1MEXL

Antibody catalysis of a bimolecular cycloaddition reaction
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIVMTQSQKFMSTSLGNRVSVTCKASQNVGTNVAWFQQKPGQSPKTLIYSASYRYSGVPDRFTGSGSGTDFTLTINNVQSEDLAEYFCQQYNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTGGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 29G12 light chain
publication title Antibody Catalysis of a Bimolecular Cycloaddition Reaction
rcsb
molecule tags Immune system
total genus 52
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2002-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mexL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mexL01
1CFQA 4LU5L 4JRYD 5DJ2B 5F70A 2E27L 1JZ4A 2R69L 2WMPA 3TBSA 5HY9B 1QBLL 5EBLA 1P69B 4Y4FC 5H2BA 2VLLA 1TVDA 4CVXA 2D0HA 2A9NL 1JZ3A 4FABL 4P3CL 2EXYC 4GQPH 1QUNA 4CU7A 2YSSB 4PG2A 5DD0H 4OGZA 1T83A 1CD0A 1DANU 3FTGB 2ITCA 1Q1JH 3CXHJ 3UYRH 1SYVB 3V0AC 2BY3A 2CIKB 1VGEL 1FZKA 1G7JA 3AB0B 1S9XB 4LDOB 4Q2ZB 4LHUG 5DO2C 1JI2A 4H0GA 4NN5B 2V7HA 4EDXB 4ZTOH 3BH9B 4RNRB 1LK3L 3BN3B 5HGAA 3SKMA 1WWCA 2VL4A 4PYGA 2VLRB 1N64L 4XC3H 3QO1A 1R3HB 1E4KC 2BVOA 4KQ3H 4X6CA 2FYYA 1T3FB 2X4TB 2DBLL 4HXAH 1A7NL 1SEBA 3ALPA 3TVMA 3G04A 4P4RA 3RL1B 3FQWB 2ESVB 5DYOB 2XZCL 4ZODA 1GL4B 3KPLB 3O3AA 3P30H 2OYPA 4D2NA 3JV6B 2WP3O 3ARGD 3B4NA 5GGRA 2EDRA 4WWKC 4TNWK 4PJIB 1FV1B 2HKHH 4U7MA 3PWVA 3EDDA 2XA8L 2I9TA 3PP4H 4DVBA 2N7BA 5HYQB 4LAQH 3VRJA 3KR3L 4OQTH 5IQ9A 1RFDH 3KJ6L 3MXWH 1NFDF 2P8MA 4P59H 1VADB 2YUXA 3GRWA 4ZXBA 1ZT7A 4P5TD 1FL5B 1EVTC 1WITA 2GSGA 4G6FD 4L4TE 5IG7B 1JTOA 3HZMB 2RAMA 3STZA 1EMTL 2X09A 4AQ1B 3V79C 3MV9E 2ZCHH 3HE7A 4N90D 2R8SH 1OY3B 1AY1H 1FGVH 3HFMH 4K07A 2F8XC 3VFWA 1GHFH 3T0BA 1I7ZB 1JMXA 4ZMAT 4LCUA 3L9RB 4X6DA 1KJ2H 5FHAH 5CSGA 5DQDH 4PPTA 2OTWB 5I1CH 4QGTA 1PG7L 5I0DA 1UQSA 3DUSB 4DAGH 2R1YB 3BI9X 1L6ZA 3LN4A 3NGBB 5DGRA 4BH7B 4X4ME 5GGTL 1QRND 4PRHE 3OPZH 2XTJC 4NQDB 4OZHE 4ODXB 4CJ1A 1R5IB 2IMNA 4HJGB 1MCEA 1IL1B 1B0WA 4PJXF 3T2QA 2XZAH 3NFPA 4L8DB 1QEWB 3MLSL 4IOIB 4L4TD 4Y7MA 4K2UH 2YEZB 5C0CB 1ZMYA 5HYEA 5ISZE 4A2LA 4P3WA 3ROOA 4G8IA 3MNVA 3MV9D 1CG9B 3F7YA 2CKBA 4KJYB 1KJ3H 3WMSA 4CN4A 1MIML 3BN9C 1YMMB 2QTEA 5INDB 5IB2A 4K7PL 5GS1B 5DA0B 4OZGE 4UV4H 1X9QA 1YPZA 4WGWB 5JIKA 1MY7A 1YNLL 5EU3A 1WWAX 1FG2B 1ZHBA 2B7DT 3DJ9A 3GMOA 4PRHD 4DQOH 3LDBB 1OARL 4Y1AB 2ITDA 1NSNL 4QHKI 3DV6B 5F88B 3FB8A 5CZXC 2B20A 3MOBL 3TJHC 4PJ9D 1TFHA 5J1TC 3QUZB 3GHBL 1M7DA 2OJZL 3HE6B 3MRMB 5I8EB 3MUGA 3LB6D 3QBTB 1OGTB 1RIUH 1JFQL 2APVA 4D9RD 1N8ZB 5BVJA 4YR6B 3RUGE 3FB5B 2IAMD 1FNHA 4JVWA 1UWXH 4M7ZB 1BBDL 2E7MA 4KRPC 4DK3A 5FM5O 4RMVA 4JFFA 2C3WA 1QSFB 3D3VA 4EI5D 4P2RA 1A7QL 1T83C 3REWA 1LQSR 3EIFA 1S7TB 1DCLA 1DFBL 4L4VB 1XF2B 4K3DH 2UVEA 1IM3A 5I73B 3M1BB 3LD8B 3VXSB 2X4OA 1EFXA 1MCOL 1DQQB 3GSQA 4XMKL 2ARWA 5JMRA 4OD1H 1PDKA 1KLUB 1G1YA 5EO1B 1P9MA 1XGYL 2FHCA 3C6LC 1IAIM 1XZ0A 2GJZB 2W38A 5DWUL 1J1XL 2P8LA 4NKMB 4PJ8C 5A2KH 1R0AH 3VMPA 4BSWB 3UTSA 1ZHLB 2H3NB 3QZWA 4HAFA 4JCLA 4TTDC 2EE3A 4BYHA 1P53A 3BYTA 4M7KL 3SDYH 4YQXL 3ARDD 3PABB 3NVQA 4MQ7A 1EX0A 4JEGB 3TBWB 3PXJA 5IM7B 1EJOL 5ITBL 1ADQH 4K9EL 4NQUA 5JZ7D 3VRIA 1W8OA 4PJGB 3W5NA 3DLQR 3K1DA 4J6RH 1GGYA 3N9GL 3TWCH 3GRWH 5ITFA 3SHSA 1MJ8L 1BWMA 1TVHB 5IMOB 5DF0A 4ETQA 1R3LA 1Z5LB 3WFBL 2DQUH 5JO5A 1FGNL 4KJWC 4YHYB 1RUKL 4M62L 1LHZA 1DN0A 5J12B 1OAUL 1AR1D 3P4OB 3VI4F 3BMWA 5SWSB 5JW4R 1E6OL 3ARFB 4ZXBC 2K7QA 4BQCA 3VXQB 4MD0B 3ZYOA 1RUQL 3OB8A 5DJCB 4G43B 4Q7DA 3IXAB 4LLDB 3VXRA 1ETZA 5SWQA 2DQFA 2QQKH 1MRDH 3DX6B 5L7XL 5TDPB 5IW6B 3LQAH 5E6IA 5DDHA 1S78D 2XWTB 3OF6D 1MCCA 5JOEA 5DRZA 4KGJA 4WCYL 5TE4L 5JPNA 3CFEB 4M6NL 4HWEL 1Q38A 3TYGH 4O51B 2FECI 4FQQB 1GRWA 1JWUA 1RUAL 4G8EB 4MD4A 3DO7A 3LRSA 4KMTL 1JHTA 4QCIB 2VLMD 2ICEA 1NBYB 3LQAC 2C3VB 4KV5E 1OQXA 2WLYA 3NIGF 3ZE0E 1A5FH 4LQFL 3SO3C 1Q72L 2NQCA 4GG6A 2QV2A 3MQIA 3DSFL 2CKBH 2V9RA 5IJVB 5EORL 4YFDB 5EN2B 1JWMB 1JPTL 5IHZB 4JM4L 2P24B 4YJZL 1J8HE 2H41A 1QG3A 4PJHB 1T7YA 3QPXH 3LIZH 3TO4C 1KPRA 3GI9H 1W72H 4RBPH 3RVVC 4N1HB 5FV1L 1X5JA 3P0VH 2PTTA 4IDLA 4KI1A 4PJAF 1EK3A 5TDOA 4GRLA 3ZHDA 4Z7WB 4WFFD 3QIBD 5DQ9A 1IC7L 1LILA 4BUHA 3IDIB 1GAFL 4M1GH 4KRNA 4PTUA 4U1GB 5DEGB 3O3EA 4G6KL 3FZUC 3E8UH 4ZO9A 2FX9L 1KB5L 3KNBA 4FQIL 5D8JH 3MUJA 5DA4A 3QZWG 1U3HD 1VACB 1KPUB 1XR9B 2VLJB 2BFVH 5AUMA 2DQCL 1NCWH 4S1RL 1KOAA 2D7MA 4NNYA 3HCVB 1LEGB 1A3RH 1DQTA 3V7AE 5LGJB 1JZ7A 4L8CB 3QEQB 3HI6H 2AGJL 3F58L 4Q9QH 2Z92B 1J8HD 2DIAA 3SPVA 3KYAA 4BK4A 3MBED 1KJMB 2L7JA 2P5WA 4AT6B 4MNGE 4RWYL 1X44A 1H3PH 4F7EA 2DYPB 4EOWL 3GHEH 2HFTA 1Q8MA 1A6WL 3V5HB 2BRRL 2NR6C 2PXYA 2BVYA 5ACMA 2R0WL 1CE1H 5HHOA 4CADB 1DQML 1DTUA 1YYLL 2YXMA 3SDDC 3MRDB 2MPAH 1T20A 3BGFB 4PRIB 4XT1C 3UJIL 5EBGA 3GMMA 4YHZL 1RZKL 3RWIB 2X1XR 2NLJB 4FXGB 1P9MC 3QUXA 5F9JA 1FFNA 1A7RL 1A6TA 1KTLB 5HHME 2DQGH 3ULSB 4CVWA 4P48A 4K94H 5KVEL 2BNRD 5HGHA 1S7UB 1H8NA 5D7LD 2RIKA 1WT5C 4LVOB 2DI7A 4DK6A 4MNQA 1MAKA 3ZO0A 1LMKA 1YEKL 4TNVF 5I1JL 5I8CB 5IVXA 1FORH 4I0KA 4ZS6D 4BFEA 4XPBH 4DOHB 4R7NB 4FQHB 3PQYE 4K94C 5E5MA 5BCAA 1AGFB 1ITBB 4RGMB 3VG9C 3HS0A 1HDMA 