1MEXH

Antibody catalysis of a bimolecular cycloaddition reaction
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
215
structure length
211
Chain Sequence
QVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWVKQKPGLEWIGYISPGNGDIKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCKMEYLDYWGQGTTLTVSSGGTTPPSVYPLAPGSAAQTNSVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQSVTCNVAHPASSTAVDKKIAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 29G12 light chain
publication title Antibody Catalysis of a Bimolecular Cycloaddition Reaction
rcsb
molecule tags Immune system
total genus 43
structure length 211
sequence length 215
ec nomenclature
pdb deposition date 2002-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mexH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mexH02
4P23C 2J5LC 4JRXD 4KJWD 4C4KO 5CINL 4JFFB 1BOGB 2FL5A 3D2UD 1Q0XL 5C09B 3OR6B 3LN9A 4XC3L 3KGRA 3HAEH 5HGBB 1LE9A 4JG0H 3R0NA 3DV6B 5CSZA 5C07B 2NY0B 3HC0B 5F7FA 5DVLA 3I3BA 1T3FA 4TRPH 5A40E 1S7VA 2NY0C 5HHOB 1KIPB 3CX5J 1O7VA 1T0NB 4HUNB 3FFDB 3NZHL 2ICEB 1FGVH 2MQ0A 5E8NB 1FZJB 4P2RA 2AQ3A 3X3FH 3B9VA 1RMFH 2YPLD 4K3GA 1ORQA 4RAVA 3MR9A 4PRHB 3H9SE 1U8OA 1W0WA 5HY9A 1FL3A 1RIVL 5LQBL 1P5UA 2XKUA 3LPWA 3J7HA 5D7LA 5H94A 4KU1A 3MBXL 1ZHNB 1MPAH 1DEEA 1MQKL 4APQB 3T3PF 3ZT7A 2OXHA 5HYSA 5EC2B 4A6YB 4UMGA 1S3KL 2BXZA 3BP7A 3KPSE 4MXVF 3EUUA 1RUKL 3C8KA 5DHVA 4K7PX 5E56A 4I48B 1FCCA 1CD1B 1FYTB 5CKGA 1JWSA 1YNKL 3GSXA 1CFQB 5EZLB 5JIHA 3RWHB 3QIUD 4PJEB 3M45A 4L4TB 3LN5B 1KT2B 2A83B 3TCLB 4X9BA 4HIEA 5KN5B 1LEGB 1DBMH 3REWB 4ZFOB 4EEEA 4KI5D 1HKFA 2ICWJ 1K8DB 2ZUQB 4J3UA 5KTEL 1EGJA 2VISA 3JV6A 3O3DB 1C08A 1FP5A 1RVFH 1UFUA 1UH4A 1KC5L 4NHUA 4OGAD 4F9LA 1WWAX 3QQ9C 4YGVB 2W60B 1OM3H 3UTOA 4JN2A 2CDEA 5L0QB 5FUOL 3TGXA 4DKEL 4R3SA 4NO3B 3QDMB 5IW6B 2YUVA 3ZDZE 2RAMA 5HYIA 1J1OL 3HB3C 3PDGA 1KLGB 2R2EB 2RJMA 3H7BB 3MRGA 1UKTA 3KPNB 3CFEB 4WGWB 4NN5B 4U1LB 4K7FB 5HDQL 1P53A 2ADJA 2Z0BA 3MRJB 4JCLA 5DK2A 3MGAA 4IJ3B 4J3XA 4ZUTB 2XPGA 4R26H 1TLKA 2AK1L 4IM8A 4NRYA 3SJVA 1I9IL 4IJ3C 3O6FA 1J88A 2OQJB 3DO3A 1JN6B 5GISH 3E8UH 4CN4A 5MI0B 4KC3B 4O9HL 3S96A 4DQOL 1GAFH 3C9NA 4XI5C 3QZWG 1BOYA 1KIRB 3L7FB 5EC1B 1BQHA 4Q0XL 4JPKL 3GKZA 1AQKH 5MI0C 2YMXH 5LVEA 5IK3B 1AKJD 5EIIA 1EMTL 4EDWH 4NKQB 4RX4D 4E5XA 4PGEA 5F21B 3VMNA 4AZ8A 4NZJA 1QO3B 1WT5C 4Z0XA 1NQBA 4Y16A 1UH3A 3RWDB 3HE6A 4OLWH 1RZJH 4GKNA 3GBML 5K59F 4X8JA 4K71C 1I1RA 2QADB 4WJ5A 4HKXB 3WN5C 3TJEL 5JNYB 1HH9A 1ZLSH 3JTTB 2FYYB 5FV1L 4UT6H 3R06B 2P5WA 3MV7E 3MACL 4KTDL 2R0LL 3MJ7B 1I9JL 4R4BA 4GG8A 4MQSB 4UB0L 12E8L 5DSCA 1G7MB 1TVBB 1NMAL 3GSNH 5BO1L 3OGOE 2XZQH 1J05A 4PLJD 4Z76B 3ZSTA 3RIAK 1PKQE 1DP0A 3DI3B 2EIEA 4JFPA 4S1RL 1RZIB 1V05A 2FX8L 5H2BB 5DEFB 3QUXD 5E8EA 4XBPA 1X7QB 1T1ZB 3VXUD 1OAYL 4IMKC 4DCQA 1K3ZA 1MCHA 1BLNB 2KBGA 2MMXA 4Z7VA 2YPVL 4ZTOL 1OP3K 1A6WH 3PHSA 3S34H 4JM2D 4L3EB 1N6UA 4Z0BH 4DOHE 2ZNWA 3IDNA 1R24B 3O2VH 5IEHB 1GC1C 4UIMB 2OTWB 1U0QA 5DMIL 5KOVC 1B0GB 1P7QA 3WIFA 2GY7B 3ARFB 3M17A 3HE7D 5MP6L 4LLQB 1VSCA 5IB4B 3W2DH 1VADA 3A6BL 4ZTPL 1DUZA 3VFVB 4HIHA 5A2FA 1V7ML 2DBLL 3HMXH 4JDZB 1U3HC 2F8XC 3CCHA 3GM0A 3O4LE 4LSDA 1R5WB 1XF2A 1CLZH 4UINL 4P9ML 1IMHC 4RDQG 3FO2B 1PSKH 1U2HA 1NAML 3EYSH 5F1OB 4PRHD 1WFOA 1FNEA 5EU4B 4HXBH 1MJJB 3BJLA 3KPTA 2VDPL 5EFIA 4O2FA 2HKHL 1MIMH 1G6RB 1FO0L 2ZPKL 4KHXH 4N0UE 1NCDH 4L8CA 2OL3B 3DBXA 1XF5B 1A1NA 4X4MA 4XBEL 4APQD 3V6OA 5C0BD 4XT1C 4OQ1A 1I8MA 3OKEA 2DKSA 1D5IH 5DJDA 2P1YA 1S7TB 4RIRA 4CVZB 3ZKXB 4Y88A 3RZWA 4L4VE 3CSPA 3ZKXC 2A2QT 3KNBA 3FT2A 2VKXA 4FXGA 5K9QI 4LLUB 4YFEA 1U36A 5MEPA 3ARED 4PP2B 4GW5B 1FE8H 2VE6A 5JPMA 2DQIH 3RGHA 1QSED 4Z7UA 1QRND 3SDCD 1PYWA 4LKCA 4PLKC 3VRLE 3QH3B 4JO1H 1Z9LA 4K8RC 4KDWA 4LBEB 5JHLL 4F7TA 3DYMA 5TGBA 5HYJE 1NCWH 5I66B 3MRPA 1KNOA 3B43A 4QF1B 4DW2L 2EXWC 2WNGA 1D5XA 3FO0L 3MRIA 1FJ1A 4YXHH 5SX4I 4G9DA 2FR4A 4WUUB 1EK3A 1IAIH 1GPOH 2BHUA 3IDYB 3GMPA 5TDPA 1UXSB 1W72B 3Q1SH 1A3LL 5E6IC 5FF6A 1QBAA 3T0EB 5HGHB 1ODAA 3DJ9A 3WJLA 4YHLL 1DL7L 5KSBF 3CFJB 5ETUA 1RZFH 5ICXB 3VMOA 3QNZA 5TPWH 3PP3K 4XZUA 1FN4A 4KUZL 5D7IB 2CUMA 1JV5B 3DMMD 4OLUL 1NH6A 5ITBH 2XY1A 2LABA 2BDNL 5DJZB 3BXNA 4WI6A 3TIDB 4PJHB 1J1PH 3UBXI 3V5HB 3VRIB 3ZYOA 2PTTB 3KPLA 1RU9H 2YKLL 4GRWH 4HJJH 1AHWA 5D96B 3BZDA 1DSFL 5ALCH 3EYOB 1NGZB 4LLVB 3HZKB 4TN9A 2NPLX 4ZXBB 5D96C 3MV8E 3ZSSA 1JF1B 5E2TL 4YAQB 1ADQA 3BKYL 3VFTA 1XMWA 3JWDL 1LEIB 1U93B 2QADD 1ZVHA 3HUJF 4LGPB 4F7PB 4MQTB 3V5DA 4XNXL 2LV4A 3O6ML 1A0QL 1YEKL 2XN9D 1XCQB 3HKFA 4JZJA 3WXVL 1YEJH 1ONQB 4XX1E 4UNVA 3SOBL 1MFBH 1OSPH 4PIRF 1ZLWH 1EO8H 1QSFD 2BNRD 4K3EL 4PYGA 3B6SB 4TNWK 4MNQA 4FQ2H 4PY8J 3TO2A 2CDGB 3WHXB 1OGTB 5FK9A 2EIZA 5KSAA 2X1XR 1MJ8H 4UV7L 1G7JA 3UTSE 3PWPB 1CFVL 4XNMB 1S9XB 1VEMA 5LGHH 5JORB 5FYKD 1AD9A 4X6CE 2ZUTA 4U0QB 3VXSB 1U42A 4UDUB 3S4SB 5J12C 2BVOA 1A4KB 1DQQB 1V8HA 4W6WB 3GJFA 3OPZH 5L6YH 1M71A 3MUZ1 4PJ8A 4XVSL 1GZQA 4NJ9L 1DQDL 1UB6A 3WLWC 2FL5B 3H7LA 3PQYE 5FCUH 1PY4A 4UT9L 1AGCA 4FOMA 1MRDH 3B9DA 2GJJA 3WJJC 3PWLA 2MCG1 1LE9B 5IF0A 3PGFH 3QEQA 2Z4QB 5TJWK 2FD6L 5CSZB 1UADC 