1MEXH

Antibody catalysis of a bimolecular cycloaddition reaction
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
215
structure length
211
Chain Sequence
QVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWVKQKPGLEWIGYISPGNGDIKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCKMEYLDYWGQGTTLTVSSGGTTPPSVYPLAPGSAAQTNSVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQSVTCNVAHPASSTAVDKKIAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 29G12 light chain
publication title Antibody Catalysis of a Bimolecular Cycloaddition Reaction
rcsb
molecule tags Immune system
total genus 43
structure length 211
sequence length 215
ec nomenclature
pdb deposition date 2002-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mexH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mexH02
2VITB 3U7YH 2L7JA 1QYGL 4WEMB 1RJZA 4ZUVB 1NEZA 3IKCB 4OBRA 4JPIB 3KPRA 4O2CB 5TE4L 5IK3B 4PGZA 1TZGH 1W72L 4BKLA 1LNUB 1OAKL 4AMKH 3TT3H 4TSAL 5I8KL 5TQ2H 4G8IB 1KIRA 4D9QE 2P5WA 4Y89A 1F13A 3IAPA 4FQXD 3ZKXB 3CSBA 5IOPA 1YNKH 5DTFB 1JF1A 4LEXL 3VWKA 1OAQH 1LP9E 4V1DD 4G8EB 3NFNA 4XC3L 5EZOH 4RGND 3BGFC 3C5JA 5HDLA 2BY0A 1JWMB 3LAFA 2ILLA 2X40A 4CMHB 5E9DE 3T3PF 1WEJL 1DE4B 1NDMB 4H26B 3TPUB 3KDMA 2AV1A 2IFGA 5IVZB 1LEIB 4LGRB 4X7CC 4IHOB 2EXWC 2W9DL 1XIWD 3QA3B 1O7SA 4MQSB 3X17A 5D9SB 1HOCA 4FABL 3S97C 2VE6A 4X5XA 1A6PA 3CDFA 2AABH 4WW2A 4GS7B 5B8CB 4GRLA 1IAIH 2ITCA 3IFPB 1UZ8A 4JVUA 3M1BB 4M7LH 3MOAL 5F21B 3TN0D 3TO4C 3G08A 5D7JB 3BPLC 5EC2B 1RZ8B 1DN0A 2C1PB 4PJEE 3SN6N 1QLFB 5F7DA 4YAQA 1FVEB 1IC7H 2QADC 3VD3A 2EEDA 4KC3B 1B4JL 5TDPA 4MA1B 5FUOL 2XZQH 3SJVE 5T3XE 2L0DA 3VXQA 1GSMA 2W92A 5FYJL 1MCOH 3RY5A 2FO1A 2XV6B 4LVOC 5FAAA 5F89B 3QO1A 2ZOKA 4P46A 4F37K 5TGBB 5AYQA 2BNQA 1T5WA 2GTZA 5F44A 3J7HA 1OSZB 2G2RB 1I7UA 4KI5F 4AQOA 1IC5L 1U3JA 4IOIA 2NXYB 4BM7A 2BX5A 2Z31A 5I0ZA 1IZJA 2VZTA 1F6FB 1YPZE 4DUXA 4XI5C 5IIEB 1AXSA 3MLYH 5EZJA 3WD5H 1BJMA 4OCYL 1CGXA 3H3KA 4JLRB 5JHDA 5F9JB 4EBQH 3U7AA 3LMJL 4HW6A 1J5OH 3O3AB 2HFEA 2C4XA 3D39A 4G6AC 1A4JB 1QBBA 5EU3A 4FQCL 1X44A 3NBNA 5D1ZC 3F7VB 3UDWC 1HE7A 3IDUA 1QFWM 1F4WL 4OIIL 4XWGL 4UB0H 3I6GA 43CAA 1HEZB 1EO5A 3PHQA 1T3FB 1A21A 3QG6B 3QHFL 3V4UL 1WGOA 1LP9B 4JM2D 3F58L 2X4PA 2R1XB 4PD4J 5HHQB 4DFHA 1A14L 3INUH 1FDLL 5E9DB 3I3DA 2VIRA 4JVPA 3DX6A 1FYTB 3JV0A 5ETUA 1WTGT 4GKOA 2HRPH 5GGSA 3ARFD 4CBPA 2JJVA 4ALAL 4ONFH 2R2HA 1ZGLA 4BZ1L 4GFTB 1JF5A 4JDVA 4LCCB 4H8WL 1MHPL 3MTRA 5BV7B 2BXZA 2AK4E 4LVHC 1A3RL 1C1EL 4MA8L 1S9VB 2FSEA 3UROR 4DGIH 3U4EB 4DEPC 3PDOB 3CUPA 2XTLA 4P23C 4S11A 1RUKH 1NBVL 4UQ3A 3SDXE 1CQKA 4R4FH 2XXCB 1MWAH 2DI9A 1GAFH 4Q6IA 5IT2L 2OYPA 3RL2A 3U9UA 5I8CA 5KVDH 2BOCB 3NGBB 5IBLD 1V8HA 2V9TA 4PJEB 3VXRB 4GBXA 4HBQA 4P57B 2X4SB 5I75C 4WGWB 1HHKA 3RJDA 3GHBH 1YY8A 1N5AA 4Y4HA 3C2AL 5M94B 3QDJA 3NCBB 4BH8A 3L3IA 1MQKH 3TCLB 5FGRA 5EOTB 4I5BB 1ONQB 4YHNA 4S1QL 4OV6F 2QSVA 5C9JA 3EDJA 4QRSA 2VXUL 3B6SB 4U1SA 1HQ4A 1OY3B 1S8DB 2GK0A 1GJIA 4M6NH 3NZ8A 4EVNB 5IV2B 3H7LA 4E9LA 1N26A 4X8XA 5D2NE 1WJ3A 1HH9A 1MAJA 4LLUA 4ELMA 1H0DB 4PP2B 3ULSB 4UBDC 2EO1A 5GSRA 2IBZY 3KR3L 4L4VB 2Q87A 4WHCA 1CBVH 4QF1B 1J8HB 3V6OC 5D7IE 4NN7B 1Q9WA 5IMLB 1FV1B 5EPMB 4MSWB 4G6AD 2FJGA 1OP3K 1RURH 2JE8A 3ULUH 2X4NB 2D9QB 4GKNB 2OX5A 3ARSA 1LEGB 5D1ZD 1L7IL 2W9EL 4OAWA 2VR5A 4GXUM 5JXEA 4RAUA 3PQYA 5HYSA 4PJ7E 4GMTL 5HGHA 4U0QB 2VAAB 4I4WB 4CNIB 1L7TL 3FONB 5EO9B 5FYJD 1BQSA 2ADFH 4MCZA 5DVMA 3C8KB 4ODVH 2ZG3A 3O6LH 3VXSD 3L6FB 4MJ6B 4CVZA 3C9NA 2JLLA 2Y7QB 3BW9B 4HC1A 4X4MA 5KVGH 1I9IH 3NABL 2OJZL 3MRDB 2VITA 5J0BA 2DQUL 4U1MB 4ZUVA 1QFOA 15C8L 3IKCA 1UJTA 1A7BA 4YDIH 4JPIA 3BGAA 4FP8L 4O2CA 4F7TB 5IK3A 4G5ZL 5ALBL 4KKCD 4M93C 4M7JH 1LNUA 3MRQB 1KJ2L 4P9MH 4G8IA 2XTJC 1IZKA 1FHGA 1EXUB 3MRPB 4OD1L 5DTFA 4R7DB 3MLVL 3EJYC 4G8EA 2WP3O 3ULUC 4NN6C 2VZOA 3MLWH 2R29H 1X5AA 1JWMA 5D2LE 5GRXG 1DE4A 1NDMA 2G5RA 4H26A 3TPUA 1CE1L 3GGWB 5IVZA 3RTQD 3CVHB 1CGTA 4F9PC 1LEIA 2RCSL 5E00B 5GHWH 1I1AB 1TQCC 4IHOA 3QA3A 2HJFB 1WWBX 1BGXH 4GW1B 5D9SA 3DHMA 1ZTXL 1T7XA 3BYYA 4OLYH 3V79C 4W6XB 3T0WA 1RZFH 3PP3K 2NYYC 1FNFA 3JTSB 5B8CA 5FCSH 5LQBL 1CR9H 4L5FH 2ZKHH 3IFPA 1JN6B 2IPUG 3M1BA 1IGFL 5D7JA 4UBDD 1OCWH 1IAII 1VA9A 3KXFD 5EC2A 1RZ8A 4MWFB 2FECI 3OAYH 2R56H 2OL3L 1A3LL 1QLFA 1RZJL 1DCLA 5D7IB 3TT1L 3RWHB 2EZ0C 3ARDC 1FVEA 1CDUA 4ZOEA 3U4BH 4OZIE 4XC1L 3FQXB 3JTTB 4UMGA 3BUYB 3FFDB 4M3JA 1M7DB 4C56B 5L2KD 4KJWC 1FLTX 3D25B 4PJ7B 2R4SH 3MUZ1 4JG0L 5DMIH 5F89A 2X1OA 4BQ6A 1MJJB 2BVQB 5TGBA 3ZHLA 1U8MB 3C09C 4R97B 1OSZA 2G2RA 2CPCA 2ICWB 3HE6C 4MJ5B 1OLLA 3CFDB 4YZFE 4ETQB 1CK0L 3BJ91 5IIEA 3RU8L 4KJQC 5F3HB 3PE9A 3NTCH 4UTAL 4JLRA 5I6XB 1YYMH 1NAML 1TQBB 5F9JA 5JW5B 1PSKH 4F37F 1KELL 3O3AA 5DJ2B 3CX5K 1A4JA 2CO6B 3B4NA 1H3XA 4KZDH 2NY1C 1LK2B 4LSRL 1C5DB 1VFMA 5SWSE 1CZ8L 3WDIA 1OW0A 1WITA 3RY6A 3F7VA 1MF2H 5E24E 2V2XB 4IMLB 2FATH 1HEZA 1OGTB 2DQDL 1ZANH 1T3FA 1X5IA 2QQLH 3QG6A 3MXVL 4AK1A 4WWKD 4BSVB 1XGQB 2EKJA 3TA3C 1VACB 3TEUA 3WS6C 5HPOA 3BWUC 4NM4L 1YA5A 1LP9A 4KUZH 2R9HC 4HK3J 1NBQA 3EJYD 4P9HH 4ODTH 2R1XA 3FHQA 3QAZB 5H8DA 4XNYH 5HHQA 3JUZA 