4U1KB 1EH9A 3C8DA 3U2SA 3DURB 4EEEA 1BPVA 4XCNA 3TYFB 5CD3A 5T1LA 4LKCB 1TVBA 4V1DB 4WWID 1GPOH 5BV7B 4N0YH 5E9DE 2NY4D 4UBDC 4ZFGH 2E6PA 1CVSC 1G7PA 3BDXA 2JTDA 1GIGH 1KYOK 3C5SA 3Q6GH 4XP6H 1MH5A 3BVNA 1F6AA 5SX5H 3K0WA 3HG1B 4OAWB 3ULVF 1I3RB 1U58B 3AREA 4NZRL 5IHUH 4PB0H 2PW2B 1F3JB 3BZEB 3PQYD 4YHPB 3RVTD 1MQKL 4DN4H 4ORGB 2NX5E 1X5LA 3WFCL 3CAFA 3ZKMD 2B0SL 5D93C 4C4KO 4U0RC 5JXED 4OCWL 1M71B 4XHJD 3TNMA 2O5ZL 2AABL 3O0RL 1Y0LA 5E9DD 1LK3H 2EH7H 4FZEH 5CGYD 1A6VL 3BD5A 1PW3A 5DJDA 2FLBT 1I7TA 4GAGL 5IMMA 3O6LH 1WBYB 1MCWW 2PO6B 1SJHA 4D0BA 1SYSA 3PL6D 3T0EC 1T7WA 3UTQA 1KCSL 1A7NH 1KCKA 5D6DA 5ANME 1BZ7B 5TJWK 3AXLA 3QUYA 2WBWB 3STLB 3X3FL 1WCBB 1JIBA 4NN7C 4RMWA 2P7TB 5AZEH 1Z0NA 5TF0A 1DEEB 1CR9H 3TV3H 4KXZI 1YQVH 4GRLC 2NX5D 1Q94B 1HSBB 1KXTB 3WXWL 2OI9C 3L3OA 4UDTB 5DK0B 2D4DA 1IGML 5ETUB 4S2SA 2XI9A 4NYLA 1AH1A 4XP5L 1G84A 4KH2A 3IS1X 5HVGB 1L6XA 4LCWE 4NM8L 1CFVH 1EEZA 4G8GE 3FT3A 3CDGB 5D4QA 5IW1B 5C3LD 2OSLA 3KWWA 2R2EB 2FO4A 3IU4L 2BHZA 3W11C 3BUYB 4LSQL 3GM8A 2UUDH 1IFHH 3P73A 5AZ2L 2OL3H 3VWKB 3C8KB 1OP3H 5C0EB 3KPPA 4Y5VC 4XWOD 2ZUSA 4FXKB 4U1LA 5FF6A 5K9OA 3HC4H 3F7VA 3JUZA 2KQMA 4RMUA 4WU5A 3L3IA 3UP1A 1TETL 5I2IA 5MERA 3DX9A 5CLTA 2W9DH 2APTA 2PXYC 2XKNA 2AV1A 4GW1A 1KTKE 1G9MC 4DZBB 5FM5M 3S37X 3GMNA 3SKNB 1LDPH 4P23D 1LEKB 1UYWL 1K4CB 5ILTL 3FOLB 3MR9B 3VFPB 2HVKB 4RSVA 2FX8H 4LCWD 1PYWB 3WSQL 4G8GD 4XNXL 1CGSH 1JHLH 3LZFL 4K8RD 5A2LH 5KSAC 4RAVB 1YEFL 2DM4A 5EZJA 2Y5TB 3QUXC 1QBMH 4PY7A 1Z9MA 2IQ9H 1K3ZA 4JFOB 3ARUA 4JO2L 1J0IA 4WDIA 2A38A 1RJZA 3QNYA 2FEDC 2VDOL 4KKBC 3EGSB 3U83A 1N59B 5T3XL 2CRIA 5D71H 4PJBF 3RNQB 1DBKL 4GQ9H 1T7XA 1BBJA 5FA3B 4PRBB 5HGDA 4BZ2H 5IJKC 3GKWL 1F3DH 4K3JL 3SDAC 1YNLH 3K46A 2AKRB 3RWJA 4L1HA 4RQQB 1JF1B 2GSIB 5BQ7A 3DHMA 3I6GB 4LVEA 2P42B 4GW5A 1RUMH 4OLWH 4JDTL 3PHQA 4JGMA 4OT1L 3G9VA 3MLZH 3MXVH 5CJOH 3PGCA 3AFLA 2VQ1A 1HWGB 1KB5A 4MJ6B 1HEZA 4YNYB 5EU6B 5EZIH 4X5XA 1A64A 2OJZH 3UTTB 5IT2L 3IDYB 1YN6A 1KIRB 4LSDA 3OJDA 2FL5B 1CGUA 3LEVL 3R0NA 4HMCA 4LPCA 1CU4H 3UTPE 1E4XI 4NFCA 4ACPA 4HLJA 4R0LB 4NO3A 2A6KA 2D03H 4O00A 3VXUE 5A2FA 1FNLA 4G6JL 4KRLB 3EZ8A 4MSWA 3D0LB 4Y4KA 3MA7A 1DFBH 1NC2D 2G5RA 1SEQL 4Q9BA 3MRJB 2W07A 4Y4FB 1X4YA 4UT6L 4E5XA 2AEIT 2R15A 3PGFL 5INCA 3VFOA 2DM2A 3MUHL 3RKDC 2ZWLT 2IBZX 1EDQA 4OKVB 4IBLT 1M7IB 1SVZA 3DMMB 1RJLB 2RBLA 2E7CA 4HPOH 3ETBF 4U6VH 2I27N 4PJFA 2YR3A 4YDVB 1HKFA 4NO0A 3WNLA 1R5VB 1B6UA 2FATH 1YJDH 3MLVL 2VXTH 2NY3D 5D6DC 2LAAA 3U7WL 3OQ3B 2FBOJ 3VXUD 1NGPH 1T1ZA 5F89A 1EJOH 4TRPH 1PJ9A 4K9EH 3GJFA 2IANA 1TTGA 2Y07H 3HI1B 3JTTA 5DD6A 4GSDH 3RVWD 5BOPA 3N9GH 5I1HL 3LEYH 1MWAH 1XH3B 5FO9A 1YJDC 2GYSA 4KQ4H 4LBEA 3EOAA 3RY4A 4APQD 1T0NA 2ADIA 1FGNH 1ZV5A 2HLAA 4XZUB 5IB4A 2AEQH 4EVNA 4M62H 4U1JB 3RGHA 2CR6A 4JO4H 3ZHLA 5IBUB 2DQJH 3CIQA 3NH7L 2X4PA 1RZJL 1E6OH 3HI5L 4WWKB 1S7SB 1U8KB 4AIZA 1B90A 4RGOL 3TGXA 3G08B 1P7QA 3QDGB 3W9DA 1A6ZA 3MRLB 2AJXL 4X9FA 3MREB 4ZPVA 1WIPA 5ICXB 5KSBF 4QRQB 4D9QE 2QQNL 1T0MA 4KVNH 3BO8A 2C4FT 1X5YA 3O2DA 4HPYL 4H26B 3VWJD 4PGDB 1LWRA 5TE4H 2EDBA 2I9LA 4AEIH 4ZPTB 4CDHA 3BPCB 1F3RB 1CGXA 4QRRB 5T33H 4MJ5B 3SGKA 5D2NA 1CICB 2VH5L 2IF7A 4D3CL 3RDTA 1LO5A 3NFSH 3LN5A 1LVEA 5EC1A 1KFAH 3HUJB 2IWGA 2A73B 2YPVL 5CZVH 2GAZA 1Q72H 3NAAL 5FOBB 4XVUC 1INQB 5EORH 4K3GA 1SM3L 3QO0B 3WV0A 1N2RB 2ICWJ 2VMFA 3L6FA 2D0FA 4M61B 4BSJA 1HN1A 3EUUA 4LGSB 5IFAL 4JO3H 4H88L 1CT8B 2XTJB 5CS7A 4FTVA 4XAKE 3WLWC 4D9QD 3CLFH 3MMEB 1KJ2B 3QQ4B 4MB4A 4MX7A 3BPNB 5I1AB 4HUVA 4FFWD 3VGHA 1MCHA 4TUOA 5LAXA 4GUPA 4HGKC 4J3OC 3HMXH 3I50L 3FHQA 2YBRB 1KBGL 4D9LL 1U42A 2FJFA 3BZFB 3EOTH 2GJJA 1RI8A 1JTPA 3EJYD 3NCFB 1IC5L 5EBWA 1OLLA 1XIWD 5FYJH 1CD8A 1B88A 1OWWA 5AG8A 4C56A 3W5MA 4NNXB 3DX7A 4U4BA 4X4XB 4WHYH 4MXQD 4WFGE 3PXHA 4AEHL 4WO4C 1MFCH 4DCQB 1KT2A 3I02B 3H2WA 5IVZB 2VXSH 1XF4B 3LSOB 4PJDF 4XAKD 1LD9B 4WUKL 4BFGA 3TN0B 4EOWH 1NFDA 5DI8B 4AZ8A 2XXMB 1A6WH 3CXDH 1KLGA 1L7TL 1CFQB 4KI5E 3R0MA 3I2CL 1Q0XL 1XGUA 3CVHL 3TBSB 4TVSa 2GITA 4WU7B 5EBLB 5H2BB 4EUPG 4KRPB 2VLLB 1RZKH 1T89A 4CVXB 3DECA 2PTVA 5C2UB 4DKDC 1MI5D 2AQ3A 2ZG2A 1H3UA 1AQKH 4MQXC 4WFGD 2ITCB 3KG5A 5KVEH 3FT2A 4M7LT 1CWVA 2AK4D 1FZKB 1RZKC 1GGBL 4I0PC 4XMPL 1G7JB 2A1WL 4P5MB 4NP4H 5DJYA 1JPST 5FM4A 2VLRE 4ALAL 3FN3A 2XTLA 4JM2D 2V7HB 1J1PH 4PJXA 4H0IA 4LNVA 1NEUA 2X4UA 4KI5D 5HGAB 2H26A 1NJ9A 5E8OA 3SKMB 5AYQA 2YA1A 3VI3E 1XCTA 4J8RA 4A6YA 2ESVE 3QO1B 2EE2A 4LLUA 2BVOB 5C0RL 3BT2L 2FYYB 3GO1H 3OGCA 3MRNA 1LK2A 3SKOA 4EUPH 5FB8A 1SEBB 1DQDH 3TVMB 3G04B 4P4RB 4PJIE 1UZ6F 4XBEL 2C4FU 3IAPA 3P9WB 4IS6A 3O3AB 2LU3A 4Q6IA 4JFZH 3QXDA 3TT1L 5I8OL 5F7FA 4MXVF 5FYKU 3MNWA 2EDYA 4KTDL 4HQQH 2MJWA 1IE5A 5GGRB 3JUYA 4BFBD 4YDIH 5I6XC 3O2DH 3PWVB 1RZIA 3A6BH 3L1OH 2ZUWA 1HSAB 1AJ7L 4G5ZL 4H0HB 1NCNA 2I9TB 2VLRD 3VH8A 4DVBB 5IEKA 4X7DC 5GRVK 5D96B 3MOAH 3VRJB 2YD6A 2MCPL 4LMQE 3V4UL 1N3NA 1CDIA 5IQ9B 4EXPX 1IQWL 1MFDL 3Q1SH 2P8MB 4WNQB 4ZXBB 2ESVD 3HR5A 4M1CD 1OSPL 2GSGB 2JJUA 2WIMA 5HBBA 4OCWH 1FFOA 1GGUA 2ZCLL 2O61A 1JNNH 4PV9A 1SBSH 2AABH 2VN4A 1ZVHA 4BQBA 3NCYS 2DJSA 3RDTC 2W0LA 3HE7B 3MJGX 