3ARFD 1IBGH 2Z92A 4XPTH 4G7VH 1T3FB 4JKWA 4KY1L 1S7VB 4J6RH 2XTJC 4LSPL 2I9LB 5J06A 2BVPA 3CX5K 3NTCH 1A6UL 2VJXA 4JPVH 5EWIL 2W07A 3P0VH 5FM5O 2DI9A 5FYKH 4P2RB 2DTMH 5EPMA 1RD6A 3EOTH 3ET9F 3G6AB 1ORQB 1PG7L 3BIKA 3MR9B 1W0WB 1FL3B 1XR9A 1N3NA 3K46A 4YDKH 3CH1A 5FV2A 1NDMA 5KG9A 4XP5L 3NFPA 1SYVA 2NZ9D 5D7LB 1H3TA 5FYLD 3N85L 4MJIA 1DEEB 2F53A 5J1TC 3EDEA 2VLKD 4OCRH 5HYSB 4GG6F 3NFSH 3OXSB 2MQCA 3BP7B 1HKLH 4MJ4A 1QP1A 3C8KB 5DHVB 5D6DC 4MAUL 2JCCE 2I5YH 1JWSB 2R0WL 3GSXB 4OD3L 4RCAA 3VG0L 4F7EA 2HMIC 1YC7A 5DD6B 1U3ZA 4PJ7F 5D1ZA 1B9ZA 1OTTD 3K74B 1U3JA 5SWZE 4HIEB 2VDOL 4FZEL 3SE8H 1QBLH 5DK3A 4LGRB 5KW9H 4LFHG 3JV6B 1F6FB 1C08B 2FDBP 3V0VA 4KKAC 1ZT4A 3CMGA 5CILH 3QG7L 4AIOA 3GI8H 4ODSL 3GSOA 4JN2B 1XIWC 2CDEB 4KK8D 3SGJA 4X4YA 5E24E 5FYLH 5HHQA 1JCKA 4YWGH 3VRJA 1MJ7L 3WLBA 4I9WE 1KIUA 3KDMA 1I3RA 5JUEL 2VB5A 3L5WA 3MRGB 5IP4A 1GGIH 3S37L 2IG2H 3EDDA 5HI4C 3RAJH 2OL3H 5JHDA 4KKLC 2ADJB 1A7NL 4JFEB 3GSUA 2A77L 1A14H 4M9PA 3RA7L 2RBLA 4Y4KA 3LEYL 4Y19E 1JYNA 4NRYB 3SJVB 4KRPD 4NHCH 5FA3B 2FB4H 4YJZL 4M03A 1FIGL 4UBDC 4WI4A 1UM4L 1VFOA 1QHPA 3FN9A 5F93C 4PREA 1MAJA 1OHQA 4PJEF 3O6FC 4UOJA 1TJIH 4GLRH 3S96B 3LH2H 3O4OB 3C9NB 4P5KA 4PG9A 3OTTA 4KVCL 1BQHB 1FFQA 1MCSA 4UTAL 2Z31A 4N5EC 5EIIB 2JE8A 3BAEL 4E5XB 2BNQA 1K9TA 3H8NA 1X44A 4JJHA 4G6MH 4MJ6B 4Z0XB 4Y16B 1JF5A 3SKMA 3QUYD 4XP4H 4BM7A 5HVFB 1GOGA 3HE6B 4GKNB 5EBWA 4JRYD 4G9FA 4X8JB 2CXGA 1U8MA 3HRPA 2YUZA 1KJ2A 1MFAL 3ARWA 1WIOA 1DANT 3HE6C 3NMEA 2APTA 3QI9C 5D1QC 1HH9B 2YXMA 4ZS7L 1YEIL 4YHPB 5ID1A 1MY5A 2G9HA 4X7SL 2P5WB 4J3SA 4KGLA 4XMKH 4R4BB 2W0FA 4LCCB 5AYUL 4GG8B 2R9HD 2Y9RT 4NUGH 2F19H 2D9CA 1D5MB 5DSCB 4RGNE 2J3SA 1NMCC 1J05B 3GMNA 2NY3D 3RNKA 3H42H 1ITBB 3MRFA 2OCFD 15C8H 3VDAA 4GQPH 4JFPB 3BDYL 4I2XE 4NRXA 5E8EB 1V5JA 1NUFA 4XBPB 5I19L 3W39A 4DCQB 3SE4A 1DBKH 2XKSA 1N7ML 4Z7NE 4PS4L 3GSVA 1NANH 3RIFK 3IDNB 1RK0A 1AO7E 1NUGA 4ZOAA 1U41A 1P7QB 3WIFB 2NXYD 3M17B 3LV3A 3RUGA 1IEHA 4AEIH 1GGUA 5I1CH 2UYLA 4UV4L 4HD9A 1LHZA 3ESVF 5C2UB 2V2TA 1VADB 2HG5A 1ULVA 1FFNB 5MERA 2LAGB 4HIHB 3BJ91 2FGWH 2BFVH 5BV7B 1G9NL 1UYWL 3NABH 3CCHB 1QD0A 5HYSG 5E4IA 4Y0GA 1MFNA 4IOIA 1I1AC 4IS6A 4I8DA 1KYOJ 4R7NA 5BV7C 2AK4A 2BOBA 3MODH 4J3VA 1CVSC 2X89A 3PJSA 4RGOL 5ADPL 2QSVA 2NYYD 1FNEB 4NQUA 1OGAD 4K7PL 4LHJB 5EFIB 4O2FB 1BM3L 1D5BA 1U8NA 3VI3F 5FO8B 4NCC1 2OZ4A 1FLRH 3DBXB 3QRFM 4L8CB 4MLSA 1A1NB 4QRPD 1LGVA 3MXWH 4D9RE 5GJSH 1GH7A 3ROLA 3E1F1 4U1JA 2CLRB 3KPRD 1WWBX 1I8MB 1WJ3A 3OKEB 4LAQH 1JI2A 5DJDB 3N9GH 3FFCA 4RIRB 3PWVB 1YQ2A 3TBWB 2UVEA 3WNOA 2EDLA 3VXMD 2RB8A 3ZE0F 2OXGA 1NEZA 1EAPA 1MNUH 1H8OA 1KCLA 3KNBB 4P2QA 5GS3A 3PWUA 4NSKA 1Z6JT 4FXGB 3O2DL 3BIBX 1HHGA 3TT3L 2IANE 2GSIB 4AT6A 4XNYL 5BVPH 2CKBH 2VYRE 1LK2A 1RZKH 2VE6B 1A6AA 4OFPA 5JPMB 3FQNA 3VFGL 1P7KA 4Z7UB 1P84J 3I9GH 1PYWB 4LKCB 1KCKA 4NPYA 3VFMA 2BZDA 4P4KA 4FQJH 4F7TB 1G9EA 4XTRC 4JFHD 1DBJH 3MRPB 1YEDA 3CVIL 1NJ9A 2W59A 1D5XB 2GJ6D 4NKIL 1RULH 2QQLL 5BRZE 3MRIB 1FJ1B 2DJ4A 4G9DB 3U7YH 2FR4B 2QJDA 2Q8BL 2YEZA 4Q6IA 1X5ZA 4K2UH 1P6AB 5C7XH 3GMPB 4JFED 2VZSA 5ID0A 4Z5RA 1KB5H 5FF6B 3RVTD 1Q1JH 1GHFL 3MV11 4OQTL 5ETUB 3MUJA 3LQMA 4XZUB 1FN4B 5HHNA 1IRAY 3HTLX 4QWWC 4OCNC 4HV8A 4F9PC 2R8SH 4RMSA 1HEZA 4BFGA 4PRID 4CMMA 1YMMD 3BXNB 1JVKA 5E5UB 1P4LA 1M05A 3P30L 1OTSD 3WFEL 2EDNA 3RU8H 4U49A 3OF6A 2Y4SA 2OR7A 1G9MC 5F6HJ 3KPLB 3H3KA 3QNXA 3VJ6A 2MKWA 4LSVL 4POYA 3WIIH 1AHWB 4OD1H 1TENA 4FQPA 3EO9H 4K23L 3W0WE 2YA1A 5DFVD 3EGSA 1AHWC 4AEHH 3ZE2F 3OR7A 4WEMB 3MLUL 3VFTB 5EG6C 3V8OA 4MS8C 2G60H 3RZCC 3NACL 3H9SA 2R23A 5SWQA 3V5DB 1OD9A 5EU7E 1KCUH 4F7MA 1CQYA 2VO5A 4JZJB 4ZO6A 1BP3B 2X7LA 3KYKL 5I15H 1CI5A 5D2LE 4OZIA 2AVGA 4HZLA 1IC4H 3SDXA 4MNQB 5F70A 3TO2B 1DBAH 3O2WL 1N0XL 5FK9B 2EIZB 5GZOD 1RJLA 4AIZA 1ACYL 2EYTA 4X4XA 1G7JB 5HDLA 4FFWD 5KSAC 3QDGA 3BPOB 2ZCKL 4IOSD 1AD9B 2F8OA 3GSWB 2BSTA 4F2MA 1VPOH 4N9GA 5CEZE 5EN2B 3SPVA 1RHFA 3GJFB 1M71B 3U48A 5I1IL 4PJ8B 4LQ1A 4PJHF 2I9TA 1UB6B 4Y2DD 1LO0H 1QFWI 3CXHJ 4AJ0A 3DETD 3DRTA 4I0PD 2BY1A 3TA3C 4QTIH 1WEJL 1KEGL 1NGQL 4X6EA 3PWLB 1UC6A 5IF0B 3QEQB 2X40A 2GTWA 4OLEA 1KG0B 4FTVD 4NZUL 2Z92B 3EFFA 3WFBL 2AP2A 2ICCA 4P99A 1A7PL 3V6BR 3EHBC 2BVPB 4Q9RL 1T21A 4JFDA 2OR8A 4XWOD 2MPAH 5I8CA 3QXVA 1SJXA 3KS0J 3BIKB 3MLYL 2DD8L 1XR9B 4OF7A 1N3NB 3CH1B 3P11L 2IALA 1NDMB 1FVEB 4WO4D 5KG9B 3NFPB 3QP3A 3U46B 3WSQH 1PG7W 1A5FH 4JGUA 1YQVH 5C0RL 3QA3A 2VLRD 3KXFE 4MJIB 3TBYA 2F53B 1QYGL 5FHAH 4OFKA 1CN4A 3K1DA 3WFHA 4YHML 2IMMA 4KK5D 4X6BB 3MRMB 2MFNA 5EULV 5DRXA 3K2MC 1MH5B 1H3VA 3VGGA 5FHBH 3VGDA 5D1ZB 1DBBH 3LIZL 2PW1A 1CDUA 5MEOA 4XP9H 2BC4B 1UZ6F 4W70A 4L8BA 2M1KA 4OGXL 3N1FC 1BFVL 3HPJA 2M8XA 3BPCA 1ZT4B 5E2WH 2Y06H 2EICA 3R4DA 1JPST 2H32H 3GSOB 3KLAA 3MV7A 3QHTC 4KUCF 3MA9H 4U1HA 3GRWH 5HHQB 4LARH 4EIZC 3MOBL 5D7JA 5ILTL 1JI1A 3KDMB 4Z95L 1I3RB 4PGCA 4UOW1 4JO2L 1HINH 1AC0A 3L5WB 4GXUM 4H8WH 4FA8A 4IDLA 4OM1H 1YYML 2DQFA 4OFDA 3EOYG 3GSUB 5DQDL 1CFSB 3ARVA 3OL2A 4Y4KB 4LPWA 4ALAL 4CU7A 5A2JH 3HZMA 2C1PB 1F6LL 4Y4KC 4RA0C 1UZ8A 4NO0A 4EN3A 4KV5E 4PREB 1MLBA 3MZGB 5I1JH 2HT2D 5IT2H 3EFDH 4XMLL 3GHBH 1JZ8A 2G75A 