1MDUA

Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (gs-1)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
VVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an F-actin trimer disrupted by gelsolin and implications for the mechanism of severing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords gelsolin precursor
total genus 39
structure length 124
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1mduA00
2KVKA 5KYXA 3EFOA 2FH3A 4LIZA 1V6FA 2LJ8A 2FGHA 1NM1G 1T2LA 4S10C 1VFQA 1P8ZG 1J72A 1M2VB 5KYWA 1M2OA 3DAWB 3A5OS 2FH1A 3L50A 1COFA 1SVQA 1TVJA 1H1VG 1VKKA 2VACA 2FF3A 1YAGG 2I2QA 2LXXA 2NUTA 5KYUA 3EGXA 5KYYA 1WNJA 4KEFA 2D8BA 2MOTA 1CNUA 1ESVS 5HVKD 1YVNG 5L6WC 3FFKA 1D0NA 2W0IA 1WM4A 5A1MA 3EFOB 3FFNA 1MDUA 4KEEA 1P8XA 1AK7A 1CFYA 1WFSA 3EH1A 1NMDG 1M2VA 3EG9B 4JD2H 5IVUA 2QTVA 2FH4A 5FAFA 2VIKA 1T3XA 1T44G 1PD1A 1T3YA 1TMWA 1AK6A 2NUPA 1PCXA 1SVRA 3CI5G 1KCQA 1RGIG 5KYUB 3EGDB 1X67A 1Q8GA 3A5LS 5HVKB 1D4XG 3A5NS 1AHQA 1DEJS 3FG7A 3A5MS 4PKHB 5KYNA 5KYXB 1F7SA 2L72A 3EG9A 5FAEA 4PKGG 1NLVG 2FH2A 1C0FS 2XFAA 1PD0A 4CBWG 4BEX1 2XF1A 4KEDA 3EH2A 1NPHA 5KYWB 3CJBG 1Q8XA 2MP4A 2NUPB 4Z94G 2MV2A 3CJCG 1JHWA 1UDMA 2HD7A 2LLFA 1C0GS 3EGDA 3FG6A 1QPVA 4CBUG 2VILA 4PKIG 4CBXG 3TU5B 3CIPG 3Q2BA 5DD2A 2NUTB 1HQZ1 2FF6G 1SVYA 3EGXB 5KYYB 1M4JA 1EQYS
chains in the Genus database with same CATH superfamily
2KVKA 5KYXA 3EFOA 2FH3A 4LIZA 1V6FA 2LJ8A 2FGHA 1NM1G 1T2LA 4S10C 1VFQA 1P8ZG 1J72A 1M2VB 5KYWA 1M2OA 3DAWB 3A5OS 2FH1A 3L50A 1COFA 1SVQA 1TVJA 1H1VG 1VKKA 2VACA 2FF3A 1YAGG 2I2QA 2LXXA 2NUTA 5KYUA 3EGXA 5KYYA 1WNJA 4KEFA 2D8BA 2MOTA 1CNUA 1ESVS 5HVKD 1YVNG 5L6WC 3FFKA 1D0NA 2W0IA 1WM4A 5A1MA 3DA7A 3EFOB 1MDUA 3FFNA 4KEEA 1P8XA 1AK7A 1CFYA 1WFSA 3EH1A 1NMDG 1M2VA 3EG9B 4JD2H 5IVUA 2QTVA 2FH4A 5FAFA 2VIKA 1T3XA 1T44G 1PD1A 1T3YA 1TMWA 1AK6A 2NUPA 1PCXA 1SVRA 3CI5G 1KCQA 1RGIG 5KYUB 3EGDB 1X67A 1Q8GA 3A5LS 5HVKB 1D4XG 3A5NS 1AHQA 1DEJS 3FG7A 3A5MS 4PKHB 5KYNA 5KYXB 1F7SA 2L72A 3EG9A 5FAEA 4PKGG 1NLVG 2FH2A 1C0FS 2XFAA 1PD0A 4CBWG 4BEX1 2XF1A 4KEDA 3EH2A 1NPHA 5KYWB 3CJBG 1Q8XA 2MP4A 2NUPB 4Z94G 2MV2A 3CJCG 1JHWA 1UDMA 2HD7A 2LLFA 1C0GS 3EGDA 3FG6A 1QPVA 4CBUG 2VILA 4PKIG 4CBXG 3TU5B 3CIPG 3Q2BA 5DD2A 2NUTB 1HQZ1 2FF6G 1SVYA 3EGXB 5KYYB 1M4JA 1EQYS
chains in the Genus database with same CATH topology
