1MENA

Complex structure of human gar tfase and substrate beta-gar
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
RILVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human GAR Tfase of low and high pH and with substrate beta-GAR
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phosphoribosylglycinamide formyltransferase
total genus 61
structure length 201
sequence length 201
chains with identical sequence B, C
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2002-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1menA00
1RBYA 3DCJA 3GARA 1ZLYA 4NV1A 1YRWA 4TT8A 3W7BA 3AV3A 4EW2A 4ZYVA 1CDEA 1C3EA 3TQRA 4ZYUA 3OBIA 1S3IA 4ZZ2A 5J63A 2CFIA 4S1NA 1CDDA 5J9FA 1RC1A 1NJSA 4IQFA 1GARA 1RBQA 4PZUA 4QPCA 4YFVA 1C2TA 3KCQA 3N0VA 1ZLXA 1GRCA 1MEOA 1MEJA 4DS3A 3O1LA 2BW0A 4ZYWA 2FMTA 2GARA 1RBMA 3P9XA 1MENA 4TS4A 3AUFA 4ZZ0A 4R8VA 3LOUA 1ZGHA 4EW3A 4ZZ1A 1RBZA 1FMTA 4QPDA 3Q0IA 5CJJA 4ZYTA 1JKXA 4ZYYA 4ZZ3A 4EW1A 2BLNA 3DA8A 3TQQA 4ZYZA 4TTSA 4Q12A 4ZYXA 3R8XA 1RC0A 2YWRA 3NRBA 4YFYA
chains in the Genus database with same CATH superfamily
2BFEA 1P1CA 2XF2A 3TSWA 4F1KA 3WE7A 3TQSA 2A9VA 1I0ZA 2O07A 2I4TA 3BF8A 4HN2A 1VE6A 3EGDB 4ZEXA 3KB1A 4AK9A 4BO7A 2FE4A 1A7KA 3B7GA 3QWAA 4MKRA 3NHYA 4ALNA 4E33A 4S1WA 3WGHA 1EJ6A 2FMXA 3EXFA 3GCXA 4HAXA 1PR3A 3E0QA 4MV9A 3DDZX 2JJ1D 4JLBA 4IRUB 5AJVB 1UK9A 1MOZA 3QX7A 4FFVA 4G63A 2QVBA 5ALUA 2OV1A 1GZ3A 4JJ4A 1B00A 3VR5H 2FA9A 3IV6A 3O1IC 2RAUA 5JSQA 2BOVA 3UT5A 3TMAA 1VA5A 4NCBA 4RORA 4NBVA 1W88B 1EVIA 3G0IA 1I36A 4Y2TA 1QFXA 4L4SA 1CUYA 1COWA 2B1RA 3LWDA 4IFIA 1U3WA 1VGVA 2NYVA 4C21A 1CIVA 2IOQA 3H19A 3HZZA 3MS4A 2RB5A 4NVRA 4QDUA 3TW8A 4DCSA 1K7YA 3JD2A 3LM8A 4G07A 2Z6AA 3RS5A 4KSBA 4KPYA 1V16B 4DJTA 1NX6A 1POWA 1ZH8A 7REQB 2CXPA 3VI4B 1W0KD 4QRIA 5JNWA 1JHZA 4JHLA 2HJGA 4ZZIA 5E8RA 5BRAA 1G3IA 2VHEA 4LDQA 4UNNA 5DI9A 1P7ZA 1PJ4A 3PSAA 5HKAA 2IU4A 5LZ2A 4R9SA 1JG7A 3SLGA 1PGPA 3KR9A 2A9OA 3NATA 1VJ5A 2GBPA 4I81A 3Q7IA 1JZTA 2YTZA 3F5FA 4UM8B 5LYYA 3VJLA 1KEEA 1I01A 2OCXA 1H23A 3AP3A 4N39A 3B51X 2Z5LA 4IY1A 2ODTX 3EPKA 2XMRA 3KPJA 4QJBA 4M9RA 1XL0A 1TUBB 3TQRA 2G17A 3HL4A 2R1TB 4JB0A 2GF0A 4MW4A 4ZCSA 2NV0A 3FN4A 1KPIA 3OIWA 2Q4TA 2GPSA 3ADPA 3DT9A 2OUIA 4E12A 1T5BA 2QJWA 4N65A 3UT6A 1KOFA 2E6KA 3T54A 4IILA 5JYEA 5EKUA 2ETVA 3UJAA 5BN3A 1UBCA 4LPKA 2P90A 3E7XA 1DO0A 4KLNA 3ET5A 4WSOA 3UICA 3IO3A 3VKUA 1P4SA 3MTAA 4P4SB 1OAOC 1YBHA 3AL3A 3N8HA 2FUCA 2PSFA 2P7HA 3W3AH 5JXHA 2YV5A 3OEHD 3GNQA 1B8UA 4C0LA 4GOOD 1GZ6A 3OE1A 3PE3A 2BF4A 1A7JA 1GKIA 2ANBA 2R47A 2H17A 4WLOA 3AJEA 4F9FA 4F6LA 1IZ7A 2BFNA 4KN9S 3IR5A 4YV1A 1RTKA 2M1ZA 3FDJA 3KR1A 1LZLA 3E9CA 1D7AA 3HJCA 5EZYF 4HWPA 4BNVA 3RC7A 1VFNA 4RZIA 4YALA 2UUCB 1K7XB 3VX4A 2FPIB 1US8A 5MN4A 1A96A 1YNSA 3GLTA 4LXUA 3OIFA 1E58A 2JVKA 1FTSA 4UZFA 1X80B 4CEIA 2DERA 2ZSKA 4QM6A 3W3AA 3SNKA 4MQEB 5I7RA 4Y9TA 2IEGA 1E7YA 1OTYA 2GO7A 4OSPA 5CT8A 5IASA 3DCNA 3W34A 4YEDA 3TAUA 3A6JA 5HE9A 4H2DA 5KHLB 2ZIWB 1SY7A 1Y6RA 1K08A 3G2LA 3PNVA 1PJCA 3FOAA 3OTWA 1K68A 4L5AA 3BILA 4M1MA 1E5LA 1ZR4A 4P98A 2HHJA 4IIDA 3ZWQA 4XDYA 4UNRA 5EJGA 1Q91A 2C4HA 1LSJA 2HH9A 1IJEA 2H1WA 1Z0AA 2BDUA 3VOSA 3MTBA 3ZQ6A 4KL8S 3S4YA 1LU9A 2A35A 3A4TA 2AG1A 1W93A 1Z36A 1BJTA 1I0IA 2AHRA 1U9IA 5CNJA 2P62A 3TZEA 8ABPA 4Z2YA 4W5OA 5FFFA 2V97A 4FGJA 5JAMA 3QEAZ 4RMIA 1BD3A 1ZMBA 3Q8XB 4EHDA 1VHJA 1CDZA 2DHQA 3RC9A 2IIVA 5MDHA 5T57A 3THXB 2J07A 2F48A 2Q1WA 5G0UA 2WG1A 3TOCA 4J76A 2WKWA 1JFFA 2MT9A 1OV4A 1LPOA 1WHSB 3C8HA 4MMXB 5BSMA 2D1YA 3WYGA 3Q8LA 2GJSA 4PVCA 3PUXA 3NC0C 1ZCFA 4LSMA 5ALKA 3MILA 5ALDA 3AEKA 3TFWA 4GXQA 4AYWA 3QVGA 2V7WA 4FHFA 4DJFC 1FLAA 1Q7EA 1PS8A 1RWVA 1DJQA 3K20A 3WLNA 2BM9A 3HKEB 1TD9A 4K7JA 3DW1X 4QJIA 3GD5A 4ZODA 2ZZMA 4QGBA 4EJ6A 5BQFA 4Q19A 2MSLA 3ENVA 3IV7A 2G5CA 3PRYA 4LYEA 3WWCA 4COKA 4HUTA 1T8YA 1Q0QA 5CT9A 3R2JA 4BCDA 5ABPA 4H77A 1FDRA 1LBHA 3NNNA 5D3KA 2YWRA 4BQQA 4D5GA 2I6GA 4DM3A 1OA0A 2WLTA 1BX3A 1MRSA 3DQPA 2C2XA 4G25A 5IKMA 5LDHA 3UHFA 2EJWA 2JHAA 3W6UA 4AS1A 3TZBA 4G84A 3TKAA 2WWGA 1WD5A 3KOOA 3LCMA 4P4UA 2QMOA 1CYDA 4LSWA 7MDHA 1NN1A 4YAJA 4OV6B 2FV8A 3QLVA 1U4NA 3OSZA 1SC1A 3UMRA 1QO9A 3D43A 1W2WB 2XSZD 3R23A 1O9GA 3P4XA 4O3FA 2J3DA 2WPDD 4GWKA 4QJ5A 3VNVA 5GGYA 1D5WA 3PX3A 3ILVA 3THWA 3F7OA 1AA9A 4D4GA 2XDQA 5AMXA 2P9EA 2NAFA 1OT5A 2AYZA 4BWVA 1G8JA 2GFHA 3BF7A 5I9IA 1N34B 4AJIA 1X1QA 4X6LA 3MC1A 3V4FA 5LB2A 1CJSA 4QRDA 1LKZA 3S2ZA 4YHHB 1BRTA 4MIKA 1OY1A 2C61A 2X0FA 1O6GA 1V0JA 4A8JC 5K7SA 1M2OA 1DAHA 1IUKA 4K9SA 4QGSA 1AQ6A 1K4KA 1KEWA 3UJBA 3ENNA 1L4HA 4RJJA 1DXQA 4PC7A 4Y8VA 1IN8A 4S0ZA 1FFDA 5FQNA 4CDRA 4Z7JA 5ALYA 4X6XA 4LNAA 3ND6A 2BEUB 2I2CA 1J42A 2VUIB 1XZMA 5FXMA 3GBSA 2EXXA 5KEIA 2QQ5A 2BYTA 1Y7PA 5BNZA 2FFBA 3SC2B 1XU4A 5BWCA 1E59A 4LHYA 3UJ8A 1FP4A 2DQ4A 3HADA 4HSGA 3T9EA 3HI4A 1DFIA 1F3OA 3SVZA 1LDBA 1B41A 2FMIA 3QPAA 1EFCA 2LE0A 2CYAA 2HU2A 3BSWA 3KLPX 3ZIDA 1K8ZB 2FUNB 2TS1A 4L8FA 3NW9A 3L6OO 3BHJA 4W1SA 2YY5A 1MMFB 1UKZA 1WB4A 4JP5A 3C14C 3K15A 4AXBA 2O06A 2B3TA 1Y8QB 3U48A 3W9YA 2ZTUA 4HLCA 1RPJA 2WF7A 3MB8A 1A8PA 2G06A 