NA 1W2PA 4PUWA 1R3TA 3WENA 3S8HA 1SFTA 4IGHA 3ES8A 3UR8A 1I2PA 1W54A 3I6TA 2GR0A 1NQKA 4BR1A 4OBTA 4LY8A 2WSYA 1RQBA 1H09A 1Q85A 1EDQA 2WVSA 2FH8A 1ZQ5A 4Q4KA 5FD0A 3QYQA 3QGAC 3NL6A 3HF3A 3UA4A 1TPVA 1JEHA 2PLCA 3UG5A 4PRTA 1FCUA 3PSWA 4MTVA 2VEPA 3GHTA 1EO7A 4LFYA 3AICA 1WE5A 2B7NA 3AROA 1D9EA 2LLEA 5EMLA 1PYMA 3L9CA 1M7OA 1MW0A 5C7HA 4IMAA 2NWSA 3M0XA 3HPSA 3M5ZA 3NQEA 3ITYA 3PJWA 3OVQA 4IIDA 1IEXA 3E2RA 2HZGA 3IJ7A 3BSHA 3H2MA 3D9XA 3QBUA 2HVMA 2Z1XA 1AW5A 1GREA 4GI4A 3PZUA 1C91A 4OWGA 3B0PA 3SQPA 1QOQA 2TMDA 2BHYA 1O1ZA 2FTWA 3C2EA 2BXYA 3C2RA 1Z44A 1XYBA 4C60A 1M65A 3TTEA 3TAOA 1JCMP 3W74A 4OV4A 3GX9A 3GFYA 2ZUNA 5I77A 5GNZA 2YVGA 3GKAA 1K8XA 1HKKA 3B03A 3SQSA 1OCQA 3SRKA 2DSUA 2XIJA 3FY1A 1NOFA 1JRCA 4AVFA 1WZLA 3IS4A 2H90A 4LWWA 1W9UA 1ZBWA 4QISA 5I02A 4JQ1A 5DMYA 4L56A 4NZ4A 1TR9A 1GZGA 2VX6A 4EF8A 4CCDA 1IIHA 2ISDA 4RW3A 3DAQA 2D0HA 1K9TA 4K8EA 2C3ZA 4OBRA 4TVUA 4LUYA 4RR4A 1XDMA 3W22A 1ONEA 5C55A 2R6OA 3AXHA 3PZNA 4YIWA 4OGZA 1PKMA 1BGGA 1JCLA 4JDYA 3TR2A 2PLJA 4J7RA 1JR1A 1ZENA 5I3GA 3KVMA 1YDOA 2BY1A 4HPXA 1J6OA 1DV7A 3AJ7A 3GAKA 1XGZA 2YW4A 1UZ1A 2ZCGA 3T0DA 3L0GA 1PSCA 3NPXA 1HN1A 3CHCA 5CZSA 3GXIA 5FL1A 4US5D 2WZHA 4GO8A 3THQA 1DQXA 1AODA 2C8NA 2HE8A 4LUSA 2QPXA 3TYUA 1FWJC 3I65A 3EF6A 2DORA 1IWPA 3N2XA 4HK5A 4PB4A 2YL5A 3EA1A 5FOOA 3AQUA 4C5ZA 5D2WA 4GD0A 1Z42A 3NO3A 3N29A 3AIUA 3PTQA 5E1QA 3WD2A 4CNOA 4RJEA 3AISA 4NNAA 1E5NA 3AMGA 4FHAA 1T6MA 2EQ9A 1H2IA 1RR2A 5FS7A 4HK7A 3BPWA 3NS1B 1J0JA 2ZX6A 2VOTA 1JFXA 1FCQA 3OLDA 3PNZA 2WCGA 1YLVA 3CB8A 3U6WA 1QO5A 2W66A 3Q4DA 3NL3A 2PF0A 1HTIA 3AIBA 3K30A 4J35A 3QFBA 2YDSA 2ZQ0A 4H6EA 2V5KA 1ESWA 3AM9A 