5D2LB 5E9DA 3QUXB 3TZVC 4M9OA 1FYTA 1A6UH 1QA9B 1NGQH 4RIRB 3ZDZF 4QRPE 1C5BL 2LFGA 2W65B 1PKQE 4JN1H 1B9ZA 4AJ0A 3QQ4B 3P4OB 1P6FA 4GQ9H 4LCCA 1JGUL 3WN5C 3GDBA 2GHWB 2YMXH 4RAVB 4JFPB 1S9VA 3CFCL 3MV9E 2A0LC 3U4EA 3VXMD 2R0WH 5FECB 3CDYA 3JV4B 3PDOA 1MRCL 1QSFD 2AI0H 5LXGL 1CN4A 3FMGL 4O2FB 5E1AB 4KDTC 3EO9L 4I18B 2WM0A 1MREH 3DNKA 1E27B 1J0JA 1TZIB 4NQSB 3UBXB 1JJUA 2BOCA 4ODSH 4PJEA 5C0BE 3VXRA 4P57A 2X4SA 2DRUA 3O41B 1YEDB 4JRXD 5C0FA 4OKDA 3W11C 5JW4N 3NCYP 1XEDA 1S3KL 3FQWB 3IB4A 4Z7OF 4OZIB 2OP4H 4PRIE 5C86A 4TUKL 1XGYH 4I3GA 3TCLA 5EOTA 4HULB 4I5BA 3HRZB 1SMAA 1ONQA 2R1YB 3O6KH 3AROA 1F90H 3B6SA 1DQLL 5B3JF 1S8DA 3LZFL 1T2QL 5DMKB 4EVNA 2JIXB 1F3DH 5F7HA 5IV2A 3PV6B 5KSBE 1LK3L 2DQTH 1O5DT 3HNVL 3TFKD 1X7QA 1ROWA 1INDL 4L8SC 1H0DA 4M5YH 4PP2A 4Y5XC 3ULSA 3JVGC 3EDEA 4XPTL 4WU7B 3ROOB 1BOYA 1MFDL 2AGJH 4HV8A 4L4VA 3MLUH 1A7OH 4QF1A 1J8HA 2GQHA 1WIPA 1G84A 3ETBF 3MYZA 4HS8L 3QEQD 5IMLA 3BKCH 3NCJH 1FV1A 1X5FA 2XA3A 4MSWA 5EPMA 4L3ED 4KUCD 2X4NA 2FR4B 4XMKH 1I1YB 4GKNA 5SWSB 2XQBH 5FM4A 3C6LD 1LEGA 1VESA 3SGKC 1MCKA 3U48A 1WFOA 1Y6KR 1JNNH 3TA3D 3QXVA 5FYKL 2VAAA 4I4WA 4CNIA 3FONA 1IGCH 5EO9A 1NAKH 1TFHA 1DVFD 2N7BA 4XMPH 2EDFA 5FHAH 1KTDB 3C8KA 3MO1B 3L6FA 4MJ6A 4RFEB 2Y7QA 3BW9A 5DD5H 4UT7L 5ACZB 1IGYB 4QRPB 2UZYB 3PV7A 3OJMB 5DEFB 3MRDA 2MFNA 3DVGB 4R26L 4U1MA 3LQAL 3BISA 5DHYB 4GUPB 4QWWD 1QSEE 3Q2CA 4F7TA 3HMWL 4KK6C 1D5IH 1X6LA 4KQ3L 5TPWH 3MRQA 3MV9B 3RX5A 1S5IL 4ZFZB 4OI8A 1UWGH 4HIHB 4I13B 3VRJB 2FEDC 1DDHB 1EXUA 3MRPA 5KW9L 2EYTB 4DKAA 4ZPVB 2BVTA 5I1CL 4R7DA 3ZDZE 4C4KT 4TVPE 3RBSA 5JORB 2CQVA 5C0BB 2D9CA 3NA9L 1DQJB 2QQNL 2QTEA 1A9EB 2IBZX 1NCCH 1N6QH 1MELA 3RDTC 1D3CA 4MAYD 5FHBL 3W11D 4F8TA 4JQIH 3GGWA 5L8LB 1U8HB 3EIFA 4YDKL 3CVHA 4NQED 4PRIB 1RIHL 2MJWA 5E00A 3KYKL 1I1AA 4G42B 3KYOB 3M17B 4WI3A 2HJFA 3SE4A 1MCSA 4PJHB 4GW1A 1NGXB 1U9KA 4NT6B 5E4EB 4YC2C 1BFSA 4PRPE 1Q9KB 1IQWH 1MY7A 2XQYK 4R2GB 5KSBB 3JTSA 3FB8B 4Y16A 1OAZL 5D1XD 2GEEA 1JN6A 2YHGA 5I2IB 4BFEA 2BNRD 3D85B 4XNZC 4MWFA 1K6QH 2A6JB 5CILL 5D7IA 4JREC 3RWHA 1V3MA 1ETZB 5TE6L 5E8PB 1WZ1L 2OLDA 3IJYB 1VFUA 2Y5TB 3FQXA 3JTTA 1UM5L 1HILB 3FFDA 2V7NB 4FMKA 4WNQB 4M3KB 1M7DA 2DS4A 4K7PY 1KBGH 3W9DB 4C56A 3BI9X 4NP4L 3D25A 4PJ7A 4IRZH 4GRWF 4QRTB 3AREC 4IRSB 1MJJA 2BVQA 2D7PA 3T2QA 5L7XL 1U8MA 1HYRC 4JZOB 1JRHH 2JF1A 4QRRD 1E4WL 2ICWA 3JV5A 4MJ5A 3BIKB 3CSPA 3CFDA 4ETQA 2Z35B 1PFCA 3MV8E 4WFFE 3G6JE 4IRJB 2IBBA 4NKIH 3TP4A 1MCRA 1LO4L 1CGUA 5F3HA 2PR4L 5KZCB 4MNGE 1GPOH 2FHCA 4MZ3A 4BUHA 5JW5A 1LO0L 1QSEB 5DJ2A 3WNKA 4N0CD 1N2RB 3DI3B 1YNLL 1LK2A 3Q5YA 1C5DA 2XICA 1IGIL 3WXVL 2HKHH 4OLXL 1NLDH 3O0RH 2VLMD 1YEEH 3D2UB 5I71B 2V2XA 4JO3L 4IMLA 2XZCH 5ADPL 3ZHDA 4APQB 1HKFA 4M9PA 1KPRB 1OGTA 4CKVX 2FEDD 2GK2A 1XGQA 4AQ1B 1VACA 2IPTL 3P0YH 1ZLUK 3FFCD 1JNJA 4J3TA 3T2NL 3LN5B 5CIPH 3UPRB 4M6MH 3QCTH 3VMPA 5D2LA 4HUXB 1AKJD 3DGCR 3QUXA 5I66B 5B4MC 1QA9A 1SY6L 4RIRA 3QHTC 4MB3A 4NZDA 4ZNCD 1WZMA 4OI9A 1U8QB 4G6FB 1B6DA 2JB5L 2DYPB 4O4YH 2W65A 4XP6L 2EE6A 3QQ4A 3P4OA 1CDBA 1ES0B 1YDPB 1Q0XH 3ALXA 4G6KL 3DV6B 3MOQA 4RAVA 2EEAA 2CMRH 4LQFH 5I15L 4JFPA 1MCHA 3WLBB 2WLYA 1MOEA 4PRPB 5MHSD 5HHME 5FECA 1KJMB 3JV4A 3PL6B 1M71B 2KH2B 4F2MB 4YEFA 1H8NA 5BS0B 3QG7L 3ZTNL 4MJ4A 3EOBB 4O2FA 1NFDE 1BOGB 4EI6B 4WRLA 3W0WD 5E1AA 4I18A 2DBLH 4KKBC 1E27A 2R8SH 5HBBA 3WNNA 1TZIA 4NQSA 3UBXA 4PJ8C 2Y6SD 4JFDE 4XBGB 3VG9C 4EXKA 4TNVK 4KMTH 3O41A 1YEDA 3SCMC 2E7CA 3MACL 3FQWA 4HD9A 3MA7B 5IFAL 4OZIA 1C08B 2VTFA 1B2WH 4XPAL 4YFDB 4I1NB 3WIIL 1BFVL 3U2SB 3DTXB 1BQUA 1XF3B 2CR3A 2HWZH 3HRZA 3LCYA 2R1YA 3IYLW 1MNUL 1S7UB 5DMKA 4FN0A 2JIXA 4PJ5B 3PV6A 3GM8A 1JL8A 4KGJA 3QEUB 3DRTB 1I8LA 4MDJB 4G7VH 5HVWA 5T5NF 5C08B 3MV8B 4FZ8L 1A1NB 4WU7A 3ROOA 4EOWL 2O5YH 5F7KC 4G43B 2IFFH 5JHLH 2KBGA 3LVEA 3GO1H 3KYNB 5AG8A 2DM2A 1PY9A 4U0RC 2VQ1B 5EIIB 2KQMA 3MFGB 2WBJD 4GRWE 4DKFL 2C9AA 5GZND 2FR4A 4PLKC 1I1YA 2HT3C 5SWSA 2ICCA 3C08L 2GJ6E 2X4QB 4XNQB 1TETH 3REWB 3PABB 3VGFA 1INEL 5D70L 1TJIH 4UILH 4RGMB 2Y06H 1KTDA 3QFDA 3MO1A 3NH7L 5CWSB 3RQ3A 3P4NB 4RFEA 2OZ4A 1IAIM 3KWWB 3V0WL 5ACZA 5HYJD 1IGYA 4QRPA 4QY8B 1Z2KA 3FO1B 2Z4QB 2F8VA 2APVA 4QTHB 5DC0A 1AJ7H 5DEFA 4XAWL 5E5RB 1ZEAH 1PKQA 3DVGA 1B6UA 3S4SG 4M62H 5DHYA 4GUPA 2A38A 4EJ1C 4AEHH 3S3PA 4E41E 5ADOL 2H1PH 4WFEE 4OGZA 3B2UC 2HVKB 2ZP0T 5F88B 2D0FA 4M1DH 4X9GA 3MV9A 3S34H 1OQOA 4ZFZA 1PLGH 1C5CH 1SBBA 4HIHA 3VRJA 4B7LA 2DQIL 1DDHA 3ZYIA 2R2BB 2EYTA 2F19H 3CFBB 4ZPVA 4KKBD 5GJSH 3D69B 2ARWA 5I1AB 4Z7QF 4M7ZB 4BZ2H 4PJCE 5CEXB 3QB7C 5JORA 5C0BA 5MP6H 1DQJA 4J12A 1A9EA 4TYUA 3ZE1F 3SCMD 4FFYH 3LPGA 1U8HA 1F4XL 4M61B 4PRIA 3QRGL 4HKJB 4OBSA 2QQQA 3VFWB 1GGIH 3KYOA 3M17A 4G42A 4JZJC 3CU1A 5FK9B 4LCIL 4KTYA 3DUSB 4PJHA 1J12A 1NGXA 4OCXH 5IB1B 4NT6A 3V6BR 1Q9KA 4ZXBC 5KSBA 1HWGB 3FB8A 5DHVH 5I2IA 1QEWB 3UYPA 1BJ1J 1N59B 2Y9RT 4GW4B 2PTUA 4XCYB 1JMZA 1HIML 1NMCC 3D85A 4ZOBA 4TSCH 4V1DE 5DK0B 3LS5L 1RI8A 1G7IB 3BT2L 2XT1B 2A6JA 2DQGH 1CDYA 4LKCB 1B0RB 5ERWB 2F8XC 1ETZA 5FUCC 4GT7A 5E8PA 5J13C 3IJYA 5J8OA 5CZXC 4GH7B 2LVEA 3REVB 1HILA 1ZA6B 4H0GA 4PLKD 2HT3D 4U05A 3MLXH 4G9DB 4WNQA 3W9DA 