4UEJA 4PC3A 3O5AA 5HK8A 3FKSA 3PFNA 2NZ8A 1C3XA 2QWXA 3FRJA 1T5OA 4P3KA 3RC8A 3WL8A 4E3ZA 1A72A 4UTOA 4ZVKA 1GTJ1 4CIBA 3WGJA 1ZH4A 4PGHA 1NZDA 2I6QA 1EFVB 2RHOA 3LNTA 4ZPJA 2DHDA 3NT2A 3VAZA 4F2GA 1CUSA 3WVNA 2OHJA 2O9JA 2AD5A 1H05A 2R85A 3OP4A 4AB1A 5KTTA 4UNPA 4S1VA 2XGJA 1BE6A 5JYDA 2P4EA 2DKFA 1P80A 2GAFA 4LX0A 2XZOA 3H84A 4OGGA 4TL6A 2CLFB 1EWVA 3FF4A 3GU3A 5KU7A 1Z4KA 2IODA 4KO8A 3H3FA 1UOQA 3TOSA 1V96A 3ACBA 3ODGA 5JXJA 3K0FB 1IY9A 1V6CA 1J00A 3OOYA 3EARA 4JR0A 3O21A 1ODIA 3I2FA 1YQ9A 1NVGA 3UA3A 4DR5B 1R8XA 4GIBA 4IRMA 2C7QA 4ND8B 1ORWA 2ODAA 4D82A 3A9RA 1BWQA 3L43A 4KFRA 8AT1A 4Q1DA 4U7PB 3BWDD 1ATIA 2IP1A 1XAGA 2OM6A 5LVAA 5A9TA 1LPNA 1P39A 4JV5B 1SBTA 2FKNA 4L85A 3MG9A 1YOVB 3B3QA 3CX7A 3GBPA 4JJEA 5EYPB 3ME5A 3F73A 2PUDA 4O4LF 4C2UA 4JGGA 3K2QA 5B1IA 1JSCA 1V1MA 4RK6A 4MXDA 1AV7A 1YR9A 4Y6PA 3TVTA 3WIUA 4KO4S 4D2IA 1Y98A 3REFA 1EK0A 4Q9AA 3KZNA 1TMKA 4H6PA 2ES4A 3ICWA 4HGRA 4K6KA 4PHTA 3M1YA 2HO4A 3Q7TA 1EJ2A 3BWVA 3ESAA 5DNEA 3K0FA 1H4VB 4JKOA 1CJBA 5CAEA 6NULA 2GD0A 2G80A 1NLYA 3OX3A 3C0KA 2JLQA 3K0CC 5KCMA 1BGWA 4HLDA 3VR5D 1CR6A 1YZFA 3AB8A 3HCBA 3PUWA 1K8QA 2C57A 3CMCO 3X1MA 1C5KA 4IFBA 4TMTA 5DLQC 4YR9A 5F2KA 4ZA2A 4YRZA 3BT7A 5ADHA 4KMMA 4ZAZA 3HXLA 1SA0B 3P9ZA 3HKBB 5HR5A 1L8AA 5E9QA 4QPCA 1FFXA 2BZ0A 4UAUA 5LA6F 4C20A 2I99A 2B9VA 3V55A 9ABPA 1KI7A 1U7PA 2X14A 4OVKA 3CKYA 4MWGA 4KGXA 4GBJA 4Q6BA 4WKGA 2BMFA 5LFAA 3PX7A 2IEDA 1NRWA 1DAFA 2VG8A 2FSFA 3ZDAA 3AO0B 1ZA2A 1KR5A 3CZAA 2I1LA 1LQ2A 1YZKA 3A2MA 4EPVA 2ZJ8A 3W9SA 2BEWB 4G89A 5E8JA 2YJZA 3DMFA 1T0JB 3I9JA 1C9YA 2CUNA 2QGFA 3VAAA 1KYVA 3AVXA 4IKEA 2Y3IA 3K9WA 2WFZA 3IPXA 2OZKA 3NPMA 3PYXA 4CM4B 5JJKA 1LQUA 4O4JF 3JX9A 1GUBA 2CNLA 1YQDA 1BYIA 3I6YA 5TARA 4DYVA 1G55A 5GP1A 1CUFA 1OTXA 3I72A 1CUBA 4ZT2A 3MMNA 4PHHA 1P17A 3NKLA 2OHIA 3CKKA 1B93A 2R66A 3ER8A 1QIJA 2H2GA 2H7YA 2XOKD 4P3XA 3A14A 4QD3A 4H1TA 4O2AB 2GVNA 3HG7A 4YHBA 3LOPA 1Z7WA 5EUQB 3TX2A 3S8YA 5HOEA 3DZDA 4BDSA 4R31A 2B7LA 1QVAA 5KVSA 2PGXA 3GIDA 1O5TA 4WCFA 1X77A 2CXXA 2MYPA 2FW1A 4KAAA 1U98A 2HLNA 3AHFA 4OFWA 4DLRA 4O8ZA 1B1AA 1YBAA 2JF0A 1GQYA 1LRKA 3L79A 3WV4A 5JANA 4B3IA 1VG9B 2WJHA 5ITVA 4D0RA 3PSHA 3SSOA 3ZVLA 3NCHA 1UDXA 2R8BA 3UJPA 3R41A 4DB2A 2ATEA 5A04A 4HS4A 1TLLA 2GN0A 3N39C 3QTLA 2OFFA 4C0BA 1WOMA 4PYMA 3AVYA 2V59A 4UE2A 3WIBA 1AJEA 2CCJA 2GCIA 2PE5A 1QIFA 4JLNA 3LIPA 1XQXA 1NE2A 3CMMA 4RA6B 5DHAA 4FT4A 2H1LA 2QHXA 3GXBA 5F12A 4IICA 5BVGA 2WK1A 3OVMA 4I5DA 4BNHA 2MYUA 1JKJB 4IHQA 4GZMA 5IWCA 1TK3A 1EDZA 4LYFA 5BYAA 1DX6A 1KXZA 4HWKA 2JNWA 2A1TR 3PIRA 2H3EA 4DREA 3QFSA 2J6CA 1UK8A 3BGOS 2JLBA 1E1LA 2YRXA 3MPUA 5KSZA 2ZEJA 5TXGA 2WD7A 2WM9B 4TWRA 4DIKA 4KR3A 4I1SA 1UP4A 1FSSA 3KZXA 4W9NC 4HLUA 3V6MA 1NNLA 3C3AA 4V0KA 5L3SA 2NXEA 4U8GA 3H9CA 3IQZA 2CXUA 2LIPA 3V3KA 4MIOA 2VHXA 3CWQA 2QVXX 3DMGA 5T5QA 5AVTA 2F00A 2OMKA 3C7KA 3ITEA 3KQOA 5AUQA 4CCAA 3EOZA 4KC0A 5JROA 1EFPA 4IV0A 1YK0A 2JBHA 3RSLA 4Q47A 4QO8A 1U2EA 1EG2A 4UTRA 3NRCA 2VATA 1ONNA 1U6JA 1HL3A 1IC6A 4JUAA 3UHOA 3WK5A 4FBLA 4ZYLA 2RC5A 3R7AA 4R2WA 4YMTA 4L0DA 1LK0A 5EVCA 2OC4A 3OCCA 3FWZA 4P81A 3WYBA 4DIOA 4DWOA 3G7NA 2G04A 3DAGA 4EJMA 2W42A 5E2IA 1U7HA 3GFTA 4PS0A 2PWYA 5B57C 4DV1B 1F12A 2ZVPX 2Q5LA 4P0TA 3S1LA 4MMZB 1W34A 4Q34A 4GO1A 1ETHA 1L4BA 2DBYA 2BFBB 3G8BA 3W5JA 2WAMA 4AY5A 5L3SB 2WABA 1NAHA 1Z0ZA 1U28A 4QDJA 1CEXA 2Z56A 2O8FA 3AF4A 1CR0A 4RJLA 5ED4A 1WG8A 1XZIA 4BFWA 1OYOA 1XUOA 2LCFA 2B6HA 3LC1O 4RLFA 5H81A 2W2KA 2DWQA 5IK2A 4MI3A 1J5XA 3TLMA 3FFAA 1NVUQ 1NPTO 4PSUA 1XKQA 2ZBQA 3SQNA 2OV8A 1EZ4A 2H29A 8MHTA 2W8ZA 1JSLA 4NICA 4QQRA 2IYSA 5JTTA 2PFKA 5L8VA 4XJSA 5JJIA 5I7WA 2B7BA 1OC2A 1NLMA 2AC4A 3MS2A 3G13A 5I9LA 4DR3B 5BSWA 3GP5A 1WO8A 2ZUVA 5I4BA 5IEJA 1XNGA 1BW9A 3G5AA 3KS9A 3AFOA 1VL0A 5D6OA 3ZGVA 5DOZA 1Y9AA 2G25A 5ALIA 2X0DA 4ZGWA 4JYBA 3KQVA 5BSTA 4TV8B 1WWKA 1AGPA 2QMZA 3H8JA 3SFZA 4EB6B 2HMVA 1VDZA 5BSVA 5KJ1A 1E4YA 2C3YA 2ZYDA 4HDSA 4HP8A 4PX2A 1JNXX 3LFHA 4HFJA 4U5XA 1FMCA 1HV8A 5KJCA 3TNLA 5B2EA 1TZKA 3SHWA 2FOLA 1CY2A 5K3FA 1FFEA 2FPPA 1A1VA 4UHCA 1M6VB 2A67A 3R0VA 4RDHA 3KFXA 4X7PA 3HJTA 5HF8A 1OLOA 3DPIA 5DWDA 1H2RS 5KC8A 4KXMA 1WU8A 3IVGA 4ENUA 4D92A 3KKOA 5EJ7A 3K92A 2O23A 1JFRA 5HIKA 5KQLA 4BX2A 3FDFA 2W2QA 4YJFB 1G8SA 2NUPB 4MVJG 1PV2A 3CZ9A 4FUQA 2VXYA 1DADA 1RCTE 2QN1A 2WIFA 3VZPA 4D3YA 4NV3A 5DHFA 1ZJ6A 2ZB7A 4HEA6 5HGJA 4XFDA 1X3LA 1KEKA 2FEKA 4B4OA 3D8TA 1M2GA 4RULA 3I3SR 5K6RA 1PZEA 1VLJA 2JH8A 3SU8A 3M2TA 5HGXA 5BV2P 1JDPA 1PN3A 4MW5A 1SC6A 4ZJYA 1CUWA 2OCYC 4CQLA 1NF2A 2J8ZA 2PU7A 2QN2A 5I7UA 4XX0A 3Q98A 2REBA 5IXJA 3FOZA 2L19A 5A6SB 3B1JA 3FG9A 4N48A 3FBWA 4E2YA 1TIKA 1KI6A 2BE7A 2XUDA 3FCCA 3B3FA 3O92A 2QTVB 3UV7A 3WTCA 1SQSA 3JQPA 4ZREA 1Z34A 2O8BA 5KSOA 5DK4A 2JBAB 1SU6A 3AF0A 3FOWA 2DHCA 4N8EA 3EMBA 3IUSA 5E1OA 3WMRA 4Q1EA 3ZI4A 4CT4B 4ESOA 3TGWA 4EYQA 1BEZA 4TMFA 1FUYB 1UAAA 2FDXA 2PMWB 3UH0A 4ZV4A 3GFGA 3TGPA 3A2NA 3DB2A 1K63A 1Y34E 3PDCA 4EW1A 3NBUA 2X5OA 1OPRA 2Y4OA 2V9ZA 4IH4A 4Y2HA 4Y1GA 1CQJB 3I23A 4I2NA 4PO9A 3A6ZA 1EVQA 1C3OA 1P8AA 2CNWD 4X1OA 2DFTA 5DB4A 2D1QA 4KU4A 4YREA 