4P5KB 4JN1H 2IH3B 4PG9B 5JQ6L 3IDUA 5I0ZA 3I6LE 1MHPL 4FQIL 4H20H 4XXDA 2Z31B 3WXWL 5HHVH 4U1IB 2BNQB 4KHTL 4PJ5E 2Z31C 3BQUC 3D3VE 3C5ZA 4LIQE 3HA0A 4R7DA 1RFDH 3SKMB 1A3QA 3QCVH 1QFOA 2FIKB 4BQ8A 2FX9H 1MFEL 1R5VB 5EBWB 3Q6FA 2YD3A 4G9FB 3VA2C 4HGKC 5B4MC 1KJ2B 3TCXA 3PIQA 3O4LA 3K4ZA 5E1HB 4NQDB 2HKFH 2HN7A 1MFDH 4G8GE 3EZJB 4FNLH 4JFXA 1BVZA 5ID1B 2HWZL 2MNUA 1ZEAH 4TSBH 1H3WM 5I1EH 4NGHL 2I25N 2W0FB 3ZTJH 4GJTB 3K2UH 1IC7H 1OAKL 4Y4HA 3UJIL 5HYFA 4GS7C 3V7AE 3FONA 4HJ0D 1AIFA 3MGOA 1DVFA 1B0WA 1CQKA 3NIGE 1EHNA 3P9LB 4QRRE 4KTYA 3GMMA 3RNKB 1KN4L 1X4ZA 2KPNA 1BQUA 1BJ8A 1LK3L 5F7WC 3MRFB 5KSVA 3L5HA 5TF1L 3VG9B 2ADFL 3FO9A 4NRXB 1CDYA 1MI5D 1X5HA 4OUUB 4L4VA 4OJFH 1VGEL 3PDOA 3W39B 4Z7QE 3BWAA 1NSNL 3JSSA 3T77B 1CDHA 1RUQL 2WW8A 3JVGA 2YD5A 3GSVB 1NAMA 5D2NA 4EI5A 1RK0B 3V4PL 2HLFC 4Z8FL 5F44A 3RUGB 3LV3B 5CJQL 2NX5E 5C08E 4PJIA 3VFUA 3MRKA 2PYEE 2UYLB 1FO0A 4PJAE 4YGAB 3ULVC 4HLZH 1YJDH 5HYJA 1JIBA 3CSYA 5E08H 2V2TB 2HG5B 2EKJA 4P3CL 5MERB 3O6KH 4FS0A 3MLZH 1MHCA 2H41A 5C0FA 2QTEA 4L8SB 1MEXH 2IWGA 4IOIB 4IS6B 5DRZB 4ZS6C 3OKOB 5D5MB 2AK4B 2BOBB 3QWRA 5IMKA 1KYOK 2HT3D 3L95A 3HI6L 1IQWL 1YN7B 2HTLD 4OCSH 1F4YL 1I7ZA 3GIZH 3TBTA 4BQBA 1D5BB 1U8NB 1XT5A 2WWMC 1K85A 3UC0H 1G84A 3DXAA 5F9DC 1XGQA 3BZEA 4QHKI 3TWCH 1AP2A 3GBLA 1L7TH 3NA9L 2H8PB 1ZTXL 4U1JB 4Z7VF 2D0GA 4GSDL 1JPSL 3FFCB 1KENL 3CVHH 3HMWH 5KAQG 2WUBL 3E6FA 4CDHA 1U6AH 3BRFA 2R4RH 4ZYKA 4OSUH 4BH7B 1NEZB 1EAPB 4P2QB 1A7OH 3PWUB 4NWTL 3QPXH 1HHGB 3KJ6L 4AT6B 4UTBH 3MV8A 2Z8VC 1FSKC 4X83A 3TBSB 1OAUH 4GQ9H 1A6AB 3FQNB 5TQ0H 3B9KD 5F9WB 4NPYB 3VFMB 3PL6C 5GRVL 3IXTA 4P4KB 2OTUA 5JOPE 1EFXA 1FFOB 5B39A 1A02N 3U4BH 3S36X 4M6MH 1T83A 3ARGC 1NJ9B 3CAFA 5EOTA 4EBQH 3SEPA 3F62A 1GVIA 1HYSC 3W5NA 2YEZB 2VZUA 4M1CD 4P5MA 4Q6IB 5AZ2H 4WI9A 4PRPD 2JB6B 1ND0B 4UQ2A 3FT3B 5C0NC 4Z9KB 1M7IA 5ID0B 4X6CA 4Z5RB 5IFAH 4Q6IC 3LKSA 4TRPL 5F97E 5LXGH 2O5XH 5D70L 3P0GB 3A67H 3GI9H 4N90D 3VFWA 2OI9C 3IFLH 2NR6C 4Y1AD 5HHNB 5F9AC 1FGVL 2VDNH 3PQYA 3X3FL 4ZAKD 1HEZB 2XV6B 4HS3A 2H26A 3R8BB 4CMMB 5HVHB 1UQSA 1A9EA 5BVJA 1OSZA 2ZUVA 1DZBA 1UT9A 1S7WA 2DQTH 4JANA 4E41E 5HVHC 1A47A 3QNXB 3VJ6B 4Z7UF 1LDPH 4W6XB 2D4FA 1UM5H 3QIBA 1ZSDA 3EGSB 1OLZA 4MA3A 5J3HD 1JGLH 3FQUA 3GBNH 2EE3A 4ZG1A 2G5BA 3H9SB 1EERB 5SWQB 4FQ1H 4NQDD 1F90H 3QHFH 1CVRA 1RIUL 1JZ5A 4OKVA 1DBML 4F7MB 4O51A 4OGYH 5EU3A 3SDAA 4LPXA 2X7LB 1WZLA 1TJHH 4OZIB 4LCWD 4HZLB 1PLGH 1YEEH 3SDXB 4MWFA 5I74C 1RVFL 4TQEL 4TULL 3OJVC 2YR3A 4JRXE 1CTOA 1U95A 3L3DA 3KPSB 1RJLB 5GGQH 1WTGT 2ENSA 4AIZB 2EYTB 5EUKA 4X4XB 1INDH 4WU7B 4P23D 3FRUA 1FC2D 2JCCA 4LHUG 1EZVX 3MLWL 2XXMB 5I75B 5CZXD 2A0LD 2BSTB 3EAKA 1F8TL 4F2MB 5SWZA 3SPVB 2D2OA 4OIIL 3UBXA 5DI8A 2D7QA 3BPLC 2GT9A 1VDGA 3QCTH 4YO0A 2I9TB 1KJ2H 4XGZA 3WL9A 3O8XA 4R26L 5IVNA 1MCNA 1HHIB 3CXHK 4X6EB 5JIKA 4XP6H 5CJBA 4LHUD 4EQ2A 1VEOA 1AGDA 2R0KL 5L2JA 2WWKO 5GISL 4YZFF 1I9RH 3E8UL 4XNQB 3EFFB 1JNLH 3V79C 1GAFL 1J8HE 5GS0D 5ESQA 1RHHA 2P7TA 2WAHA 2EO9A 3S3SA 1AQKL 3MYZA 5T1KD 2B0SH 2YMXL 3RKDD 4QRTA 7CGTA 3CFKA 4JFDB 5KZCB 1V3KA 1AC6A 2F54A 3IT8D 1AE6H 1IGFH 4EDWL 3VD7A 1NCAH 5I8CB 5IJKA 1QOKA 2FX7H 4KTEH 4G6KH 4OLWL 2NW3A 3MLPA 1RZJL 3MQIA 2IALB 2AK4D 5F7DA 4ACPA 2C3XA 1IGIH 4NFCA 1EFQA 1IZKA 1RZ8A 1XH3A 3WS6C 3OJDA 3IETA 4KI5E 1ZLSL 5E6YA 3OB8A 2P49B 4UT6L 1OVZA 4H1LA 1TFHA 1B90A 4HGMA 5DRXB 1TVHA 5GS0H 5JA9A 5LG1A 4H88H 1QHOA 3GSNL 2PW1B 5CP3A 2JELH 4ELMF 4MNGE 2XZQL 5C3LD 5HGAA 1GIGH 4L8BB 2DJUA 5JMRA 5T1MA 5GGSY 3HB3D 3HPJB 3JWNC 1H5BA 3BPCB 2GK2A 3ULSA 1CLOH 1CXHA 5KANI 1CXFA 2ZUYA 3KLAB 4P5TC 3MV7B 1A4JA 4IRZH 3OQ3B 4U1HB 4RMUA 5IW1A 1GYAA 1BIIB 5DFTA 1IGTA 5D7JB 3BKCL 1WK0A 4PGCB 4JFYA 1A6WL 5C0IA 3S34L 2LU4A 4JB9H 4I3SH 5I18H 3O2VL 5D7JC 3G5ZA 2DQFB 3AM8A 4CUCA 5A43C 3V0WH 2CMRH 1JP5A 1CGXA 1MELA 2EEBA 5T5FH 5EOQH 1IGCL 1L9NA 3FRPA 5DA0B 2D3VA 3KJ4B 4DFIA 1S7QA 4F15C 3BGAA 3NZ8A 1HSBA 1IAII 3LMJH 4K55A 2ZSVB 3CDGA 3KJ4C 3HZMB 3W2DL 2XWJB 1WTLA 3REVA 1UZ8B 4NO0B 4M1DL 3HMXL 4F8TA 3BVNA 1MLBB 3K1KC 5F9JB 3MJGX 1WBXA 1NCBH 4ORZC 1CLZL 2G75B 4EN3C 4P46C 5INDA 3K8MA 3WIHL 3ZDXE 1AO7A 1PSKL 5CJOL 4R4ND 4XXDB 3EYSL 5F96L 4DGYH 2MCPL 4PJ9D 5CHNB 1S7SB 4HXBL 2ATKA 1DLFH 1Q0YH 4QCIA 4R7DB 1MIML 3O3BA 4IRJD 4KHXL 2QKIB 4G5ZH 3NPSC 3Q6FB 3C5ZC 3ZKNC 1E28A 4DEPC 5IV2A 2A9MH 4ONGL 1P1ZA 3PIQB 5KVDL 1UACH 3O4LB 5EUOE 1TVDA 2HN7B 5B38A 4JFXB 1UGNA 3TFKC 3RFZC 5J4MA 5AUMA 2V9TA 4HGWA 3FO1A 5IHUH 2YD6A 4YEFA 3VXUE 4FRWA 3FONB 1U8KA 1AIFB 2EDRA 3MGOB 1DVFB 1FE8L 5E6ZA 2IFFL 2WANA 4Y4HC 3GMMB 1X6LA 3QUKA 4JO1L 2WV3A 3KPSD 4R8WH 4NRZA 3RWGB 5KSVB 4F7CB 5IBUB 3D18A 4BFBD 3MLVH 4JLRA 3FO9B 4N68A 1NCWL 4L4VB 2P8LA 3TNNA 3PDOB 2I07B 3M07A 3T04D 3BWAB 1DQMH 4HMCA 2XA8H 2HTKC 3N1QC 1IAIL 3SGDH 1GPOL 2FEDD 1NAMB 5D2NB 3T0WA 4NQVA 5D2NC 4EI5C 1D5ZA 4PJIB 3VFUB 3MRKB 1LQSR 1RZFL 2H2PC 1U3HD 4OCYH 1FO0B 4ODUA 5CINH 5TPWL 5HYJB 3W9EA 3CSYB 4CW1A 4G8EB 2BNUA 5BRZA 1AGEA 5DHYA 5ACLA 5EB9A 1J0IA 4U6XA 1MHCB 5C0FB 2D31A 5KZCD 3HNSL 1NBVH 1J1PL 4UT7H 3HZYA 5DS8A 4D9LH 5C0BE 1RQ5A 5A1AA 1RU9L 5IMKB 1GC1H 2DL9A 4HJJL 3L95B 4I0CC 3O2DA 4WW2C 5ALCL 