2GJ6B 4KHXH 4QRTA 2CK0H 2J88H 4YXKL 2RJMA 4Z0BH 4TOYL 2PN5A 4IRSA 1OPGL 3OTTA 1CXLA 5GXBB 1EVUA 4JZOA 5I9QC 4OGYL 4Q9BA 4ZAKB 4EI5C 4RGOL 2W60B 3BIKA 5DD6B 4AIOA 2Z35A 3MNVB 3ZSTA 1JRHI 4IRJA 4NO2B 1CS6A 1RK0B 5CEZL 4XP4H 5TDOB 2VZSA 3LQMA 1KB5B 3QPXL 1QSEA 3NAAH 4QCIB 3OB8A 4E41B 1N2RA 5HVGB 4XWOD 5ID1B 3IETB 4UT9L 3ALWA 4XXCC 4LMQI 3D2UA 1AHWC 4YHOL 3IDXL 4NZUH 4APQA 3TM6A 4WY7H 4FQIL 1KPRA 4M48L 2EIBA 5I1KH 4PJCB 1MIEH 3LN5A 1L6ZA 3UPRA 3LEYL 3P73B 1J0IA 1FAIL 4HUXA 3O8XC 4PY7B 1AGCB 5ESVB 5I66A 1JFQL 2I27N 3FN0L 3MYJB 1Y6MR 2DL2A 3RFZC 1U8QA 3D87B 4RISL 1U2HA 2QJDA 2DYPA 4PP1D 3DROB 3MRMB 1KTRL 1ZT4B 1U3HD 3DOSA 4MLSA 4MQTB 1YDPA 4XPBH 5JDSB 3DV6A 4CRPA 3QCVL 4K7PX 4OTXL 3WLBA 4PRPA 1A7NH 1MAML 5F8QC 3PDDA 3U4AA 1KJMA 2WSKA 3PL6A 3BPNB 1M71A 4F2MA 5BS0A 3VCLB 3L5HA 3EOBA 5T1MB 4EI6A 1BOGA 2K3TA 2ITDB 2GUOB 2L7UA 4GJTB 4FQXB 3FRUB 1CF8L 4R0LC 2CIKB 2AJXH 4V1DB 5K33A 2VLRD 4G7YH 4XBGA 4E5XB 4RGNB 1D5XB 4K07A 5IBTL 4Z76B 3CXDH 2FX9L 1REIA 2UZIH 3MA7A 1PGRB 1C08A 5CZXD 2HTLD 1YECH 5GJTL 3U2SA 3DTXA 1XF3A 1Q72H 3HI6L 2E6JA 2I60H 1XIWB 1FCGA 2B0SL 4GAJL 4P48A 2E9IA 1S7UA 2VLJD 3EHBC 1K85A 3IDMB 4PJ5A 3LS4L 4KTDH 4JDZB 3QEUA 1I3VA 3DRTA 4MDJA 4WV1B 4EI5D 3L7FB 4O51B 3OF6A 5DJYB 4OF0A 4CJ1A 5EOCH 3TN0B 5C08A 3MV8A 2FEEL 1MCCA 1A1NA 2EDDA 3P30H 5JXAH 4G43A 3TLRA 2Z93B 1OLZA 4WCYH 3WIHL 5DYOB 3S88H 3EGSB 3KYNA 1FNAA 3FRPG 5DRZB 5HHVL 4JQXC 2VQ1A 3MOAH 5EIIA 2B20A 4HT1L 1FRGL 5CZKA 5D8JH 2Q7YB 3JSSA 3MRIB 4LSSH 3FAXA 1EJ6A 5BRZD 3QUZC 3T1WA 2A77L 3HMXL 4P59L 2X4QA 1NC4D 3VD7A 4JGUA 2Z8WC 3HC3H 4XNQA 1A7RH 4EQ3A 3REWA 2ICWJ 3PABA 2BERA 1B4JH 2IG2H 5EO1B 1QACA 1YY9D 2G75B 4HAGA 2BNUB 4YHLH 3HAEH 5CWSA 3P4NA 3BIAX 4OCRH 3TH3T 2PYEE 3KWWA 4QY8A 3FO1A 2Z4QA 4ZODA 1SM3H 3GRWL 4QTHA 2C4FT 3MRRB 3QUMB 4V2CB 3HNTL 4FTVD 2FWOB 2WUBH 4Z18A 5CEZD 2CH8A 1DBAH 4X4XB 1Z0MA 2XKSA 4X6EB 2HVKA 3GSXB 5F88A 3TF7C 4ONGH 1RIVH 4HWEH 5TF1H 2DKMA 5IHZB 5J1SC 2Q8AL 3NACH 4JFED 4TRPL 1JZ4A 1NJ9B 2BJML 4Q9RH 2R2BA 4PREB 1HHJB 3CFBA 4KRLB 3VXPB 3D69A 1ADQA 1FFPB 3DVNB 4U7KA 1RMFH 5I1AA 3ARBC 3FB7B 3GIZL 4QTIH 2VXVL 5CEXA 4UV4L 4JM2B 1T6VN 4XWGH 3BGFB 3GI8L 3C87A 3VXSE 1FGNH 4CN1A 1G7JB 4HF5L 2ZNWA 5I1HH 4GSDL 1ITBB 1GXEA 1V7NH 4M61A 3ARFB 3AFLA 4LLDB 3ULUF 2VDML 4Y19D 4HKJA 4BYHA 3VFWA 3GK8H 1BIHA 5F96L 1SEBB 5FK9A 1RAMA 3DUSA 2FRGP 4F57L 1MHHB 5IB1A 4PGEB 4ALAH 4F7MB 4FMFA 5F72S 3X13B 2J6EL 4YE4L 1JI2A 3BD3A 1QEWA 1N59A 1W2KT 4GW4A 4H8WH 2CK2A 4XCYA 2DTML 1XCTB 2IF7A 1JHKH 3QULB 4MA8H 5C0CD 5DK0A 4AL8L 1G7IA 1GHFH 1EGJH 3ZDYE 1XR8B 3R0NA 1KOAA 4LKCA 3V52L 5JMOC 5ERWA 2YD5A 1XFPA 1A4KB 2QADB 3REVA 3U7WH 3AM8A 4JR9L 1ZA6A 1TTUA 3F62A 4G9DA 1RZ7H 3OPZL 1XGPB 3MMEB 3T3ME 5K59E 1KENL 2AQ3A 2GJ6A 3HPJB 4Z5RB 5CJOH 4LVOB 3KLHC 4JG1L 2F53D 4XTRD 4ZAKA 3PP4L 2W60A 3UJTH 1IAOB 1YC7A 2YD8A 5DD6A 1JUFB 3MNVA 4HS6B 1P7HL 4NO2A 3EYQC 1RK0A 3T0AA 1JYVA 3C6SB 4X6BB 2FJHB 5TDOA 1NLBL 5T5FL 3V6OE 4NZRL 3DO7B 1KB5A 5EUKB 4HG4K 5IW6B 4OSUH 1BQHB 4N0YH 4QCIA 4JFQB 4E41A 1QVOB 4H8WC 5ID1A 3IETA 2WWMD 3KPSE 2EDXA 1LEKB 5D1ZB 5CAYB 4AM0B 5L2KE 1TNMA 3VWJC 4OZHF 5DUBB 3HA0A 1YEKL 1QR1B 3BDXA 4LRIA 4X6CF 5FV1L 1LMKA 5GGUB 4PJCA 2NW3B 2ZUVA 3P73A 1LE5B 4Y8DC 3VD5A 1FN4B 2RHEA 4PY7A 1AGCA 5ESVA 3VXSB 2ED9A 3S5LG 3BKML 1S7XB 5JUEL 3MYJA 4ISVA 5T33L 4U1NB 3DROA 4QHMB 3MRMA 1MFBL 1CE6B 2DQEL 1ZT4A 4BQBA 2FBOJ 4V2BA 4YXLL 5JDSA 1NUDA 4X7SH 4K7PH 4Z7VF 1HSAB 5IFJB 1JHLH 1JTPA 3NABH 2OJZH 2ADIB 5FM8A 1A6TB 3OR6B 4DEPB 1P7QD 5F1IB 2XTJE 3X3FH 3VCLA 5T1MA 3EW3B 4DUWA 4FP8H 2ITDA 2GUOA 1F4AA 4FQXA 3FRUA 5DQJB 2CIKA 4V1DA 1EEYB 3OAUH 1K2DB 5EA0L 2IANE 4E5XA 1QFUL 2NY7L 1LE9B 1D5XA 2Q76B 3RA7H 4HUMB 1KCUH 4Z76A 5E5MB 1YEJH 2V6HA 4ZS7H 4OD1H 3G6AB 5T3ZH 2PW2B 4NO3B 3U0PA 3RTQB 2ZCHL 3TV3H 3O3UN 4IDJL 2A83B 4N0UE 1IKFL 1XIWA 4WHYG 1VFOA 3MGOB 3E3QC 3MROB 3IAQA 1JTTA 3KLHD 5GS2H 3IDMA 2QSCL 1C12B 1YUHB 2X4RB 4JDZA 5CSZB 3BHBB 5LG1A 1H3PH 1QSFE 4JN2B 4WV1A 1GCFA 3L7FA 4K3DL 4O51A 4KVCH 5DJYA 3TN0A 3SQBA 4POYA 1Q8MA 1ZTXH 3EYQD 3LQZB 3KXFB 1MEXL 2Z93A 3O11B 3GMNB 5DYOA 2W0KA 1FLRH 5CD3B 3EGSA 4JRXE 4KAQL 5DRZA 3RRQA 2X70B 1RZKL 1N0XL 4UAOC 2RBLA 1U8OB 5AYUH 2Q7YA 3KPNB 2E6PA 1T03H 3MRIA 1MWAB 1FIEA 2A6KB 2OL3H 4NNXB 5IJVB 2F5AH 5L2KB 2X4TB 4LEOB 2K1MA 3RAJH 5EO1A 5K9KB 2G75A 2BNUA 3N9GH 1UM6L 1G0YR 2Y5EA 2E27H 3UJIL 4PJXF 2YWYA 4DAGL 3GNMH 4WHYH 5KOMC 1JPTL 4Z7WF 3MRRA 3QUMA 2DQHL 4HMEA 2FWOA 3DV4B 3QEQE 4HDIB 4K8RL 4Z8FH 2VSCA 1I1FB 3WDHA 3X3GH 1SQ2N 5JQ6H 3RU8H 4HJ0D 3SBWA 4X4XA 4X6EA 4M93B 3GSXA 4MS8D 1FE8H 3CK0H 3BFOA 4FXKB 5IHZA 3I3EA 2CR6A 1ZLSL 2P24A 1NJ9A 4WWKB 4PREA 1HHJA 5BMFH 3VXPA 4LSRH 3I9GH 1JGLL 1FFPA 3DVNA 5E2VH 3U0WH 2UVEA 4HC1L 1U42A 2YN5A 2EH8H 1ZS8B 3U1SH 4JM2A 4NN6B 3RVTC 4J3OC 3UTSD 4ZFFB 1I85A 3WNOA 1M1SA 1G7JA 3VE0B 5FFLA 3ARZA 1EEZB 4X0KB 5H2BB 3ARFA 4LLDA 2YK1L 2ARJQ 3U6RB 5H37G 4AEFA 5GSVB 2UUDK 1DBKL 4LPCA 3OSKA 5LGJB 5DUML 5ALCH 4N0UB 1SEBA 1O0VA 4P49A 1MHHA 2H41A 4PGEA 5EOQL 2FLBT 4FFZL 4F7MA 1AGEB 3MZGB 1G6VK 1V3JA 2KQNA 1BEYL 3RIFK 3VXMB 5EC1B 1JPSH 4R4NC 1QSFB 2AXFB 1XCTA 1J11A 1EEUA 3C5ZD 3QULA 4PYGA 