2WP0A 4OHWA 2ROQA 2NM0A 4H3HB 5GVSA 1UODA 2Z98A 1F3LA 1LJLA 1Q0SA 2VPWA 3C39A 1GG5A 1PJ2A 1MEOA 3IE2A 4JENA 4FFBA 3U3DA 5HK9A 5KNCD 2VYVA 3PC2A 1GDHA 1KYYA 4PY2A 5CXQA 1J2TA 2E21A 1UPUA 2ZW9A 1ZMRA 4CM8B 3BIJA 3IAFA 3PPWA 3GV0A 1YOBA 3KD3A 1FVFA 4V2IA 3KRTA 4XR4A 3W04A 2XUPA 2VKQA 1NI4B 1G3QA 1NSFA 1PW5A 1VPLA 9LDTA 3JTMA 5AI0A 4AJKA 3QBTA 2CJWA 2AG8A 4F45A 3J80A 3P9QA 4DLUA 2X3UA 4R8KA 4IXNA 5PNTA 5HYVA 4W5WA 4LOIA 1VL1A 1I9CA 1XZGA 1TJPB 3NALA 5CP8A 1QJCA 2LGJA 3EN0A 4GR4A 3HBLA 2IYOA 3KYCB 4NULA 4X54A 1O9BA 4A91A 2I55A 3ZZTA 3R9XB 1N77A 3S0JA 4RUKA 4G5YA 5CK5A 5JMTA 3VPXA 2G5TA 1EQUA 4KR2A 5JO0A 1NXVA 2Y1KA 2QAGB 1AMUA 2RJ3A 4HFMA 4ZZ0A 3CLKA 3LUPA 4L0QA 3A1UA 3OOWA 4WASA 2GRAA 1IVNA 5EQFA 5ALFA 4DLSA 4AYTA 4MRPA 4U8HA 1S8AA 1DCMA 1M54A 4EA7A 4D9BA 2BLNA 3ZX4A 4RKRA 1M5TA 1DKPA 5K4AA 4R2JA 1NVVR 4GKBA 3NBXX 4BTLA 1JJAA 2O5EA 4Q3EA 4DBLC 4LSZA 3R3ZA 1F51E 2JGFA 4M1KA 5IT5A 4M60A 4BEVA 1EUDA 5DO9A 1GQ2A 1WW3A 4WY2A 4YUVA 5CH3A 3FYTA 4H18A 1N33B 4E7OA 1DT5A 4ETIA 5JYCA 1VB5A 4J3FA 4QOGA 1Y9DA 4XM0A 3PTZA 5FUBA 1Q6YA 3D1LA 3SSAA 4M55A 1J0XO 5IDWA 3SR3A 2COEA 5CFLA 1KERA 4O4JB 4B47A 1P1FA 5IKEA 2VI5A 4MQEA 4K6GA 3D6NB 4Q9NA 4R2XA 5REQA 1M0EA 3ORSA 3BWBA 1PJZA 2ONZA 1PG0A 2ADOA 1S2DA 1YACA 3HB4X 5I5GA 4F5YA 5EJ6A 3T5MA 5JAHA 1JJVA 1JT9A 1D6MA 3TLKA 4FZJA 3NDPA 5LNK6 4BV2A 1SN7A 3RVOA 4H27A 1QG6A 4OK6A 3C3EA 3A31A 1T0IA 4NZNA 5DGDA 4HUQB 3LD9A 1T6NA 2J6HA 3HXKA 1T5DX 2PWPA 3D81A 3QUSA 3C16C 5IC4A 3GJ4A 2NTYC 4MGZR 3RUAA 4C7KA 4M1TA 5AM5A 5HUQA 2Q6OA 2B21A 5IYZB 4FM9A 1CLUA 4CKWA 1DQZA 4PV7A 3LUDA 1DZIA 3QMVA 2IW1A 5DU2A 4Q4DA 3LHFA 2QENA 3L1KA 4G8DA 1KEUA 3QLUA 4NDNE 1CQIB 2I4LA 3W6PA 3ZHXA 3FGNA 2JDID 3I2IA 1KY4A 4LRTB 1A4RA 2CDBA 4HDAA 4MR7A 1ZVKA 1X7XA 2GAAA 1Y4DE 2GEFA 2CJYA 2QUAA 3DOFA 1D8TA 1MD9A 1B3RA 3RG2A 4J0EA 3GWZA 3DF7A 1IJFA 1NJFA 3VUFA 1E2MA 2E5LB 4F85A 2A7QA 2TYSB 3I4LA 5DH9A 3ZBUA 4YDHB 4TMKA 2FUG1 1S3GA 2HWYA 2MSEB 1B8NA 1G8FA 3HB1A 4A0GA 1JFVA 4R84A 3BA6A 2HRCA 4J0QA 3WJAA 4P58A 1Z88A 1RXEA 2HEIA 4GP6A 4MYRA 3E3AA 1HE2A 3ZNOA 1VP3A 4H3SA 3RUPA 3DYBA 4CJXA 4OI4A 4EP1A 2JCXA 3CUEF 3HDTA 4RK0A 1M75A 1V7CA 3GJXC 4MVJM 4RXUA 5TPWB 1DLJA 2IZ6A 3KEGA 4A27A 3KB8A 3K31A 4ALKA 4RJIA 1J8YF 3QFTA 5CFPA 4J1SA 2RBGA 1NJ1A 4RD1A 1TUBA 1RBYA 5HRUA 4L7VA 4LBYA 5ELMA 3ZGNA 4RSRA 1VZ2A 2A14A 2R751 3N8NA 5AFSA 4JC4A 3U7HB 4TVSA 5LXTF 1QAMA 4HXFB 4K5QA 2CNBA 4MHSA 1DHTA 4YRKA 2EEPA 2JFGA 3WK7A 2NN3C 1GQOA 5F2NA 5AVXA 3GZJA 3NOVA 1A9PA 2IYLD 2NIPA 2EZUA 1MQ8B 2BM1A 3CCCA 3EFOB 1AV6A 2CLKB 3O38A 5B3JC 3F5QA 5B1EA 4OHRA 4GOMD 5FDFA 3HDQA 2GYUA 4CBVA 4CL0A 1UFKA 4YCSA 5F23A 5AUPB 1B14A 2QZ4A 1MT0A 1I5RA 3FWHA 4QGHA 4ERNA 1W0CA 2XE7A 1QYCA 1XTPA 4AMZA 4BMZA 1U6IA 1BWPA 4FB4A 4AJNA 2HQRA 4ZC8A 4AZSA 2HSGA 3NDBB 1RXUA 2PO5A 3A0RB 4W1PA 2PZGA 3FZGA 5IC5A 1SRQA 4TYWA 2HGZA 3IR7A 1WW2A 2OP0A 3JZMA 3JATB 2FLKA 4LMBA 3RU9A 1EX9A 4YQFA 3C5WP 1KWGA 3FTDA 1FF9A 1V7PC 4B84A 5TEWA 5IF9A 3RHTA 5IBQA 5BYBA 1XNHA 4UKDA 4J1TA 1BA3A 1XZKA 2YDYA 4KJXA 3RJ5A 1PVDA 1OYVA 4PNZA 3SEQA 1H85A 1GNRA 2VHQA 1XEWX 2HUNA 4CODB 3C6KA 1SBHA 3PLNA 1BG6A 2RCYA 4M0EA 1HT2E 3WLAA 4OJTA 2YDXA 2EDCA 2UDPA 4MO2A 1I1QB 2V9PA 4JYCA 2BD0A 4TKVA 2X7JA 4XGNA 1RFGE 3D8HA 1SG9A 1AY0A 4XIIA 1NZJA 3FSGD 2QX9A 3M70A 2C2BA 4II3A 1Q1GA 2CNWA 5DW3A 2FW6A 1L2TA 1N8SA 1LWOA 3OJCA 4RPKA 4EPTA 4UQLA 4MDEA 1EJBA 3PP8A 5FUYA 4GFDA 3GN1A 4IMPA 5FYQA 1CTQA 1DWQA 3D4BA 4DUGD 2XQGA 3UO8B 2D13A 3PA8A 2XYRA 4WBNF 3WLHA 4N8SA 1AUQA 1QOZA 2YY7A 4ROTA 1GL3A 1ACMA 5BN4A 2ET6A 4KVGA 1MO6A 1U1IA 3IQHX 4DSOA 1N0VC 1YASA 4OH1A 2G9NA 1P5RA 2NZWA 2ZIVB 3RKUA 2OD7A 2IV7A 4EY3A 5ARBA 5C8YA 3GAZA 3V48A 3D0KA 2JI8A 1CNEA 1SC4A 4OQMA 4B31A 2FPIA 2O6HA 1E9DA 1I7SB 1QTQA 3IP7A 1PQYA 1RR6A 3FRIA 4IUBS 4J6FA 1HWYA 1Q7TA 3LBIA 3ZY6A 1G1MA 3M6MD 4YMWA 1QQBA 1DRUA 2F2TA 1DC7A 1J70A 1II8B 4L5JA 1K66A 4XM2A 2FRDA 3V8NA 4E1BA 1ZM9A 5IPFA 5F9FA 1YA8A 5ADWA 1IEXA 4Q4JB 5A9SB 4YAIA 4QICA 4UBOA 4RABA 3CGGA 2WKSA 2BFEB 3EBPA 2MINB 4WV3A 3R0ZA 4UXJA 4M9CA 3FLBA 4D97A 1SXQA 1E6WA 3I1YA 1YKFA 4RD2A 3K1AB 3HN2A 1RI5A 4G9BA 4OM7A 5J1SB 2J7KA 4RFSA 1C9NA 4RL4A 3W8RA 1WEKA 3K1TA 2QLLA 3UK2A 1YULA 5LZ8A 1PQUA 3ZEIA 1MAAA 4JUDX 1XHEA 3V1LA 1HE8B 3HYCA 2Y1GA 4HX2A 2ID8A 4AJOA 3KETA 2HF9A 2ZT6A 1FJXA 4UUAA 1WETA 5JH7B 2JRCA 2G82A 2IZ0A 3OE7A 4A8TA 4WBNA 1LJUA 1CCWA 3CGWA 2NUPA 5BR4A 3JD4A 1R0WA 5H7XA 4A5SA 1C30A 2AIRA 2DWUA 2ORWA 2XQFA 4TUYA 5F1KA 1FQKA 4JU9A 1HNWB 1YVRA 1Z2CA 2H07A 3ROTA 1T36A 3A9UA 3DL2A 4DA6A 1VJCA 3QQPA 2OB1A 4I6EA 2UZ4A 4MKFA 5D6NA 1RWPA 2XDWA 2WG2A 4LZLA 4LHEA 2EEZA 2IYRA 3TPCA 1MN6A 3QNUA 4LY0A 4UU7A 5E6SA 3KP1A 4MQ5A 2JD1A 5YASA 2QLMA 2PUEA 3O9MA 4L4UA 3B9PA 1OGJA 2A33A 1VXOA 4O2RA 3A9CA 3FTEA 4HQ6A 1JHQA 4OFXA 3DT6A 2JGEA 3SXUB 4QBKA 3V4OA 4B3CA 5CFQA 5JD4A 4XPIB 4Z3OA 1HFEL 2NU6A 4MQLA 5CT5A 3SC4A 4YRMA 4RZQA 4INPA 3UPTA 3NVKI 1N4DA 3BRSA 5FUVA 5G3ZA 4HH1A 4GS5A 3EIEA 3OIVA 4HADA 4R2KA 4HQLA 5CDSA 1A9SA 3L2OB 4DWJA 2K5UA 5FA5A 3R8FA 1D4AA 5CNMA 2AZ4A 1HF3A 1FJ2A 1ZMTA 3QIAA 4ZQFA 2ERCA 5EKTA 4CT5A 1T36B 1PNQA 3O94A 1PNOA 