2AW2A 1I7ZB 3FB8A 1E4KA 2DYPB 2KH2B 4ESKA 1KLUA 3EJJX 1YECH 1PJ9A 4CVWA 4NQEA 3N1PC 4LEXL 5FA4A 3DXAB 2ZCLH 1XGQB 5ITFB 3BZEB 5CGYD 1DANU 1AP2B 1ZT7A 1GGBH 2D7NA 1YEJL 1QSEE 1QRNE 1OSPL 2ZCHL 3E6FB 4U1GB 1EO8L 3P2TA 1NBQA 1OB1A 2R56H 4G6FB 1T7XA 4ZYKB 5I2IA 3MCLH 3QXUA 2EYRA 4D2NA 3RUGF 1BZ9A 4NQTA 1AXSA 2KKQA 4OZFA 3E3QE 1MJ8L 3W0WA 4XNUL 5IG7A 1VFUA 2WBWB 1WFNA 3MV8B 5LGHL 2C3HA 3BWUC 4M7LT 4XPBH 4OQTA 1JPTH 4WFGD 3TNMA 4TUOA 1BMGA 3P40A 5L6YL 1JNNH 3KPPA 3IXTB 2OTUB 5DD3H 1EFXB 5D2LA 1WSST 5B39B 4JAMA 4UOW0 3SKNA 4PJBF 2X6MA 1B6DA 2N56A 3L3KB 4NN6B 5E6ID 2BHZA 4M00A 2O93L 3MUGA 2R15A 4P5MB 2E8YA 1AGBA 4Q7DA 3PGFL 4YH6A 2VKWA 4UQ2B 3EIFA 5F7UA 3C60A 5D93B 1M4KA 1IBGL 5ESAA 1M7IB 4X6CB 4XPTL 3LKSB 4J6RL 3U9UA 3VFWB 1KCRH 2P48B 1HXMA 1DQJA 4Z7WE 5JW5A 1XGRA 3NTCL 4JPVL 5EZIH 2ZOLA 2EZ0D 2DTML 3PQYB 2H26B 3FAXA 3AY4A 3O81A 1EUTA 4Q9CA 3UTQB 1UQSB 3UAJC 2FZ3A 2AJXL 4YDKL 3V7MA 5BVJB 4O9HH 1OSZB 3GB7A 4RMVA 2QR0A 1U92A 6FABH 5F3HA 1S7WB 4JANB 2XN9E 3SDDB 3LPFA 4OLVH 3NFSL 1HKLL 4H0GA 4U7MA 2BNRE 3IFOB 3QIBB 1ZSDB 4YBQC 5F1IA 4MA3B 1UB5A 3RIAF 3BIAX 3SE9L 3FQUB 4P57A 3ARDB 4KJPC 2G5BB 4FFYH 5K93A 3MMEA 4NCDA 1TZGH 4OKVB 2PO6A 2XZAH 1ZLUK 1BJMA 1GOFA 3SE8L 1QBLL 5KW9L 1O5DT 1A1MA 1X5YA 3QIWD 4PJXA 4JO4L 1EHLH 3GMQA 1CLCA 4J3TA 3SDAC 3HZVB 5ERWA 3L3DB 3WFDH 3GI8L 3O6LH 1DVFD 5EUKB 1I9JH 4KQ3L 3FRUB 5BS0D 2JCCB 1KXQE 3QBTB 4YWGL 3WLWD 4MD4A 4R2GD 4TUJA 4HULB 1DFBH 4WWID 1UENA 1J87A 1SQ2N 1YPZA 5SWZB 3DRQB 3MREA 2J8UE 1GGIL 2IG2L 3UBXB 1NC4D 5DI8B 2BOCA 2GT9B 3RAJL 4X7FC 2Y6SC 4K3DH 4YO0B 2VN7A 3IFNL 4LRIA 1A14L 1CF8H 1ZVYA 4S1RH 4XGZB 3VWJA 3WL9B 3O8XB 4NIKB 5BXFA 2FX8H 4HUKB 4PRBA 3D87B 4NHCL 2NXZB 2FB4L 2XTJD 3O8XC 1EO5A 2AJYH 3MNZA 3U0WH 1CD9B 5IB2A 1AGDB 5L2JB 2NXZC 4I3GA 5EIVA 4ZTOH 2ZJSH 3QUZA 1BFOA 3LH2L 5ESQB 1RHHB 3DX7A 2P7TB 2IPUK 4D8PA 3W82A 3LKQA 3BDBA 4Q74A 5FM5M 3CFKB 2WQRA 4PGZA 2F54B 4OZIF 2VLKE 3K4AA 5E5RB 3SDXF 3BMVA 4ZOEA 4Y19B 2WMPA 4G6ML 3OGCA 4AM0A 3FKUS 2DM7A 4M7KH 3OKKB 1UCBL 4XP4L 2DBLH 3LKOA 4HWEH 5IJKC 3EYFA 1T0MA 5F7DB 4UINH 5D1XA 3TO4B 2VDMH 1SY6H 2DL2A 4GRLA 4HWUA 4P9MH 5JDJA 1KIQA 1RZ8B 3OB0H 4ORGA 1MWAH 1XH3B 2IADA 1WZKA 4FQLH 1IEAA 3IETB 8FABA 4HPYH 2DYPD 4UNTA 4WENB 4H1LB 3I3EA 2F9BT 1WBYA 1TVHB 4XPGH 4XMKL 4PJ5A 3D3VA 3IRPX 4NUGL 2F19L 4KKAD 5JW3H 4FQXC 4XX1G 2QHLA 2VR4A 1XIWD 2X05A 2HFFA 3H42L 1JHKL 4GOSA 4NBXB 3F12A 4ENED 2CUIA 5T1MB 15C8L 2O5ZH 3CFCH 1H5BB 4RFEB 4G8GA 3D5OF 3DYPA 2OK0H 4QXUH 4RFNB 5HXMA 5IROA 1H5BC 4KKLD 5IW1B 3ARTA 3P4OB 1IGTB 1J7VR 4P9HC 1DBKL 4P3WA 3C09C 3TZVA 4DAGH 1CYGA 4JFYB 5C0IB 1NFDE 5ACZA 4RGNB 3VGAC 4KDTA 3G5ZB 4HS8H 4QRRA 3QR2A 1OAQH 4Y5XA 1HOCA 1KULA 1E4XH 4AEIL 5I1CL 3AM8C 5K9QG 5JXAL 3NZ8B 1HSBB 3UTSD 4KROB 3UPAA 4Z7OF 5ESVA 3T0AA 1A3RL 3REVB 3QUMH 4KROC 4Q58C 1ZLWK 4V1DD 3PXHA 1MCEA 3U79A 4N5ED 3BVNB 2FGWL 4Y4FC 2BFVL 2ITDA 4AL8H 1MHHB 4O58L 5F7KC 1WBXB 4JHBA 1B0RA 5INDB 4CDGC 4YHLH 1AO7B 3MODL 5F7HA 4BZ2H 3C6LA 2NX5A 5C08A 4KUZH 2ERJC 4NJAH 4PJAA 2ATKB 2XXCB 3CSBA 4G43A 4QCIB 3NAAH 3QI9D 3C8DA 5D1QD 3O3BB 4TNWF 4GAYB 4M8VA 2BDNH 1JNHA 1DQLH 3SDDD 2VN4A 3MXWL 5GJSL 4OFYD 5IV2B 1EXUA 1P1ZB 4XVUC 4H0HB 4LAQL 3RVVC 4NM8H 1RJZB 3OX8A 3V52H 5B38B 2JJTC 2YD7A 3ARDD 3CU7A 3TYFA 4JGJA 1MNUL 4JHWL 5AUMB 4HGWB 5FUZH 3FO1B 3IDMA 1PW3A 5IIEA 4EVNB 4U2ZA 3VXQB 3WE6A 3HC3L 5BVPL 1U8KB 5L2KA 2CKBL 1RZKL 1T5XA 1N4XH 1CICB 2VIRA 4EXPX 3I9GL 4P2OA 4X8XA 1HWHB 1T6WA 2XICA 5DZLA 5F9OH 3SOBH 2H1PL 4NRZB 1CFTA 4M48L 4FQJL 3STLA 4K3EH 4BJLA 1TJGH 5F6HI 1DBJL 3JV5A 1CGUA 2GCYA 1F3DH 2P8LB 3TNNB 5TF0A 2DWDA 2GK0A 1JL8A 1Z9SA 1CFVH 4E0RA 3BRDA 4KKCC 2FEEI 4QHUA 4K2UL 2OX5A 2VABA 1MFCH 2PF6A 4LMQI 5C7XL 1I1CA 1X5IA 3MROA 5SX4H 1KB5L 4NQVB 5CSBA 5F71A 4LVNB 4MXWH 1DQDH 1NBZA 2N4IA 3W9EB 1F5WA 1I1AD 5FGRA 3BKJH 2R8SL 1RSFA 5SWSD 4R4FH 4CW1B 1OGAE 4I9WD 2BNUB 4LDEB 1AGEB 4FP8L 5DEGA 5DHYB 5BRZB 1U8IA 2FD6H 1M6OA 5INCA 4X5WA 4U6XB 1X5FA 1KB9K 2CR3A 4HH9A 2D31B 3RU8L 3MRRB 4HLJA 4QRPE 3HZYB 3TVMA 5DS8B 3FTGA 2QHRH 2GI7A 3WCYA 4LSPH 1RK1A 4Y19D 3KPRE 4LLWA 5HJ3B 2HH0H 3WIIL 4OD1L 2V5SA 2WSKA 4DK3A 5JZ7C 3EO9L 3FB8B 3B3IA 3EJZD 4AEHL 1PG7H 4NQSA 3VXME 3B5HA 2X9WA 2FWOA 1M7DA 3TO4D 1EH9A 5FA4B 2G60L 4YXKH 2ZUWA 4UUJA 2YWYA 4QHNA 2X4RA 1ZT7B 1I7TB 5JO5A 3KVQA 1U91A 4XHQA 3SGKC 1KCUL 4NDMA 3N85H 5I15L 4E41A 1T2QH 1IC4L 5TE7H 5J57B 3MLTA 3ARRA 4QRQA 3HAEA 4K3JH 5I2IB 2R1WA 1DBAL 3EO1A 2EYRB 3NCFB 4MVBD 4JFHE 4PJIF 1BZ9B 1AXSB 1T20A 4OD3H 4OZFB 4YDVB 3W0WB 5IG7B 4NM4H 1Q9WA 4LLMA 2DM2A 3WDHA 3VD4A 3TNMB 5LKNA 3KPPB 1EEZA 1NBYA 2BSSA 4WVRA 2HFTA 3CDCA 2FEEL 5D2LB 4JAMB 1KCVH 3SKNB 5CIPB 4OCWL 1LO0L 3MJ6A 5E00B 2FH6A 4ODSH 3LQAC 3KYNA 4JRXA 2CRZA 3DO7A 3MUGB 3TM6A 1WFTA 3D2UA 4RGND 1TQBB 4RISL 1AGBB 1OWWA 1T0PB 2MJWA 4WHTA 5DDHA 4FFVC 5E94B 1MJ7H 1VENA 4LKXA 4PRIE 3C60B 1L9MA 1BBDH 2BERA 1TQBC 5E8DH 3S37H 4YDJA 4DZBA 3IU3A 3QXWA 4KK9C 3U9UB 3TPKA 3C60C 1HXMB 1A7NH 5D9SB 2CRIA 3T2NL 1DQJB 5JW5B 1XGRB 5EO0B 1I8KA 5IHZB 4G8FA 2ZOLB 1X3DA 2MPAL 3QJHA 3CUPA 4CRPA 4LMQE 1UWXK 2DIAA 2FZ3B 2YPLA 3GB7B 5B38G 2QR0B 1U92B 5F3HB 4YQXH 1YQVL 5DO2C 4MS8D 