3BN9D 4RMRA 1QSVA 5CD5C 4H88L 2B5IB 2ED8A 1RULH 1XR8A 5I8OL 5LXGH 4JRXB 5IB3B 2AEPL 4ZMAT 3CMGA 2IWGA 1A4KA 4I0PC 4I3RL 4JM4H 4KRNA 3BQUC 5D5ME 1XGPA 3MMEA 4XNMB 4OZFG 1R6VA 4GG6F 5CUSH 5CSGA 1WWCA 2HLAB 3HPJA 4Z5RA 2VDOL 4PLJD 3VI4F 5HGGS 1JPFB 3RY4A 1HINL 1OAUH 5T3ZD 2J8HA 1IKNC 2MCPH 3B5TA 3RP1A 4R9HA 4DW2H 1IAOA 4NBYB 1JUFA 5H37H 1DQLH 4HS6A 2VN4A 3LZFH 5DJ8B 1JV5B 3SE9H 3QDHA 3RVWD 1ACZA 2XA8L 1A5FL 1Q94B 1CI5A 4N1HB 3C6SA 4PG2C 4X6BA 2FJHA 2R0KL 3HNVH 3D9AH 3DO7A 5EUKA 5GPRA 5IW6A 1QPPA 1BQHA 2IEPA 2J12B 3QEQB 4JKKA 4JFQA 1QVOA 4NUGH 4L3EB 5CZVL 2NY1B 3CLEL 2ICEB 4PRDB 4BSWB 4JHZA 1LEKA 3C6LB 5D1ZA 2VR4A 1OTUC 4WUUE 3UDWA 4AM0A 5D71L 5DUPH 2J4WH 5ACMA 5DUBA 4UOW0 2VZ3A 4TUOB 1QR1A 3TA3B 4XP1H 2R4RH 2CGRL 4JB9H 4B5EA 5GGUA 3RZCC 3JZ7A 4K94L 4M1GL 2NW3A 1DVFB 4XP9H 4QRRE 1LE5A 3RVTD 1FN4A 1D5MB 1MJUL 3VXSA 1T21B 5D1QD 1S7XA 3KS0H 4U1NA 2DLHA 2XG4A 3T1FB 4OZFH 3BKJL 4QHMA 3I6KB 2IALB 3EJZC 1CE6A 1JNLL 2WLZA 3MLZH 1QUNA 2DQFB 5B38B 4Q0XL 3VGBA 1CLZH 4HLJA 4EDWH 5GRZA 5GGTH 4PB9L 4UT7H 3EO1A 5KS9F 1HSAA 1NAMB 2NNAB 5IFJA 1A02N 2ZG1A 5JW4Q 5C0JB 4JO2H 4K8RD 2ADIA 4HFUL 4OV5B 5IFHH 1A6TA 3OR6A 5I74B 4DTGH 4MAUH 5F1IA 3UTZB 4R4ND 4ZPTB 2EDRA 3WS3B 2FD6L 5LVEA 3HMWH 3QP3A 5DQJA 1EEYA 4WJ5B 1K2DA 1LE9A 2Q76A 3SE8H 3RWGB 3L5IA 5E5MA 1HXMB 1KJ3H 4AY0A 2H3NB 4MAYB 3G6AA 1TZHB 2PW2A 4J6RL 4Y0GA 4NO3A 3RTQA 3VMNA 4NQEB 1KG0B 4FS0A 5D5MB 3NA9H 2Y25A 2QQNH 2A83A 4U3HA 5JW4M 5KVEH 1KGCD 3MGOA 3MROA 4FG6D 2ZUUA 3HR5B 5HGDB 3VFTB 1RIHH 1C12A 1QKZH 1YUHA 2X4RA 2XPGB 3MBXL 4KMLB 1SBSL 9CGTA 5MHSE 5CSZA 3BHBA 3H9YA 4JN2A 1E4XH 4UT6L 5EBGA 3DMMD 3FHAA 4NIKB 1P4IH 5D1XB 2IJ0C 1DL7L 4L8SB 3W0WE 1R0AL 2BNRB 5HI4C 4UDUB 1OT2A 3LQZA 4JHAH 4XPHL 3KXFA 5GRWA 3VGHA 3O11A 3GMNA 2D7NA 1KIPB 1H8OA 5CD3A 3IJHB 5FEBA 2MTPA 2X70A 3KLSA 4OLUL 2P8LB 5T3XL 3WFHB 3WFDH 5EU5B 1QO3B 1U8OA 2FIRT 1EFXD 3KPNA 3DXAD 1DTUA 3KPSA 1H5BC 2QQKH 1MWAA 2A6KA 4X7EC 4NNXA 2DWDB 4W6YB 5IJVA 3W5MA 5GGVY 3QNZB 5CILH 5KTEL 5L2KA 2X4TA 5TE6H 5MEPB 4LEOA 3PWLB 4JEGB 1X5XA 1IGJB 1Z0NA 5L88H 5E7BA 2QBWA 2VMFA 4NZJA 4PJ9C 3TH4T 3VFUB 1VKXB 4NQUA 3MREB 5K9KA 4QRRB 4HIJB 3U9PH 3QIWC 4WHTB 5FGSA 1KB9J 5KOVC 1DEDA 4DN3L 1R5VB 5TFSL 1YEIL 1Q1JL 1PX3A 2ERJB 4PGJA 1WICA 2W38A 5DFVC 3N50A 4ZD3L 1FNEB 1KLFA 4KFZC 4YK4C 3U82B 1I3GL 5T1DL 3ZT6A 1BF8A 5J57B 3GSNL 3DV4A 4HDIA 5D72H 4FFWD 5GGSY 1I1FA 3QRFM 5JR1L 2Z9TA 3FB6B 4AZ8A 2B2XL 1WISA 3KHQA 1JZ2A 4FXKA 4PJGE 5BW7A 2YS4A 3E8UH 1V05A 5DVOA 1UWXK 5KANG 4N5UA 4WWKA 1YQVL 5E8OB 5I1JH 2XZAL 1EO7A 5TJWK 3V8CA 1IGIH 4Q74A 4OLXH 3FFCB 3WXVH 1WAAE 1WZLA 3JWDL 1ZS8A 5L9DL 2QEJA 5C7XL 4N68A 5F7EH 4ZFFA 1AKJB 4JHBA 5EZIL 2NXYD 3VE0A 1CU4H 3H2WA 4ZO9A 4NJAH 1IILE 1EEZA 1RSFA 4X0KA 5C0AE 1EAJA 5H2BA 3U6RA 5A2JH 5JW4R 4F9PA 1UCBH 2PYFB 4OCMC 3Q0HA 5GSVA 3UPAA 3NCFB 2VXTH 5LGJA 5I30L 4N0UA 4MXWH 3W2DL 2KZ1B 1SY6H 2JB5H 2VL5B 4YC2B 5CGTA 1CXEA 1G0XA 1AGEA 1KSRA 1N6UA 3VXMA 3QNXB 5EC1A 3RIAF 4D9QD 1AXTL 1MJ8L 1QSFA 1NCWL 2AXFA 2G60L 3S8WA 3UYOD 1CFBA 1A6ZB 3MOBL 3W0WB 3WHXB 5HI4D 4XNZB 3HZYB 4LMQE 4X80L 1ZLVK 1JBJA 1FL3B 2XRAH 4M5ZL 2ZCKH 5AEAA 5AZEL 3CVHL 1P6AB 1BBDH 3SDAD 3QG7H 1MCFA 4L9LB 4JRXA 4JREB 5IB3A 4K71C 3WFCL 3A6CH 2FX8L 1XGRB 2EDLA 1IQDB 3TCXA 5FYLH 4XNMA 3L3OB 1KCSL 4OZ4B 2HLAA 4RBPH 4XXDB 2ORBL 1RV6X 4S1DD 1JPFA 1T22B 1BFVH 2VERN 1YEFL 5DO2C 3QIWD 4WO4D 2CXGA 3HE6A 4KV5F 2A6IB 3RGHA 3QQ9D 5DJ8A 1JV5A 1Z9SA 3CLFH 4FQQB 1Q94A 2AJVH 1Q9OB 2XXMB 1AGFB 3BESR 2LAAA 1JZ7A 3H3PL 5DFVD 3BRFA 4P3CH 3BX7C 1OWRM 4PPTA 1UB5B 2DLGA 2XYCA 2JELL 3QEQA 2R0LH 4ODBD 4ZFOL 2FGWH 2EYRB 1JGVL 4FQJH 4L3EA 2WBJB 3SGJC 3SEPA 1I8MB 4EOWH 2ICEA 4PRDA 1EERB 3KJ6L 4BSWA 5TQ0L 3C6LA 4ERSH 3SJVD 5T3XD 3CPLB 4PJGB 4AH2B 4K23H 3ARQA 1FSKC 3RVXD 4JCMA 4TUOA 1UH4A 1YMME 1FVDB 3TA3A 2DWEB 4DKFH 3MCLL 3WS6A 4LSPH 1MVUA 3FCTB 4JANB 5BO1L 1DVFA 5D7KD 2GIYA 4UUJB 2W1NA 1NCDL 5C70A 7FABL 4RMTA 1T21A 35C8L 4KWUA 4L29B 2EKSB 2X09A 4LVEA 5HYJB 1HZHH 2WUCL 3T1FA 1AD9B 1UM4L 4CMMB 3NPSB 3I6KA 3S36L 2IALA 2VDRH 1FC2D 2DQFA 2V17L 5B38A 3NH7H 1A1OB 4NOBA 2P42B 5C0EB 3MRLB 2R0ZH 2O61B 3TYGL 1NAMA 2NNAA 3L5JA 4HIXH 3IFNL 1HYSC 5C0JA 4LGSB 3S37X 3I3BA 2OXGA 2Q3AA 4Y1AE 4KMQA 4OV5A 1X4YA 3DX8B 3UTZA 1F02I 4ZPTA 4KI5C 3V4PL 3O2DL 5CJ5A 2F54E 5HDBF 4WJ5A 1UC6A 2AJ3B 5K9OB 4CU8A 3RWGA 4DVRL 3SCMB 2H3NA 2Q8BL 4MAYA 1TZHA 2DLFL 1NMAH 2HFGL 4NQEA 1R3IL 1KG0A 2Q7NA 1LQSR 5D5MA 1V3LA 1I9RH 2ARJB 2YKLL 3G6DH 2QHRL 2NPLX 3HR5A 2NXZC 5HGDA 3V0AC 3VFTA 2AK4D 2NLJB 4YHMH 2X4OB 2XPGA 4QO1A 5FOJA 4TTDC 1XT5A 2XWBB 2X89D 5D1XA 2VNCA 4OLVL 4L8SA 4OCSH 1NUFA 2BNRA 3MV7D 4UDUA 3JVGA 4IEFB 3ME0A 1E4XI 2F5BH 4CDGC 4YHKL 2VLRE 1JI1A 3V7AG 5ESQB 3LHPL 12E8L 1KIPA 4GG8B 1YYLH 5FUCE 4LSTL 4U0RB 2P8LA 1PJ9A 3WFHA 5EU5A 1QO3A 1MIML 4JPWL 5D6CB 4AEIH 4OUOA 5KG9B 2MPAL 1Z6JT 3SGKA 2DWDA 3QNZA 5BZDB 1X5KA 4R90H 5MEPA 3PWLA 2NY5H 1IGJA 4QXUL 1EHLL 2AVGA 2VLJE 3VFUA 1VKXA 3MREA 3AY4C 4QRRA 4HIJA 4Y16D 1DBBH 3HUJF 4WHTA 3O4OC 3NIFF 4PJFE 4ETYA 1FFQA 1R5VA 4YXKH 5B22A 2BFVL 1JZ3A 2D3VA 4TPRL 4X4YB 2YWZA 5CJXC 4M6OL 3TBSB 5DURD 1FNEA 1V3KA 1I3UA 4NM8H 1HN1A 4RGOH 1MCPH 