2NZJA 3DEFA 3HEAA 3ESYA 4C29A 4K8RB 1DBVO 3V8VA 3EEQA 4XLLA 3ZJ5A 5J3JA 1QCCA 3PYLA 4Q1BA 4WTOA 5HMMA 4EM6A 5K3DA 1IHDA 1PQPA 1V47A 2YBEA 4RTKA 5EXPA 1LPBB 2E4WA 3GPDG 3TD2A 1EINA 3EEOA 1N1MA 2Q7DA 1LDEA 3RYIB 3TBHA 3BCRA 1A9XB 3DTVB 1GNVA 3QW2A 4X90A 2AXNA 3FMIA 3VAYA 2P6MA 1E3QA 1Q1ZA 1GZVA 2IA5A 2FMFA 3O3CA 4TX1A 4YRIA 5L3QB 3AB7A 2FN4A 3E03A 2BKEA 3K2BA 2TMYA 1ZN2A 5BR8B 4UASA 4EJFA 3ZCPA 1AKUA 4Q3DA 1WXXA 3OOJA 1J6UA 1YMVA 3TCNA 4XWOA 2GOYA 1ZU4A 1KTVA 3KLNA 1E4EA 4DCOA 5ELXA 1LLUA 5D5HA 4YUXA 5FFMA 4HNTA 1UBRS 3NIBA 5GV8A 4G01B 2FWJA 4IQFA 4M99A 3ZS9A 4TS9A 1XTQA 2RI1A 1Q5PA 4KWCA 4S1TA 4IJ5A 2CE2X 2X22A 1ZD4A 2BKLA 4OXRA 5FNVA 2OHGA 5FTNA 3C4VA 5ALQA 1Y48E 3FWPA 4RH3A 5FO1A 5DI3B 2KBEA 3N0RA 4Q9DA 2KI5A 4NOJA 2OG2A 3JQQA 3OTGA 4B81A 1FP4B 4UCWA 4HV4A 5BMVF 4QUDA 2NNLD 2XCRB 3FPSA 3DTVA 3L4BC 5BNIA 1FUEA 2VNKA 1VE9A 1F0YA 2P5TB 3HO1A 3O73A 4QOSA 3T34A 5K2OA 3TO5A 3LGSA 4NS4A 1KSGA 4EKIA 4ZYYA 2VRWA 3W79A 1M66A 1DKUA 2MSNA 4FYIA 4NXNB 3V7FA 1RSZA 1P7YA 3LDHA 3RE1A 2WTAA 4RWEA 4BP1A 2SBTA 3CO0S 1ZGBA 3KCNA 1O08A 2X9LA 1U9ZA 3C3KA 4ZI5A 1YJCA 1WMDA 3QEMB 4Q01A 4NYMR 4DZRA 2VLIA 4D42A 2JAOA 4E88A 1QGDA 2X0RA 1M2VB 3NOQA 2HTEA 5SZKB 2P3LA 4JEIA 1OZ0A 5KNDD 2EFHB 2FPGA 3AYXB 3USES 3EFBA 1U3GA 3LZDA 2VHUA 5ENDA 4B6JA 1SUEA 2G36A 3QE0A 4WX2B 1F4VA 4AXXA 2QR2A 4JGBA 5BSFA 2W4IA 1WHTB 1CY7A 2AN5A 2CCKA 1L4YA 4JDPA 3MXOA 3PCRB 4JQZA 1HQCA 5EJ9A 1W36D 3H6GA 5C81A 3QVMA 3THYB 1SIOA 2VHVA 4S12A 3RPEA 1WHSA 3DVAB 4KN6A 3R3VA 4AJLA 4LF5B 3U17A 1Y42X 4C3UA 1CY0A 1KZ9A 1D6NA 3DO8A 2Z8YA 3OSUA 4K9RA 5K0TA 5T4HA 1VYTA 1JAHA 3LXXA 4HWSA 5J4LA 2XKKA 2LTAA 2WIDA 1V8PA 4MI1A 4Q4AB 5AHWA 4E08A 3QVGB 1MO3A 3IXQA 4CF3A 1TA4A 2WU8A 1GFIA 1V8OA 4PIPA 1JRLA 2EQAA 4DDHA 3LYLA 5EUBA 1ZS9A 3PF8A 4ZHQA 1MHPA 3RGGA 5KSYA 2ZKIA 4F8EA 2QBYB 3F6RA 2PUBA 2FSSA 1Q21A 4NAHA 1P2DA 4HWOA 4MGKR 5EP2A 5K3EA 5H3LA 3ASYA 2NSHA 3GLUA 5T8KA 1MTZA 2FW0A 2R2AA 2X9GA 4QSMA 1R0XA 4WZAE 5EMKA 5F3DA 1G64A 5C1IA 3PXGA 4DIEA 4B4UA 1DQSA 2QSJA 2VDOB 4MJXA 2WD8A 1W4RA 4JX9A 4JROA 5TY0A 5IT9A 3WWPA 3P2JA 1OFHA 1BDHA 1TECE 3ELBA 1GGVA 2AEEA 1DB3A 2WZCA 3MFYA 4P32A 4PZAA 4KIUA 3PKJA 2PPVA 5ECWA 1M6HA 3VR6H 5FORA 3ZV4A 3VPDA 2IXDA 1E62A 2BGIA 3ACCA 3JZAA 4WL0A 3GT0A 3Q6NA 3SEFA 2WUVA 3K8ZA 3X1YA 4F4FA 3AHEA 2I7CA 1AO3A 3I2KA 4YP0A 1PT5A 4GUAA 3O3OB 2HM7A 3CUKA 2I71A 3JAWA 3P9SA 4Z86A 2FUKA 3KOUA 2WPDA 4F56A 1KYWA 4X95A 1LDGA 3HKBA 1E8DA 2J0QA 4RHYA 4LHSA 3JSXA 2NO0A 1H1DA 1S3SA 1XN4A 1J22A 3JALA 2Z3ZA 3A9WA 3EAQA 1Q2XA 1TA0A 3CLRD 3KXKA 3PBKA 2PK3A 2ZRDA 1U94A 4HDRB 1T8RA 2WHPB 3M1IA 3OA0A 2YRFA 5IABA 4BNJA 3GWGA 3ZV5A 1QWSA 2XB8A 1I7PA 3RFTA 4YECA 3BHMA 4KIFA 2GCNA 4NL4H 3NM5A 4QODA 2GVZC 2XUKA 1B3BA 1KEVA 4C01A 3EIOA 4QREA 3MCZA 4EPYA 1F8YA 3K7EA 2QN8A 1UC9A 2QJTA 2VTKA 3WJ2A 1I2DA 1YTUA 3D5QA 3SR4A 3AKCA 3NHUA 3TQOA 2AZDA 3JAWB 3C3MA 1U0NA 3VDMA 1L5RA 1RIIA 3MJSA 3I42A 4OL0A 2E18A 1ONOA 3QPBA 1NRIA 4UOQA 2VTVA 1PP4A 3CEJA 3NGXA 1Q50A 1U9YA 2F3PA 4B6EA 3KSDO 4XKJA 2WINI 5DHPA 5K0ZA 1Z4JA 4G0WA 2C2HA 4YFVA 1R5NA 2M2IA 1LW7A 1LEHA 4JIMA 3F9IA 3JYLA 5F1PA 1TI7A 1E9FA 4KZKA 1QHHB 4AN0A 1R00A 3QJGA 3RVBA 1DAIA 3SX2A 4HXYA 1SXPA 3SICE 4U6NA 1U02A 1BDJA 1SUFA 3FNEA 3KQMA 1EWKA 4PR3A 3ZWPA 5DNCA 1PT8A 1CV2A 2KSQA 3W4JA 1UIRA 1XZQA 2IZ7A 4CDNA 1AURA 1D09A 1Q0ZA 4FBMA 4JLAA 2X3FA 3VNUA 3SKVA 5IVKA 3KR2A 2OFPA 1MB2A 2AJTA 2FX3A 3OUUA 4JCOA 3EODA 3ISJA 1GG2A 3BJRA 3FPGA 1R5OA 4BRWA 4NZMA 4ZVPA 4LZNA 2NSDA 1PYOA 3G59A 4FT2A 1KI1A 5MGBA 5IULC 2IUYA 2GFQA 1E7QA 5BSUA 5AKIA 3UXYA 5K0SA 3T1QA 3V7YA 1SPXA 2R6HA 3UUGA 5F7OA 5HQ3A 1Y1PA 4M3NA 3OY7A 5B1SA 1IU9A 1A3CA 1EUZA 5FUWA 2AG0A 1AKEA 2YHBA 1V5FA 3WMEA 4CZ2A 5HE8A 4DT1A 3OPNA 4EY7A 2IPLA 3DOOA 4WJLA 2YZKA 4NH4A 4FWTA 1MA3A 1ZKMA 3T5DA 5IT4A 5K8JB 3INGA 7AT1A 3AERB 1N7JA 2G1JA 2GM5A 1KDOA 3ZKWA 1DEXA 5E6UA 3TRKA 3SF8B 3PQ6A 3KQSA 5JAOA 1U2GA 4AJEA 3NCTA 3N59A 2FPWA 4PC1A 3ON5A 3UPDA 2OLJA 1SHZA 5DN6D 1NU6A 3GDWA 1A2QA 2I22A 2ZAMA 1B16A 4C5AA 4F3TA 1KMHA 2J9RA 4GE3A 2X8BA 3E8SA 5DLYA 3DMPA 5LLDA 2OY0A 1KZ7B 4QUBA 5F7ZA 1XDWA 2P9TA 2WQ6A 2CGEA 2IKSA 3UA4A 2X2PA 2BHLA 1HT0A 3HGQA 3HRIA 2RGXA 4C0XA 4NNOA 4E03A 2XTNA 1GZHB 4R69A 2EARA 1JLHA 3C48A 1ST2A 5A02A 2ZUWA 1D2HA 4JYMA 1BVUA 3ZDEA 4EYSA 2C58A 2W22A 2I91A 1G20B 3LO5A 1I3CA 1RYDA 1S8FA 2G9QA 2I3GA 3TD9A 4EI7A 5LQRA 1EVYA 1FX0A 1F2DA 3KR0A 4UEWA 4YRPA 4OBWA 5H0IA 1THGA 5F76A 5LBIA 4MS4A 4NYJQ 2JI9A 2VRCA 2XWPA 3L05A 3GFBA 1BTOA 1R8SA 2FUEA 3MIIA 1MVNA 3ORYA 4UXIA 3OMWA 1IZ9A 2YH2A 2AK2A 2HV9A 4Q9JA 1E63A 1Z29A 1M7HA 4Q93A 4WNIA 1JEEA 4HR7A 2ZG6A 5A4DA 4LRXA 3CLRC 3QEMA 4EKYA 1U31A 4CCWA 1DRVA 1RJDA 1U0RA 3WKDA 4JP1A 4HXGA 4YRTA 4L4YA 1WXFA 1BMDA 2C3MA 3V46A 4MQFB 5JS2A 5TQVA 1KHHA 1NVEA 2PYZA 3MTIA 4QBTA 2XECA 1FRZA 3PR2B 4DEVA 1PVOA 1F0KA 2I2DA 5BWNA 2BPOA 1TNDA 4HTAA 4JZYA 5AM4A 4KRYA 2GPTA 5KVAA 4MV4A 2QD5A 3EW7A 3LHDA 3WAJA 2GM4A 2VK8A 3MTQA 3LWBA 3CR3C 3N0VA 5JD3A 4UJ3A 2AN3A 1W4LA 5EZQA 1FUUA 3D02A 4OOFA 4YRCA 5FBRB 1XDUA 2WJPA 1QMGA 4LNUB 3LJKA 3AHCA 3AFMA 3C2QA 4R9NA 3SJAA 3PNOA 2ATXA 4LC9A 