1GL4B 3MV9D 5FHAL 3RZCD 2A6JA 1BEYH 1BWWA 4HXAL 4UTAH 3JUYA 4R0LA 2CLVA 4KJQC 3RKPA 3F8UB 5F1IB 3LKNA 4OF6A 4NBYB 1UB5B 3OG4B 4JPIB 4P57B 1IFHH 1JYVA 4Y5YA 2OR9H 5FHBL 4L3CB 1DBBL 3IJSA 5E7FA 2WP3O 3T3PE 3MMEB 4DN4H 4HQQH 3QIUA 3I50L 1FVCA 5IHBA 4XP9L 1RAMA 3EDFA 4MXVE 4HFWA 3T0VA 3P0YL 2X41A 1A1MB 2XZZA 4JY5H 4PJXB 2PO6C 3GMQB 3KXFB 1S7XA 3LB6C 4X7SH 5E2WL 3RIFF 3ZKMD 5ERWB 1T03H 1OP9A 4MZ2A 3LD8B 4G7YL 1MCWW 1B2WH 4YPGA 3ARXA 1CICD 1T7VA 3FJTA 3LD8C 4KFZC 3VWKC 4TUJB 3QXAA 1HHKA 4EIGB 1YPZB 1HINL 3TA3D 2XA3A 2XACC 3MREB 3IVKA 4H8WL 3RBSA 4MNGA 4OM1L 2BOCB 3BP5A 3TJHC 4MA1C 4GBXD 1FL5A 1A6VH 1HQ4A 3KYOA 4PRBB 4LRIC 2IAND 2APVA 3HI1B 3VWJC 3MNZB 4N0YH 4WU5A 5IB2B 5IQ9B 1PDKA 1N7MH 4PUBL 1VFBB 2YK1H 2WBJD 2HVKA 5I1JL 1C5DA 1S7RA 3X14A 5IT2L 3EFDL 3QUZB 3GHBL 1BFOB 1HIMH 4LOUD 3DX7B 3QXTA 4D8PB 3IJYB 3LKQB 4BFIA 4M1GL 4OZHA 1EEUA 3F6LA 2VAAA 4H20L 4UV4H 5HHVL 5BRZD 3KLHC 1U8PA 5K9OA 3KLSA 3RVXD 3GSNA 3OGCB 4AM0B 4TSCH 1QFUL 5EU6D 1AKJA 1RFDL 2A6KA 4RX4A 3QCVL 3LKOB 4AG4L 3EYFB 1VA9A 3RPIA 1FNGA 5LCVH 2JCCF 2XY2A 2DLHA 5D1XB 4P4RA 4GRLB 1KIQB 4ORGB 2F58H 5IJVB 2HKFL 1IEAB 8FABB 2ESVD 1T66D 1MFDL 4GRLC 5IM7A 4MQ7A 2NY4B 4J1UA 3RWJA 3B8SA 2A6DA 1WBYB 4TSBL 5K59E 2XZCL 2VITA 5I1EL 5I8KH 1KTKE 4PJ5B 2NY4C 3K2UL 4U7KA 3D3VB 1IC7L 2AV1A 3JUZA 3VCLA 6CGTA 5EO1A 3RWEA 1DN2A 1FAIH 4TNVF 2HFFB 1T2JA 1PVHA 4X9FA 3F12B 3IU4H 5EUOA 2YZ8A 2XOTA 3O11A 1Q9LA 4G8GB 4BSVA 2Q76B 3HMXA 1HNGA 4OJFL 2VDQH 1LILA 4YUEH 1X6NA 3PWJA 2X1OA 3TH2T 1T5WA 3U9PL 5F1SA 3DOSA 3QUXA 4XNYH 5IROC 1FFRA 3WIHA 3TZVB 3MV01 1E4JA 3VXUA 3VFGH 3QEGH 2I60H 1MCDA 5ACZB 5CKAA 4ODXA 3TZVC 4QRRB 3DTXA 3EZ8A 4AY0A 2QQNH 4Y5XB 4MD0B 3T1WA 4JM2A 3NFNA 2EEDA 2DAVA 4KDTC 2YD1A 2FBOJ 1YJDL 3LDBC 4FG6D 2ID5A 5E08L 5ESVB 5GGRA 2HFGH 1CDJA 2Q7YA 2V7HA 4K94H 3WBDA 1WWWX 3RBGA 5DWUH 1T1WA 3HE7A 3MJ8B 4ZO7A 2PTUA 5CEZD 2ITDB 3HC0A 3BRGC 3MLZL 2YBRA 1CTNA 1MEXL 3BQUD 4W68A 1GHFH 1KIPA 1U8JA 4E42A 3C6LB 2NX5B 5C08B 4OCSL 2ICEA 1BD2D 2Q1EA 4M6OH 4PJAB 3U0PA 1MCLA 3QPQD 4G43B 3C6LC 5DURB 1A9BA 5LBSH 2DOCA 4PRHA 5CIPH 4DKAA 1JNHB 2EXYD 3WFEH 4N8PA 1IC1A 4L9LA 2W1NA 4NKOA 3QFJD 1EXUB 1L7TL 3H9YA 3DX8A 3ILQC 1YN6A 4UILH 5E2VH 1PX4A 2LU7A 4APQA 3CVHL 3HMWL 3OX8B 2W65A 4HX1A 4LSVH 1A7QL 5C0BA 1U6AL 4YK4B 3TYFB 4HC1H 4RQQA 1QSZA 2O5YH 5IMMA 4OSUL 5CEZH 1U58A 3T0XA 1A7OL 3CFBA 4K9EC 4YK4C 4W4NA 1CFQA 1MI5E 3IDMB 3QPXL 3BUTA 5IIEB 3BEVA 4OGZA 4UTBL 2OP4H 3LN5A 4RBPH 1LO2H 2EH7H 3WE6B 3WNMA 5L2KB 1OAUL 4GQ9L 1T5XB 3KXFD 1LEGA 2MSPA 5TQ0L 4ZFOA 4P2OB 5CEYA 1C1EH 3AREA 3T0BA 1RUPH 1CFTB 3STLB 3BT2H 3ZDYE 3VDCA 1QSEA 1QRNA 3SDCA 3U4BL 2GCYB 1JHTB 4M6ML 3STBA 2W60A 3QDAA 1F42A 5EBMA 2DWDB 2GK0B 1ACYH 4EBQL 4CL7A 1NGWA 2BCKA 2FH8A 4NO3A 4CU8A 4E0RB 4X9HA 3C6SA 3TN0C 4RMWA 4QHUB 4GRMA 2VDKH 2D7TH 4XCEA 2VABB 4C55A 3ULVD 2VLMD 1EZVY 3MROB 4UIKH 3VGEA 4JPWL 5IFAL 2ARJA 5LXGL 1KUMA 2O5XL 3LKRB 2VLJE 5D7KE 3A67L 3GI9L 4K7FA 3D25A 1WCBA 2JJSA 2AV7A 5I0DA 3ILPA 5GZND 3DPBA 2PXYD 2VDNL 4MQXC 1KEGH 3AC0A 2VZOA 3QUZD 3L3IA 5DEGB 3IDJA 1I3VA 5IFHH 1U8IB 1JMZA 4L3AA 5C0CD 3DMMA 1M6OB 5INCB 3U4AA 4X5WB 4EKXA 5I73C 5KSBE 4HH9B 3SGEI 3WYRA 4N0FB 1TCRA 2DQTL 3FCTA 3FTGB 1WUNT 4KPHH 1RK1B 4HUVA 4LLWB 1IARB 4I0KA 3TVMC 1LDPL 5T3XD 2ENYA 1Z9OA 3ORJA 4Z7WA 1UM5L 3B3IB 3ULVH 1JGLL 5HI3D 4MB3A 5HD8C 1ZT1A 2FWOB 3GBNL 1M7DB 2QQQA 4UUJB 1QZ1A 2BX5A 3S6CA 4QHNB 2X4RB 4FQ1L 3P11H 1F90L 5JO5B 1U91B 1G0XA 1AR1C 3I6LD 2UUDH 1ZANH 4NDMB 3T1FA 4L5FL 3T65A 4GAJH 4E41B 1PLGL 2JK5A 3MRHA 2XN9A 3MLTB 4QRQB 3P9WB 3HAEB 1MAKA 2R1WB 3EO1B 3SKOA 3TH3T 3HUJE 3RQ3A 35C8H 1KJ3H 1T20B 3D39D 1QSFA 2BNRA 3K8LA 4P3DA 3PL6D 5DMGC 1II4E 4LLMB 1TDQA 1CDBA 3FN0H 1UJ3A 1NKOA 4NN7B 3WFCL 4PRPE 1VB9A 4W81A 5T3XH 1EEZB 2P5EE 1NBYB 4LRNH 5GGUB 1HYSD 4LPVA 4BSJA 4NN7C 3BW9B 4W4OA 3QCTL 3OKYA 4N90E 5T1LA 3QYCA 4Y1AE 2YRPA 4OFIA 3KYNB 2X70A 4JRXB 3FQRA 2PKDA 2L7UA 5BW7A 1T1ZA 3DO7B 2COQA 4XP6L 1JUFA 2NR6D 3D2UB 4WHTB 2OM5A 4KJWC 1QFWH 2YUWA 1PEZA 4LKXB 1CXEA 4PJFE 3NIFF 4U6VH 1JNLL 4YDJB 4Y7MA 5IEHA 4LIQH 2J8UA 5EDXA 4BFEA 2IBGA 2B0SL 2UWEF 3ARFA 4YHIA 4P49A 4G8FB 1AE6L 1IGFL 5D72H 1N64H 3BN9D 1NCAL 1FRGH 3QJHB 4IDJL 2FX7L 4M5ZH 4OF8A 3CUPB 1QA9B 4KTEL 1QPXA 2J8OA 5A16A 2BK8A 5BJTA 2YS4A 2YPLB 5GS2D 2WK2A 1ZWIA 4ZFFA 2B39A 3VD5A 1N5AA 3HG1D 4Q97A 4GXUN 1IGIL 2NCMA 5JQ6H 1J0JA 1FNSH 1A1OA 2PYED 3RVWC 1BF8A 4FQIH 4QRSA 3L6FB 4LSTL 4R0LB 2CLVB 4Q2ZA 1QBBA 1OWRM 1OP3H 2IBBA 1MJJA 2VLKA 1F3JB 4R0LC 4XVJL 4ETYA 2J8HA 1J5OH 4Y5YB 1S8DA 3MRLA 1MFEH 1SYSA 2OL3A 3IJSB 2XI9A 3T0DA 2BJMH 4RGMC 4H88L 1HSAA 3QIUB 1FVCB 2JELL 4Y5YC 5FYJU 5TDOA 3CX2A 4OZ4A 3QIUC 4CVZA 1S7XB 4JFFE 4M4RA 2VR5A 1EPFA 5C09E 2MHAA 1K6QH 1MVUB 1CLOL 4PJ7E 4KKBD 4WV1B 3SN6N 3I6GA 5GS2H 4YPGB 3LPGA 1QLRB 4IRZL 2YSSA 3GSQB 3UJIH 4P2OD 1MF2H 1RURH 5GRZA 5FGCE 3QXAB 1HHKB 4OGAC 3DVFA 3GJFK 4X7EC 4DTGH 2Y5EA 4AENA 5EOCH 4JB9L 1ZHKA 3IVKB 4I3SL 4MNGB 3L9RA 3BP5B 4I18C 3EYQC 4LBEA 3V0WL 2CMRL 1MIEH 5T5FL 5EOQL 1LDSA 5DFWH 1HQ4B 1WICA 4WFHE 3KYOB 1VGEH 3LMJL 3FOMB 1PBYA 3EOAA 2IPTH 1RZJC 43C9A 4OF3A 3TIEA 4BSWA 1SBBA 1C5DB 3UPCA 1S7RB 3GEWB 4X4ZA 