2YC1A 5EZLA 3QEUA 4UAOC 3C08L 4OFYD 3VFWB 3RY6A 4HS6A 5E8PA 4LDEB 4NQDE 4X6DB 4KROB 2CPCA 3D18A 1UQSB 4YZFE 4MAYA 3LQMA 4U05A 5EUOF 3LN4B 1OTSD 4I8DA 3C6SA 2K9UA 1A6PA 2FWOA 3MJ7A 4F57H 5C0CE 4Q0XH 2E8ZA 3GBMH 3EYVA 4FQ2L 3OAYH 4LL9A 4UOW0 3NFPB 1A0QL 1EEUA 1YMME 1YECL 5IOPA 1QHOA 3O6KL 4XP5H 4OLYH 4E0RA 3ROOB 4G8IB 3DO3A 5JW3L 4RRPA 4HT1H 2VUOA 3MNVB 4U6HA 1T7VA 3F7YB 2CKBB 4RFOH 3S96A 3PG2A 4KMLB 4N9OB 5IB2B 3HKFA 4NQDD 2E7HA 4Y1AE 1YPZB 3WKNA 2QSCL 5EU3B 2HT4D 1ZHBB 1WAAE 4MS8C 1RK0A 2E9JA 1U92A 3GMOB 5JW4M 3WNOA 5HDQH 5C0CD 5GS2H 4H1LH 5DJ8A 3EFDH 2ITDB 1TETH 4U3HA 4J12A 3FB8B 1K9TA 3PDGA 3B5GA 1KEGH 4ZNEE 5HDBE 1L0YA 1M7DB 1QSFE 35C8L 3MUGB 5ILTH 3WJLA 5BVJB 4MGXA 4L4VE 3WSQH 3VXSE 4JFFB 1YEFH 3VH8G 4Z7NF 1JJUA 5E8NA 5F6IC 3D3VB 4P2RB 3RWGA 1NUDA 4R2GC 4O2FA 3QNXB 2VRAA 3WS3A 2YRZA 1QKZH 1NKOA 2NXZD 1C16B 4Y1AD 3WYRA 4EKXA 4JO2H 1IM3B 3D69A 1ZLWK 2X4OB 1EFXB 1OAYH 3QCUH 4A6YH 1VEMA 8FABA 4MVBD 1IJ9A 2YZ8A 3CDFA 3HE6D 5JW5A 1XZ0B 3AS2A 3TO2A 5H35A 1JZ5A 2ED9A 2P1YA 3GKWH 3O2WL 1CZ8H 4K3JH 5DHYA 2P8LB 4I3SL 5CMAA 1FDLL 5I1KL 2FH8A 3JWDL 4JKKA 1CFBA 1FSKB 3UTSB 4X6EA 2ED7A 3QZWB 4QOKA 1RHHA 3HRZA 5D1XD 5C0AA 4JDTH 4YHKL 4OT1H 4Y88A 4L4VD 4PJGE 1UH4A 4PJAA 4Y19A 2NY1C 5IV2A 1DSFH 4BZ1H 5F1NB 2DI9A 3SCMD 3VXSD 4MQ7B 5LWYL 5H94A 3ARBA 5I9QB 2A83A 1DUZA 1D6VL 4PB9H 4PRNA 3N0PB 3VG9B 3GB7A 3VRIB 1QHPA 4AK1A 1BFVH 1KCUL 2HFEA 3FB6A 1RMFH 4JO1H 5DD1H 5DJXA 5ITFB 5SWSE 4JDVA 2QL1A 4ETQB 1R3LB 3ARXA 4JQVA 5JO5B 1MCQA 5HHXH 5JA9A 5HPMA 1BJ1J 2WBJC 1E6JL 4OB5L 3OJMB 4X4YA 2OXGA 4RRPG 5F71A 3MCG1 3MLXH 5F96L 5MENA 5I8KL 1DN0B 5L2KA 5EULV 2V5MA 1T03H 4S10A 2HLFC 3NN8A 1REIA 1K3IA 3IFNL 2WQRA 3WHE0 3MRKA 4XGZA 2YD5A 3VXRB 1ETZB 5SWQB 4X9HA 2DQFB 3G6DL 2X1QA 2Y25A 3QHFH 4BELD 2CDEA 5E6IB 4QT5A 3F12A 5DDHB 2NYYD 4HUWA 3CD4A 4G80B 4M48L 5DRZB 4Y2OA 2C7UA 3O9WC 3RY6C 1F8TL 5JPNB 5FKAA 4U0RB 1BJMA 3GUTA 1F90H 4LFHG 1LGVA 5SWSD 2BSRA 3U7WH 3ZDZE 1K2DA 4MAYC 1JWUB 5DR5L 3DO7B 4MD4B 3LRSB 3BP5A 1JHTB 3S88L 2ICEB 2ADGA 4PJHE 3RVUC 3U0WL 1MHPL 4GG6B 3T3PE 8CGTA 4N8VA 4NQVA 2XYCA 3S36L 2VDMH 3X17A 2H2PD 4Z7WE 1DDHA 3A6OA 4BA8A 1YEEH 2W1NA 3LPFA 4NN7B 1KPRB 4MDJA 5C6TH 4Z0XA 3BQUB 1D5ZA 1G1CA 2NY5H 4ORZC 1CXFA 2PTTB 5TDOB 3D85D 5JXAL 3CSPA 2XT1B 5DQ9B 5EU7C 2VLJE 4OIIL 5FAAA 1U8HA 4PTUB 2I25N 4LMQI 1PY4A 4PLOB 1YY8A 3KNBB 4YHNA 1AFVH 3MROA 4JVUA 3VMOA 5ACZA 2NY5C 1NCCH 3QEQE 3SBWC 43C9A 1JZ8A 5AUMB 1ZLUK 2C3GA 4EQ3A 4HKXA 4NNYB 1NL0H 2HFGH 1I8KA 3BPOC 3U1SH 4JG0L 4GMSH 5L9DL 1CLOH 3MV8A 1NCTA 5T1MA 3WIIH 3ARPA 3OTTA 5KANG 3SPVB 1I8LC 1S7QA 1PAMA 5DUPH 1P2CA 2DL9A 2YPVH 2P5WB 4HWZA 3WJLC 4DGIH 5IB1B 1GZPA 4PRIE 4F7EB 3ES6A 4QXWA 5KJRL 5GJTH 1P7KA 2PXYB 1HHJA 1I7RA 2WUCH 5HHOB 1J86A 2J6EL 3QCVL 4XX1G 5IFAH 2LU7A 1T20B 2CMRL 5DRXA 1FH5L 4ODSL 3RNKA 4F15B 3GMMB 4P46D 1YNKH 4P57B 4JZNA 4Z9KB 1BGXL 1JGUH 3OAZK 2VZVA 3QUXB 5F9JB 1J5OL 2E5EA 1FFNB 3I50H 1A6TB 3FL7A 2R2BA 5SWZA 2ARJQ 5HSFA 1QBBA 2CRZA 2DYPD 3BAEH 3JV0A 2B5IC 3VFNA 5CKAA 1T80A 5HGHB 4DOHE 5C0ND 1BFOA 2FBJL 4NUGH 3F65A 1KCVL 4ODHL 4MNQB 2JLLA 5DJ0A 2F53A 4XXDA 4QTHA 5IVXB 3ET9F 3TCLA 2JIXA 2IBBA 4PRID 4Y16A 4N1EA 1P1ZA 2R1WA 4AEHH 12E8H 4JZJA 1EEQA 1BVLA 1S5IH 4V1DE 4NWUL 4U1HA 3S3SA 3HS0B 2A0LC 1HDMB 2A74A 4N8VG 4R97B 3U2SB 4NN6C 4XCNB 5CD3B 5T1LB 1TVBB 1U91A 3G5VA 3L5HA 3NPZB 3HG1E 4JQVC 1HZHL 1E4WH 2EE9A 3RZCC 5CILH 3BSZL 2KQNA 1CDCA 1G7PB 5GRYA 5J3HC 2W60B 3C5SB 3CH8A 3IETA 1MH5B 1N0XL 3N06B 3KPRD 3X12A 1F6AB 4KTEH 2AXHA 1KN2H 4F9LA 5FYKE 4U0QB 3AREB 1HYSD 1HE7A 2EC8A 1SJEA 5HGBA 1CK0H 1IBGH 1NKRA 4XPTH 1C7TA 3LQZA 4HK0A 4O58H 3S34H 2BP3A 2VUYA 4HLZH 1QSVA 4YXHL 3F7RA 4L3CA 5FDYA 1C1EL 4XP4L 3TESA 3C2SA 5HXMA 1B4JL 3EO9L 2HKFL 4FQLL 4V1DD 4YHOH 1GGBH 5IGXL 3S37L 1IQDA 4FP8L 4ZFFA 2W9EH 3D6GA 4RFNC 3G6AA 5DVOA 2ZSVA 3TNMB 4LF3A 1MLCA 5TQ0L 3OSKA 4NHCL 4P9ML 1Y0LB 3ZKXC 3HG1D 4OFDA 1QQDA 3BJ91 1I9EA 1I7TB 3NZ8A 4KUZH 5IMMB 5EZOH 2DMCA 1HWHB 3Q5YA 1SJHB 2QADC 2MCG1 2V5RA 1U95B 1SYSB 5C0RH 3BT2H 3BRFA 5E1AA 2FJHA 4J4PA 2GFBA 1RIHH 5FYKD 4PJBA 2DI8A 3AXLB 3QUYB 3CJJA 4YEFA 5MHSE 3SE3A 3JV4A 2LAGB 5KW9L 3V2AR 3IJHB 4OZHF 2R56L 4OKDA 3GSWA 4JFEA 2FIKA 2NTFA 3LH2L 3L3OB 1H5BA 1YC7A 3SKJH 2PO6D 4S2SB 1MCSA 5E03A 3ULVH 5C3TA 4NYLB 1FNAA 1IQWH 5C0DA 1EEZB 1BQLH 5FA4A 3FT3B 4UIMA 4N8CL 3O2VH 2YD4A 3RFZC 2OSLB 3KWWB 4RZCA 3C60C 3PNWA 1QPPA 4YUEL 2FO4B 3U4BL 3U4EA 3ULVC 3SJVD 2P5EA 5I1LA 4NBXB 4LASL 4KY1H 3P73B 5MHSD 4KK8C 2JK5A 4WI6A 3H42H 3KPPB 5DD5H 3I6LE 3C08H 3UJTL 4U1LB 5FF6B 2VYRE 5K9OB 3F7VB 4WW2A 2Q76A 2VDQH 4S0TD 4WU5B 3L3IB 5KVMC 1OCWH 2AW2A 4HWBH 4NQSA 1MIEH 5I2IB 5MERB 4OI9A 5E99H 1BJ8A 3DX9B 4ZOCA 4Z18A 1U2CA 3QG7L 1DN2A 1X3DA 2EC9U 4XP9L 2AV1B 2DQDH 2F19L 4OJFL 4GW1B 1DVFA 3T0AA 2AEPH 3GMNB 3MRHA 5F8RC 3RUGF 2VDRL 1RZ7H 1ZLSL 1PQZA 4HXBH 1BWWA 1AGCA 3WNNA 5CUSL 3ZT5A 2DTMH 3O3UN 5EZJB 3VWKD 3WE6A 5HYJA 5ID0A 5JTWA 4PY7B 1NCAH 4K7PY 1N26A 2OR9H 3CLEH 4ZAKC 1TZHA 4R4NC 4WDIB 3W9EA 1RJZB 3QNYB 1RZFL 2B4CL 1G9NH 1FCCA 1S3KL 4X80L 3EO0A 1MAJA 1BBJB 5HGDB 4FFYH 4Y16C 1NLBH 4JZJC 3VGDA 5FYLD 5EU4A 4H8WH 3RWJB 