3UTCA 4BN0A 2IU3A 5CD9A 2PBLA 2EGUA 1XVUA 2I4IA 4UDNA 1JEDA 1M1YA 3FNGA 3HEMA 4UAVA 1PK7A 4WZBE 1P0CA 1M2KA 3BWEA 3VHRA 3IP9A 4Q3KA 2JBWA 2Z95A 4IGEA 3VH1A 1QXSA 1A71A 2QV0A 4DWWA 5FLYA 1UOEA 4KREA 1TAUA 1WW8A 5B58T 1K6XA 3H65A 2QQEA 1NTOA 2OILA 1Z12A 3BL8A 3ZXIA 5FX2A 3C3JA 2QP9X 4RTPA 5EEGA 3T94A 5JNLA 1LPPA 3FPKA 3CF6R 4IUCS 1RRPA 1P0PA 2CSUA 3H0EA 3JQ7B 3G7SA 1PBTA 3ETJA 4X3PA 3Q85A 5EIFA 2X4GA 3N8DA 4D81A 1CEQA 4CNQA 4NBWA 5DCUA 3Q0TA 1DMSA 1V1RA 3EPRA 2P2YA 2ZKLA 3GZNB 4RQBA 3S27A 4EYGA 3TQQA 1EBBA 2P77A 3KWMA 2EIXA 2VXBA 4KXVA 5FI1B 4JBNA 4ZVMA 4QSHA 4AJ1A 3Q8KA 3LY7A 3SDSA 2NUAA 4IJUA 4GPTA 1P7VA 4OXYA 3RJ9A 3M6FA 2ESRA 3VPHA 2P5YA 3SBXA 2QQFA 1RQLA 2V03A 3KIPA 3OPVA 2H1VA 2RHHA 2D1TA 3EXG2 3JALB 3QY9A 2IQIA 3WA6A 2B4QA 4ZAVA 1Y1KE 1QYDA 3SPXA 3N58A 4QX6A 3GEIA 3BWCA 4RA9A 3VC3A 2EJBA 2MDTA 4LRWA 4JVMA 4TT3A 2Z9CA 4V0QA 1CY4A 3HA5A 1YDWA 2HAEA 5BW8A 3EMDA 3UJHA 1X38A 1QHGA 1EFPB 4FS3A 3KKNA 5HF5A 3L7DA 2RHRA 4PG6A 1UBFA 5HW0A 1WA5A 4MIYA 5DIZA 4BPBA 1X1RA 1L9XA 1YD7A 1ZIPA 1Q22A 3ND5A 4I19A 4L73A 4KX3A 4LWQA 2X1HA 2H8KA 5A5FA 5MHTA 5JNUA 5CMLA 3HLTA 2HOQA 3N07A 3R7LA 1OT3A 4JVSB 1F8UA 4WXRA 3HNOA 3X1DA 5JYBA 4P31A 3BE6A 2ID7A 5JPCA 4HEHA 1D2MA 2KMLA 3QUQA 3LLMA 3DMTC 16PKA 1FUIA 3IAS1 5D51S 1EFDN 1SURA 1SG0A 3HXTA 4FJ2A 2Z5FA 4IFEA 3OFKA 4TYMA 1YHYA 4BWFB 2VK4A 3C7AA 3D54D 1W85B 4LEIA 1KC1A 2JB9A 4E5SA 1KQGA 4XQ0A 3RU2A 1IMOA 4Z8XA 3TR5A 1FFYA 4JELA 1MR3F 1EB9A 2CD7A 3LGAA 1VPTA 1BO6A 5KOIA 4RDCA 3FZQA 4MH0R 4TXNA 3KJGA 5FPPA 3Q88A 3TJMA 3ZE7A 2ATCA 4EX7A 5KNDA 1W7AA 1KK2A 4OQYA 4EMBA 1AIPA 3CVUA 3S2SA 1UXIA 2H4JA 1FS4A 3N2KB 5FPTA 3PXDA 1V3VA 5CGZA 1N0UA 3ZY5A 5GIOE 2XB6A 1NLZA 1EWYA 4YP7A 2B2NA 3IC5A 3G9QA 3KV1A 3LZ6A 3TSCA 5H59A 2CVFA 4R83A 4EG6A 1Y1RA 5A3SA 4RZ3A 1X86B 2Z2XA 3LQ4A 1UMDB 1SUCA 3ZCTA 2NSYA 2NPIA 3SQOA 2RC6A 4UAGA 4BFVA 2DPYA 3A36A 1EDEA 1PWXA 3B38A 5K0GA 4OA8A 1ZVVA 2HSEA 3SJCA 1E0SA 4JODA 2EW1A 2Q3HA 3WYAA 1J4AA 1U7TA 2X5NA 1BS1A 1HM5A 4K86A 3T5AA 1QVVA 1ZIYA 2EZ8A 1NIJA 5I8PA 1ZI8A 1MDFA 1YDHA 4GLJA 2XV1A 5B6IA 2GILA 3HJRA 1MEEA 2R8EA 2V6JA 3T7SA 3ICQB 1MAUA 3I5MA 2CFIA 1O94A 2P1ZA 4O4LA 1RC1A 3CT6A 4QUIA 3DFMA 3G2JA 3L49A 3U7QB 4DMLA 1T8PA 1Z4QA 4ITVA 2WC1A 2JPDA 4R1NA 4DMHA 3E9QA 2NZVG 4YYZA 3BOSA 3UMBA 1ZXLA 3QE3A 4V39A 3OTQA 1J23A 1M10A 4HH0A 5AJWA 1NRJB 3MQ4A 4HY3A 2V1UA 3VHXA 2C7BA 3FCXA 5CLLA 3KQTA 5AHXA 5AI5A 5EWMA 5J1TB 4Q37A 4JI6B 2XVZA 4S35A 1P5JA 4Q9KA 2HADA 1NKVA 2FQWA 1IPEA 1OQAA 2P9BA 1Y5RA 4C3VA 4Z4IA 4ESHA 2XNDD 2Y0EA 3R3SA 1J20A 4JBGA 5FAXA 3GDHA 4DMCA 1Z3CA 3HWX1 3DT8A 1X2BA 2O0HA 3IVMA 4PN3A 3UGJA 1XVAA 4NFYA 1Z6QA 2VSQA 1JJFA 4U3JB 3UKJA 2QIOA 4C4YA 4AQ7A 3CNNA 3RSGA 4MQBA 5DM60 2J5RA 4CCYA 2HPVA 2H6EA 3EZ2A 4M1YA 4IG9A 5DKFA 4OHZA 3RYHB 5FAKA 1UJ4A 4WN9B 3D3QA 1MGPA 2OD2A 2QOEA 1TAHA 1YS4A 2FGJA 3EXHC 4TUYB 2AL7A 3D6HA 3NAMA 4J3NA 1J56A 2JFOA 4FR0A 3MLAA 4IZIA 4MR7B 4CVNA 1UDAA 2EJUA 2PU5A 1UR5A 5ARDA 3UGTA 1YVPA 2X5KO 3DLBA 2VJKA 4M0LA 3GLHB 4MWBA 1XRRA 5JT1A 5HOQA 3HSSA 1KDTA 1VKZA 3DOEA 4Q3NA 4R05A 4RQAA 2CL7X 4CIXA 3HRHA 3TSYA 5A5EA 4KMRA 1EHCA 3T7RA 6AT1A 2FFJA 3BXFA 3KSMA 1WS6A 3Q9SA 5F5LA 4NKRA 5DEIA 3IT2A 3JR7A 2H2FA 2OGWA 3PNQA 2Y1LA 3VMFA 1Z5OA 1XZBA 1I1OA 2IHZA 1ZK0A 2BIFA 2CK3D 2VYND 5I7HA 4TZ0A 4DC9A 2VZEA 2G8NA 2O7RA 3SX0A 4DS3A 1SIBE 4JIGA 3X43A 4Z0TA 4J16C 2XKBA 3KUUA 1X14A 1DC3A 1U2DC 4UHJA 3AEKB 2AR0A 3J81A 4YK7A 3VTAA 4JBXA 2ZI4A 4IHAA 1VCIA 4NMHA 1AXRA 1V7ZA 4H7PA 3GLHA 2BKXA 1AQLA 4BNNA 4IZOA 3Q3GE 4MUHA 2TRSB 2OZLA 2XKAA 1P1JA 5CTAA 2R8OA 3AR6A 4CMEA 3JVDA 2IYFA 1N7GA 3AJRA 3EYWA 3LNCA 3M6LA 1X13A 3QU5A 2IS1A 1QGYA 1U8YA 3LPMA 1QFJA 2VT6A 5KOHA 4KWEA 4IJWA 4JP2A 4MVXA 2NVUA 1KIMA 2J4FA 1C2YA 1LK5A 4A6EA 4BS9A 4WN3A 4E4RA 2ONJA 3TRHA 1ZW6A 1CE8B 1NYLA 4WJKB 3C7CB 2G70A 1LS6A 3HWSA 1FYFA 1RJWA 3UOAB 3GUZA 1N6NA 3KB2A 1AD2A 2NOAA 4REQB 3W9BA 4UEQA 5LB4A 2HJWA 5IHPA 1NKSA 1KJIA 1DBRA 4W5NA 1ADGA 3KOYA 2VIIA 2CNDA 2FFHA 3B5EA 4TOIA 5CFRA 2O5CA 3GRUA 4GSYA 3PUZA 3VDNB 2ABWA 1KK0A 1TCUA 4PAGA 3W4KA 1PJQA 1SD5A 2ZRGA 3ANXA 5FT9A 3Q40A 2ZYHA 4F97A 4UCXA 4H7HA 2HKIA 2HBYA 2B61A 2C8LA 2ZIZA 3D0RA 2H2IA 1G6OA 3KT3A 1MJ5A 3OOSA 1E1YA 4V02A 1GTVA 3RT7A 1UZMA 3V4VB 3ONNA 5LKAA 3TK1A 1K6JA 3U19A 3EMVA 3G82C 2I3ZA 4U9UA 2OPBA 1YBFA 2C3OA 3VDQA 3G2KA 4I9GA 5KYTA 5K0CA 4QLBA 1M7GA 2FSUA 3DXFA 5DZSA 3ULKA 1YO6A 3PWTA 5CBPB 3TL6A 1JQKA 1EGAA 5FNVF 1PK9A 3NQ41 2CLLB 1ZNYA 2ZAYA 5GY7A 2I3BA 4UVDA 4DDKA 3JYQA 4IQ4A 3R7BA 1RHRA 1H6CA 2CE7A 1BWSA 5AOVA 3K4QA 1Q17A 1R4MB 2DXIA 2ZRQA 4AJ4A 4J4HA 3MWGA 3KZMA 1GWNA 3PVZA 1RCFA 3COWA 3AM1A 3WO1A 4FN4A 5ECYA 3WKEA 4P54A 4EIWA 1EJ0A 2C4NA 2XE8A 1H0KA 1KYXA 2D4AA 4LCEA 1OF1A 5SICE 3GEEA 5EJEA 4QT0A 1AN0A 3L0DA 5GONA 4ATNA 1WB6A 4P3YA 1XEAA 4D57A 1N6PA 4LMRA 4V0MA 3SDZA 1NJ8A 3S6JA 3W5HA 1XTUA 3LC7O 1QYXA 1XTJA 5HWSA 1IB0A 1OMOA 3NWOA 2GM9A 4TTJA 4C3OB 1QNLA 1XYGA 4I66A 4JR2A 2F4VB 3IMFA 4DSZA 5A1TA 1KVQA 3TOVA 3K70B 1KARA 2P0AA 2VP4A 2ZYSA 1JHPA 2E48A 4LA4A 1NXQA 1FDUA 1D7OA 1M2JA 3C1UA 3O4HA 2NZUG 4TYYA 3T7CA 1U1DA 3K9BA 1H69A 1B15A 3E9EA 