2KVKA 5KYXA 3EFOA 2FH3A 4LIZA 1V6FA 2LJ8A 2FGHA 1NM1G 1T2LA 4S10C 1VFQA 1P8ZG 1J72A 1M2VB 5KYWA 1M2OA 3DAWB 3A5OS 2FH1A 3L50A 1COFA 1SVQA 1TVJA 1H1VG 1VKKA 2VACA 2FF3A 1YAGG 2I2QA 2LXXA 2NUTA 5KYUA 3EGXA 5KYYA 1WNJA 4KEFA 2D8BA 2MOTA 1CNUA 1ESVS 5HVKD 1YVNG 5L6WC 3FFKA 1D0NA 2W0IA 1WM4A 5A1MA 3DA7A 3EFOB 1MDUA 3FFNA 4KEEA 1P8XA 1AK7A 1CFYA 1WFSA 3EH1A 1NMDG 1M2VA 3EG9B 4JD2H 5IVUA 2QTVA 2FH4A 5FAFA 2VIKA 1T3XA 1T44G 1PD1A 1T3YA 1TMWA 1AK6A 2NUPA 1PCXA 1SVRA 3CI5G 1KCQA 1RGIG 5KYUB 3EGDB 1X67A 1Q8GA 3A5LS 5HVKB 1D4XG 3A5NS 1AHQA 1DEJS 3FG7A 3A5MS 4PKHB 5KYNA 5KYXB 1F7SA 2L72A 3EG9A 5FAEA 4PKGG 1NLVG 2FH2A 1C0FS 2XFAA 1PD0A 4CBWG 4BEX1 2XF1A 4KEDA 3EH2A 1NPHA 5KYWB 3CJBG 1Q8XA 2MP4A 2NUPB 4Z94G 2MV2A 3CJCG 1JHWA 1UDMA 2HD7A 2LLFA 1C0GS 3EGDA 3FG6A 1QPVA 4CBUG 2VILA 4PKIG 4CBXG 3TU5B 3CIPG 3Q2BA 5DD2A 2NUTB 1HQZ1 2FF6G 1SVYA 3EGXB 5KYYB 1M4JA 1EQYS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVK A;  5KYX A;  3EFO A;  2FH3 A;  4LIZ A;  1V6F A;  2LJ8 A;  2FGH A;  1NM1 G;  1T2L A;  4S10 C;  1VFQ A;  1P8Z G;  1J72 A;  1M2V B;  5KYW A;  1M2O A;  3DAW B;  3A5O S;  2FH1 A;  3L50 A;  1COF A;  1SVQ A;  1TVJ A;  1H1V G;  1VKK A;  2VAC A;  2FF3 A;  1YAG G;  2I2Q A;  2LXX A;  2NUT A;  5KYU A;  3EGX A;  5KYY A;  1WNJ A;  4KEF A;  2D8B A;  2MOT A;  1CNU A;  1ESV S;  5HVK D;  1YVN G;  5L6W C;  3FFK A;  1D0N A;  2W0I A;  1WM4 A;  5A1M A;  3EFO B;  3FFN A;  1MDU A;  4KEE A;  1P8X A;  1AK7 A;  1CFY A;  1WFS A;  3EH1 A;  1NMD G;  1M2V A;  3EG9 B;  4JD2 H;  5IVU A;  2QTV A;  2FH4 A;  5FAF A;  2VIK A;  1T3X A;  1T44 G;  1PD1 A;  1T3Y A;  1TMW A;  1AK6 A;  2NUP A;  1PCX A;  1SVR A;  3CI5 G;  1KCQ A;  1RGI G;  5KYU B;  3EGD B;  1X67 A;  1Q8G A;  3A5L S;  5HVK B;  1D4X G;  3A5N S;  1AHQ A;  1DEJ S;  3FG7 A;  3A5M S;  4PKH B;  5KYN A;  5KYX B;  1F7S A;  2L72 A;  3EG9 A;  5FAE A;  4PKG G;  1NLV G;  2FH2 A;  1C0F S;  2XFA A;  1PD0 A;  4CBW G;  4BEX 1;  2XF1 A;  4KED A;  3EH2 A;  1NPH A;  5KYW B;  3CJB G;  1Q8X A;  2MP4 A;  2NUP B;  4Z94 G;  2MV2 A;  3CJC G;  1JHW A;  1UDM A;  2HD7 A;  2LLF A;  1C0G S;  3EGD A;  3FG6 A;  1QPV A;  4CBU G;  2VIL A;  4PKI G;  4CBX G;  3TU5 B;  3CIP G;  3Q2B A;  5DD2 A;  2NUT B;  1HQZ 1;  2FF6 G;  1SVY A;  3EGX B;  5KYY B;  1M4J A;  1EQY S; 
#chains in the Genus database with same CATH topology