5EU6E 3GBNL 5BQ7B 1CS6A 3UTTE 1G9NC 1MFAH 3ILQC 4GW5B 4AIOA 1JF5A 4M6OH 5ALCL 3PHQB 3DYPA 5ENWA 3PGCB 4HBCL 1DLFL 2VQ1B 3QQ3A 4M5ZL 1KB5B 5CEZE 1HEZB 3GEWB 4U6TA 4X5XB 4H8WC 5IKCA 4TULL 5F9OH 3AUVA 1R3KA 1YN6B 4XPGH 2MKWA 4IEFB 2N4IA 3OJDB 3QHTC 3U4AA 5KSBA 3T09A 1S7RA 4NO3B 2A6KB 3S5LA 1W8NA 4L4JA 2VDKL 4MSWB 2Y06L 4Y4KB 2AJZA 5CGMA 2IG2H 5EOQH 3BKCH 1YZZA 1G7LA 3L3HA 4NQEA 1JGEA 4E5XB 4I3RL 3UTTD 2BNUA 4JKLA 5INCB 3VFOB 4LARL 2J6EA 2BK8A 3HNSL 1PZ5A 4I3SH 3K4DA 1FDLH 2WWMD 5CEZD 5I1KH 5FUCE 1UC6A 4YC2B 5F1OB 4U2ZA 4Y5YA 5F6HJ 4CN1A 3AY4A 4NO0B 3HZYA 2Q87A 4ISVA 4KZEL 4L8SA 3UTZA 2ZUYA 1H9VA 3QCTL 4HFUH 3SGDH 2CGRH 1FPTL 4LSTH 1T1ZB 2OMNA 5DC0A 5F89B 1BREA 4GAJH 3MLRL 3ZE0F 4W6XB 4JFXB 3PWJA 3GJFB 2IANB 4WUUA 4S0SD 2IC2A 3QNZA 1NANI 4KGLA 2FD6H 3JTTB 4KUCF 5DD6B 1DEDA 4XB7A 4QLRA 4YFLI 5FO9B 1UADC 4LBEB 3EOAB 1OM3L 1T0NB 2ADIB 3DMMD 4AL8L 3L95A 3QDGE 4GXVH 2HLAB 1P6FA 5IB4B 4YDLC 5F96H 4EVNB 5FDWA 4G3YL 1QSEA 4G6AC 1OD9A 1UCBH 1PLGH 1T2QL 2X4PB 3MCLL 4KK5D 4AIZB 4ZO6A 3RTQA 5DQJA 2NW2A 3W9DB 1P7QB 1A6ZB 3T3MF 1HILA 5TF1L 4CVUA 5TPWL 1SJVA 1O7VA 4Z7VF 3NTCL 3LAFA 4ZPVB 5IROC 3G6DH 1CQKA 3HMWH 4QRRE 1T0MB 2VZ1A 3A67L 3BO8B 1D3CA 4Y2DA 4OD3L 3TPUA 5LBSL 2B8OT 1P4IL 4OFIA 4NSKA 1YEJL 3HUJE 3CFKA 2XFXA 2I9LB 4GFTB 2BX5A 4XWGL 2WP3T 2H1PH 5BO1L 3ZDXE 1W2KT 3LCYA 5D2NB 1LO5B 4WWKD 3LN5B 5EC1B 3QDGD 3BZDA 1DVFC 4K3HA 4X7SL 3NCJL 1UCTA 2VXQH 2AJUL 2GAZB 2RCSH 4OBSA 1FBIL 2XTJE 1MRFL 3S5LG 2VDPL 3M8OL 4CVZA 3T2NH 5KSVA 4DVRH 3L6FB 3BOVA 4MB5A 1NGWA 1PX4A 4RMSA 2IJ0C 5FO7B 3O6MH 5GPRA 5H37G 3X13A 3ZE2F 2GJ6D 2Z8SA 1HK6A 4FTVB 2GI7A 4U6XA 5E2UH 3V6OE 1TCRA 4QRRD 1CICD 4YHLL 4HUVB 4MX7B 2MQCA 1K8DA 5JXAH 1FYTD 5EPMA 4MHHG 5JQHC 4TUOB 2WZPD 3LPWA 4GUPB 3S4SA 2HMIC 1QFWH 3GSNA 2ZCKL 5E8DL 2Z8VC 2YD3A 4NCC2 4O2CA 4KRMB 4EN3C 1KXQE 5EBWB 5H8DA 4WW1A 3FO2A 4RIRA 1PVHA 3O3BA 4C56B 3DX7B 3SDCC 4WV1A 1Q9WA 2V17L 4G7VL 5HI3C 5B39A 2DMBA 2VR9A 3K8MA 4OF3A 1KT2B 4IIQA 1TENA 5H37H 2NY0B 2VABA 1VEPA 1NFDB 1KLGB 2DQEL 1UGNA 4UB0H 1JNLH 1KB9J 2DKSA 3ZL4L 1IKNC 1TPXC 2CMRH 1NFIA 3LKOA 5CAYB 2FDBP 2ID5A 4OF5A 4ODSH 1XGUB 3HPLA 2GITB 3QAZB 3DARA 4XH2A 5JORB 3V0WL 1NAMH 1I85C 1J5OH 1DBBL 3M07A 4MD5A 2GEEA 1J0JA 4JRXA 1NPUA 3TN0D 3NBNA 3FT2B 5KN5A 1D5MA 3EHBC 5EUOA 2RGSA 3LRHA 1URLA 4Y5YC 4HMDA 1WCQA 4AH2A 1LO3H 3HTLX 3EDKA 3MLUL 3AY4C 5DJYB 5C0IA 3CSBA 4GKZA 2VZUA 5J8OA 4PJXB 3DXAA 1NFKA 3OXSA 3F6LA 3X3GL 4KRPD 1NGYA 3MLWH 3WFHA 2X4UB 2H26B 2HJLA 2H9GA 1NJ9B 3AM8A 5E8OB 1IAKA 1A7OH 1XCTB 4J8RB 4A6YB 4YIQA 3CFDA 2Z31A 4LLUB 5JUEH 3OGCB 2HWZH 3MRNB 1LK2B 5ECJE 4ZUWA 3SKOB 5FB8B 3VGFA 4G7YL 1BX2A 4RGNC 4TVPE 1NLDL 3VGAC 4IS6B 4Q6IB 3QWRA 3QXDB 3MNWB 1TQBC 3BP4A 4HCRL 1E27A 4Z95H 1LNUA 3RTQC 2IPUG 3S4SG 1RZIB 4HJ0D 5DMGD 5DRNA 4FFVC 1MPAH 3VH8B 4WTWA 3ARVA 5IEKB 5D7JA 2L0DA 5JR1H 1C1EH 3EKCA 1FAIL 1N3NB 4FQLH 2ICWA 5KSUA 4Y2DC 4FQXC 3TVMD 3VFGH 3S37H 3QIUA 1VPOH 3HR5B 2APWA 1FFOB 1MCNA 4OI7A 5ELIA 5CSZA 2O61B 1WFNA 4PV9B 5IESL 4NGHH 4FG6C 5TQ0H 4P9MH 5B39G 3B9AA 2CSPA 3GM0A 4X6DE 4MB3A 3TZVC 1ZGLP 2YC1B 1T66C 1A47A 5EZLB 1I1FA 4TVPD 1OTUD 3QEUB 3VD5A 4ENED 1DBAL 4LLMA 4HG4J 5IFHH 3ZHKA 3ECBA 4HS6B 5E8PB 1Q0YH 3QHZH 3TT3L 2YOCA 1HINL 1YYML 4QTIH 3D18B 1IZKA 2NY2D 1ERNA 4MAYB 4IJ3B 4BJLA 3C6SB 3GSNH 1U3JA 2UYLA 2FWOB 3MJ7B 5DEFA 4XPFL 1NMBH 2BNQA 2R56H 3L5IA 2XQBH 4KPHH 3CZJA 1GSMA 5E2TL 3EYVB 4U1MB 1EHNA 3WJJA 4YK4C 3HE7D 1Y6KR 4QXGL 2XRAH 3THML 2JJTC 1BOGA 1KN4H 2Y6SD 2R2HA 1FFPA 2EZ0D 5IOPB 3RVXC 4PJ5A 4DKEH 4N5UA 1CFSA 4E0RB 2O5XL 2HH0H 3CX5K 25C8L 4KROD 4UTBH 1YPZE 4UT9L 1FIGL 2XV6B 4R4FH 4IDJL 4N8CH 4LSRL 3S96B 4O5LH 5F6HI 4RAUA 2V2WA 2FR4A 3U4BH 4Y5XC 3JV5A 1V7ML 1V3JA 4WV1C 4LHQB 4ZSOA 1RK0B 4IIQC 5LXGL 3NFNA 1U92B 1YNTB 4F9PC 3T77A 4PUBL 5BMFH 4R26H 1ORSA 5DJ8B 3QRGL 3BPOB 4OF0A 4QRSA 3ALXA 3QT2A 2MOVA 4OJFH 2F19H 4HC1H 4GXUM 4NKDA 4JFFE 1H8OA 1T6WA 3BP6A 1U8JA 3D3VE 5TE6L 4P2RE 2P8PA 1D6EB 5K9QG 2VDRH 4XAWL 4YXLL 4P4KA 3IJSA 5E4IA 5A2JH 5E8NB 1ZWIA 2E7LA 3RWGB 3DUHA 4O2FB 3WS3B 4OZFA 3O4LA 3C09C 2VZTA 2Y36L 1MJ7H 1MUJA 3LV3A 2DQIH 4ZG1A 3WO4C 3D69B 4QHNA 1FNSL 3QIWA 4G9DA 4LCIL 2B4CH 4V2CB 3X14A 2GQHA 8FABB 5CD5D 4P9HL 5JW5B 3UTSE 1QP1A 1WQVT 4JHWH 3TO2B 5H35B 4QEGA 4W4NA 5DHYB 5CMAB 3FFDA 5EA0L 3O6FD 4JFFD 2B4CC 5ID1A 1AXIB 3D3VD 4P2RD 4X6EB 1R24A 4QOKB 1RHHB 3HRZB 5C0FA 5ALCH 5C0AB 2Z31C 1X5FA 1FE8L 2FEEL 4PJAB 1ZA6A 4Y19B 5DVLA 4Z7QE 5IV2B 1ZANL 4XI5D 2KBGA 5H94B 3ARBB 3PV6A 3FFCA 2A83B 5FHBL 3T65A 1DUZB 5GS0D 3RWCA 4POZC 4Q9RL 1U93A 4PRNB 4E41A 3GB7B 1J1OL 4N5ED 3VDAA 2HFEB 3FB6B 5A2IH 3HB3C 4P3DA 5DJXB 1RZGA 4HUXA 3P40A 4IRJA 5KVGH 4YAQA 2VDKH 5HPMB 2EE6A 3UTSD 1KV3A 3G5ZA 4X4YB 3NIDF 3PWPA 5D7JC 5MENB 1IVLA 4LRNL 1Q9OA 1QR1A 4IOFD 3B6SA 5L2KB 3QWOA 2HRLA 2EDKA 1VHPA 2HTLD 1JGVH 4DN3H 3IDGA 4X8XA 3RA7L 3NN8B 4L8BA 4LARH 2OK0H 1YQ2A 3MRKB 3OKMA 3HNSH 1IMHC 1I1AA 2R4RH 5IQ7H 1UM5L 4HIJA 2IFFH 3C87A 4LIQL 2CDEB 3IYLW 1LO4L 4QT5B 3F12B 4HUWB 5LJYH 4PLJD 2B1HH 2NZ9D 4JFPA 4OLVL 4XNZC 2C7UB 1RU9H 1XGPB 2YMXH 2GY5A 3BEVA 5FKAB 3JTSA 3GUTB 1N6QL 2HTKC 1G7QA 4GG6E 1JPGB 3QCTH 