3VI3B 2PT9A 2ZE6A 1K5HA 2UU9B 4KQ6A 2RGDA 2QF7A 1GFWA 2J3JA 3CLTC 4NENB 3OO1A 2B2CA 1U7XA 3BCSA 1UPBA 3A3NA 4Y6RA 2DQSA 2R8XA 4X1KA 1UK7A 1Q16A 1RP7A 3TQTA 3ZXSA 2OUKA 4PYNA 2B0CA 5ESRA 4K26A 1JT2A 3V8BA 4GRAA 4PW0A 2GZ3A 1HA3A 4I4CA 4RGYA 1BN6A 4GWLA 4DIMA 1TLFA 3VZDA 1L5KA 5JFTA 1JQJC 2O14A 2H5IA 2XCQA 2IFTA 4KAJA 4YJ2B 4QJ3A 2PX2A 5JJCA 1ML3A 4X63A 3ICCA 4KYUA 1PF7E 3B6MA 2ZDHA 3KEMA 4JQYA 4EQ6B 2IEYA 1Q7CA 1YOVA 3EOBI 1UAYA 5CVTA 1OI3A 3G0OA 1N2EA 4UTNA 1M0WA 2A92A 3KEOA 5HJ5A 1T4DA 1ZGCA 3IT0A 1G7RA 2ERXA 3B8HA 4F2WA 1WV0A 3MJVA 4N7MA 3H8SA 4U0JA 5F35A 1E4OA 1GSHA 5ALZA 2FOXA 5E0OA 5BRNA 1WXDA 4BZPA 1L6IA 3LCRA 4F4HA 2E4UA 3MSXA 3R8CA 1XV5A 2CXNA 2DM6A 1YI0A 2XADA 3ESRA 1CNFA 4LDZA 1APBA 3C70A 4QEZA 4FFLA 3T3HA 1JA1A 5EMHA 3D8NA 4LXIA 2CFSA 3RODA 4B8YA 1WB5A 3CH5A 4DNFA 5LOVA 3A9TA 4KO3S 1RRCA 3EQ8A 3FB1A 4LOLA 2JZOA 1WVIA 4N5MA 4ETWA 4KHPB 5AIBA 1D0SA 3V80A 3LIIA 4PGFA 5HIJA 4Q3OA 3HBMA 3SHTA 1AQUA 3BE4A 3NHSA 1LC0A 5KYNA 4OPMA 5EPEA 2VYCA 3P0EA 4YRLA 2CHFA 3P9XA 1HOXA 1NVMB 1XGKA 1Y5NA 3FF1A 2CHVA 4HN9A 5LL6P 1IN1A 4KVZA 1X9IA 2FZ5A 1A9TA 1Z26A 2I8AA 2WUGA 1E99A 4PO1A 4RA9B 3GRFA 5LD2B 4KDRA 5EE9A 3K70C 3WRYA 3VM6A 2DF8A 3T0GA 4F1JA 2Q5JA 3L6RA 3T9DA 3A6KA 4MPJA 4EMUA 3BXXA 2AR9A 3UW3A 4C5CA 2P9GA 2WUDA 1AGNA 4L15A 5KYKA 4DR4B 4WJZA 3WWEA 5FA8A 2NQ8A 2DT5A 2VN8A 3L7MA 4RMNA 3U9LA 5FLXA 3N0TA 2XJ9A 1Z68A 3OJFA 3D59A 3MT9A 1FLDA 3WB1A 4L7QA 1QU3A 2Z4RA 1Z5ZA 2CB0A 2E3JA 1EGVB 1YK1A 1EVJA 2HPAA 2QAGC 4KE9A 1PT7A 3HJGA 4G0ZA 1UBHS 2FK7A 1P0MA 3LH5A 2EVWX 2PV0A 2Q6KA 3MT8A 2P27A 5LMUB 4FCTA 3IEKA 4GI7A 1AZTA 3F6PA 2GX6A 3JW8A 2IV3A 4ARSA 2JLXA 4FI3C 4BNTA 5AW8A 3ZHVA 3RUEA 1MOPA 1FRFS 4G5SA 4B43A 4BBJA 3DVAA 3A25A 1PJBA 3GMIA 4DLXA 1PUJA 2WVJA 3GY0A 4XGQA 2UYGA 2RHGB 4LV6A 1XRMA 1ADYA 2ZSUA 4F4JA 3ZNPA 3N05A 1Q7RA 1BXZA 1TQHA 2YMQA 3S5JA 3RHZA 4GMGA 5FR2A 1AGYA 4FCCA 4GR5A 4C6RA 1XI2A 3LO8A 4LJSA 1CJCA 2FWAA 4D8WA 4KE6A 5HKKD 1ZCZA 4QPPA 2Q1YA 1QR2A 3LY8A 3Q7QA 4C7OA 1TCAA 2CBXA 3FY4A 2XCIA 1BOOA 2LCIA 2VZ8A 3M3HA 3KVRA 3R7WB 4TRNA 3C24A 5ESWA 4Z54A 2O8CA 1UH5A 2Z08A 3EVEA 2XPCA 5BO5A 2V55B 3KBOA 3ZJUA 4PG4A 4F9TA 1FUKA 3R0JA 2I9KA 4E1VA 1H0SA 4JI2B 5LZ4A 3R6WA 4MP6A 2I1QA 5HJ2A 1E3EA 2ZWOA 4P7KA 4AM8A 4FMDF 1CUDA 1ML4A 4RE6A 1Q3HA 4JNCA 1TU0A 3P4UA 2QY6A 3UKOA 1DBPA 1AKVA 3U6BA 2BMAA 5T7BA 3B52X 2PCJA 2OHHA 2AG6A 2PS0A 2BT4A 2VH5R 1ORDA 2WFLB 1QHEA 2GCEA 2X7XA 3C5EA 1XPOA 1VFPA 1H6BA 3G9TA 2C7VA 2XWJI 2FP4A 1N2ZA 4YWJA 5AVRA 1Q7BA 1GSOA 2ZAGA 3JAKB 2Q28A 4W7HA 1KH2A 2NTEA 3PC3A 1ZC4A 3I04A 4LE2A 4OYYA 1N2XA 3QX9A 4Q03A 3LTNC 4HH4A 1RHQA 3HCEA 3MN1A 3QKRB 4RELA 3EGOA 2YIVX 3WWZA 4JI5B 3PXAA 1N1EA 3B2EA 3KQYA 4I50A 2AJLI 1UDRA 3CBGA 3EVTA 3EWAA 4U7WA 3GT4A 1VMIA 5CPFA 5IJZA 5JDIC 3UK1A 3PXEA 4EW2A 5C8YF 2F1HA 4FSHA 5AICA 2OB2A 4IVNA 3FBGA 3S1SA 3FPFA 3VYVA 4HB2A 2WYWA 3RIMA 1Q44A 4UAJA 5HVNA 1ISFA 3R6TA 4R3WA 3L5KA 3ELDA 4HDCA 1NXXA 4QEDA 1OLUB 4D6PA 2VJBA 2W6QA 4MIEA 1S7CA 3SIWA 2ZJ1A 1HG1A 4OHFA 4ZD6A 1SCUB 1JAIA 1DAEA 3E84A 3L3BA 4JEHA 3FFBA 4HYQA 2Q49A 3DEHA 3ENZA 3E9MA 1SUAA 2C0QA 2HZBA 4UM9D 5EIHA 5JZMA 1E66A 2Z43A 3IR6A 4XWKA 2HSZA 3I34X 1W29A 3ILYA 3LDGA 3ZBQA 3H6HA 4OMUA 4PYJA 1TT5B 2J4CA 3AIIA 3O91A 4Z9YA 1G8KA 1OZHA 2HK7A 4PTZA 2GNAA 5TX7A 5D7NA 3HA2A 4LRYA 2VWHA 3SIRA 3HM9A 4J0HA 3NIWA 4NMWA 3KKKA 1XYVA 1EIWA 3FOBA 2A8YA 2IYNA 3KTOA 3LDUA 2WHXA 1U3CA 3HN7A 1HDGO 3ED5A 5J5AA 1Z4OA 3DOJA 3FETA 4PYKA 1IE3A 5FUXA 5FJJA 1VJTA 3SYNA 3D5EA 4AJPA 5B6PA 1WXGA 5DTQA 4MB6A 3PC8A 4YT4A 1I5OA 1CJVC 1G16A 2A5LA 3IKMB 3M8KA 4X45A 2FEAA 3ROGA 2G88A 4CKWB 4PLFA 3D0OA 4QQ8A 1T4GA 3ZK9A 1RZUA 2OXRA 3GJ5A 5DNUA 5DTRA 1TCBA 1VHLA 3JSAA 3KD2A 4URZR 2RGNC 1M8FA 3OZIA 1REQA 4MCIA 3KFLA 5E6RA 1MFZA 1C9DB 2GYVA 5HM6A 3ZJTA 4O4HF 2JGMA 2QMYA 2XTMA 5KX5F 4N5IX 3PKIA 4J0FA 4GZ3A 2ZU0C 1N2GA 4L6IA 3SHFA 1QU2A 1OH8A 3ACDA 1KAMA 1R9MA 3JQAD 4WUTA 1HI9A 1DU4A 4GD3Q 1CD5A 3DC7A 3GCDA 3NC4A 1FMJA 2VUSA 1TVMA 2WVGA 3PU6A 4LFCB 4JMLA 2PMEA 4CFZA 5FEUA 1QG4A 1BWRA 4US2R 3HWWA 1JHRA 1RABA 4L74A 4RVCA 3WZMA 1M8PA 1R66A 2CLOB 3GFQA 1VCOA 3TM5A 5KHOC 1Y3BE 1XWIA 2CJXA 4GUDA 1JDSA 5HEKA 3VVLA 5A06A 2I66A 1DE0A 1CERA 1T6BY 1UBEA 2VQSA 4JBIA 4PG7A 5HS4A 2JEOA 2HUPA 4RGBA 4MSUA 1MZPA 3TLBA 1IXSB 5IEBA 1ZVQA 4FD3A 1QP4A 3H1GA 1BIFA 3OQHA 3T3PB 3PRKE 4FYPA 4FU0A 1N0HA 1ZU5A 1QP8A 3BB1A 5GADl 2QIPA 1BCRA 5C52B 2NO6A 2G1UA 4ML3A 1IG0A 5KVQA 1C14A 1I9GA 3PHLA 3WV5A 3HTXA 3ZCUA 4AZ3A 4XYMA 3LFTA 2PIDA 2R6FA 3UYKA 4E22A 3IBTA 1JAZA 1KK1A 4FNMA 3ETLA 1E9VA 1RHKA 5T67A 3W4IA 3H17A 1KMCA 3ZXYA 3FMOB 1FX0B 3H9UA 5CFZA 4K1LA 3M9LA 4KDCA 2O19A 3VYTB 4XWYA 1MDBA 2EL7A 1ULBA 1QTRA 1BU8A 1JDJA 3HI6A 3HUEA 3KVVA 4Q00A 4WVLA 4Z9BA 5DT9A 3LUJA 3WYEA 2GAIA 2BKVA 3FFTA 2QRHA 2ZJFA 2H16A 4LGYA 3I9OA 4V0RA 1Y4ZA 3OCXA 1WXWA 3Q72A 4H3KB 4BLQA 4QFDA 1AXEA 1JJBA 1MPTA 3LFUA 1G19A 2PYIA 2P1RA 4FS8A 5CUQA 1F4PA 3RJMA 1KKLA 3V9PA 2VK1A 2HNAA 3BRQA 4DPLA 1KH1A 1G5FA 3A37A 4CTNA 5I7AA 3GEBA 1QYWA 3STHA 2KW5A 5KJEA 3C43A 2B34A 3QWIA 1Z6PA 3NORA 1ENPA 1W8IA 2CMHA 2AMJA 1UPTA 3IQGX 2V65A 4S04A 5F98A 