3MLXH 2EIDA 1HYRC 1NCBL 2E6JA 4X5LA 5JOPD 1JWMA 1NFDA 3V4PH 3L3GB 4Z8FH 5DD1L 4BFIB 4OZHB 3CFJA 4WHDA 2VAAB 5D7IA 3IF1A 4PB0H 4PJXF 1CIUA 1U8PB 1JZ7A 3DX6A 3GSNB 1XF4B 1DLFL 1Q0YL 1A2YA 3BPNB 4P3CH 3BD4A 2A6KB 1KBGH 5DC4B 3H2WA 1FNGB 5B3JE 3L3OB 1D3CA 2X42A 1FIEA 3Q0HA 3KLDA 3QUYA 3HAEG 1UACL 1A6ZA 2PTTA 3UCRA 3LRSA 4IOFD 1IAOA 3QXDB 5DUMH 4JRYA 1YPZF 4HFUH 4IEFB 5C6TH 4MQ7B 2N1KA 4J1UB 3RWJB 2A6DB 4N1EA 2E7CA 2VITB 1K2DA 3T09A 3QDME 5DJCB 1BPVA 5DJ6A 5IHUL 2AV1B 3VCLB 3QDJD 5EO1B 3RWEB 3PP3H 5J89A 1IKFH 1F97A 1L7IH 2R1YB 4EUPG 4PP1D 4P5TD 1ONQA 4GSDH 1JPSH 3AS1A 3DUSA 3GMLB 4R8WL 5EUOB 1TQCB 3O11B 1MCIA 3MLVL 4BSVB 4JQVA 4AH2A 3WHXA 4ODTH 4JQIL 4ISVA 5FGBA 3O3EB 2P47B 3ZKQD 3J8F7 4ODVH 1MJUH 2YD4A 3PWJB 4MDJA 4PJCA 4WTXA 4G42A 1DQML 4XNMA 3QUXB 1G0DA 3G5YA 4JZOA 5DXWA 3VXUB 1AD0A 1E0OB 1GRWA 3MOAH 4ODXB 3HS0B 5CUSH 4XAKD 2I26N 3DTXB 4YR6B 4KV5F 1FG2A 1YEHH 1WIPA 2VH5H 2N7AA 4JM2B 4G3YH 3NFNB 2B2XH 3IDXL 4OCYL 2H3NA 4OT1H 2X4QA 2NY7H 1X5KA 4PJDF 4P46D 4JM2C 5GGRB 2Q7YB 2V7HB 3KPQA 1T1WB 3HE7B 3T8XA 2Z4QA 4MD5A 5JOEA 2O61A 1KOAA 3AVEA 2YBRB 3HE7C 3PF2A 5FAAA 4LPUA 4O4YH 1NBVL 4UT7L 5D70H 2PW2A 4JZNB 4D9LL 2I9LA 1U8JB 1GC1L 4E42B 2H2SD 2CKBA 4N8CH 2IAMB 3D85B 3U0PB 5CJ8A 5AEAA 3CXDL 2XTLA 3G6AA 3HRZA 4EUPH 1YECL 1A9BB 4J23A 4ZPVB 2F5AH 1JJUA 2QSCH 4LASH 1OGAA 2CLZB 2ZCLL 1OOAA 1J8HD 4YBHA 5I76A 4L9LB 4NKOB 4FQCH 4Y8DC 3DX8B 3L1OH 4ZMAT 1YN6B 4GW1A 1GGBL 5EZOH 4EDXA 1SJEA 2XWTA 1G7IA 4QRPA 4L9LC 1V7NL 2W65B 4HX1B 5FEBA 5C0BB 2R56L 3OXSA 3NIGF 1U8HA 3VI3E 3D1MC 1ZHLA 3KPRA 4RQQB 5IMMB 3MCLL 1I7RA 4APQC 1KCSH 1U58B 5JXEC 1PQZA 1V3JA 3CFBB 1F02I 2Y23A 3BEVB 1KB5A 1QRKA 3D6GA 5KVGL 1QBMH 3VXMA 5DD6A 4KMTL 1EO7A 4XPBL 3V0AC 4L3EE 1JPTL 4JFZH 1RIUH 3RJDA 1LEKA 4Z7QF 1K4DA 5CEYB 1JNNL 3WEXA 1EA9C 3AREB 4JY6A 1YUHA 2HTKD 5DD3L 1QSEB 4F33A 1QRNB 4TQEH 4TULH 3SDCB 3LCYA 2ZUQC 2JTDA 2VXUH 3AREC 4FHBD 4JHAL 4ZNEE 5EBMB 1NUNB 3SDCC 3D0VA 1NGWB 2BCKB 2K7QA 4PJAF 3C6SB 4XMPL 3MLWH 4GRMB 4XCEB 1FLTX 4GRWB 5L0QC 2GJ6A 3CZJA 1F8TH 2ARJB 4MA7H 4OIBA 3UP1A 4OIIH 1MRCH 1Z0MA 1FZOA 5IMLA 1PAMA 4WFFE 1KCRL 2W91A 2AJ3B 3D25B 2DLGA 3EYVA 4JFEA 1WCBB 5DMKA 2AV7B 2XFXA 3ILPB 5EZIL 5HI5C 3B9EA 4NN5C 1WISA 3QULA 2JJSC 5GQBA 1D6EA 1JPFA 5FA3A 5C70A 3NIDF 3L3IB 3IDJB 3KPMA 2R0KH 3DMMB 3CH8A 4TVPL 4QT5B 1CU4H 4ZUUA 3RDTD 3C87A 4PRIA 4YHNA 6FABL 4KRNA 1T7ZA 1TCRB 3DMMC 1YMMA 3FCTB 3TF7C 3IYLW 4HUVB 1S9YA 3RL2A 4J4PD 1W2KT 4OLVL 2VSCA 3RY6C 4ODBD 4Z7WB 2V9RA 5BMFH 1U8LA 4ZSOA 5T5NG 4S1DD 1VKXA 1F3RB 4MJ6A 1ZT1B 5DUBA 4OD2B 2X4NA 1L6XA 1HHJA 1I1FA 4FFYL 2HLAA 3KYMA 1TZGL 2XZAL 5I1HH 3T1FB 3T65B 4WFGE 1S9KC 1Q94A 4OUOA 2R29H 2B4CC 2JK5B 2VQ1B 3GMOA 4NP4H 1EHLL 3MRHB 2XN9B 2QADC 4TVPE 4YHPA 3UTZA 5B8CA 3SKOB 2DS4A 1KPRA 4IMLA 4U05A 3WFDL 3O6LL 3KAAA 5B22A 1QSFB 2BNRB 4P3DB 4QGTA 3DX9A 4LCCA 2HJLB 1RUAH 1UJ3B 1D5MA 4EI6A 1FVDA 2D9QB 1DFBL 3BSZH 3PHQA 1LO4H 3FB7B 2EDTA 3QQ3A 3S3PA 3AS0A 4K3DL 5DR5H 2VZ1A 5HBBA 2EC8A 1EVTC 4F58H 1X9QA 2ZG3A 1CF8L 3FQWB 5T1LB 3O9WB 4W4OC 3T4YB 3RGVD 5GS1A 1H3UA 2X70B 3FQRB 2CRYA 4Y2DA 1BFTA 1JUFB 2AJYL 3U0WL 2DMKA 4I0PA 3BKCH 3SQOH 1E4XI 2ZJSL 3GIVA 4HCRL 3S7GA 3UJTH 3ETBF 3MCKA 4YDIH 2J8UB 4FTVA 1X5GA 5KANG 1RZ7L 4BZ1L 1BFSA 1IGCH 4YHIB 4Q9QH 1CZ8H 1G7PA 2VRAA 3DVGB 1NLDL 4WFEE 3ARFC 1WAAE 2FRGP 3G08B 4EQ3A 4UI2A 1TZIA 1FFNA 4M7KL 1P6FA 4U6TA 4M1DH 4KRLB 5A16B 4HWEL 5BJTB 1F3DJ 1M7XA 4I13B 3G04A 1ZWIB 5FOJA 3HPLA 4ZFFB 1CS6A 1N5AB 3UZEA 2VDML 1SY6L 4KJPD 3WIHH 1MWAL 1A1OB 2H32A 3MFFA 4O2CA 2IAMD 1I3GH 3D85D 4FQLL 4WO4A 1EBPA 4HPYL 5CJOH 5DJ8B 4QRSB 5F96H 3GRWA 2MCPH 4Q2ZB 3OV6A 2VLRA 2E6QA 2X9YA 3VFOB 1FHGA 3NCBB 1YZZA 2VC2L 3CU1A 2VLKB 2NZ9C 4XPGL 3P4LA 3QQ4A 2P8MA 5IEKA 5FO8A 1S8DB 1T89A 3DV4A 3MRLB 1SYSB 5BS0E 3O45A 3VXSE 3RVUD 2IF7A 3EJYC 5JW3L 1HSAB 5E1AA 3SDYH 5TDOB 4ONGH 1JGVH 3CDFA 4OZ4B 2CLRA 5KVDH 1FNHA 2EDKA 4GAGH 5I1GL 3VXNB 1CG9A 3PWVA 2O5ZL 3CFCL 3Q6GH 2MHAB 3TBWA 5H35A 5E9DD 1OTTC 4PG2C 3I6GB 5JPNA 2OK0L 4QXUL 5GRXG 1A7RH 5TQ2H 5EO9A 4D0BA 2YSSB 1K8IA 1UZ6E 2GSIA 4XPAH 2VXTH 2DM4A 2XTJE 2C4FT 3G5VA 4PYHA 2V17H 4DAGL 2DMBA 2IFFH 4AENB 1ZHKB 1F4XH 3GDBA 4KK8C 3L9RB 4HS8L 1OAQL 1E4XL 3DROA 5IVXE 4P48A 4P2RE 4KXZI 4LCYA 1EGJL 4MCYA 4RAHA 4D94A 2HVJB 2LTQB 2QLVB 1TCMA 3EOAB 4UNUA 5EBLB 3QUML 43C9B 5E4EB 1CR9L 2K7PA 5AYQA 4U2YA 3TIEB 2LTQC 4KRPB 4BSWB 1IGMH 3GKWH 4AL8L 2EEAA 3CLEH 3JTSB 4DGIH 3O41A 4P59H 3TBVA 3VH8A 3W11D 4KRPC 1CD8A 1JWMB 1NFDB 1Y6MR 3IDYC 4DVBA 5GRJH 1OY3B 5ICYA 4BZ2L 3T0EC 4BQCA 3T08A 3IF1B 3P77A 4NJAL 1X5JA 3DX6B 1ZA6A 1A2YB 4OZGF 3NAAL 1L6ZA 1CE6B 4CVUA 3F6IA 1DQLL 4XHJC 1BQSA 2GQHA 2J6EH 3HNSH 3QUYB 1MHEA 1A6ZB 3LRSB 1IAOB 3OAUH 4JRYB 4NM8L 3V52L 3QUYC 4IRSB 4NNXA 4WNQA 5SV4A 5AG8A 4HMDA 3QCUH 5IB3B 2VDLL 4B50A 4Y89A 3UZVB 4NQCD 1K2DB 4HIIA 5I6XB 5L8KB 1IAIM 5FUZL 1XGYL 3IAPA 5DJ6B 4LEXH 4ZXBC 5I6XC 2O26U 4ZUSA 1WZMA 1N4XL 4NZRL 2JIXD 5CD3A 2ZUUA 5F9OL 1H3PH 2XKNA 3DUSB 1LP9F 2ZCHH 3Q5OA 1X5AA 4RWYH 1TJGL 1YC8A 2AXFB 2NY3B 4AH2B 4NBZB 4MAYB 4KVNH 4OZHF 2HT4D 4ISVB 1MAML 2NY3C 4XNUH 4C58B 4JQVC 4MDJB 4PJCB 4G42B 2D0HA 1MI5A 4CGTA 5FGBC 