2DJ4A 1XT5A 2BSRB 2KL6A 1K2DB 4UIKL 1RURH 3KYOA 1RJYA 3BP5B 5TFSL 3N1QC 1CTOA 2ADGB 2GHWB 1IAMA 1F97A 1R3IL 2C3HA 3ARGA 1SY6L 3CSGA 1CD1A 5D72L 1MF2H 4N0CC 4N8VB 3IDXL 4NQVB 3L3JA 4OZFG 2EECA 5E6ID 2BOCA 1KCRL 4ZD3H 4GS7C 1DDHB 2DDQL 4HFWA 3RIAF 4PRPA 5DMKA 4MDJB 4C4KT 2FB4L 4Z0XB 3RGVD 1D5ZB 4Y4HA 4QHLA 4HV8A 3IDNA 5FCUL 4QRUA 3SDXF 2VB5A 1KNOA 1U8HB 2VLKB 2BC4A 1GYAA 5C7XL 3NTCH 1YY8B 6FABH 4YHNB 3MROB 4WFEE 5ACZB 3RBGA 4HCRA 4NHUA 43C9B 5I1IL 2QHRH 1UG9A 5HHVL 4HKXB 4XTRD 3LOWA 5HD8C 3MODL 2P5WE 3GSUA 1I8KB 4YLQT 3BQUD 2R29H 2WAHA 2YKLH 3MV8B 4ODVH 5T3ZL 5T1MB 1IEBA 2LTQC 3MRPB 5DEZA 1ZLWH 2ZUUA 5GZNC 2YD8A 2FGZA 1QRNA 2AJVL 3FONA 3D39D 1KIPA 1S7QB 3IAGC 5HHOE 1P2CB 2DM3A 4F58L 4HWZB 5L0QC 1FBIH 2BZDA 5D7SH 5GGSA 1GZPB 4JM2F 2I26N 1BQHA 1UM4L 2NNAA 3ES6B 3ULUH 1NBVH 3OV6A 1HHJB 3GKZA 1I7RB 3G6JA 2GIYA 4ZYKA 3ESUF 2JB5H 3P4NA 3CH1A 5DRXB 3VDCA 3MV9A 1CBVL 4ODWA 3RNKB 3RWFA 3QIWC 3ULUC 4JZNB 1MY5A 1JRHL 3KYKL 2EXWD 4MNQE 4NC1C 1A1MA 3QJFA 1TJIH 2P5WD 5IVXE 4G8FA 2R2BB 5SWZB 5JHDD 1NMCC 2ZCKH 1QD0A 5DXWA 5E8DH 3TA3C 1TITA 3VFNB 3VW3L 4K23L 5E4EC 2J4WH 5F1IA 4PGBA 1BFOB 2APXA 4C59B 2ZJSL 2F53B 4LCCC 4XXDB 4GBXC 4QTHB 3PE9A 5AAWA 2JELL 1A4JB 1AP2A 5MEPA 4GRWF 5KVFL 3TCLB 2JIXB 4Y16B 1P1ZB 4K3EL 3EYOA 3VFRA 2R1WB 5C0JA 2M1KA 4JZJB 4QHUA 1BVLB 1LO0L 3EYUH 3HPJA 4B7LA 2ORBH 1UB5A 2J88H 3DGGA 1U8OA 1LO2H 2DLFH 2DL2A 2Z91A 4U1HB 3P11H 1FYHB 2A74B 5CP7B 3QFJD 4HGMA 4L5FL 1U91B 3G5VB 4PJIF 2IMMA 3KPMA 3OKEA 1BLNA 3D9AL 4MNQD 4HIHA 1VB9A 4OIBA 5F1KC 1IM9A 1KF9B 2X40A 1BOYA 1GGTA 1KGCD 3IETB 3QFDA 1ZEAH 4MAUL 3X12B 3V6FA 2YPLA 5EO0A 3I3DA 1IGFL 3L5WA 5I75C 3NA9L 4PY8J 5HGBB 1SJEB 3ZT7A 4OGYL 3RX5A 3LQZB 1Z3GH 4HK0B 4AYFA 1ACYH 4TOYL 2RFXA 4L3CB 3T08A 3WN5A 5DMYA 1H15A 4KVCH 4X83A 1WICA 1S5HA 3OKKA 1OTTD 1IQDB 4S1QL 4ZFFB 3UTOA 5LVEA 3G6AB 3RY5A 2ZSVB 3FB7A 5IHLB 1KULA 1MLCB 2EDJA 1F5WA 5ALBH 1QQDB 1JUFA 1JNHA 3ARED 3NZ8B 3ARGC 5DD0L 1BQHG 1E4JA 3ARTA 4HH9A 4KZDH 1Q1JL 1TLKA 4ELMF 4TUKL 2GT9A 5E1AB 3TFKD 1ZTXL 1INDH 4GKNA 2FJHB 1IAII 3UYRL 2GFBB 1ZK9A 1D5XA 4PJBB 3BHBA 4G7YH 4ELKA 2Y4SA 5F9WC 1ZLUH 3SE4C 1ZXQA 4YBQD 4OZIF 1BM3L 1I9RH 1OL0A 3BD4A 3C8HA 5K59E 3GSWB 4DGVL 4JFEB 2FIKB 2NTFB 4P5TC 1HCVA 1B0RA 5DVKA 4P99A 4W68A 1H5BB 2NCMA 2YUZA 4XC3L 4B7IA 5FO8A 4YDLB 4KQ3L 1V3LA 4P2OA 5D2LA 5C2BH 3GMLA 4Z7UF 4KDWA 4HEME 3VU2A 3NCYP 4TPRH 5C0DB 5B3JE 3M45A 3ZDYE 5FA4B 4UIMB 3GNMH 3QUYD 5B22A 2J5LB 5J89A 3P30L 3HAEA 4RZCB 2EDWA 4U1IB 3PNWB 5IK3A 3U4EB 5C07A 4DUVA 5ESVB 3INUH 3OZ9L 5GZOD 1PG7W 2FX7H 5D1ZD 3IRPX 3GIZL 2HKHL 2P5EB 2XZQH 5I1LB 1V8HA 4NQXA 4PJ7F 1A4KA 3B9EA 4WJ5A 2JK5B 3MRRA 4XVSH 3OAZH 3PP4L 1QLFA 4M1DH 4WW2B 2Q76B 4PD4K 4OQTL 3R06A 1RFDL 4NQSB 3MXWL 1YYMH 4ZFZA 2KZWA 2GUOA 2G9HA 3O41A 4NQCA 5F7MC 1DVFB 1GC1H 2QR0A 1UVQA 2YK1L 2VZSA 3MRHB 3U79A 1CIUA 1U8LA 3WS6A 1MHHA 3V4PH 5BJTA 1PQZB 3KPOA 1AGCB 1CQYA 1YEHH 2J8UF 3L5JA 1AY1L 5CP3H 3HFML 5EUKA 3WE6B 3VXMA 5HYJB 5ID0B 1GHFL 1GC1C 4JJHA 3EDFA 4JY5H 2MHAB 1MCFA 5DQDL 5I1CL 1SY6A 1TZHB 3W9EB 2AXGA 4LSRH 3EO0B 3DGCR 4QXUH 5CJ5A 3I75A 5I71C 5A1AA 1PZUB 3DI3B 5HI5D 4PJ9C 5GSVA 4PP1D 4OM1H 1F58H 5EU4B 2WINA 1KG0A 3LB6C 4K2UL 5LXGH 2RB8A 4PUBH 2IAMC 4JQXA 4PJGF 5ENWB 3N50A 3WLWD 3QQ3B 3BW9A 4LQ1A 5I17A 4EI5C 3RL2A 3BH8A 3FMGL 5IKCB 1R3KB 1UACH 2PYFA 4Z7VA 1BVKA 4UV4L 4M3JA 5KSBB 4WFHE 1S7RB 2DAVA 43CAA 3S5LB 3DBXA 1BFTA 4DQOL 4L29B 2R1XA 1TPXB 1YUHA 2AJZB 4M7JH 2BNRA 4X0KA 2CLVA 4MXWH 5DC9B 3WN5C 3EZJB 1G7LB 4RX4A 5D7LA 3L3HB 4NQEB 1JGEB 3HAEG 1D7FA 1NCBH 2MKLC 4MNGA 2BNUB 3QDJA 4HKJB 1FIEA 2OLDA 4JANA 1EGJH 3ARDC 5E94A 4NWTL 1R6VA 2DMKA 1PZ5B 2XXCB 4I77H 3CFCL 4YXKL 5JZ7C 4LVHC 4Y5YB 1H3GA 4I1NB 2EYSA 4YBLB 3R8BB 3MLTA 3LKRA 3I85A 1FC1A 4HHAA 2IANE 4Y4KD 3BEWB 5FUZH 3HZYB 4K3DL 2NY7L 4ISVB 4WFHD 4L8SB 2ZPKL 3UTZB 4JKWA 5C9KA 4OGXH 4XMLL 3F5WA 4C58B 2YN5A 1UWGH 5DHVA 4OD1L 3QDMA 5TQ2H 5FHBH 2LQRA 1QFUH 4Q9RH 2AQ1A 1F4HA 3PWJB 2R0LL 1AR1C 3QNZB 3T3PF 4QNPE 2HT2D 5MI0C 3V4VH 2ADJA 3WKMH 3HAEH 3L95B 1MHEA 4Q58C 4GRMB 4QF1A 5I15L 5FDWB 4JFYA 3SDYL 1EAPA 3P9MA 1QSEB 4KXZH 5AEAA 4AG4H 7FABH 3B9DA 1J11A 1TQBB 1HNGA 2UY7A 3UC0H 1S78C 3K4AA 3RJQB 3RX7A 2X7LA 2BVEA 3RTQB 4CMHC 2NW2B 2Y7QA 4HIIA 1ADQL 4ODBD 1TMCB 4HDIA 2CIIA 3S3PA 5DUBB 5FGCB 1HILB 1WJ3A 2IAND 3DROA 1SQ2N 4KKNA 3TWCL 3GRWL 4R96A 4LIQH 4YHIA 3QPQD 2DQUL 5D2NE 1LO4H 2H45A 4Y2DB 3TPUB 4OFPA 5J13C 2LVCA 3KPQA 3PL6A 4NSKB 4KDTC 3CFKB 1WTLA 1ES0A 4XXCA 3IFOA 5TGBA 1B6DA 3BMVA 5LGHL 4PIRF 5I1EH 2LFGA 1MCPH 2WV3A 4FFZH 3V6ZA 2D31A 1J88A 5C0GB 1SY6H 3WS6C 4FMKA 3VG0H 4NJ9H 5D72H 2QQKL 1MRDL 4FTVE 4CVZB 3QIBC 1OPGH 3LQAL 3OKOB 4JZOA 4IMLA 5KSVB 4OD2A 4FN0A 2E8YA 3DHJA 4YWGH 1JGDA 2DDQH 5GXBB 2IGFH 1NGWB 3P4MA 3X13B 3FOMA 1G7IA 1CI5A 4HUNB 4RCAA 1S9VA 3TYGL 4U6XB 4ODUA 1U3HC 4JRWA 1TCRB 3LKPA 4QXTA 4KJPD 5DJAA 3EBAA 1K8DB 2M26A 5FCUH 5EPMB 4YK4B 1A5FL 4YEEA 1IGJA 3S4SB 4WHDA 1MFEH 1E4KA 3U30C 2CKBL 4PLKC 4C56E 4DKFH 2BSED 1EIBA 4U49A 4WENB 5I1IH 4UT7H 4O2CB 3MBEC 3OBAA 3QPXL 3LIZL 4OLEA 4WW1B 3FO2B 4RIRB 1ULVA 3GI9L 1W72L 3O3BB 4HD9A 1UKSA 3MODH 4JQXC 4FTVD 