1H9CA 4FZVA 4H0FA 2C2OA 5T3YA 3UH1A 3V32A 5KYWB 4LYAA 1SXIA 2E5FA 4RK4A 2VSOA 4V24A 4YC7A 1I24A 1SD1A 3Q15C 1JA0A 4FXPA 1L4GA 1SWVA 4I9HA 4W8GA 1W9HA 4KXNA 5U4XA 4UM7A 2Q99A 3HL0A 3H3XA 2O8FB 1Y9ZA 2VNSA 3OPQA 5C31A 4KB5A 3C5HA 1LBIA 2ASEA 2PZEA 3IB3A 4MULA 1OH7A 5EHGA 2NP6A 3H9EO 1T3TA 4BFYA 1V25A 1RXVA 1GU1A 2YJ5A 1N1DA 1ZVMA 2O3QA 3I28A 4KQFA 4O2BB 1VP9A 4PHFA 2JFYA 2PLWA 3HUDA 3LKVA 3P94A 4FX2A 5JWHA 3W5VA 1UL1X 3N28A 3UHJA 1R0YA 1SBZA 4B44A 2NZ2A 1VSUA 5IK2D 2IH2A 2DEUA 2OSBA 3GNTA 3MZ0A 3L0IB 1AGXA 4PLWA 4A15A 5LMCA 2GAJA 2XYHA 3K5PA 3MXTA 1Z6XA 3SM3A 1KR2A 3L4JA 4WKPA 4X20B 4LWPA 4ZCPA 2Q5EA 2RKBA 3QENA 1TE2A 1RYYA 2PG3A 1MB0A 1M34E 2PH1A 2QUIA 4KXLA 4LBVA 4Y0AA 4BN4A 3U26A 1Y4AE 4FDUA 4F12A 4C4OA 2Z3WA 3ZBPA 4F9GA 2JLWA 3GVXA 1B0AA 1GQRA 2E1PA 5JCOA 4DCTA 3QKSA 4A26A 1FDVA 1IB6A 1U04A 3B6KA 3BTSA 1GTG1 4GRIA 4OI1A 3RWBA 3GLFE 4NG5A 2R44A 3R7DA 2EV9A 1T5LA 2C78A 4O6VA 1NOIA 1TM1E 1XDSA 3E3NA 2Q29A 1JEQA 1G21A 2OSVA 1X7WB 3K6RA 4M7PA 5E9WA 3TCXB 4B6PA 4IS2A 4WXPA 3OMLA 4YAWA 5GWXA 1TC2A 2Q8PA 1VRCA 1JX6A 3GJSA 1S0UA 3OJLA 5AIAA 2MCFA 5H70A 2XNJA 2OECA 4ENSA 5FNZA 1GCGA 1COWD 4GM1A 4RW0A 2P30A 4OHVA 3I83A 4QU0A 1NBMD 3IUJA 4L3WA 3FJOA 3NJ8A 4TKUA 1Z7BA 5HZGA 1Z16A 4XCVA 1RPAA 4FW8A 2QI9F 1PL6A 1AMOA 4QVIA 4LVUA 4FCWA 1RXSA 4BX0A 4FFRA 1Q6ZA 3BG5A 2PZBA 2DPXA 3FPEA 4TV9B 4HDNB 4FFNA 2ZSFA 1EXDA 3M0EA 3JD0A 4BY9E 3PDJA 1RPNA 1YDFA 2LIVA 1R9JA 1A4IA 2JCVA 2CV2A 4Q7QA 3CZ4A 4X60A 3SM9A 4BQPA 2A0UA 1OAKA 3VR2D 3TRDA 5B3KA 2FCAA 3ROFA 5JARA 3ASUA 3Q8WA 3KFVA 2YXNA 1W44A 1ZKDA 2R7KA 1E9SA 1G8GA 4N5NA 3AKYA 4R6WA 5AP9A 3NHWA 2ZUTA 4CIVA 2PGLA 2QTLA 2FI1A 3C98A 3QA3E 2FG7C 4C4TA 1JPUA 3NBZC 1CUHA 1Z74A 2V7BA 4RO0A 4RZ2A 2QI9C 3E05A 2OGUA 4GP7A 1N6KA 1WLSA 1G5RA 3GEMA 1CR1A 1K8RA 4EUSA 5TF4A 2PS9A 2BHNA 2QP3A 3WQQA 3HKCB 3DF9A 4Y6OA 4H1VA 3HDVA 1H42A 3H5RA 1VCNA 5GONF 5EIEA 1E6KA 1NW4A 1TYAE 4MVWA 1Z35A 3UWSA 3D2AA 4XUCA 5FTWA 2Z57A 3L9WA 5AVKA 1HDZA 2GBIA 1NF3A 1DIGA 2WJZB 3AOEA 1ISMA 3C1AA 5GM2A 4GLFA 1N2CE 1TL7C 2GO1A 3ABRB 2R68A 5DCYA 5BW5A 4CTOA 3F0TA 5AWFC 1NSTA 3UY4A 4F06A 4W6QA 4PF1A 8GPBA 3LF2A 5SYAA 3U2QA 4CPDA 3PC7A 3TNJA 1NY6A 2XTJA 2F1KA 3WNVA 3MWEB 4M1QA 1ZAKA 2XUZA 3QBVA 3NYQA 1VHWA 1LTQA 2EGGA 4L76A 5CXXA 3ESBA 3SYRA 1LNSA 1NQAO 4A0FA 1KYIA 3E58A 1DV1A 5KNCA 2PZLA 2JGKA 4MDYA 1RJGA 2ADFA 2YMPA 3QSGA 3WQBA 1EDDA 2BHSA 3HNPA 2FPXA 3INTA 4XD2A 1DBQA 4LKOA 2GHQA 2ZTLA 1FYDA 1Z0IA 5JTUA 1MJNA 3L40A 3SR0A 2C9DA 3DZFA 3JXEA 4ENTA 4CE6A 4A8PA 2NV6A 2I7DA 4ALLA 1EDBA 1PFVA 3ZU4A 2Q2OA 4HX5A 1Z5GA 1PZNA 1RBZA 1JDNA 4U2KA 1ZD3A 3HU3A 1DBIA 2O3SA 1PFYA 3H1FA 3VYRB 1T9AA 2J32A 3HCAA 4FNAA 4JA2A 4PHGA 1TW3A 3QE2A 4MJLA 4YAEA 4DNPA 3IV9A 1CRWG 3ID6C 2WD9A 2ZT5A 2DUMA 4BGUA 1GPUA 4K3UA 4M46A 5EUCA 3U44A 4LY3A 2X1VA 4P08A 1AKQA 3R7WA 4KRXA 4R1UA 2X7HA 3BZBA 3D0QA 1ABFA 4ODIA 1Z75A 4ZOBA 1PNRA 4BP9A 4B4VA 3PPYA 5CVUA 2DE0X 3FJ1A 5HRAA 1TK2A 1Y6GA 4XM1A 2VCYA 3T3NA 1GRCA 5DT2A 3DBLB 4IRXA 1O9HA 2ZUDA 4FYMA 5EMLA 4N40A 4UU8A 2VCHA 1CIPA 2FCRA 3IIJA 3ESCA 2Q1XA 4V38A 4YRFA 3GP8A 4DV5B 1PG5A 2COKA 2VRBA 421PA 5JEDA 1XT6A 2REQA 5LKRA 4Q21A 2BEVA 2Q1UA 2WSSA 3KHUA 3QXJA 4QTUB 3LLSA 3FJYA 1ZOLA 1P0IA 2Z4TA 3AQIA 3DJYA 3OWOA 4FYJA 4KO2S 4G85A 4RYDA 2UYHA 3X1ZA 4Z4HA 3ZDCA 4F4IA 1KKMA 5BQXA 2AGVA 2X8JA 3I4CA 3QX3A 1QAQA 1OILA 4HNUA 3HRKA 2GLXA 5SY4A 3AL0C 4CKBB 1NUUA 1DIOB 3ABZA 3GEPA 2F6RA 2B5OA 3GUHA 4AKTA 5EMJA 4BVEA 1XRLA 3OZCA 4GXRA 3CW9A 3HUUA 1GPNA 2AFHA 2ASVA 3AZPA 4HI0E 1CR2A 1SUIA 1YS9A 4RXMA 3MJFA 4WRRA 1DDGA 1XYYA 4F91B 2E82A 3Q3EA 5JG7A 2YYAA 3H0CA 3U1TA 4PN7A 1ZNWA 4Z49A 1I6MA 2ZRAA 4XRGA 3IEIA 3E5HA 5CJJA 1B0ZA 1FTWA 2CNNA 5CJ2A 1XB2A 1D2GA 3SF0A 2RARA 2GYYA 4XIJA 3DH0A 2OENG 2QPLA 4UCQA 1CYEA 1SVSA 3K5IA 5EWLB 4CM4A 2AKAB 3B7WA 4XCXA 3ZXXA 4OX9B 2DTDA 2HT1A 5DM0A 4HNQA 2VF5X 4NMXB 1BRMA 1NASA 1QUEA 4N41A 4FC7A 1U2ZA 4F8JA 2XSZA 2D00A 1YQTA 1OKKA 3FMPB 1QV9A 4BNDB 2D7JA 1ORHA 1DJNA 4X1KB 4K9DA 4DXDA 4FJ0A 3ROEA 4PQEA 1RYHA 4JJAA 4UBNA 4W8OA 5T6BA 2ZANA 2NU7A 4DSAA 3BL6A 2AFHB 2V6IA 3UAOA 1PR9A 3U4MA 3IA2A 1Q1EA 4MP3A 1V2GA 2BBOA 2XDQB 2WA1A 3KAKA 3NWEA 3ZWBA 2I2BA 4IP0A 5IN4A 2Y1EA 1ICEA 4LRSB 1MGOA 1QZ3A 1RE1A 5F2OA 3M1AA 5JRZA 1JQ5A 1Q74A 3BB3A 3IDQA 2VQFB 5BT8A 1LBQA 1NW8A 2OO5A 4C6TB 3ERCA 1CZRA 3FCUB 2AOTB 4HTFA 5DGCA 1S2LA 1U0HC 3ECCA 1XKTA 4CEJA 2G0AA 2VDJA 3ZU5A 3QJYA 5TPWA 1Y9EA 3ZE1B 2X4LA 4CT0A 1KKUA 1WZEA 1E9EA 3DJFA 3ZPXA 4ESEA 3NVAA 4M1EA 1I3MA 4BE9A 1LD3A 3K70D 3HVJA 4Z53A 2V7QD 5BVGB 2MOKA 4WH0A 5EIXA 1GPKA 3I76A 1WZ2A 3GOHA 3WB2A 5HP4A 2GUGA 4V0LA 5K3OA 5LYJF 2O2GA 3MK31 4TKMA 5K3AA 4EFDA 3DL0A 4GPZA 1A8IA 4FLEA 3D2BA 1HZZA 2GN8A 2GK7A 1FP2A 3DA8A 3TR6A 4BBAA 4EEKA 1NQOA 5IJ0A 4CXMA 2XMPA 1R6BX 1XTZA 4ZOAA 1WE2A 3M4NA 2Z1MA 3RR2A 1QAOA 1Z06A 4MRAA 2DFVA 3QU4A 1RAEA 4LV5B 3PWKA 9LDBA 1QPGA 1ULSA 3FLAA 1XWFA 2HLDA 1LSUA 1M0TA 1ZMOA 4TGLA 4X91A 4HPJB 3O93A 4EJ2A 2YFKA 1P74A 4Q1VA 2VTBB 4D7AA 2RHJA 2BSQA 4TQAA 3FKSD 4I7EA 5JNVA 2GUWA 3I53A 4FQ5A 3PYMA 4KV9A 3ZLUA 4AP6A 5CYGA 1SVIA 4MDFA 3NBQA 3N7AA 2WUEA 1Y63A 4PX5A 