1QBAA 4Q8TA 3SN4A 4UCGA 2WPCA 3REQB 1EHNA 1JZ2A 2WCAA 3VNJA 4U33A 2Y7FA 5A6TC 2YA0A 4E2DA 5AN7A 4H4IA 3THUA 2G96A 3CK5A 3T81A 3FSUA 5DANA 3FCPA 4UZUA 1WXJA 4GE8A 3BQ6A 3QJAA 4H8VA 4BQ2A 4HA4A 3EAUA 4DM1A 3W84A 1MWOA 3AWNA 1YE4A 1D7KA 1N2VA 3C2VA 1JDCA 2PC4A 3C56A 3CIVA 2DW7A 3F4NA 4LS1A 2GH5A 3GXTA 2WMJA 1B31A 5I03A 1VLWA 4CCCA 5DXYA 1GJPA 3TW9A 2RAGA 1VEMA 4XKYB 1TWZA 5BCAA 1GERA 4U4MA 3W01A 4JX5A 2V3FA 4AWEA 1XANA 3BAYA 2SFPA 1M5WA 2TYSA 1UP0A 2DZTA 3F4VA 4ACZB 4U5KA 3AUOA 3SM0A 3LQGA 1R3QA 3WDRA 3CPRA 4ZL1A 2ZA3A 1WZAA 2DZBA 1XR2A 3QV9A 4M6PA 3EMQA 4AC7C 4GHRA 1TELA 2V67A 4DJFC 4B5TA 3DGRA 5BWFA 4RPPA 2PWEA 2FQIA 3WQFA 2UY2A 1H41A 1EJ7L 1EEXA 5CCZA 1X96A 4XAZA 3ABOA 1LRQA 4WR3A 1A4LA 1JD7A 2F6KA 4DWDA 3W7QA 1OC5A 1GOIA 5G4EA 2GGGA 5AHMA 2BODX 4MNJA 4M1RA 1ZU8A 4HJFA 5HA7A 4YWOA 3S0CA 3DJGX 4LNYA 2QUTA 1MEIA 8TIMA 3I7RA 2IKHA 2C7FA 4GI8A 4KCVA 5D9OA 1NOUA 2NV9A 3GD4A 4IFKA 5HR7A 5HJYA 4EX4A 4DZAA 4J3SA 2PLKA 1XHGA 1E0XA 5T91A 2E6DA 3MHFA 1L9WA 4NY2A 3OHIA 1SO5A 3E38A 2F84A 6PTDA 1XG3A 3VMPA 4DPPA 3S9ZA 4PN2A 2PRHA 4EP8C 1EYWA 2ZIDA 1DJXA 4KFPA 2TPSA 3PWAA 2ZUVA 4UOZA 1WNOA 5M2FX 2OOFA 3L4WA 1FXQA 3MPGA 1TE6A 1J96A 3KBJA 1SZGA 3QN3A 2TPRA 3N17A 2VP8A 2OEMA 3SUTA 3HRDC 5GVJA 4LA1A 4GH3A 1ONFA 5CLTA 1US2A 2OLAA 4IHCA 1W5OA 3EX4A 2J13A 1XKJA 3KBMA 2IXVA 3B8TA 1E9ZB 1CWYA 1X6NA 4KT2A 3BLOA 5F1VA 1ZDLA 3AYVA 4INFA 4MWAA 1IEIA 3VNYA 3V75A 3NQBA 5ECVA 3I3BA 5GJNA 3MUXA 3LENA 1Q8JA 1X7FA 5JRBA 2X2GA 4HU3A 3KL3A 4ZO6A 2Y8VA 3DGHA 4HYRA 2G8ZA 2YBTA 5IBXA 3N04A 4UTIA 4ZE5A 4DO5A 4QE5A 1DHKA 5IRPA 5C70A 3VKDA 2GJXB 3CL7A 3T7VA 3U7VA 4AEFA 2QV5A 4DN1A 4MFEA 4GIAA 1L6GA 4K3ZA