3P0VL 1Q9WB 1NFDE 3MLYH 5C08A 5E0QA 5B39B 1UZ8A 4BK5A 4CW1A 4IIQB 2B2XH 4M1GL 4P23A 4F58H 5F44A 3E8UL 2MWCA 2VABB 4LCWA 2R2CA 3KJ4C 2BFVL 1HHKA 1NCWL 3V7MA 3VFMA 3UDWC 1J18A 1A3RL 3HC0A 3LKOB 1NFIB 4AM0A 4C56D 4OTXH 1MOEA 3RWEA 1MAMH 3HI6L 3HPLB 5HGGS 5J6HA 5L88H 4XH2B 4Q9QL 4NKIH 1T22A 1I9IH 3QQ9C 1JRHH 3ZKSD 4ZS6C 2DTSA 1H3PL 5B21A 1JBJA 4JRXB 2NY0D 3C09B 2OR8A 5DVMA 5C71A 3GHEL 3O81A 1QFPA 5KN5B 1D5MB 4I18C 1CDYA 1FNEA 1UKTA 4PJXE 5EUOB 1CE1L 3WUZA 3TEUA 1H3VA 2ZJSH 4AH2B 1F2XK 3RHWK 2MPAL 5T3XE 5KVFH 4MA1C 5C0IB 4GKZB 4K3EH 4AMKH 1GZQA 2G2RA 1K85A 1JVKA 2YD1A 2NY4C 2A9ML 3QI9D 3GMQA 3OXSB 1NGYB 4I3GA 3WFHB 2HJLB 2H9GB 4NBYB 5DURB 2PF6A 1IAKB 1B2WH 2DQGL 4YIQB 5E8EA 4K94L 3CFDB 2Z31B 4HZAA 4B50A 4XBGA 4ZUWB 2JKXA 4FNLL 3HNTH 1BX2B 3BJLA 4OCNC 1FORL 3B9VA 2W0FA 3RVTC 1WEJH 2UWEF 1FJ1A 4XPBL 4HF5H 3BP4B 1CXLA 1E27B 1IGFH 1ED3A 1LNUB 4ONGH 5B4MD 3ZKMC 3FN0H 5CINH 5ADOH 5DRNB 5JXEC 1MCRA 5T3XD 4XHJC 5HDOA 5D7JB 3TH2T 2DJUA 4L3AA 4TOYH 5CGYC 1GPOL 4N0YL 3BXNA 2ICWB 3UAJD 4XPAH 3IDJA 1EJ6A 4ZFGL 5HHQB 4S1QH 5T1DL 3QIUB 1I1CA 3PL6C 1GIGL 3Q6GL 4XP6L 3KLHD 1M05B 4XXCC 5CSZB 1MVUA 2R0ZH 1MNUH 2C1OA 1CDJA 1YN7A 1PFCA 1NQBA 1I1FB 5IHUL 1IEHA 4PB0L 1HIML 3LHPH 1YDPA 4LLMB 2EIDA 2AVGA 1C12A 4TUKH 3ECBB 3NIFF 4JPIB 2V7NA 1ZTXH 5C8JA 5I1DA 4DN4L 3E1F1 4APQA 3QRFM 3EDEA 4EZMA 1GH7A 4RDQF 2R39A 3MGOA 3C6LA 4M6AA 5IIEA 5DEFB 2UYLB 1T0PB 1BM3H 3GGWA 3DYOA 2BNQB 5HVFB 4NKOA 4PJ8A 4DGVH 5CEYA 2JCCA 2EH7L 2K3TA 4FZEL 4PJCF 5CIPH 1TQCC 3O6LL 3CFJA 4JR9H 1BOGB 3V95A 4GS7B 2R2HB 1FFPB 4KK6D 2XICA 5EU7E 4LCYA 4PJ5B 1Z0MA 1CFSB 2VZOA 1Q9KA 3I6KA 4DUXA 1FZOB 1CGYA 5D1QD 4XWOC 2WQ8A 3VWJA 4RAUB 2V2WB 3RWDA 2FR4B 1MHCA 5AZEL 4L3EA 2CUIA 4K8RH 2A6JA 3OZ9H 1CR9L 3TV3L 3VI4E 3GIZH 5DJZA 5GHWL 1YQVL 1AGDA 1T2XA 2NXYB 4ZSOB 2EEBA 1FO0A 1TNNA 4CL7A 4P23C 1TCMA 3NFNB 4OCRH 1EPFA 3T77B 1ADQA 1Z2KA 1ORSB 2KDGA 4R6UA 4K8RC 4QRSB 1CFVL 5B38A 3HNVH 3GBLA 3E2HC 2ZUVA 4NKDB 3BP6B 1U8JB 4MA3A 2YK1H 3DNKA 4JN1H 2P8PB 1CFNA 3ZKNC 1IFHL 3VD9A 3DRTA 4HS3A 1G9ML 4UQ2A 2OL3L 4Z0BH 4LVNB 4MDIA 1EZVY 4P4KB 3IJSB 2GW5A 1KXVC 1ZWIB 3HC4L 5FGSA 3MYJA 5BVPH 5GJSH 4OZFB 3O4LB 1MUJB 3SE9H 3LV3B 2W9DL 3LEXA 4QHNB 3QIWB 4ONOA 2JJSA 1JK8B 2F74A 5EH1A 3X14B 1BQSA 4LFHD 3W81A 1LDPL 1MLBA 4JHAH 2PETA 3CFIC 1OAXH 4QOKE 5C0AE 4F8QA 2FX8L 1CGSL 1JHLL 1NMCB 4PJAE 4Y19E 3FFDB 5E4EB 3W39A 1W0VA 3S9DB 2NY6B 1X5AA 4OLZL 3BD3A 5ID1B 1QBML 5GGVY 3TO4A 5FKPB 1R24B 2IQ9L 4EJ1C 5C0FB 9CGTA 1U41A 1PY9A 1RUPH 1ZA6B 5ABDE 4XBPA 5D71L 3SDXA 3FMGH 4GQ9L 4TNWF 3PV6B 3FFCB 3T65B 4NZUH 3RWCB 4BZ2L 3BZ4A 3WLBA 1U93B 3H3KA 4E41B 3KPSA 2AERT 5MENE 1W72A 3GSRA 5DFTA 1RZ8A 4P3DB 5L2KE 4JPVH 1RZGB 1S7VA 1X5ZA 4HUXB 3S8WA 4IRJB 4YAQB 2ED8A 4HIXH 4JPKL 1CE6A 1RUML 1MI5A 1EBPA 4OLWL 3G5ZB 4QOKD 3PWPB 4XCEA 3MLZL 5C0AD 3MXVL 1Q9OB 1YMHA 5CJOL 1QR1B 1SHMA 4L9LC 3B6SB 4DW2H 2VQUA 3QWOB 3WXVH 3FQUA 2AK4A 5EZIL 3IDGB 3ARBD 1N5YH 1CLZH 4D0CA 5ISZD 4L8BB 1AXSA 3BPLC 4HUUA 4JM2A 1CU4L 4NWTH 2KPNA 2NY3C 3OKMB 2OTUA 3CFCH 4YXKH 1I1AB 2X89A 1YA5A 2ARJA 4HIJB 3G5YA 3SQOH 2D03L 3UEZA 5EB9A 3HUJF 3IXTA 3SDDA 2I60H 4JFPB 3RVWC 1YY9D 2GTZA 1ZVYA 2H2SD 5MEND 3P3YA 3BEVB 2NY7H 5B38G 2ZPKH 1G7QB 3ARSA 1BECA 4APQC 4XMLH 3U7AA 3D1MC 3UZEA 3KYOB 1RJYB 4KHXL 1S9XA 2BY1A 2UZYB 2OR7A 2IBGA 2Q8AH 3VCLA 6CGTA 2R0LH 4LGPB 3ARGB 2CJUH 1O5DT 1A3LH 1K5NA 1UWXK 1CD1B 3WUWA 3MOQA 4IOSD 3KXFA 1WT5A 3IKKA 3L3JB 5JDSA 2X70A 2UZXB 4HPOL 2Z8RA 4U6VL 1ZGLM 1F2QA 5F9WB 5I15H 4HFWB 1R3HA 3EDJA 2FATL 4PRPB 1YJDL 1OW0C 2VLKE 5DMKB 3AROA 4Y4HB 5CBAA 2VXTL 2WWKO 3QH3A 4QHLB 4X5WA 1FO0H 1NGPL 3IDNB 4TRPL 1I9JL 4NO2B 3VWJC 4XCYA 4QRUB 4G6FB 5HVHB 1I7UA 2Y07L 1KNOB 2BC4B 2Q3AA 4GSDL 3LEYL 1MWAL 3TNNA 4KQ4L 1FV1A 2IPKA 3MV8E 1QACA 4NHUB 5KAQF 4QY8B 3OKLA 4HW6A 5I1GH 2AEQL 5MEQB 1U8IA 4JO4L 3AS1A 4EBQH 2DQJL 5HI4D 2FH6A 2EO1A 3GSUB 1ZGLA 4NNPH 2ZUQC 1IEBB 5LGHH 3FQTA 3MGAA 4Z6AT 5SV4A 1QRNB 3QQNA 3FONB 3VMNA 4RA3A 1JCKA 1I75A 1KIPB 4OV6F 3VFUA 3SO5A 2VLKD 2FSEA 4GKSA 5CJQL 2RR3A 5GGSB 3KPTA 1BQHB 2D0GA 2NNAB 1KYOJ 3Q6FA 4FFWC 3TM6A 4KVNL 1MCBA 3C5ZA 3IDMA 2C26A 1OF2A 3G6JB 4ZYKB 4AEIL 4Z5RA 1J12A 3CH1B 3OAUH 3P4NB 1A7PH 4U33A 4KAQH 5T33L 5E56A 2FLRT 3K81A 1X5GA 5SWZE 4Z8FL 3NFSL 2JJSC 3EJYC 4XC1H 1XIWC 1KFAL 3OB0K 4JQIH 5CZVL 1A1MB 3I9GH 2CR3A 1P84K 4NQDA 2F53E 4ELMA 3QJFB 4MXQC 3JWOH 3T0EA 2G75A 4JPWH 4G8FB 5F9AC 3CZFA 3ILPA 5BRZA 1I1RA 3MZGB 4F80A 4IHOA 5F1IB 1KSRA 4PGBB 4ZO7A 2V2TA 1JTTA 2XNAA 1F4WH 1U8QA 4OZIA 4JO3L 5I71B 2Q7YA 1AP2B 1V7NH 5MEPB 1RVFH 4XNMA 3JWOC 3VFRB 3EYOB 4HUKB 4DZ8B 3CLFL 5C0JB 4QHUB 3HPJB 4AJ0A 3MACH 4I2XA 3DGGB 5GGVH 1J87A 1U8OB 2Z91B 3HMXL 4DTGH 5GS1A 5LKNA 3WUWG 2CLRA 4Z7UA 4AEEA 1U8MA 2EDXA 2OZ4H 3GJEA 4GOSA 3KAAA 3OR7A 3EOTL 3OWEA 2GK0A 4H20H 3WD5L 5CEXA 2BVQA 3KPMB 5FYJL 3OKEB 1BLNB 1VFMA 4HIHB 2V9QA 2F53D 3KYMA 1IM9B 2J12B 3QFDB 2KKQA 4MQSB 5F88A 1JN6A 4PJ7A 4R8WH 1RIVH 2YPLB 5EO0B 4LAJH 3MFGB 3L5WB 5E70A 1MFCL 1TDQA 4Y5VA 3HE6A 2IPTH 2VXSL 1OGTA 1PX3A 1FL3A 2CRMA 4JM2C 1OAQL 4YR6A 2RFXB 2Q1EA 3CXDL 3FJTA 3WN5B 1XGRA 4F7MA 1H15B 1HI6A 4ZTPH 1WBZA 