 2KVK A;  5KYX A;  3EFO A;  2FH3 A;  4LIZ A;  1V6F A;  2LJ8 A;  2FGH A;  1NM1 G;  1T2L A;  4S10 C;  1VFQ A;  1P8Z G;  1J72 A;  1M2V B;  5KYW A;  1M2O A;  3DAW B;  3A5O S;  2FH1 A;  3L50 A;  1COF A;  1SVQ A;  1TVJ A;  1H1V G;  1VKK A;  2VAC A;  2FF3 A;  1YAG G;  2I2Q A;  2LXX A;  2NUT A;  5KYU A;  3EGX A;  5KYY A;  1WNJ A;  4KEF A;  2D8B A;  2MOT A;  1CNU A;  1ESV S;  5HVK D;  1YVN G;  5L6W C;  3FFK A;  1D0N A;  2W0I A;  1WM4 A;  5A1M A;  3DA7 A;  3EFO B;  1MDU A;  3FFN A;  4KEE A;  1P8X A;  1AK7 A;  1CFY A;  1WFS A;  3EH1 A;  1NMD G;  1M2V A;  3EG9 B;  4JD2 H;  5IVU A;  2QTV A;  2FH4 A;  5FAF A;  2VIK A;  1T3X A;  1T44 G;  1PD1 A;  1T3Y A;  1TMW A;  1AK6 A;  2NUP A;  1PCX A;  1SVR A;  3CI5 G;  1KCQ A;  1RGI G;  5KYU B;  3EGD B;  1X67 A;  1Q8G A;  3A5L S;  5HVK B;  1D4X G;  3A5N S;  1AHQ A;  1DEJ S;  3FG7 A;  3A5M S;  4PKH B;  5KYN A;  5KYX B;  1F7S A;  2L72 A;  3EG9 A;  5FAE A;  4PKG G;  1NLV G;  2FH2 A;  1C0F S;  2XFA A;  1PD0 A;  4CBW G;  4BEX 1;  2XF1 A;  4KED A;  3EH2 A;  1NPH A;  5KYW B;  3CJB G;  1Q8X A;  2MP4 A;  2NUP B;  4Z94 G;  2MV2 A;  3CJC G;  1JHW A;  1UDM A;  2HD7 A;  2LLF A;  1C0G S;  3EGD A;  3FG6 A;  1QPV A;  4CBU G;  2VIL A;  4PKI G;  4CBX G;  3TU5 B;  3CIP G;  3Q2B A;  5DD2 A;  2NUT B;  1HQZ 1;  2FF6 G;  1SVY A;  3EGX B;  5KYY B;  1M4J A;  1EQY S; 
#chains in the Genus database with same CATH homology
 2KVK A;  5KYX A;  3EFO A;  2FH3 A;  4LIZ A;  1V6F A;  2LJ8 A;  2FGH A;  1NM1 G;  1T2L A;  4S10 C;  1VFQ A;  1P8Z G;  1J72 A;  1M2V B;  5KYW A;  1M2O A;  3DAW B;  3A5O S;  2FH1 A;  3L50 A;  1COF A;  1SVQ A;  1TVJ A;  1H1V G;  1VKK A;  2VAC A;  2FF3 A;  1YAG G;  2I2Q A;  2LXX A;  2NUT A;  5KYU A;  3EGX A;  5KYY A;  1WNJ A;  4KEF A;  2D8B A;  2MOT A;  1CNU A;  1ESV S;  5HVK D;  1YVN G;  5L6W C;  3FFK A;  1D0N A;  2W0I A;  1WM4 A;  5A1M A;  3DA7 A;  3EFO B;  1MDU A;  3FFN A;  4KEE A;  1P8X A;  1AK7 A;  1CFY A;  1WFS A;  3EH1 A;  1NMD G;  1M2V A;  3EG9 B;  4JD2 H;  5IVU A;  2QTV A;  2FH4 A;  5FAF A;  2VIK A;  1T3X A;  1T44 G;  1PD1 A;  1T3Y A;  1TMW A;  1AK6 A;  2NUP A;  1PCX A;  1SVR A;  3CI5 G;  1KCQ A;  1RGI G;  5KYU B;  3EGD B;  1X67 A;  1Q8G A;  3A5L S;  5HVK B;  1D4X G;  3A5N S;  1AHQ A;  1DEJ S;  3FG7 A;  3A5M S;  4PKH B;  5KYN A;  5KYX B;  1F7S A;  2L72 A;  3EG9 A;  5FAE A;  4PKG G;  1NLV G;  2FH2 A;  1C0F S;  2XFA A;  1PD0 A;  4CBW G;  4BEX 1;  2XF1 A;  4KED A;  3EH2 A;  1NPH A;  5KYW B;  3CJB G;  1Q8X A;  2MP4 A;  2NUP B;  4Z94 G;  2MV2 A;  3CJC G;  1JHW A;  1UDM A;  2HD7 A;  2LLF A;  1C0G S;  3EGD A;  3FG6 A;  1QPV A;  4CBU G;  2VIL A;  4PKI G;  4CBX G;  3TU5 B;  3CIP G;  3Q2B A;  5DD2 A;  2NUT B;  1HQZ 1;  2FF6 G;  1SVY A;  3EGX B;  5KYY B;  1M4J A;  1EQY S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...