3JWOC 1V3MA 3UZQA 1ROWA 2RR3A 1MFCL 3G5YB 3GSWA 4JZOB 1AD0B 3SO5A 3QISA 2J1KA 4V1DE 5EN2A 5T1LD 4ZO9A 3K80A 1B6UA 3O9WD 4HIXH 2ZUSA 3N0PB 4QOKE 1FG2B 3AFLA 3JBG7 4MXQD 3MNVA 4MXWL 1I8LA 4Y4FD 5IBTH 3GMRA 2H3NB 2X4QB 2W9LA 1U8QA 2NXYB 1Z0NA 3BKJL 4OM0H 3KPQB 4R4FL 3T8XB 3VGFA 4MD5B 3CVHA 2O61B 4XCFL 1KG0A 4G6JH 2R0ZL 4X6DA 2F15A 2PW2B 4ZODA 1HXYA 5FXCH 2QHRL 2HH0L 4PBXA 2E9JA 4DFHA 2CKBB 4X6FA 3R0MA 3ROOA 3HRZB 3AU1B 3TP4A 4LSRH 5AWNH 5F1NA 4YXKL 1RZKC 1OGAB 2AJXH 5I76B 1FVEA 2B5IB 3U46A 1AFVH 4GW1B 5SX5K 4EDXB 1SJEB 2XWTB 1G7IB 4QRPB 1OAXL 3Q2CA 1T2QL 5TE7L 1U8HB 3GO1L 3G6JE 1ZHLB 3KPRB 4K3JL 1I7RB 5DK0B 4X6BA 3FT4B 3MRMA 3OHXA 1OL0A 1PQZB 2CRMA 4JM2F 3U1SH 1KELH 2AJZA 3SE9H 2V5YA 1MH5A 4NM4L 1KB5B 4Z7VE 3VXMB 4AEEA 4NC1C 2APXA 2E5EA 1LEKB 1K4DB 2BC4A 1J1XH 3WEXB 4JY6B 1YUHB 4WI3A 4JO4H 1INQA 5MEND 3BEWA 4HAGA 4F33B 25C8H 1C16A 4PJGE 3B9KA 1KCVL 1ZLVK 1QACA 2R1XB 4LSSH 1R3IH 1OARH 2APFA 2CIKA 3HUJA 4F9LC 3D0VB 3OB0K 4KQ3H 3PABA 5T1DH 1IVLA 4M62H 3RI5F 3S5LG 5SWSE 4IIQA 3WUWG 2GJ6B 2GITA 2NY5C 1QFHA 3UYOD 4NKDB 1BBDL 5E8DL 2OSLA 1VERA 2VZ3A 1FZOB 2DJSA 2NW2A 4PRPA 4LLDB 5IMLB 2X4PA 5FYJD 2DQEL 2P5EA 3EYVB 3IFNH 5DMKB 3W9DA 2XFXB 5KS9A 1CFSA 1QR4A 1A7BA 3QULB 3M8OL 1Y6NR 3QDHA 1D6EB 1JPFB 4Y1AA 4J8RA 4HWBH 5F89A 2C1PA 4RDQF 1HCVA 1IC5H 3KPMB 4LL9A 4ZAKA 5GGVY 4ZUUB 2GHWB 4ONOA 3T2PA 3PGDA 4PRIB 4YHNB 4YQXL 1HHHB 2GY5A 1YMMB 1MUJA 4PJFA 5LJYH 2IH3A 5E2UH 2RQ8A 1S9YB 3RL2B 2Y36H 1SMAA 2XQYK 3O4OC 1BEYL 4KWUA 3U82B 1T1XA 4U1IA 1U8LB 3WNNA 4ZSOB 1C12A 4C4KT 1VKXB 5DUBB 2YA0A 1IFHL 1MY7A 2X4NB 1UCBH 1HHJB 1I1FB 2FIKA 2OR9L 1R5VA 2HLAB 5HGDA 3KYMB 5FYJH 4Z7UE 4Y16C 4DN4L 4LVOB 4U3HA 4HQQL 4IRSD 3UEZA 5DZNA 4GRWF 5DFVC 1Q94B 4ZOCA 4JY5L 4NQDA 1G9ML 4LVOC 3GMOB 3Q48A 3UTZB 2AJUH 5B8CB 1KPRB 5DMYA 1T03L 4IMLB 4LCWA 3R8QA 4M7LH 5TE4H 5K9KA 1RI8A 3DX9B 1B2WL 5B8CC 1B3JA 4OCXH 3C8HA 4BQ9A 5L9DH 5EU5A 3ISWA 4EI6B 4LCCC 1FVDB 1BF2A 4WY7H 3WFZA 4J7RA 4P23A 1DEDA 3P9LA 3PHQB 2E7HA 2XT1B 2ZZUT 5GZOC 4MAYD 1JHKH 3QQ3B 5E8OA 4O5LL 4FFWC 1CFNA 3OJ2C 2CUHA 4GO6B 3GGWA 1OT1A 1A6VL 3S36H 1GGCH 5CGTA 5CJ5A 1VCAA 4OUUA 5GS1B 4NCC2 2A1WH 4Y2DB 1J86A 4Z7WF 5E7BA 4MHHI 2QL1A 4N0YL 4GFTB 1MCPH 3IJHA 1BJ1H 4I0PB 4LPTA 1WITA 2YK1L 3T77A 3GIVB 2HYMA 2ZUXA 2E8ZA 1HIML 3DETC 4I0PC 4LHUA 3MCKB 1J12A 1REIA 5F88A 4FTVB 5C8JA 1K4CA 1G7PB 1XGPA 2AJVH 5JXAH 3MV9E 5F3BA 1YEGH 3B9AA 2N7BA 2A6IB 5T1KA 5DO2D 4TSCL 4OI7A 1A3RH 1TZIB 3AB0B 4TSAH 5HHXH 3CMOH 2Q3ZA 4OLZH 3HC4H 3G04B 4O58H 4XWOC 1S78D 3HPLB 5LCVL 5IESH 32C2A 4FN0A 4L8SA 5I30H 4OBRA 5DRZA 3IS1X 5I8OH 3OKOA 5D5MA 2H32B 2F58L 3MFFB 4O2CB 5TH2A 4WO4B 1YN7A 3AS2A 2VLRB 2IEPA 1OTUD 1ACZA 4MB5A 5E99H 3ZHLA 1IAKA 1QLFA 4D3CH 5I8KL 2EO1A 3QQ4B 2P8MB 5KOMC 5IEKB 3DV4B 5FUCC 3O45B 2B1HH 4JKPH 4KK5C 5E1AB 4H8WC 1T89C 2BSRA 2H8PA 3B2VH 4R9HA 1FAIL 3V6OC 4H0IA 3IU4L 2C3VA 3VWKD 1CG9B 5H35B 2J8UF 5DRNA 1FDLH 1ZV5A 4BH7A 5IBLD 1NGYA 5JPNB 4JHWH 2VDQL 5JIPA 4YUEL 3TJHD 4ELME 1YDPA 3QEQE 5EO9B 4D0BB 2B7DT 1K8IB 4ELKA 1QNZH 3G5VB 3HC3H 4DN3L 3TBSA 1OP5H 1T04A 4FZ8H 5FM8A 3QEGL 2I60L 2Z9TA 4XCCL 4MZ3A 1QR1A 2H1PH 4M48H 2QQNL 3BH9A 4EZMA 2R2BB 1FFOA 3DROB 2NZIA 1QLEH 1YNLH 3T3ME 1I7UB 4LCYB 3PDDA 4MCYB 1S5HA 3ARBD 2HFGL 4K94L 3VXOB 4TNVK 3PE9A 5DWUL 1C8PA 5EU6E 2JB6A 3MLRH 1ND0A 3FT3A 4TUKH 1ERNA 3O41B 3TBVB 3VH8B 1HZHH 3W81A 2R2CA 4DVBB 1WBZA 5DT1L 5ICYB 3WNLA 2OYPA 3OKLA 3C5SA 3P4NA 1CXKA 3WJLC 1WT5A 2ESVE 3P77B 3PP4H 5HDBF 4M6OL 1J0ZA 1IZJA 2KL6A 1ZA6B 4AMKH 1VFAB 3M1BA 2UVFA 5LBSL 4FP8H 4PJ9A 3KR3H 1AR2A 4N0CC 4CVXB 5I16A 2CJUL 4XWGL 1EJOH 2YZ1A 2EC9T 1MHEB 4UILL 4IRJA 5E2VL 4HUXA 2E7MA 1RPQA 1MCRA 2EE9A 4NNXB 2OBGA 4WNQB 3X17A 4HC1L 1JGUH 1EDQA 2JB5H 2O5YL 5CEZL 2GJZA 5K9JH 4OI8A 2WQ8A 4ODHL 4HIIB 4D0DA 4MSWA 4KZEH 2OP4L 2V2XA 1LO2L 2EH7L 4POZD 2L0DA 2XQBH 3HFML 4WUKH 4ZUSB 3ZMRA 3TH4T 4D9QD 3WKMH 3ZYJA 5CD3B 3DURA 5JHDE 1E6OH 1C1EL 2XKNB 3MJ9H 1RUPL 1UJTA 3BT2L 5C6PB 3BKMH 4JZJC 1NFDF 1YJDC 5J56B 4HJ0C 3KPSA 3STZB 1TPXB 5D8JH 1JK8A 4WU7A 5D7IF 4YHYB 5DLMH 2GAZA 1MI5B 3D48R 4KMLB 3LS5L 2VDKL 2D7TL 5EH1A 3UO1L 2X09A 3HHRB 4UIKL 1ZKAA 5F6IB 1URLA 3BPOC 3F7VB 4PV9A 2ARWA 2ORBH 3EDKA 2GSGB 3MNVB 4HH8A 1TZHA 8CGTA 4OCWH 3GMRB 1EHXA 4PJ8C 1U8QB 2NY1B 1I8LC 1NDGA 1HHIA 2R2HA 3EDJA 2BRRH 1CL7I 1BD2E 1U3HA 3IFPB 1T6VN 4RISH 5F7NC 5IFHL 4XPFH 3F65A 1H15A 3CVHB 3NCYS 4E9LA 1DTUA 3PXJA 4XNQA 3ZTNH 5H37G 1OF2A 4X6DB 5FIEA 2E7LA 1SVCP 4LCIH 4JVWA 1HXYB 3QFJE 1U3YA 4KPHL 3CFIC 2DRUA 3T2NH 3CK0H 1KJVA 2C3GA 2EKSA 1UWGH 2V7NA 4X6FB 3ILQD 3MRQA 1QKZL 3ULVL 1MCQA 3ROOB 1TXKA 5IMOA 4I4WA 5F1NB 1Z3GH 1P4IH 3OAYK 4JFQA 4PJCF 2HTLC 1B4JL 1ZANL 3UTTD 1DR9A 4GAJL 1JGDA 2GFBA 3DGCR 4HXAH 4PPTA 5ALBH 4FABH 2NY2D 1XF3A 1ORSA 3K8KA 3QHZH 3OHXB 2PTVA 35C8L 1KJ3L 2AJZB 1NGXB 4YEEA 1FZMA 2AKRA 4WCYH 3FN0L 3MTRA 2Y25A 1OPGL 4X98A 5CWSA 3I50H 5GIRA 1N2RB 3VFRB 5D1ZC 3P0YH 3ULVE 2VLME 5T3XL 4LRNL 2DLFH 3RUGE 1SJVA 1W8NA 3KS0H 4JG1H 1INQB 3BEWB 1YY9C 4WI7A 1C16B 3ZE1F 3B9KB 4TTDD 9CGTA 3AMKA 2PYFA 2VMFA 4G7YH 2CIKB 1SEBA 3HUJB 3B9KC 3WDJA 5H37H 3PABB 3V6ZA 4K9EH 4EOWH 3VH8G 1BIIA 5I9QB 5FECA 3SGJC 