4XPIA 2HWKA 3UAGA 3DXZA 2ZRHA 1WBJB 1U8EA 2RHDA 1RI3A 3KQQA 3FOFC 3AI7A 2UXCB 3IIEA 2X2EA 1P19A 2XMSA 3CRW1 3G2MA 3G9UA 3PV0A 1O97D 4YAOA 1DO8A 1SOUA 2PH3A 1FS5A 3T4XA 3T9BA 1RRGA 4D9FA 3F90A 5D85A 1R8JA 2IYZA 4RD4A 2YWEA 4KKVA 3F74A 1XLVA 4IOJA 2B8WA 2W2LD 3T4UA 1NV8A 3QHPA 4W5QA 1IATA 1DO2A 1FRNA 3VNSA 1KGDA 1AX9A 4G1UC 4I1OA 4UUPA 4IBOA 3N8KA 4MWTA 1H3NA 4YCCA 2R1VA 4B87A 4DYDA 2CL5A 1NUHA 1SCIA 3LUCA 4DJ5X 3GLHE 2H52A 5CURA 2JW5A 2L0XA 3IP8A 3IKJA 3O7WA 1NHWA 3AVQA 3FYUB 1CC1S 4A73A 1XXHB 4WECA 1C7JA 2P6PA 3DHVA 3P2IA 2IDMA 2XZDA 3PPIA 4XJXA 3TAHA 3DDHA 3BKWA 2IX9A 2G4LA 4ZOLA 1H4QA 4XYGA 4QIHA 2IUTA 4IYJA 1E5TA 3EXG1 3CLSC 3E9DA 4BB9A 3AY0A 4Z1MA 1CY6A 4F3YA 5JDCA 1NMSA 5DBHX 3TYXA 1EI9A 3CVOA 2ZREA 3T0FA 1KVRA 1FSZA 2IWRA 4PICA 3NNDA 3FZNA 2LRHA 4GX2A 2PX0A 2MU1A 4HZGA 4ZGGA 1KI4A 3A1NA 2CB9A 3EDOA 3FYUC 4MX8A 4QT4A 6Q21A 2XTZA 1GRRA 4AICA 1L5SA 1H3EA 1JKFA 3S2IA 3UT0A 2QXUA 3F4LA 1W5FA 3D9QX 1G7SA 5E7IA 3DOCA 4O4HB 3TLAA 2ACVA 2HV8A 4G86A 4UHFA 3RIXA 5HF6A 3ESZA 4J2OA 4O2BA 1D07A 1XMJA 3C6YA 4HGZA 5DNYB 1KJ8A 1CQZA 4U7GA 2Z0MA 1LTHR 3NJRA 3C7TA 2XOKA 2ZP1A 1ZOSA 2BBTA 3IBGA 4IHJB 4MUMA 5L7TA 2XNHA 3HQ4O 4WOPA 4D9GA 1XN1A 1UINA 3JQ9A 1XNRB 5D01A 1OFUA 2I2FA 3BJIC 5ALOA 1JXQA 4YJHB 1GKYA 1IDOA 4O25A 3C87A 4H0CA 5CDHA 6GPBA 2HQ1A 4NARA 1RBMA 5KWSA 2FEPA 3EXEB 1WQ3A 5CLIA 3TZHA 4DIDA 3H2KA 3RRNA 3PQ8A 1JPNA 2FZGA 1WLYA 2QDKA 3OF5A 1V9LA 4QBIA 4YA6A 1B6SA 5EHNA 1UBLS 2GEBA 3N7UA 2YC4C 2YOFA 4LRQA 3LT5A 4YQZA 5TMBA 1XZ8A 2M1XA 4UUNA 4YO8A 2XH8A 5EC8A 4P4LA 2WJAA 4PU0A 3TTWA 3OPYA 1L1EA 1K7EB 3HCNA 2L69A 2FKAA 2ZJ2A 4RHTA 5IBPA 5E3IA 2AQKA 2GF2A 4QFCA 1YBMA 2XNCA 2Q6TA 1AQNA 1E8NA 1JR3D 3IUEA 4KV7A 5E2AA 3T4EA 2Q9AA 5BPFA 4Y6QA 3PDIA 4X1IA 1RWWA 4L8LA 2X9NA 221PA 3DO5A 2GEVA 2R62A 3L1IA 3L77A 3LE8A 1EE2A 3A4LA 1VE3A 3QMWA 4HRVA 4OREX 5E4TA 1ZX1A 5CK4A 1PTJC 4V1CI 5KYVA 2XMZA 3JARB 2GN4A 3MAGA 4P33A 1D03A 2AC7A 4ZP1A 3RFFA 1RTTA 2DHRA 3A2KA 2GF9A 3IP5A 3BUSA 4MRNA 3PK0A 2XVYA 1QRUA 4YH1A 3TF5A 2B92A 2PJUA 3B1VA 4GDMA 3R5FA 1KJYA 4HH3C 4JK3A 4UVHA 4YACA 1TM5E 4U2BA 1F7VA 3MPOA 1B6TA 3RBXA 1IBCA 2VXCA 4LHWA 3WDMA 1MRNA 4BVGA 4CETA 5JMOA 3IKVA 5LOVF 4LN1A 2DWCA 1H2HA 4QHYA 3OT5A 1JG3A 3AI3A 4JLUA 5F52A 1WXEA 3ROZA 3A7EA 1NBOA 4PXYA 4MLZA 1E1QD 2ECOA 2P9FA 2RJOA 2VP3A 1FJGB 4L07A 2YUIA 5BQOA 1OJLA 2CMGA 3EG9B 1ZJYA 2O3JA 1F7UA 1AKWA 2AK3A 1UC5B 1MO4A 1PSDA 2FR8A 1M2EA 2QGNA 4M4SA 4I8XA 1MOSA 1PGOA 2OVFA 3AEXA 3ROMA 3TEMA 3ZZNA 1GKLA 3CB2A 3DFZA 3K0CA 3PI7A 2Y66A 3G9ZA 4KVAA 2FN9A 1GAEO 2EYUA 3UUFA 4BB6A 4R2IA 5SZJA 3OQBA 3HP4A 2W6CX 2PQ0A 4QVKA 4V2UA 1SVNA 2ZYVX 2ZJZA 3IPYA 1Y7LA 4LYGA 3PEYA 4EHAA 1YUMA 4RV9A 3KZKA 2I3DA 3VR4H 3PR3A 4JP8A 2JGLA 2CMDA 3BFVA 1J9EA 1V39A 3CZPA 3RH0A 4NG4A 4D8YA 2BI4A 1HH4A 2YX1A 2QL7A 1AKYA 5ES3A 3UJ7A 4XYLA 5JZOA 2B5WA 3EJ6A 4ARZB 3OLWA 2XY4A 1G8AA 3UATA 4QU8A 4AWAA 3HFJA 4MPTA 4ZQBA 2CKDA 3HLYA 3PA6A 3PHJA 4E0BA 1PJ3A 2GGSA 3FVQA 1N5OX 4B4KA 1YI1A 1R2QA 2AFIA 4OSEA 3VR3A 5CIYA 4X00A 1N2BA 5BN3B 1GL6A 4KR6A 521PA 1MX1A 4GM4A 3BX1A 4URUR 5FPYA 1J2YA 3OO0A 1NLFA 1VYVA 5EFZA 5I45A 5CA1B 1WR8A 1AZLA 2J0UB 2V6FA 4C0QC 3G5UA 2WU1A 4KLRA 3UK6A 3ODPA 2EBWA 1NQVA 1SKBA 4JLDA 3RNOA 1MB9A 4LOKA 3HXMA 1SBQA 3B89A 3IXMA 5HTKA 4URHA 2DU8A 2FP3A 5H8WA 1ZEJA 2DKNA 2J33A 4OFZA 1E1CA 1YCHA 3TL3A 3W6NA 3FCYA 3D4NA 3SZUA 3WAKA 4HGQA 4N54A 4K6CA 3EW9A 3W2GA 4MLPA 1V6SA 4RD3A 4LZOA 2GFIA 1EGMB 3KG2A 4X7BA 1E0AA 3KYJB 4M0CA 1IOZA 3ORFA 5KTRA 4W9RA 4BTEA 2ZLBA 3F6SA 3HP1A 4RVGA 4JEUA 1WULS 2J41A 2ID4A 3G49A 4TZ6A 3PT9A 4AY6A 2HSWA 1LS1A 5HKBA 1LLCA 6ADHA 3D8BA 1C9KA 2QVGA 4Y30A 1U90A 1L9KA 2OR3A 2ZTHA 4DLTA 2C96A 4R1QA 1WHTA 3K09A 1BKDR 2GHTA 2IY8A 1TEVA 5LQDA 1JHMA 1PS0A 2CF5A 2Q3LA 1C3LA 2JGDB 4ZKDA 3T3EA 3C5CA 2OP1A 1HBJA 3KPUA 2OAEA 1HLFA 2D0DA 2FPRA 1M1ZA 3IOCA 4CV3A 4MKXA 5C7LO 5JJBA 3QF4B 4N03A 4MGHA 4HFRA 4O29A 5GQSA 4B4DA 1RACA 2AT1A 4BV8A 2J6IA 4I9UA 2IYAA 2H7VA 4QGAA 2X8LA 3F6YA 3SX4A 5LYJB 2Y27A 4QUAA 1USGA 4X5OA 1N2CA 2B99A 1N2JA 3IDSA 4CF7A 5JLAA 2PGIA 2HY7A 4JJGA 3TVDA 2YWJA 3RHSA 3V8RA 4ZCIA 2VCEA 4FFPA 4II2A 2PQ6A 4PPQA 5LPNA 3AI1A 3MBIA 4OSOA 1JMVA 1KMQA 3EGIA 1ZRSA 2FE1A 2ZQ5A 3LBYA 3OLYA 3OM8A 4IWNA 4MR8B 1GGMA 5HJEA 3I61A 1MABB 3LKDA 2B8EA 5SYNA 1K5PA 1QE5A 3A6HA 3JD1A 3X44A 4I50B 3ICVA 4HMOA 1T3ZA 1XLUA 2BTQA 5KTKA 1YKGA 3WLKX 4FMPA 4Q18A 3KT8A 1ZD2P 3GRRA 1U81A 3N2LA 1OBHA 1LBTA 1SG6A 1FNMA 2B4AA 3O3NB 4FILA 5HKLA 3VU8A 3ZV3A 1VLZA 3NVDA 1I13A 1U7ZA 4TXHA 3ONWA 2B69A 5AO9A 5IMBA 1G20A 3EOAI 1E3DA 1TCCA 1KY3A 2O0MA 3ASVA 3LW7A 3TN7A 1N92A 2A9FA 5C9ZA 4EHFA 1E5XA 3E15A 3VKGA 5AKYA 2ZITA 1FFAA 5CLQA 3IBCA 4PRLA 4CN9A 1OGYA 3CY6A 3FNQA 3FDXA 4QKQA 3H9QA 2VZ0A 2JLVA 1QIMA 3DDCA 4GX0A 3RSZA 4B73A 3FCEA 2MYTA 3QPUA 4ZAGA 1I0LA 3COVA 1Z4MA 4OQPA 2VBCA 3RD5A 4G1VA 4ALIA 2ZJ4A 4K6OA 4DE5A 2EZ4A 2JK0A 4F4UA 2WUWE 5FD8A 1D2RA 1RDFA 4PZPA 4GVXA 2WAOA 3CVJA 2G5GX 1DINA 2GZSA 2YVAA 2AI3A 4P7BA 4PZEA 2E4VA 4X6UA 5EPUA 1TJ3A 2LUOA 4OM8A 1ZLYA 4CUJA 1WDMA 4PS1A 1QORA 1T5IA 5CPBA 5J5CA 1UKCA 3OFSA 4O5OA 5JECA 4DKXA 1NM5A 5CVDA