4MHHG 2Y07L 3U0TB 1T83C 5JZ7D 4HCRH 1YQ2A 3FB6A 5BRZE 2P5ED 5E8DH 4XCFL 2AJYH 2G5BB 3VFMB 1A47A 1F8TH 3QPXH 4Q9CA 5MEOB 4NZTH 4KI5D 1QFWL 2F58H 1WWWX 3BZ4B 3MODH 2QLVB 4EKXA 5E8OA 4DK3A 1Z9LA 2D2OA 4XB8A 3HE7C 3QIBC 4UT9H 1QHOA 1KUMA 2F54B 3FFCA 3PG2A 1DBML 5EIQA 4UIKL 4FXGA 1NC2D 1JP5A 4YDLC 1AKJA 1HHIB 2CXKA 4LAQL 2NY5C 2VZVA 1WSST 2VDPL 2PYFA 4MX7B 3WLWC 1KEGL 1U3HB 3QFJD 4KVNL 3VJ6B 3WE6B 4JZJB 3AXLB 1FH5L 3IAGC 5C3LD 2QHLA 2NXZD 5HHXL 2MNUA 3B8SA 2VL5A 3QI9C 4TTDD 1KCRL 3QNXA 4WU5B 3T2OA 4PGBB 1A6ZA 4JFEE 4XP5L 3W0WA 3WHXA 1MCIA 3HZYA 4OTXH 3MRFB 5DT1L 2VLRB 4EN3D 1FL3A 5C0NC 3MZTA 2GTWB 4L9LA 4JAMB 3RKDC 4I77L 5LGHL 5E2TL 4TSBH 1AY1L 5J13B 3GMOB 1XGRA 2FB4H 4YHYC 1IQDA 4Y4KC 5IWLC 5J89A 4Y19E 3W39B 2HTKC 1J1OH 3O2VH 3BDYL 3O4LD 3L3OA 4PGCB 3WIFB 1TCMA 4OZ4A 4OM0L 5KANI 3CVIL 1XZ0B 4XXDA 4PJAE 1DFBL 1T22A 3MUY1 5F1OB 2VLJB 1OTTC 5CCKH 4CGTA 3ZTJH 5I9QB 3LKOB 4XPGL 4PJFB 4EI5B 2CJUL 1MCDA 1EIBA 2A6IA 4HWBH 3LB6D 4KRPD 4K3EL 5JOPE 3E1F1 3P9LB 4FQQA 1Q9OA 1AGFA 1HCFX 2O5XH 4EIZC 2J8UE 3Q6FB 5HI3D 1Z9OA 3CDCA 1G0DA 1UB5A 2AJSH 1NBZB 2EYRA 1OWWA 1I8MA 2WBJA 4ODXB 5I1EL 2GJJA 3RWDB 1GGCH 3LRHA 1J1PL 5BRZB 4U7SA 1NMBH 3CPLA 4PJGA 3RJQB 1FNGB 3QUYC 4AH2A 3HUJE 3K4AA 3AAZB 2QR0B 5HHVH 1NC4B 3T2PA 5IVXB 4HT1H 4Z7NF 1FVDA 5GS0H 2DWEA 2IBGA 1BFOB 1FRGH 1EHNA 2EDHA 2WW8A 1EA9C 3FCTA 3HE7D 3LH2L 3QIBD 4JANA 1QLEL 5EO0B 1WAAA 2A77H 3FAWA 2WIMA 4UUJA 4W4NA 3TJEL 1G9EA 3Q6GL 5CP3H 4L29A 1CIDA 4Z7UE 5HYJA 1TNNA 4KPHH 4W68A 1AD9A 1MCBA 3HHRB 2X9YA 4CMMA 4PB0H 4RFOL 3BSZH 2AXJA 3T8XB 4GAGL 3WLWD 5IB4B 3IDYC 1A1OA 1CVRA 2ZWLT 4FTVB 5C0IB 1DQTA 5C0EA 3MRLA 2P46B 1GOGA 5KSUB 2O61A 2JKXA 3S37H 2ESVE 4QHLB 1A7PL 4PRHD 4K3JL 3QBTB 5DD1L 3QI9D 4DKDC 2ZUQC 1MCJA 2OQJB 1F2XK 3DX8A 4KKLC 4DN4L 1A6VH 1NCBL 5JQHC 4TVPL 1JVKA 3GZKA 5SV3A 4JFEB 5F70A 1SEQH 4QHKI 1U6AH 3SKJL 1ZA3B 4KROC 4R0LB 5CGYD 1T6WA 2FO4B 1ND0B 3VI3F 2AJ3A 4YX2L 5K9OA 1DUYB 5C0ND 3QWQB 1CD1B 1R5IB 2A1WH 3ZL4H 2Q8AH 4JGMA 3RKDD 4KJYB 2YXFA 1MRFL 3SCMA 5GS1C 3VXOB 4K9EL 2VDLL 3S96B 3NIDE 5GS0C 5E99H 2CRMA 1EX0A 5ID0B 4Y19B 1A64A 1JZ5A 2V7HB 1UA6L 1S9YB 2YEZB 2ARJA 5C6WH 3ARTA 4HKXB 5EBWB 2AP2A 3ET9F 5E2UL 4N8CL 4KRMB 4GSDH 3O3BB 4PJAB 2NLJA 3IDGB 4OQTL 5AZ2H 2VDMH 2X4OA 4XVSL 2IQ9L 2VSDA 3QNYB 3RI5F 4IIQB 4U1IB 5E70A 2XWBA 1RFDL 4O02H 4TULL 3EO0B 3HS0B 4KZEH 4ELKB 2H2PD 4GMSH 4G6JH 4YUEL 3BPOC 5DD3L 5FO8B 5ESQA 2J8UB 4GG8A 4LLWB 4HJJL 1VGEH 5KJRL 1F00I 4XHJC 4Z0XB 3RWEB 1EO8L 3OWEA 2M1KA 5D6DC 5D6CA 4AL8H 1PZUB 1CICC 5KG9A 4ZOAA 1X5HA 3ILQD 2E3VA 2MKLC 1ZVHA 3D48R 4ZTOL 5BZDA 3V52H 3QUYD 4KY1H 3LN9A 3WSQH 5DI8B 4YWGH 3OV6A 1RD6A 1DSFL 1HNGA 2F53B 4R2GD 2Y1VA 1ACYL 2H6PB 1IFHH 3IFOB 4AG4H 4OFYA 1AO7E 4Z7UB 2CKBL 4X4YA 3U46B 4JG1H 3TBSA 1AQKL 1OP3H 1TIUA 1CL7L 4M7KL 5DQ9B 3B2VH 1QNZH 4PS4L 2YPKB 1DN2A 3U0TA 5EU4B 2C4FU 3MV01 2Y36H 1XGTB 2G5BA 3B83A 3LIZH 3VFMA 4PJBF 4KKLD 1U91B 5MEOA 2I9TB 1MCNA 3BZ4A 2OK0L 3C60C 1U8PB 5HI5C 1R24B 2QKIB 4FQ2H 3MJ6A 2F54A 4LARH 4Q9QL 3NCYS 4NUJB 2IQAB 4WUKH 2AJUL 1HHIA 4M1CC 4TQEL 1YEKH 2ZCLL 1E6JH 3R1GH 4OI7A 3LEVL 4RMSA 4GXVL 3GMRB 1T4KB 2JCCE 5GS0D 1MRDH 1I4FB 5KZCD 3OZ9L 2AS5M 5C6TL 4MX7A 1P53A 2WV3A 3WE6A 3VJ6A 1QSED 3DVFA 4JZJA 3AXLA 3HAEB 3QCUL 2A74B 4PLNC 1CXKA 3VW3L 4FQ1H 4WW2C 4X9BA 5A40E 1WIOA 4JKPH 4JY6B 3BE1L 1XF1A 3EFDL 2VWEE 4PJIF 4KK5D 3QISA 1ADQL 2DQEH 1MJ7H 1JMXA 3VI3E 4WU5A 1BVZA 1IT9H 4PGBA 4ONHB 1GIGL 2VABB 3ARWA 3FT4B 4WEBL 2FHFA 3BP6B 4G9FD 1QBML 5C09D 3MRFA 3OKKB 1MFEL 2VLRA 4OFPA 3NN8B 2GTWA 3ZYJA 4A6YL 4JAMA 3UTSE 3FZUC 4DGVH 2MOVA 3IJSB 2DLIA 1Z3GH 4YBHA 4XHJD 3GMOA 3F65A 5ANME 2H32B 3W39A 2FJFB 1T7VA 5A3IC 4PGCA 3WIFA 2WAHA 4P46C 1XZ0A 2OSLB 3E3QE 3GJEB 3PP3H 2VLJA 3OJVC 1MPAH 4PRPD 4WIQA 3BKYH 4IDJH 1NCAH 3LKOA 4PJFA 4EI5A 4CW1B 4KK9C 1SVZA 2BHZA 1AO7B 1T89A 3P9LA 2J5LB 4RA3A 1ZLWK 1LDPL 2EXYC 4F58H 5HYSG 3Q6FA 1S9WB 5ACLA 4S1SH 4K3DH 4PJDF 2YA2A 4BQ8A 1WTLA 2NY6C 1NBZA 3V4VL 1J1XH 2OTUB 5CLTA 4Z95L 1RUQH 4PYHA 2Z8VC 4A2MA 3RWDA 3ARXA 5BVJB 5BRZA 4XXCA 5GISH 1MCQA 1FNGA 1FG9C 2QR0A 3AAZA 1NC4A 4Y4FC 5IVXA 2D7OA 4NHCL 3C60D 2BY1A 1BFOA 2Z8SA 4URTB 4UV7L 1EHXA 5J12C 3IVKB 2B39A 5EO0A 5T3ZE 4UOW1 5J56B 3UCRA 3PWPD 2EICA 1JGDB 3CDGB 3OJDB 3K46A 3H9HB 3MV8D 1F3DJ 4YIQB 1MUJB 1W0WB 3B9KC 4OIBA 5AUMB 1AFVL 1H15B 3MBEC 3T8XA 5IB4A 1UM6H 1ZMYA 2M8XA 4FTVA 3F7QA 4OLWH 4EUPB 5C0IA 3UJIH 1R5WB 1Z5LB 2CRYA 4H1LH 4P2RE 3WNPA 2E7LA 1P1ZB 3R0MA 4W4OA 5KSUA 2LVCA 5LAXB 4QHLA 4LLVB 4YGVB 1KLUB 1JPTH 2R69L 1OM3L 2OQJA 2AK1H 4HS3B 4Q6IC 1ERNA 1FGVL 4JFEA 4GBXC 1G7MB 1ZA3A 3ZE2E 4R0LA 4XMLH 2FO4A 2VL4A 1UEMA 1ND0A 5DZLA 1DUYA 1HKLH 4KJPC 1CD1A 1R5IA 4I3SL 3QHZL 5TH2B 1BX2B 3UTSB 4KJYA 3VXOA 2NY0C 3S96A 5MI0C 5ANMB 5E5UB 4JY4B 4E42B 4HC1H 5JIPA 5ID0A 4Y19A 5GRYA 1KN4L 2V7HA 2VDQL 3DIFB 3HNSL 5A3ID 1S9YA 2YEZA 4HKXA 5EBWA 2YD7A 4NWUH 1VCAA 1MAKA 3O3BA 4PJAA 3IDGA 5EU3B 4P2QD 3RL1B 2ID5A 5HHMD 5HHOD 2XI9A 3QNYA 1DBKH 4FRWA 4IIQA 4U1IA 4D9LH 3EO0A 3HS0A 4JJ5B 4ELKA 1T0PB 3C5ZB 1NL0H 5EOQH 4YBQC 4JFDD 5FO8A 2J8UA 3MUGB 4HUUB 4P4KD 4XVJL 2PO6D 3FKUS 3VD4A 3MXWL 2IAMC 4OCLC 4LLWA 2QSTA 1P69B 