32C2A 2OL3A 4PLNC 1S5HB 2VITA 3OKKB 5D1XA 2QSQA 3H7BA 5KVDL 1G0YR 1BF8A 1FLRH 3FRUA 3WFDL 3SCMA 3FB7B 2J8UA 2A9MH 5KSAA 1TZIA 5GRZA 2YWYA 1F13A 5HDLA 1PG7X 3NPSC 2WANA 5J4MA 1G6RL 1AHWA 4GRWH 4EQ2A 1JUFB 1JNHB 4PJBE 3LKQA 4LVHB 1AQKL 2BVUA 4NN5C 5KANI 4HH9B 2Q8BH 4TSBH 2GT9B 3FRPA 4K71B 3WDHA 1DQLL 4GKNB 2D7PA 3MUY1 4FNLH 3WIHL 4JFEE 1D5XB 1MVFA 1QLEH 1RQ5A 3BHBB 4XRCA 3T2PA 4ELKB 4NP4L 3BRDA 5D7KE 5IJKA 2E9WA 5IEHA 1NAKH 1J1PL 3SDAA 1NGQL 3PP3H 5FECA 1QBAA 4LSUH 1B0RB 5IM7A 4M1CC 1TXKA 4K7PX 5FO8B 4YPJA 3GO1L 4P2OB 5D2LB 3GMLB 4WTZA 4I5BA 4O4YH 1ZT4A 4J4PD 3MTRA 1DQDL 2H32B 2P5EE 4F7TA 4MZ2A 1FCGA 5T1DH 5HHMD 4OUOA 4LSSH 3HAEB 5T5NF 4JFZL 1C5CH 2EIEA 5CKGA 5IK3B 5C07B 4HQQL 5E95B 5GRJL 4YDIL 4XVTH 3O2DL 4QYOA 4BUGA 4CKVX 4NQXB 1A4KB 1OTSC 3A6BL 3VXQA 1F6FB 3L1OL 1MRCH 4WJ5B 3VGBA 2A6DA 3MRRB 2XWBA 4LKXA 1HIMH 5D7KD 2XY2A 1QLFB 1DL7H 3EFFA 1D9KD 1UEYA 3MOAL 5TH2B 4G6AD 4OZ4A 3R06B 1RHFA 2XY1A 3Q1SL 4O9HH 4ZOBA 4ZFZB 3C5ZC 2GUOB 2G9HB 4NQCB 3AAZA 1IT9H 2GKIA 2QR0B 5HYJE 1UVQB 2QJDA 4HS8H 1JNNL 5FYLL 1SBSL 1U8LB 5SX5K 5T1KA 1MHHB 5BJTB 3KPOB 3V5DA 4Q6YA 2DLTA 2P5ED 3D85A 4UOW1 5I16A 3NGBC 5HJ3A 1IC4H 5F97E 1MCDA 4M7LL 4PP2B 5EUKB 4YHML 3VXMB 1G0DA 5GGUA 2F5BH 1I3VA 1JWMA 2HT4C 3WHXA 1MQ8A 2P24A 2AXGB 2DBJA 4YFEA 5IFJB 4LLVA 4F57L 3EJZD 3I75B 5JW4Q 2X1OA 4Q0XL 2VO5A 3NCMA 5GS3A 4FZ8H 5DMIH 3GBML 3U30B 5GHWH 4NCDA 3E0GA 5DSCA 4EIZC 4J2XA 5GSVB 1UM6L 1HHIA 1KG0B 2WINB 2DQHH 1S7WA 4YX2L 5GS1C 1XF5A 5HYJD 5IWLC 4LPVA 3FKUS 3FRPG 4HGWA 3DYMA 4OLYL 1F4AA 3B9KD 4XP1H 4HT1L 5KSBE 1AIFA 1MWAA 3BW9B 5D6CA 5I17B 1VACA 1VCAA 4PR5A 3RL2B 4RFOL 2C4XA 3BH8B 4JLRA 2YS4A 2NXZC 1FRGH 2PYFB 4N0UB 1CLYL 1IEAA 1YEGL 1BVKB 4Z7VB 4L8CA 4P46A 1G9MH 4XNUL 4MVBC 4XCFH 2AJSL 3HE6C 3KJ4B 4NQEE 4TSCH 43CAB 3DBXB 5HDQL 4WTZG 2R1XB 3EFDL 5EU5A 3BKYL 1YUHB 4U6YA 4M7ZC 5BW7A 2BNRB 4X0KB 2CLVB 2KZ1B 2APFA 5FUOH 4LLQA 4LP4A 5D7LB 4X7CC 1KEGL 5EOCH 2OQJA 5D1XC 3RIFK 5HI3D 3QDJB 3MBXH 4ETYA 5CJXA 2DQTH 4JANB 1RJCA 3MO1A 5I73C 5E94B 2DB8A 3LD8C 3SCMC 2XN9A 1IGIL 3RWIA 1AHWC 1OP3K 2FGWH 3MSPA 4OLZH 1WZ1H 4HZLA 4Y8AA 1NUFA 3BGMA 1NMAH 1QKZL 2EYSB 5E7BA 1GVIA 3LKRB 4HHAB 3V0VA 1E28A 1YEIH 3F5WB 1OAYL 3QCUL 4NQED 1A14H 5DHVB 4A6YL 3QDMB 2R4SH 5IVOA 1HOCA 4UUJA 3AU1B 5F7LB 3KPRA 5E2VH 1CZ8L 1QSEE 4LSPH 1KELH 5JQ6H 4CU8A 5HVWA 3L3GA 1QRKA 3EHBD 4JPKH 1MHEB 1GGCH 5K9JH 4NC2B 4QF1B 4JFYB 3HMXA 5FGCE 1EAPB 3P9MB 5DMJB 2YPKA 4L9DA 1DSFL 4BZ1L 2NYYC 1JNJA 2X7LB 4WO4A 5CJ8A 3KLDA 4PB9L 2Y7QB 4YHYC 4HIIB 4HDIB 2CIIB 1BFVL 3DROB 3UJJH 3ESVF 3EYFA 1RMFL 4JO1L 5DD1L 3QXVA 4R96B 3C9NB 5KTEH 4LRIC 4YHIB 5HHXL 4R9HA 1J0YA 1VDGA 3KPQB 3MLXL 3PL6B 2OP4H 3RIFF 1ES0B 3IFOB 3MRIA 5TGBB 4GG8A 1T03L 2DN7A 4MA8H 4KMQA 4KHXH 5I66A 3V6ZB 2D31B 1QFOA 3VFVA 5GRXG 3FT4A 2D9QB 4BFIA 2V5SA 3QHFL 5F7EH 3CCHA 4JZOB 4IMLB 4OF8A 4I0PA 4OD2B 3SGDI 1KIQB 1G6RA 1JGDB 1T1YA 3ARZA 5BXFA 2R0KH 1MCJA 3P4MB 3B2VL 3FOMB 3MA9L 1G7IB 3UTPD 1S9VB 1F90L 4UTAH 1HHGA 3VFSA 3DWTA 4ODUB 4QXTB 3LKPB 4G6ML 2E3VA 4OGAD 1CGTA 5DJAB 1I9JH 3RBSA 2VWEC 3WIHA 1UZ6E 1RULH 3HZVA 1IGJB 5DGQA 1NCDH 3EYQD 1ZE3C 4MXVE 3SJVA 5JLZA 1QNZH 4OSUH 2VDML 4PGJA 4WEMB 5DK0A 5IBTH 4TQEH 4B41A 4U1GC 4U2YA 1YEEL 2UWEA 5C6TL 3JBG7 2NY5L 4DKAA 4JREC 5J7CC 4WI2A 5GSRA 1I1YA 5FXCH 4EUPA 5C08B 1UZ8B 4CW1B 2F54A 4P23B 1II4E 5E6ZA 5CJQH 3UBXA 1AFVL 3U9PH 1V5JA 4P46C 1AKJA 1NCCL 1JYXA 3ZTNH 2NPLX 3VWKA 5IHBA 1UB6A 3E2HB 3VFMB 1NL0L 1F4XH 3O8XD 4PREA 2X41A 3H9ZA 5DRWA 2HFGL 1ZA3A 3HC0B 3U1SL 4AM0B 5BW7C 4GMSL 4LHUB 1CLOL 4JRXE 3RWEB 3WIIL 4Z8FH 5C0NC 4MJ4A 3PWNA 5J6HB 3T2OA 2K7PA 5D5MF 1T22B 5EUOE 1B3JA 5DUPL 1CFTA 4WHYG 5CJXC 5CBEA 1LEKA 4DGIL 3EOBA 4XB8A 1CL7L 4WY7H 5GJTL 4LEXL 1FNEB 4O02H 2X4QA 2Y5TA 3H0TA 1LP9F 2WUCL 2F5AH 1EUTA 1H3XA 4ONFL 3IAQA 4BH8A 1DJSA 1GCFA 2QHLA 1RPQA 1GZQB 2G2RB 4PJCA 3ARRA 5CWSA 1P7HL 1YNKL 4LVOC 3DETD 2YUVA 1JGUL 3D2UA 1UKQA 2ATPA 5E2JA 3CGTA 1Z6JT 3FO0H 5E8EB 1LDSA 5BV7H 2EDOA 1VA9A 3BAEL 3OKDA 3L7EA 4XBGB 3WD5H 4RQQA 4NUGL 3A0OA 1HYSC 4RGMC 5FK9B 1NANH 1C7SA 1S9YA 1WTGT 1R5WA 4W81A 1GJIA 1FJ1B 12E8L 5BV7C 3MV11 2OBGA 1S5IL 4YNYA 1ED3B 4WHTA 3K80A 1JZ6A 2J1KA 1ZSDA 5DURD 1OAQH 3MJ9L 3BE1H 5DK2A 5FYKH 5ADPH 5B3JF 4MNHA 3BXNB 1E4WL 4XVJL 4Z7NE 3IDJB 5CILL 4MJ2A 4XNYH 5KVDH 2E6JA 4H1LA 2ZP0T 3QWRD 4KTEL 1KN2L 1MVUB 4ZOAA 3WFDH 2NY3B 2C1OB 1YN7B 1G6RH 3MLPA 3UBXG 1HYRC 1CK0L 1IBGL 1NUNB 4LSVH 4XPTL 4KKLD 2ZOKA 4O58L 3S34L 5T5FL 4QGYA 3BUTA 1YDPB 4OKVA 1C12B 4IRSA 3JXAA 2BNQE 2PYEA 1DQLH 2V7NB 3QUML 4RISH 4AQOA 5C8JB 5I1DB 4M9OA 3WIHH 4APQB 4YHOL 5C6PB 4CU6A 2PO6C 5GQBA 2SEBA 2W9EL 3RPKA 3QIUD 3MGOB 3C6LB 5IIEB 5J57B 1S8DA 1U36A 4YE4H 3GGWB 2IH3A 3GFUA 2F15A 3B43A 1NGQH 4NKOB 4PJ5E 2MQ0A 4PJ8B 5CEYB 2JCCB 1JMZA 1JYWA 2Z8WC 4LDLB 4LPUA 2WK2A 4P0DA 4KUZL 3CFJB 5EZOL 1TJHH 4MLSA 4X6CB 4RDQG 4LCYB 4QHKJ 3VRLF 3I6KB 2BXZA 2PR4H 1RIHL 3I84A 5IF0A 4IMKC 1BZ9A 3GJFK 4ZSOE 3VWJB 2WLZA 4U3CA 3RWDB 1MHCB 4L3EB 1KENH 5GRJH 2A6JB 5DJZB 5L6YH 1AGDB 5J11C 3H3BC 1FO0B 2WBJA 3SKJL 5F93C 5TDNA 3ULVL 4Z7OF 1HCFX 4PJ5D 4W6WB 1DBJH 4S1DD 4B0MM 1QYGH 5DFVD 3UO1H 3VWKC 