1QFWL 3QSKB 2GITB 4IIQB 5E6IA 1D9KD 4O02H 2APWA 1I1YA 1W0YT 5C0CE 4MQXD 4U6VL 2OSLB 3SCMB 3ZTJG 4LQFH 5I9QC 4PJBE 4U6YA 3VW3H 3RWIA 2NW2B 4PRPB 4LIQL 3DYOA 1BQLH 2X4PB 3MBEB 3FZUC 2P5EB 3U6RB 2F74A 3U2SA 3W9DB 4M1CC 1PKQA 2X4SB 5KS9B 1J18A 4HKJA 5D72L 1N64L 2V5MA 1FRGL 5GGTH 1AJ7H 2ZSVA 4Y1AB 4J8RB 5F89B 5T3XE 4M5ZL 1WZ1L 2XWJA 3BGMA 5GXBB 5A3IC 3LY6A 3DWTA 3ZYIA 4M7JH 4PUBH 1SJHA 2HA1A 3WMSA 3SE3A 4BH8A 1J9CT 4ZAKB 3D69A 2NLJA 5F9JA 1P2CA 3PGDB 3ARYA 3QQNA 5ICZA 2OJEA 3FFCE 4PJFB 1MUJB 4X80L 4ZAKC 3ARUA 1FNSL 2AS5M 4M1GH 4LNRA 1XCTA 3BISA 1T1XB 4UQ3B 4P2QE 5CHNA 3S98A 1S7SA 2DIBA 3GHEH 3X12A 4F3FA 3AS3A 4F37F 2KUTA 1C12B 4KKNA 2J12B 1QFUH 2D03L 1WAAA 1LWRA 3X13A 1J5OL 3D39E 2QKIA 3RTQB 4AG4H 5HGDB 3ULUC 1Q72H 2FBJH 4HLZG 4LSUH 3MLSH 2BJML 1ETZA 2DI7A 2UY6A 4JREB 1R0AL 2DB8A 1CWVA 1XR8B 3L7EB 4U3CA 4NQXB 1C5CH 1K6QL 2RCSH 4LCWB 5LWYL 4TOYH 3QIWA 5I17B 2XZCH 5K9KB 4HCRA 4PFEA 1CE1H 4EXKA 1MF2L 1RURL 4HKZA 4N0UA 5EU5B 5HYEA 4P23B 2J5LB 5BS0A 5IVOA 4DTGL 4QEGA 3P9MA 5EOCL 2EDOA 3ZHKA 4WWKD 5IQ7H 5E8OB 2M2DA 3DUUA 1CFNB 1MIEL 3RWGA 4F7CA 3GGWB 3UJJH 3WJJA 5CZXC 4PRNA 4HS6A 1NC4A 3S88H 1H3GA 2A0LC 2G2RA 5I71B 2C3WA 2I07A 4PJ7B 3VXTA 2NMSA 3VG9C 1I4FA 4QHKJ 2IPTL 3P73A 1SY6A 3U9PH 5I71C 4XCNB 3IJHB 1MWAA 5FGCB 3MLXL 3SE4C 4LHUB 5F88B 4DZ8A 2NY1D 3HG1E 1CBVH 4HJGA 4RBPK 1EEQA 2CQVA 5C8JB 1K4CB 2BVEA 4ZDHB 1XGPB 1GOHA 3VGHA 5F3BB 1FC1A 5IVXA 4PB0L 5T1KB 4QY8A 4C56D 5GS0C 1M1SA 3RVWD 3UYPA 4G8EA 2XYCA 1UM6H 1Z5LA 3RKDC 4DGVH 1KBGL 4RZCA 5E95B 1KSRA 32C2B 3OMZA 2VLJD 3KG5A 2Y5TA 5D7KD 2OJZH 5JR1L 4OZIE 3K3QA 4JDVA 3SDXE 5DUML 5TH2B 4HFUL 1YEFH 4L8SC 1DE4A 5D6DA 1E6JL 5C6TL 3QG6A 1ITCA 2DQJH 4DUXA 4FQHA 3S97C 1IAKB 1QLFB 2DYPA 3BZFA 3QDGE 1F2XK 3AROA 5D7SH 4ZFZA 4AYFA 3HI5H 5ITFA 3MUY1 4I5BA 3MRCA 2ADIA 2X4OA 1IKFL 1L7IL 1MCKA 2BSRB 1NFKA 4NUJA 2F5BL 1FNFA 1XZ0A 4Z6AT 2NY6D 4OCMC 3VI4F 1PEWA 1A7QH 2C3VB 2WLYA 4DKDC 1XIWA 3MRDA 2UZIH 2DI8A 3LAFA 3QUMA 4C83B 5DRNB 5C92A 2ZSWA 1NGYB 4ODTL 4RFOH 5C0JB 3EYQD 4ODVL 1MJUL 1YDPB 2KQNA 4ELKB 3RX8A 3PHOA 1S9WA 1T04B 1NMBH 5HYQA 3EYUH 3MOAL 4HWNA 1WQVT 1P84K 5CUSL 1MCJA 4JE4B 1QR1B 2FLRT 3BH9B 4JFDE 1YEHL 2VH5L 4MB4A 4GW4A 5F9WC 4G3YL 5ACMA 2B2XL 3X3GH 4WW1A 4P4KC 4OT1L 3CJJA 3L3KA 2NY7L 1GJIA 1S5HB 2UUDK 5HHPB 5L7XL 3ZZ1A 3SCMD 1INEH 4QNPF 1CXLA 3UTSA 4YFLF 3MBED 5DVNA 2I24N 2P5ED 3HNVL 3V4VH 1JRHH 2VXQH 4JPWH 4O4YL 1N6QH 3IXAA 4V1DA 3PNWA 5B21A 5F7YC 4HUUA 4FMKA 1T1YA 4Z7OE 1WBZB 4QOKA 2ICWI 2VWEC 3OKLB 3C5SB 1CDGA 3P4NB 4M6NH 3P4MA 3B2UD 4N8CL 3M1BB 1ZK9A 1ZOXA 3ZLQC 2F5AL 4PJ9B 4K71B 2E7BA 2OMNA 2QSCL 4LASL 4M61B 3UTQA 5I16B 3FQXA 2AJSH 3B83A 4M3JA 4R4NC 3WN5B 3GNML 4YC2B 3QI9A 4FQCL 4PJ9C 5D1QA 2R69H 3NCJL 3L1OL 3QDJE 5IUSA 4IRJB 5EZOL 3QO1A 5ISZD 4HUXB 4LVEA 3DHMA 4YC2C 3SDDA 1RJYA 4OFYA 4IRJC 1UKSA 2AEPH 3VXRD 2Z8WC 3IFOA 3JXAA 1KCSL 4S2SA 3RTQD 2GJZB 2DQDH 3QNYA 4NWUH 1NUDA 4UZGA 4D0DB 4MSWB 5CZKA 3ARDA 1XGTB 4U1MA 4J2XA 2CD0A 1QBML 2V2XB 4J12A 5M95B 1BX2A 4JFZL 4XVTL 3DURB 4L5FH 5DD0H 5AG9A 2IGFL 1FH5H 1KGCD 4XAKE 3HZVA 5C0AE 4I3RH 2VXUL 4PLNC 3G6JA 1JMXA 4L1HA 2EECA 2B1AH 1JK8B 4BKLA 5M7QA 2C4FU 2GAZB 1HCFX 4CN1A 1MREH 4HIJB 5DUPH 4Z77A 3B5TA 3WFCH 5K33A 2IPUG 3DRQA 3TV3H 4MA7L 4JFFD 5I75C 4PV9B 1MRCL 4U6HA 1NCCH 5C09D 4KK6C 1TZHB 3IRZA 4JEGB 5HGGS 1Z2KA 3BP6A 4IBLT 5CLTA 4PJGA 4KZDH 2FEDC 1NDGB 2R2HB 4PGBA 1ZLUH 5C07D 2NY0D 1ED3A 1U3HB 5HPOA 1AH1A 2IQ9H 1H15B 1I1AA 5D71L 4HUWA 1CU4L 5HHOD 2J2ZA 5SWSA 2Q87A 4JQXA 1OF2B 3CSGA 5C9JA 3F7YA 1CDCA 3FQTA 4YX2L 4WFHD 2D4DA 2E7LC 1KJVB 3SGEH 2EKSB 2V7NB 1S9VB 4O2EA 3MRQB 5BMFL 5EORH 4IDJH 4HT1H 4Y19A 5IMOB 1ZS8A 2E9BA 4I4WB 2XRAH 3OKKA 2VL5B 3IDIB 4QGYA 4JFQB 5JXED 2BMKA 5ADOL 3FL7A 4M5YL 3TO4A 5I1HL 1IEBA 1IM3B 4G6AC 2R29L 3ALPA 5F7LB 1FYTD 1JGDB 2EDXA 2GFBB 4M8QB 4NP4L 4JVUA 3AAZA 4LSTH 1XF3B 4LDOB 4L4TD 1ORSB 2V9QA 5CGYC 4CNIA 4CN6A 2A73A 2CDFB 3ZDYF 5AD0A 1IGJA 4XVJH 1VACA 4WHYG 3WO3B 4GMTL 1FZMB 1RUAL 2AKRB 4P2YA 4F8QA 5D2NE 3CLFH 3E6HA 3QQ9D 5CWSB 4X98B 5GIRB 4JKLA 3FHQA 1R6VA 3BSZL 3VU2A 3C08L 4LPYA 1LO4L 2YD9A 5JW4Q 5DJ0A 4PJIE 1MVFA 1BZ7B 5HSFA 3NN8B 5GSRA 4RMQA 5B3NA 4X6DF 4N8VA 2X10A 5DR5L 3LZFH 1JBJA 4RFEA 4F58L 3QDMD 2PYFB 1OQXA 3VE0A 3MOQA 3DVNA 1SEBB 5EBGA 2ED7A 2HJFA 4HMEA 3RX5A 4A6YH 3V6ZB 4OAWB 1UKQA 4YNYA 1JHLL 3P4OA 5FECB 5E6IB 1KFAH 3N50A 5HI5D 2RFXA 3SQOL 2XIDA 1I1YB 3UJTL 3MA7A 4OV5A 1JTTA 4U6YB 3RWIB 4YBLB 1P9MA 4YDIL 4D0CA 3CZFA 2F74B 4F9PA 3U2SB 4KMQA 1PKQB 4YBLC 4Q9QL 1CZ8L 4HKJB 3RX7A 4R96A 3T2QA 1WLHA 4XI5D 4I2XA 2BY3A 3BGMB 3DXAE 2IJ0C 1L4IA 1SJHB 4BH8B 2GUOB 3D69B 1PY9A 1IM9B 2NLJB 1MHHA 4OCLC 1P2CB 1QEWA 2EZ0C 3RWCA 5BQ7A 5ICZB 2OJEB 5IR1A 1BECA 3SE3C 4DOHB 1ZA3A 1I3GL 5DD1H 5CLWA 4LNRB 1XCTB 4WHYH 1BZQK 3HCVA 2ARJQ 4F3FB 3X12B 3TC9A 3BX7C 1IKNA 3MV9A 3RZCA 1P4BH 5CD5C 1S5IH 5GRVK 4OFVA 3X13B 4ETQA 5KAQF 4GAYA 4LLYA 4U1NA 1F6AB 2VLLB 4MGXA 5FOBB 3A0OA 1ETZB 1IE5A 4X7DC 3SDYL 4XP1L 2DIJA 1JGVL 1NGPH 3TT1H 2ZP0T 4R90H 1RJZA 4GAGL 3H3PH 5I1AA 4AQOA 3Q6GL 1H8SA 5ELIA 3QIWB 5DVOA 2ZKHH 4V2BA 5F7EH 5KS9F 3MO1A 1A7RL 5TQ2L 4EVNA 3QIWC 4XPAL 2AERT 3VXQA 5J12