4Z0XA 3RWEA 4UAOB 5JXEC 3R8QA 4LSUL 4H88H 1FIGL 5DJ6B 2CLVA 1KGCE 1N5YL 3WO4B 2O5ZL 4ONOA 1U93A 5DI8A 4F15C 4RNRB 4MA7L 3MPCA 4PD4K 4I3RH 4O58H 2FSEB 2F53A 4XX1G 2A9NH 2HH0H 2NR6D 3HB3D 5JIKA 4JJHA 1J8KA 3ULVH 4PJDE 2H6PA 3IFOA 3ZKNC 1CXHA 2ZG2A 4Z7UA 3SDCC 3P3YA 1HINH 3B9KD 2KPNA 3U46A 4XH2B 4OF8A 2APFA 3JV6B 4ZUTB 3MX0A 5C0GB 3HC4L 1D6VL 5KSAC 3GKZA 4LFHG 5DQ9A 4P2RB 3RUGE 2YPKA 3DRQB 1GC1H 3SDDD 1L9NA 5EU4A 1II4E 3DXAE 3FO2B 1XGTA 2DI8A 2R0KH 3H7BB 2BRRH 4NGHL 1U91A 2I9TA 3S3JA 2LTQC 5DA4A 1WBZB 1U8PA 1R24A 3P0VH 1CLOH 5F1KC 2QKIA 5I1LA 5ITBL 2DQCL 4U49A 4Q97A 4CMHC 2FH8A 2E7HA 2XQYG 1MCWM 4P2OC 3S6CA 4NUJA 2IQAA 4DUVA 5IGXH 5DXWA 4KJPD 3HI5L 3GSQB 3AUVA 4P5TC 1KFAL 5D1QB 5C2BL 1TLKA 2DKUA 1X3DA 3VG0H 2NY0D 3GMRA 1T4KA 2APTA 4K94H 1I4FA 2UWEE 4PV9B 1MJUH 3GRWA 1LO2L 4E41D 3HAEA 4NHUB 2A74A 4JY6A 3ULVC 3GHEH 4GS7C 5B8CC 4QKXB 4HPOH 1PY4A 4WW1B 1VEMA 3S36X 5D7JC 5HYSB 4ONHA 2VABA 3PNWB 3FT4A 4U6TA 3H42L 3BP6A 5FOBA 4YBQD 1GC1C 3OKKA 4MXVE 2X2YA 3MRJB 1BAFL 3OG6B 3DX9B 3NN8A 2IAMD 5GGRB 1OAYH 4CVZB 2FD6H 1VEOA 3VA6A 3IJSA 4MA1C 3WUZA 1FFOB 4DZBB 3ZKSD 4I0PB 1KN2L 3UXFA 4S2SB 5HYFA 2H32A 2FJFA 3QWRD 2WBWB 4CDHA 5INDB 5EZLB 4L8BB 2OSLA 3GJEA 3DYMA 4OLZH 2X1PA 3PGFH 3U7YL 5K9QG 5GZOC 3NZHL 1K8DB 2DI7A 4CADB 5BV7H 1KJVB 3IDIB 4K94C 5DMYA 3DMMB 4CW1A 2FX7H 5FA4B 1E4KC 1ZHBB 3NIGE 3ZKND 3TT3L 1AO7A 2J6EA 5TQ2L 3SDCD 4YHIB 3MBXH 1B88A 1S9WA 5C0DB 1CDGA 1YNKL 5FIEA 4XRCB 5KSAD 1OAQL 3RUGB 3K80A 4ZQKB 1OW0C 2OTUA 3C2SA 4BFBD 1ZWIB 3P11H 4XPHH 1EFXB 3DXAB 3ARVA 5BVJA 2FYYB 2APWA 4QYOB 4L1HA 4GKZB 2XZZA 1EGJA 4ODHH 4WI8A 1A7QH 4TN9A 3F6LA 3H0TB 4LLAA 3IVKA 3CMOH 4F8QA 4DQOH 3MFFB 2N7AA 3IKKA 1KCLA 2YSSB 2XNAB 1JGDA 3CDGA 3OJDA 2DDQH 3H9HA 1FZMB 4YIQA 1MUJA 4NBXB 2AABL 1W0WA 3VGDA 5AUMA 2DOCA 1H15A 1IAIL 4LCCC 1YEGH 4M7LL 5BV7C 2FECL 2UWEB 4EUPA 1R5WA 1JNHB 1Z5LA 2BSTB 1P1ZA 5TFSH 1Q1JH 4NN5C 2FH6A 1RPQA 1G9NH 5MERB 5EB9A 5LAXA 5ABDE 4LLVA 4YGVA 1KLUA 1RIUH 3WMSA 4PUBH 4HS3A 4X6DE 1IC7L 1ZLUH 4YQXH 3HRPA 5KVMC 4AEEA 3VDCA 4Y7MA 1G7MA 1T0MB 2XZQL 2RIKA 1V7MH 3K2UH 2GYSA 1I8IB 1CGVA 3IRPX 1GH7A 3GJFB 5D7KE 1MCOL 3TNMB 2OR9H 4P2YA 5TH2A 1BX2A 3UTSA 1G7LB 4Y8AA 4IOFD 1YQVH 3KNBB 3WXWL 1GGTA 4MQXC 5ANMA 4JY4A 4Y5VB 3RVVC 4E42A 1GGUA 1S7VB 5BQ7B 1TVDA 1NGPH 1JWUB 2FIKB 5J4MA 3DIFA 4LASL 3VFOB 3U83A 3MLYL 3WD5L 1GGBH 1TPXB 3RL1A 5GZOD 3Q3GB 4JFZH 4EBQL 4FQLL 1X5GA 4MVBC 3HR6A 1J5OL 3WUWB 4HUVB 5I30H 2DJUA 3NFSH 4BSJA 5KSVB 4JJ5A 3O45B 3WBDA 1MFAL 3C5ZA 4YNYB 4NN7C 4XCEB 4UB0L 2DLTA 1UENA 1KPVB 1G9NC 2LAGB 3PGCB 3MUGA 4HUUA 3K3QA 1DBJH 3SDAB 3L1OH 5EDXA 2G60H 1NSNH 3GKWH 3MOBH 1UKTA 3QXDA 1U41A 3MCG1 3MRCB 2NTSP 4JDTH 4J3UA 2AQ2A 2BRQA 4X80H 3TJHC 4K3GA 3INUL 5A2LH 5AZEH 5DJ6A 2HRPL 5IQ7H 2EXWD 3N1MC 3I2CH 2XWJB 3BAEH 4ONFL 1MY5A 4RNRA 2Z91B 2DD8H 1L0YA 4XNXH 4UQ2B 4PJ9B 2YR3A 3ISWA 4NNPL 1KEMH 5I19H 3QIWB 4WO4B 3MLSL 5HY9B 3BEVB 3QXTA 5FO9B 3T3PE 5L6YH 4OD3H 3TO4D 3MV7E 4DGIL 3EYSL 5GRVL 4XH2A 3CXHJ 2WQ8A 1RUKL 3JV6A 4YK4B 4ZUTA 3E0GA 5C0GA 1MWAL 5C0FB 3PDGA 1GAFL 4P2RA 1RVFH 3DRQA 5KVDL 1JYXA 4HEPG 5SV4A 2QADD 3FO2A 4FNLL 1G1CA 8FABB 1DANT 5FGCE 1CDJA 2VC2H 4U6YB 3H7BA 5FUZL 3SJVB 4X6DB 3GHBL 5DC4B 4NQCE 2AQ1A 1WBZA 4HBCH 2E7BA 3IXAB 3BEWB 3GMMB 3PWJB 1X7QB 3GSQA 5FYLE 4M6NL 5IF0B 2OTWB 5D1QA 2PYED 2BY2A 1YPZB 2JJUA 2C3HA 4XI5D 5F9DC 4HV8B 3RVVD 5EWIL 1ZOXA 1UQSB 2NZ9C 1PEWA 3FT3B 1J05B 4UINH 4PV9A 2FBJH 4FQHB 5E6ZA 4WI6A 4N8VB 1NCDH 3WJLC 5C71A 4U2YA 4NHUA 1FFNB 4QHNB 3I6LD 5IJKC 3UBXG 1CBVL 3TBWB 3GSNB 3S36H 4WW1A 2WIIB 2P5EE 1OSPH 2D7TH 3GBNL 3MA9H 4XNUH 4MVBD 1I7ZB 5EFIA 3HCVB 1RURL 2NX5E 3PNWA 1GL4B 4KI5E 4RRPA 5FKPB 4MA3B 3MRJA 3QSKB 3V7MA 3K1KC 3DX9A 3CFJB 5GGRA 4WFHE 1FFOA 2RGSA 2IGFH 4LOUC 4DZBA 2ADFL 4I0PA 1BPVA 4S2SA 4ODVL 3O6LL 4CJ0A 3A6BH 1EMTH 4GAYB 1S78C 3B3IB 3MRBB 3QFJE 4MGXA 3IXTB 5INDA 5EZLA 3S35X 4L8BA 5E2WH 5KVGL 5DWUH 5FM5M 1I9IL 2Q8BH 1CVSC 2AK4B 2WP3T 3OGCB 4MNQD 2W0PA 2HFGH 1KCVH 4X6FB 2OMNA 4O5LH 1K8DA 4CADA 1KJVA 3IDIA 4YDIL 3A67H 1IKNA 4P23D 3DMMA 5FA4A 3SDXB 1ZHBA 5DJDB 4M7JL 3BUTA 2UVFA 3R06B 5I6XC 3MV7B 1TQBC 1X4ZA 2BHUA 4YHIA 2PXYC 1P9MC 1NKRA 2NCMA 5C0DA 2MWCA 4XRCA 3RUGA 4ZQKA 1ZWIA 3EKCA 2R29L 1J0KA 1EFXA 4YHKH 3OXSB 3DXAA 4ODWB 5D7LD 5KAQG 2PKDA 5FGCB 12E8H 2FYYA 4IMKC 5EUOF 3O4LE 3WFBH 2YPLE 1I1RA 1W8NA 3I02B 1UG9A 4QYOA 4NQCB 4GKZA 5K9JH 4HUNB 4BFIB 3A6OA 1FC1A 3IFLH 4JPWH 2APXA 4XT1C 2BC4B 3QAZC 3ZKMC 5GHWL 3H0TA 1CLYH 4YEEA 3QUXC 3MFFA 4XZUB 3WYRA 3W9EB 4Y16B 5GGQL 1BGXL 2YSSA 5D2NB 5C0RH 3P4MB 4OCWH 2XNAA 3MGAA 2DQJH 5C92A 1FZMA 1EHLH 3OBAA 5DZNA 1RZFL 5TF0A 1CR9L 4JO4H 4L5FL 2ZKHL 5DURB 2NZ9D 5EOCJ 4LSDA 1MFNA 2UWEA 1ZVYA 3SQOH 1OCWL 1JNHA 2BSTA 2BXYA 3WFEH 2Q1EA 5E7FA 4XBEH 2BFVH 5INCB 4OZGF 3OKLB 4HAFA 2R56L 5MERA 5K9QI 3KPSD 4M6OH 2B4CH 1WV7T 2P5EB 1BECA 1DUZB 4ZFOB 3R4DA 3WHE0 4HLZG 2A6DB 4HIIB 3U4BL 3RVUC 2NX5B 2OTPA 1UB6B 3SHSA 2R1WB 1T0MA 1I8IA 1F6AB 3I50H 1U92B 2HFFB 3GJFA 4U6VH 4LHUB 3TNMA 1X5LA 3KPOB 6FABH 1UWEL 1NC2B 1Y18B 4WHDA 2RB8A 1G7LA 1OL0A 1G6RH 3KNBA 2BMKB 5H94B 3VRLF 4LOUD 4Y5VA 1FPTH 2OZ4H 1S7VA 1JHTB 5BQ7A 4R8WH 