1BQLL 2ZUQB 5B38B 1ZT7B 4FQJL 4M8QA 4DGYH 3O2VL 1OGAA 3S3JA 2GJ6A 4MA3B 5A3ID 5FYLH 3STZB 5F9DC 1CFNB 4HH8A 2VDNH 3TH3T 3O4LE 4KY1L 1FYTA 4HS3B 4UQ2B 5GISH 4MDIB 3OJVC 2NXYD 5E24E 3H42L 5DD5L 1UWEH 4M7LH 4YHMH 1S7XA 2MSPA 3LMJL 2A73A 3O9WA 2VDQL 3U7YL 4LCUB 3MYJB 4QWWD 1OCWL 4NC1E 4HWBL 1EHLH 1JPSH 1MIEL 2J8HA 1IKFH 5E99L 3LEXB 3N1FC 2I07A 3NZHH 2DQDL 2F74B 4PRAA 4LPTA 4X9BA 4H1LG 2AEPL 1K4DA 3CDYA 1MLBB 1CT8A 3SO3B 2EH8H 4EXKA 1RZ7L 4HXBL 3ZE1E 5D7IF 1UM6H 1ND0A 2AJ3A 2DTML 3QULA 1W0VB 3B8SA 1X6LA 3W39B 4P4KD 4YX2H 1DBMH 1NCAL 3FFCE 3TO4B 4CNIA 4J23A 2OR9L 3CLEL 3O4LD 4E41E 3BKMH 4XBPB 2ZSWA 5DLMH 3SDXB 1G9NL 3K2MC 3WFEL 3BZ4B 2Q86A 4FFYL 3WLBB 4A2MA 1CLYH 2GCYA 3L7FA 1YEGH 1NLBL 4NPYA 3KPSB 4MJIA 4OFVA 5CEZH 1NEZA 4QNPF 3PWPE 5A16A 1W72B 3GSRB 3P9LA 1J05A 3C5JA 1RZ8B 4XNUH 15C8H 4H8WL 3SBWA 2AJSH 1S7VB 1BFSA 3IDYC 4DCQA 2NY6D 1MFAL 1CE6B 1OD7A 5IVZA 1MI5B 1OAKH 1RV6X 4PFEA 4M6OL 4XCEB 1LD9A 3BKYH 4UQ3A 1YMHB 2WWMC 1AE6H 1AI1L 3CPLA 5CGTA 2ICCA 3FQUB 2AK4B 5F9OL 1YMMD 4XPGL 5IBUG 1I8LA 3MUZ1 3FFCD 4QRTA 3SGJA 5I74C 4D0CB 3MX0A 4N9GA 1AXSB 4PJEF 4E41D 4HUUB 4JM2B 3SOBH 3T04D 2OTUB 1IGIH 4WU7A 1QZ1A 1YEDA 2ARJB 3CMOH 3G5YB 5MP6L 2FCBA 4IRJD 3IXTB 3REWB 3SDDB 3RQ3A 2IG2L 2EYTA 5EOQL 1E0OB 1T7ZA 2GTZB 3PWPD 4IRSC 3BKCL 4NJAH 2ENSA 1A6UH 3GSQB 3DMMC 3X11A 3NPSB 3QUZD 4F7CA 4P5MA 5C6WH 5EIIA 3VCLB 3GZKA 5GGRY 5FUCC 1K5NB 4PRPE 2DIJA 4R90H 4KK5C 3WUWB 4X9IA 1I1AD 5K9QI 3IGAA 3KXFB 1QSFD 1JV5A 5JDSB 2X70B 1OT2A 5M94B 4GRWB 5DVNA 2W65A 1LEIA 4M5YH 2HJKA 5J6GA 5CBAB 3QH3B 4HFUL 4X5WB 2CGRL 4LSTL 1HKLL 4JGUA 2ICWI 1EHAA 3MRCA 5KS9F 4N90E 3VJ6A 4GAJL 4H25A 2X42A 1PKQA 2WIIA 4XCYB 5E2WH 2MMXA 1I7UB 2FD6L 5F1SA 3TNNB 1YC8A 2AP2A 2IPKB 5E1HB 3RZCA 3OKLB 3B83A 4GXVL 1HSAA 3VFTA 3WBDA 1QRNE 4NM4H 1U8IB 1UCBL 4PRPD 3NCEB 1PLGL 4P2QA 5GGQH 1ZGLB 3MJ9A 4Y4HD 1N7MH 4UNVA 4WNQA 4KKAD 3FQTB 1VKXA 1NEZG 2J2ZA 3N1MC 3VFUB 2HN7A 3G6JE 1AXTH 1SMAA 2B1AH 2FSEB 4GKSB 4GW4A 4OIAA 5KAQG 5FGBC 4JDZA 2FJGA 3T0VA 1CICC 3HMWL 4F3FA 3ALWA 1U8NA 3Q6FB 3QSKB 5TE7H 2CK0H 3C5ZB 3QXTA 3IDMB 1OF2B 5D93B 1I4FA 3B2VH 4BSVA 4Z5RB 3MA9H 1ZLVK 4URTB 1WK0A 1F00I 4MWFA 2H1PL 2VC2H 3ARFD 3PIQA 4G6MH 4NRYA 4HBQA 4PTTA 5HYFA 3QUMA 3ULUF 1NBZA 2VXQL 4KKCD 2RCSL 4ELMB 1PD6A 3T0EB 4C83A 3L5XH 2F58H 2G75B 1CXKA 3MFFA 3SGEH 3T8XA 1L7IH 3CZFB 3ILPB 5EG6C 5BRZB 3T2NL 1NUGA 3BPNC 4IHOB 4OCSL 4DVRL 2IH1A 5ESAA 1CN4A 2V2TB 4OCMC 2XNAB 5D9SA 4RMRA 1U8QB 3O6ML 4OZIB 4S11A 2VE6A 5GRUL 5ICYA 2D7OA 1VESA 1WWWX 2Q7YB 3V6OC 4D9RE 1F6LL 3R1GH 5E2UL 4XNMB 3P4LA 4GRLB 3MV01 3BDBA 5C09A 1KPVA 2OI9B 1QPXA 4I2XB 2DOCA 3O3EB 2CLRB 1QFWL 4KK9D 4Z7UB 3D5OF 1U8MB 4KJQD 3GJEB 3OR7B 4LLYA 2GK0B 5B8CA 2CKNA 4NCC1 3H9HA 2YPLE 5CEXB 2BVQB 4M93C 3ROLA 3C60A 5SX4I 2NXZB 2HJFA 3ME0A 3KYMB 3TN0C 1BAFH 4GAFB 1JN6B 3LKSA 4PJ7B 2KH2B 3CXHK 4Y5VB 2QQLH 3O45A 3SGJC 4Z76A 1I8MA 4ZOEA 1FL3B 3O3DA 4YO0A 4LOUD 3P0GB 4S1SH 1CL7H 1T21A 1XEDA 4LEXH 1XGRB 3O6FA 4UB0L 4F7MB 1HI6B 2VLJD 1JNLL 4ONFH 1WBZB 32C2B 2AK1H 2OL3B 3RU8H 4M3KB 3OG4B 2VITB 4J3TA 3QNXA 5D1XB 4PG2C 3BWUC 3H7BB 4HJJH 3SQBA 1C16A 1IM9D 3FRUB 3MCKA 3QEQD 2VQTA 3SCMB 2J8UB 4HWBA 5KSAB 1TZIB 3W0WA 4LEOA 2YPLD 2EDLA 1NAML 2DM7A 1AHWB 3LKQB 4M6MH 2HRPH 2Q6WA 2EC9T 4ZAKA 4CUCA 3HC3H 3VXPA 1TTFA 1XCQA 1JHKL 4HJ0C 5DMGC 1LO3L 3AS3A 4XRCB 3BX7C 1K6QH 4HLZG 1T1WA 2FIRT 5IEHB 4GAYA 3BWAA 5E5MB 3V6BR 3SDAB 5D2LE 5F1NA 4TVPH 3TVMC 5FECB 3H3PL 1T04A 3MLWL 1U6AL 3T4YA 3LY6A 5I18H 2COQA 1A7OL 2DKUA 4NRZA 2C3XA 5F72S 3H9SA 3MJ9H 5IBLD 4YGVA 5JUEL 3DIFA 2HWZL 5C07E 4I5BB 1ZT4B 1XFPA 4MZ3A 1W0YT 1OTUC 1HHHA 1QFHA 4XVJH 4F7TB 2PNDA 2VLME 4ENEC 5D96C 3BVNB 3GIVA 4UILL 4Z95L 1A1OA 1U3YA 1MFBL 2NY2C 4QYOB 4OCYH 4D94A 4Q74A 2A6DB 2XWBB 1MPAL 4LKXB 3OB0H 4NQCE 5T5FH 4LIQE 3T1FA 3EFFB 3WFZA 5JR1L 4P2OD 3QUMH 4OZ4B 4TSAH 3HE7C 5T5NG 1J0ZA 1A7BA 3VFGL 5A40E 2BHYA 2Y6SC 4G80A 4WFFE 2OX5A 1VPOL 3AAZB 2R9HD 2EZ0C 3VXME 3RGVA 1C5BH 4KROC 4NGHL 5C07D 5T1KB 1R3JA 3V5DB 4E42A 4NZTL 2YRPA 3D85B 5DJDB 4R7DA 5I16B 2XPGA 5HJ3B 1HXYA 2LV4A 4D0BB 5GGUB 4KU1A 5IFHL 2D7TH 4X7FC 1HNFA 2X6MA 1Q0YL 3QHZL 4NO5A 3WIFA 3UTQB 4FQCL 4QTIL 1BQUA 3WHXB 3B2UD 4R3SA 2DLIA 4G9FA 4NQCD 1F4YH 3GSNL 4LLVB 5HYSA 5DTFA 4WI4A 1NMBL 1X4XA 2PTUA 3LRGA 2HT3D 2P45B 3BQUA 2AJYH 2XQBL 3HHRB 4KPHL 1WISA 1P4BH 4PRDA 5DSCB 4TNVK 3M17A 1HHIB 2XRAL 3EJJX 5AYUH 1S7WB 3D39A 1KN4L 1XF5B 3T3ME 3VXMD 3ZSTA 3MZTA 4HGWB 4DKEL 3BKJL 4N0UE 2HH0L 4Z7VE 5DUML 4UV7L 4UTBL 4JREB 5E00A 5B8CC 1AIFB 4JB9L 1MWAB 4R4FL 5D6CB 2CH8A 4FQJH 4PR5B 4O5LL 5DC4B 4JLRB 5T3ZE 4OZGF 4HEPG 3PHOA 4YGAB 1J0HA 1UA6L 1IEAB 4KUCD 1WFTA 2BJMH 5IROA 4HWUA 1VFAA 2BNRE 5LQBL 4PLKD 4P46B 4X7TA 3V9FA 3IU3A 5JNYA 2E9BA 3BIKA 3FQRA 5CD5C 5D7LE 4ZS7H 3O11A 1C5DA 3LMJH 5BMFL 3E3QE 4ZUSA 3U7YH 4R26L 5EU5B 5JHDA 3QDJE 5IB1A 4U6YB 1L4IA 4C55A 2XKNB 4NBZB 4LLQB 5GS0H 3O6FC 2GY7B 2I5YH 2VXUH 1FFQA 4HC1L 1ZKAA 2OQJB 4WEBH 2X9WA 3ZE2E 3OKNA 3MO1B 4BZYA 4P2YA 2XN9B 3DI2B 4XI5C 4P57A 5GS0C 2P48B 3H9YA 5T3ZD 1OHQA 1J8KA 2YD2A 5DT1H 4HZLB 3BGMB 3QDME 1QFWM 1T5XA 5GGTA 1MJ7L 4N5EC 3QFJA 3V0VB 2DQI<