2FIKA 1JWUA 3M8OH 2VXSH 3I75B 3VFOA 3QFJB 3B9AA 3OAZK 3NTCL 2NXZB 1UH2A 1IJ9A 2VDPH 1T80A 1YYML 1I8LC 3RWCB 2KUTA 3Q3GA 4PRHE 4G8FB 1LO3L 3LKRB 3WUWA 4HUVA 4NO5B 2XTJD 4KVNH 2DM3A 4KZDL 5TE7H 5KSVA 1FH5H 3O45A 3KJ4C 5IQ9B 1FZOB 3F7PC 4YNYA 3GMQB 5GGTA 4XCEA 2IAND 1KPVA 4Y5YB 4EN3B 3PGCA 1OP5H 3ULUD 4Y88A 1ZANL 3L3GB 2QQLL 1OTSC 2B4CC 2CUIA 4JFFD 2BVYA 3SDAA 3BGMA 1IGMH 4S1RL 4YXHL 3MRCA 5EBLB 1VDGA 2AEQH 4EEEA 2YD3A 3ARPA 4ODTL 2CO7B 4HLZH 4XNYL 1ZKAA 4FHBD 4DFIA 1A6UL 3O4LB 1NGQL 2YPLB 2I25N 2D4FA 3T08A 1EHAA 1AI1H 2XWJA 2NMSA 5AD0B 1QBLH 2Z91A 2EE3A 4UQ2A 4PJ9A 3PWVA 3TBYB 4GQ9L 2YMXL 2NYYD 3HZKB 1MFCH 3QIWA 2H9GB 4WO4A 3O4OB 4WTZA 5HY9A 3BEVA 5FO9A 3ES6B 4KRPB 1YJDH 1IBGH 2R0WL 5DZOA 4O00A 1FZKB 2AI0L 3SOBL 4JQVA 1LD9B 2ZJSH 5IUSA 4JFOB 4XPGH 1MREL 1DR9A 1T1WB 1T1ZB 5EUOE 2EZ0D 3ARDD 2DN7A 4G6MH 3ABZA 1KIQB 1OAXH 1ZHLA 5CINL 2BHYA 4O9HL 8FABA 1FG2B 1CTOA 3ESVF 4U6YA 1BBJB 4HQQH 4P9HC 3G5XB 3SJVA 4X6DA 4KJWD 1JE6A 2OP4L 3B9VA 5EORL 1XGYL 4I48B 2OR8A 4LSVH 2PF6A 3IXAA 3HE7B 3QIBB 1D9KC 3BEWA 4HXAL 1J1PH 3GM0A 1F90L 3GMMA 1HCVA 3PWJA 2XKUA 3HE6D 2DIAA 4YDLB 5IF0A 2OTWA 1H8SA 1EK3A 1UCTA 1CGSL 4OLEA 4WEUD 3THMH 3K8LA 1YPZA 3PIQB 1CCZA 1KC5H 4OZGE 2HVJB 2C3XA 4KJQD 1U8LB 1UQSA 3FT3A 1J05A 4M5YL 5DEZA 4CUCA 4FQHA 4N8VA 5E4EC 4HFWB 1FFNA 4OT1H 2FHBA 4QHNA 3UO1H 3TGXA 1ORSB 5DD0H 2BDNH 2NY1D 3TBWA 3GSNA 1YJDC 3K8MA 2WIIA 4PRHB 3D5OF 4RFOH 3QI9B 3AB0B 5F1NB 3BKCL 1SMOA 4GAGH 1PYWB 4ZDHB 1I7ZA 2AAVA 4RMQA 2LQRA 3HCVA 3KPPB 2YPVH 5FKPA 4WW2F 4XMKL 1DQMH 1DLFH 4MA3A 3PUCA 2JJTC 4QNPF 2GSGB 1WBYB 1OARH 2R9HD 1AH1A 4NCC2 1JZ8A 1NFIB 3QFDB 1JNNL 3CFJA 3CSYB 2QSQA 3TZVD 1IGCL 5L8JB 1NAKL 3QIUC 4ZO7A 3SE3C 4XMPL 4YHYB 3GJFK 4Y4KB 2DMCA 1PKQB 5F6HI 4I0CC 4KTEH 3S35H 4GAYA 3B3IA 3QR2A 4IRSC 3MRBA 3IXTA 2YUVA 1HQRB 4U3CA 2WWKO 5SX4H 3K0WA 4W6WB 2AK4A 2ZPKH 2CLZB 3OGCA 4X6FA 3CGTA 2A0LD 3DYPA 5HDOA 1CDCA 1T2XA 1UACH 4IRJC 2X89A 3SDXA 1BWMA 1D5IL 5DJDA 5TPWL 5FYJU 4G9FE 3R06A 3MV7A 5C09E 4B50A 2I26N 1Q0YL 1UWGL 1L9MA 1WFUA 2IQ9H 2EDEA 2B1HH 4JY5L 1EDQA 4J2XA 5KBNC 4K2UH 3L3DB 3UBXI 5I1GH 4LPWA 5AWNH 1F45A 4LF3B 4CAGA 3OXSA 4ODWA 4APQC 3HI1B 5DD3H 1IL1B 3FQNB 4DGYH 4OGXH 1NCCL 3O6FC 4ENEC 1N6QL 3I02A 1FBIL 3QUYB 4JQIL 4C54A 3S98A 4NQCA 5C07D 4BFIA 1QFHA 2IC2A 3D3VD 2BC4A 3E2HB 2UV3A 4XZUA 4F7EB 1A6WL 3W9EA 5D2NA 2RAMA 4IDLA 3P4MA 4HUWB 2V5TA 4PRNB 1QSZA 1IQWL 1C7SA 4JFYB 4CN4A 4Z7OE 1K4DB 2B1AH 3KPRE 3P0GB 4C55A 4GAFB 4UZGA 5E08L 5E2JA 5INCA 5B3JE 1K6QL 3OKLA 3GBMH 4PBWD 2P5WE 1F4HA 5FDWB 1AQKH 1RUPH 2P5EA 3UYRH 1DUZA 4WUUD 4ZFOA 2ZUQB 1CL7H 2A6DA 4HIIA 4EZMA 4PY8I 2NX5A 2XACC 1UB6A 2R1WA 1PZ5B 1F6AA 1KBGL 4YFLI 1CGWA 1U92A 2HFFA 3NCCB 4LHUA 3KPOA 4IRZL 3MC0A 1W0VB 3PWPE 1NC2A 1Y18A 1J0YA 5J11B 4LSQL 2BMKA 5H94A 3QIUD 2EIEA 1JRHL 4IJ3C 1JHTA 1Y6NR 5JPMB 3I75A 4K7FB 2AJUH 3QFJA 4NKIL 4Q2ZB 1E28B 2ZCLH 1FQ9C 4DVBB 4N1EA 3DSFH 4KK6D 1GPOL 4GXVH 3RWCA 4KHTH 2D03H 2VDKL 4G8FA 3OZ9H 2ICES 3LKRA 4YJZL 4NO5A 1RUMH 4RDQG 2V5YA 2HKHL 4G9FB 2F9BT 1NLDL 4RZCB 5IQ9A 4NKQB 5C09B 1FZOA 1YEEL 3TWCH 3ZHKA 2HA1A 3GMQA 3EFDH 2XZCL 4ELMF 4Y5YA 4EN3A 3BPOB 3L3GA 4XCCH 4BK4A 3O2DA 4YHPB 2QL1A 2MHAB 5KVFH 3Q48A 4N9GB 5E6IC 5I73B 5EBLA 5JMRA 3RDTD 5I17B 4M6ML 1NUGA 3QCTL 2JB6B 1S7SB 2WINB 1QRNE 2VH5L 3O6FD 4ENED 3O4LA 4HZLB 2YPLA 3LKNB 1X5YA 4LCWD 4O4YL 5AD0A 1QD0A 3BMWA 2HMIC 4P2QE 5J1AB 1B4RA 5HHOE 4N5EC 3TBYA 1RU9H 3GI9H 3VXUD 1YEHH 1Q0XL 4ZSOE 3HZKA 2H9GA 2Y72A 2YRLA 4OF3A 2EDOA 4LQFL 1WBXB 1AC0A 3ES6A 1WFTA 2P1YA 2B8OT 1N64H 1K5NB 1AR1C 1FZKA 5CJXA 1LD9A 5IEKB 3N85L 2A9ML 4JFOA 1T1WA 1FO0H 1T1ZA 3VFGH 4H20L 1QZ1A 2R8SL 2BVEA 3ZYOA 1BQLL 4UOJA 4LIQH 1KIQA 1T83A 4KMTL 4LK4A 1LDPH 1FG2A 1BBJA 1I9JH 2HRLA 3G5XA 3BP5B 3P9MB 4OM1H 4LU5H 4M7ZC 3VDBA 3TC9A 3V4VH 3ARED 4I48A 5IHLB 3C60B 4YH6A 4Z95H 1AE6H 3OR7B 2HWZL 3HZVB 4NRYB 3HE7A 1C16B 3QIBA 1IC4H 3SDYL 4L8DB 3MRNB 4LP4A 5B39G 3PWPB 4EXPX 3AS1A 5B21A 3OJ2C 3G6JB 3T0EC 3PIQA 4H5SB 4OB5L 5BZWB 5D96C 2HVJA 1U8LA 4G7VL 3G5ZB 4MNGB 5I0DA 3GSUB 2CKBB 4HFWA 5JTWA 5HGAB 1JIBA 2O5YL 1KB5H 1H3WM 1ORSA 2SEBB 2IFFL 4X9FA 5JHLL 3KPLB 5CSBA 1RJYB 4M43H 3GO1L 4PRHA 3QI9A 3VU2A 5F1NA 4XVTH 1PYWA 4ZDHA 4JHWL 3UTPD 3KPPA 4LHJB 5JPNB 2YD9A 3C8DA 3ULVF 4Y2DC 3DETC 1T1XB 1UZ6F 2GSGA 1WBYA 4ZTPH 5HVHC 4HCRA 2N56A 1A6AB 1NFIA 1TETL 2IMMA 2IH3B 3ARYA 3CSYA 1SYVB 2OBGA 3DVIA 5B4MD 5E6ID 2UUDH 4U6HB 5DA0B 1TJIL 5C0AD 4UILL 5F71A 2Y06L 5C9KA 5IESL 1QRNB 2HJLB 4Y4KA 4NJ9H 1JYNA 2DB8A 4LLQB 3KS0J 3QHZH 4RWYL 5CBAB 1HQRA 1AJ7L 5SWQB 1KCKA 1ZEAL 2CLZA 2XIDA 2YC1B 4ZAKC 4M62L 4NYLB 5JOEA 1RY7B 4P2QB 5HD8C 3IU4H 5HHMB 2HYMA 5SX4I 4G3YH 5HHOB 4AEHL 1KN4H 2VDQH 4ZSOB 2H1PL 1NFDB 3BOVA 5DQDH 3S34L 4XHQA 1TVBB 1PLGL 3L5XL 1C5CL 1CIUA 4PJ8D 4JFDB 1AR1D 1UJ3B 2RFXB 3LRSB 4P4KB 2F15A 2PO6B 1BM3L 2F19L 1LHZA 5DMGC 5GJSL 4A2LA 3L3DA 1UXSB 3BDBA 4LF3A 5MP6L 3HI1A 4A6YB 4CL7A 5JNYB 5ILTH 1IL1A 3FQNA 1FL6B 2Q6WB 2I9LB 4XVJH 1CFVH 4XPFH 1G9MH 1CTNA 4FFYL 4MD5B 3QUYA 4Y4FB 1GRWA 2LU4A 2DJ4A 2X42A 2CIIB 4BA8A 2Z92B 3FT2B 5J12B 5BOPA 4U1GC 4F7EA 5IHUH 1FIGH 4HUWA 4PBVC 1LP9F 3LOWA 4OCXL 5I18H 4PRNA 1A2YB 3NCMA 4OJFH 3FOMB 4U2ZA 4JFYA 3B9KB 1K4DA 1P84J 3MUHL 3K1DA 1U3ZA 2EDWA 5HPMB 4DKEH 4TSCL 5ITFB 2P48B 3SDDB 4GRWB 2IH1B 3BPNC 4HWBA 2NY4C 2GKIA 3PXJA 4PTTB 5FDWA 2DQGL 4WI9A 3RWIB 2VDNH 3FO0H 3GSRB 4JVWA 1D6VH 1EJOH 1UVQB 1YMMD 4RGNC 1PZ5A 3EYUH 3MLXL 1CL7I 4Y2DD 3DETD 1HH6B 5JW3H 3QDMD 4AIZB 3EYVB 3HLAB 4KHXL 3H3BC 1W0VA 1NUNB 1W8OA 2CK0L 2J88L 2RR3A 4Z0BL 1KTKE 1G9MC 3U30B 3QUKB 4PJEF 5E03A 3KLAB 4OFYD 3UZQA 2NY0B 2A2QT 3KPMB 1XIWC 5JPMA 4OFVA 4K7FA 3QEGH 3LD8B 4Q2ZA 2EEBA 2E9BA 1R3HB 1E28A 3QUMH 3NFPB 4JPKH 4DVBA 4XP4L 3ULVE 3TIDB 5CP3A 3B2UD 3RKPA 4Y1AD 3Q1SH 3TN0C 3NAAL 1BWWA 2CSPA 4NWTH 1P2CB 4G9FA 4RZCA 4H1LB 5C09A 2F54D 3K81A 5EULV 4NZUL 4WY7L 1F4YH 4ZFGH 4WI7A 4YHPA 2IAMB 2MHAA 5I1KL 4N9GA 3H42H 1LWRA 2AERT 4ISVB 5I17A 1MIEL 3S3SA 5I1IH 3N1PC 2JB6A 5FDYA 1S7SA 5D6DA 2WINA 2JJWA 3OG4B 3VH8B 3CH1B 3N06B 4HZLA 5ELIA 5IBUB 3P9WB 3LKNA 2YA1A 2MQ0A 5B39B 4RCAA 1RJCA 2M26A 5ICZB 4UNTA 5TDNB 5J1AA 4Z7QE 3MLTB 4ZXBD 1QYGH 4XPBL 1RJLB 1BQHG 1WBXA 2HLFC 3F8UB 4OQTA 4X7TB 5TE4H 3ZE1E 1A7NL 1W72H 1OAKH 4XX1E 5FYKU 3SDCB 5IMKB 3NZHH 1K5NA 4TSAH 5I8KH 1CXIA 5IEKA 1GZQB 3SBWC 5KSAB 5DK2B 4NKOB 3AC0A 5J3HC 1ZE3C 3MJ9A 2AJXL 3WFZA 4G7YL 4LEXH 1FVCB 2BY3A 2ZUXA 5F1SA 3U0PB 2NY4D 4XC3H 3CXDL 2H26B 1M4KA 3BP5A 3P9MA 2UZIL 4JE4B 1WEJH 1YECL 2LTQB 4OFDA 4JM2C 3C60A 4TNVF 3OR7A 3HZVA 1Q72L 1UH3A 4NRYA 1C16A 4HKBB 3SDXF 2DLEA 1I85C 3CFKB 2I60L 3QXUA 4J8RB 3EUUA 4L8DA 1FYTE 4P2OB 4J3WA 3MRNA 2W9DH 3PWPA 3ARFC 1PQZB 4P5TB 3GUTB 2EDYA 4H25B 3G6JA 3RBGA 4FABH 4KTDL 4H5SA 1XF2B 5BZWA 2C3VB 4RAHA 3G5ZA 4MNGA 5EOCL 3DX7B 4Q7DA 3GSUA 2CKBA 3CD4A 3P30L 5HGAA 4ORGB 5JXAL 2SEBA 2APBA 3VA2C 3KPLA 4WCYL 2X05A 1FNSL 1RJYA 3S88L 1UWXH 1F97A 1IM3B 2VXQL 4D9RD 5JPNA 2EDJA 5D8JL 1I3RB 4LSSL 1KLGB 5IBLC 1T1XA 3VXRE 5IM7B 5DDHB 2C5DC 5FUOH 4X5WB 1N7ML 1A6AA 3HC3L 4BH7B 1A7RL 1S9KC 1MLBB 2IH3A 5FYJH 1MCLA 3O8XD 5AG9A 1SYVA 4OD2B 5C8JB 3AGVA 2IG2L 3KPQB 4U6HA 2X4UB 3HG1E 5D7IF 4YHLL 1KTLB 1QRNA 2HJLA 4QOKD 1H3GA 4OCRL 4LLQA 5EIVA 1IC5H 5CBAA 1SM3L 5SWQA 1VPOL 3WXWH 3I6LE 4J4PC 4MD4B 3UMTA 2YC1A 4NYLA 4PJ7F 4P2QA 5DHXB 1M05B 2WUBL 5HHOA 4OCYH 5A2FA 3C5SB 3FQUB 4ZSOA 1DBAL 4LASH 3LMJH 4LVNC 1XAUA 1NFDA 2P24B 3DPBA 1ZLVH 2HLFD 4HXBL 4L4VE 3U36B 4ONGL 1RIVL 1J8HE 1TVBA 4QHKJ 5A2KH 4HWEL 5TF1L 3OKNB 4FQCH 4JFDA 2ZUWA 4FQLH 1UJ3A 2RFXA 3NACL 1F4WH 3LRSA 4OIIH 2W91A 4P4KA 1BIIB 2PO6A 4Q9RL 3RWFB 2ZSWB 2D4DA 4WFGD 1RMFL 3BMVA 3QJHB 5J3HD 4QTIL 3QHFH 3PHOB 3V4UH 1MFAH 1UYWL 1UXSA 2K7QA 4HMDA 4A6YA 5JNYA 1JK8B 2WZPD 3F58H 4BFGA 1FL6A 2Q6WA 1FGNL 2I9LA 5I1HL 4MD5A 1A14H 2A73B 1FDLH 1V7NL 4X8JB 4L9DA 2W07A 4Y4FA 1WT5A 2CIIA 4MNQE 2Z92A 3EHBD 3GK8L 3FT2A 1I8KB 4BZ1H 3BXNB 1BVLB 4ESKA 4OCNC 1AD0B 1MHPH 4K3HA 1A2YA 3TO4B 3FOLB 5JOPD 1A3RH 1C1EH 4OF5A 3FOMA 5D2LF 3BPLB 3B9KA 5DRNB 2HFTA 3UTTD 4NNPH 3MBEA 3L7EB 2WQRA 2FZ3B 5HPMA 5SX5K 3MLSH 1JHKL 1NBVH 4KKCC 3GMLB 5ITFA 2BVPB 3SDDA 2IH1A 3EYSH 4NN5B 5IT2H 4D94A 3EZ8A 1GHFL 5D7LE 4PTTA 1EGJL 3QUZD 4OKVB 3RWIA 3GSRA 4BQ9A 1OT1A 1UVQA 3ARRA 3U7WL 5C1MB 2DIBA 3C2AH 1RZ7L 3WHE1 1HH6A 4FNLH 4AIZA 3EYVA 4X9IA 3HLAA 4C57C 5FUZH 5CJOL 4S1QH 1J86A 3RTQC 2VXUH 3QZWB 1EUTA 3QUKA 2PYEB 4ZUSB 3KLAA 3HG1B 3BO8B 3GSWB 4QRUB 3KPMA 2AKRB 3UJTL 5CGMA 4HH9B 4OZIF 1ITCA 4NDMB 5F7LB 1R3HA 3NFPA 4R3SB 4J4PD 1IEHA 1QR4A 2ESVD 3TIDA 3TBVB 3KR3H 3UZEA 5EWIH 4OSUL 4N0YL 3F6IA 1R3KB 4XBPB 2BSSB 5DJ0B 1P2CA 1T2JA 4H1LA 1KF9B 4L3CB 2O26U 3ARBD 2V5RA 4YZFF 2LE9A 3GBNH 1L7IH 4F9LC 2W9EH 4YR6B 2IAMA 2ZZUT 4GMTH 4M4PA 4NRZB 1ODAA 4FXLA 4XVUC 2OI9C 1L7TH 4C56E 2GY5A 1DLHB 2F8OA 3VH8A 3CH1A 3QWRA 4R96B 3T0BA 5B39A 1IEBB 4KQ4L 4PLOB 4YFLF 3EO1B 4HKZB 4MNQB 3BP7B 4LVHB 5ICZA 5TDNA 4FFVC 3MLTA 2DQUH 1YNTB 1RJLA 4OIAA 4CVXB 15C8H 4X7SL 4K7PL 4P23B 4B7IA 1WVZA 5CEYB 4X7TA 3AS3A 1JHLL 5KAQF 4G5ZH 5ALBH 1VB9A 3OB0H 1T5XB 3SDCA 5IMKA 3O9WC 1SHMA 4MD0B 1KJ2H 3X3FL 2VUYA 3ULUE 1PG7L 4JFFE 1GZQA 5I75B 5KSAA 5DK2A 4NKOA 3OAUL 1FVCA 2R2CA 4QXGL 5BW7C 3MLVH 3SKNB 2OXHA 5D7LB 4FOMA 3RA7L 4Z78B 1KCUL 2H26A 1YEJL 4WWKC 2VQUA 2J1KA 4ZS7L 5T3ZL 3NOIA 1U3YA 5E6YA 1AGBB 3L3JB 3LRGA 1CE1H 3TV3L 3S9DB 4RA0C 4WTWA 1BVKB 1DANU 4HKBA 4UDTB 4I9WE 2RCSH 3CFKA 4J8RA 5FCUL 5B38G 4P2OA 1PQZA 4P5TA 3GUTA 2JJSA 5A1AA 4H25A 1AO7D 1QG3A 1XF2A 4KKNA 4NQVB 2C3VA 1H3PL 4YHZL 3UX9B 4GLRH 4JPVL 2O93L 4KVCL 4FZEL 5GGQH 3DX7A 4R7NB 5LQBH 3VDAA 2CDGB 1IGFH 4ORGA 5CHNB 4P5KB 1FLRL 3KPSB 4YDJB 4PJHF 1IM3A 1A3LH 4HK0B 1RZJH 3TT1H 5HXMA 2VN7A 5AYUL 3VWJD 1I3RA 1T03L 5KSBF 2PNDA 1KLGA 5LGKA 2C1PA 2B5IC 5IM7A 5DDHA 4XC1H 2F5AL 3UTOA 4X5WA 4D3CL 4BH7A 3VGAC 1MLBA 3VXNB 4OD2A 5C8JA 4JG0H 3KPQA 1H3UA 3RAJL 2H8PB 1VHPA 4H0HB 2X4UA 4XVUD 1CFTB 1QPXA 3N9GL 3BRDA 1KTLA 2CUMA 4U1HB 1IMHC 2E27L 4LPUA 1IM9D 1UWEH 1JGEB 1G7HB 1BD2D 1CK0H 3GNML 4OZHE 2VLKE 4MD4A 3TFKC 1KB9K 4X6CE 1M05A 4FFVD 4UTAH 1EBPA 3DECA 5DR5L 4RMUA 3C5SA 3FQUA 1KNOB 1NAMH 3BWAB 3B43A 4Z8FL 5FB8B 2P8PB 2XTJB 3X3GL 1KELH 5JQ6L 1E4KA 3U36A 1FE8L 4O2EB 5HSFA 1P5UA 3M07A 3CK0L 3OKNA 1CZ8H 3O9WD 2GCYB 2IANB 1LO3H 2PXYB 1BIIA 4JFFB 5BMFL 3EOTL 4POZC 3RWFA 2DQDH 2ZSWA 1SJXA 3I9GL 3MSPA 4JO1L 1RZJ