1MEXL

Antibody catalysis of a bimolecular cycloaddition reaction
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIVMTQSQKFMSTSLGNRVSVTCKASQNVGTNVAWFQQKPGQSPKTLIYSASYRYSGVPDRFTGSGSGTDFTLTINNVQSEDLAEYFCQQYNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTGGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 29G12 light chain
publication title Antibody Catalysis of a Bimolecular Cycloaddition Reaction
rcsb
molecule tags Immune system
total genus 52
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2002-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mexL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mexL01
3BUYB 3MRMA 4M6OH 1E4KC 2J3SA 1U95A 1F4WL 4GQ9H 2VN4A 1NC4B 3LPFA 3C8KB 3LIZH 3VXRA 3ARFC 1OQXA 4M43L 2XPGB 4HAGA 3WXVL 1IM9D 4MA1C 3QCTH 2PW1B 3UMTA 1I7UA 4R8WL 1KC5L 1UACH 2YPLA 2B4CL 5DMGC 4NZTH 1U0QA 1N64L 5DLMH 3T0DA 5TPWH 2DB8A 3GSNH 1H3XA 2VUOA 1PLGH 1U6AH 5EBWB 5AUMA 4MQ7A 4Q2ZB 3G6DH 4OTXH 3WJJA 5EIIA 5SWZB 2DICA 1T7YA 1QNZH 2OR9L 4X80L 5D4QA 1H15B 1XMWA 1ZHKB 5I30H 5J57B 3RI5K 5F7KC 3QB7C 1K6QH 2J8UA 3DO3A 4X98B 5ACMA 3OG6B 1TETL 4RZCB 1RZJL 1CXLA 1FYTD 1H3PL 1QFWM 2Z4QB 3DSFH 4GO6B 1NFDB 4P49A 3T04D 2YZ1A 3O2DA 4LSUH 3T09A 4X4XA 3O8XB 3PG2A 3BYTA 4LVHB 5FCUH 2OR8A 4NDMB 4LLUA 2EXWC 2VXQL 4JFPB 1NGZA 1T3FA 3HI5L 3C8DA 4WVRA 2VL5A 3QQNA 4R0LB 4NZRL 5H35A 4MB4A 3GJFH 4PJAE 4Y1AB 5ICZA 3DYMA 3HPLA 3ROLB 3HZVB 5I75B 3N06B 3EO1A 4JG1L 1J18A 4FG6C 3QNXB 4KQ3L 4NN5B 4JFQA 4WUUB 4JPWH 2H2SD 2XN9E 4HLZH 3KPMA 4Y4FD 4HGWB 4G42B 1FO0B 1NDMA 4O51A 5FO8B 2QJDA 3UTZB 3BIKB 4R2GC 5D1XC 4MWFA 5KS9F 1HKLH 3GMOA 4Q6IB 3B9KA 1XGPB 3OSKA 2VABA 4HBQA 1H8SA 4H8WC 5GGVH 3T8XB 2AK4E 4CDHA 5IGXL 1CBVH 3FQXB 3I75B 2FGWH 3IKKA 1CI5A 2CJUH 3ORJA 3NFSL 3ZKXB 3RWDA 1F3DJ 4NUGL 1FORH 1FFOA 1G7JA 1G9NC 4HK3N 4IJ3C 4QOKB 1J8KA 1OTUD 1RJYA 5FK9A 2J6EA 5C2BL 4E0RB 1QZ1A 1UB5A 2ADJA 1HSBB 3VXSA 5DI8B 1ITCA 4K2UH 5JQ6L 4KDTA 4W6YB 2VLRE 3FL7A 1QYGL 2EDOA 3BKCH 3PV6B 2UZIL 2YOCA 4MQTB 3U7YL 3QO1B 5HHVL 2DWEA 3ZE2F 4NGHL 1FNLA 5JTWA 4XPBL 3WLWD 5BZDB 5F9OL 5IKCA 1AY1L 3MJ8B 2PYFA 2G9HB 1CN4A 3QWOB 2R0WH 5E08L 1T2QL 3V4PH 1LK2A 5D7LB 5C0AE 1KPUB 2Y72A 4HKZB 4UT9L 4P57B 5TE4L 4QRRA 3E6FA 3QDMA 3S37L 4S2SA 4LRIA 3OKYA 1L4IA 4PTTA 4OFYD 5IMKB 1MIMH 3LB6D 1YMMB 3OF6A 4Q9QH 5FDWA 4LU5L 5FO7A 5HI5D 4KTDL 1HI6B 1ZVSA 3NZ8B 3MXWH 3ZKND 1NEZG 4TUJB 4NNXA 3B5GA 1A4JA 2X44D 1I8IA 2ZCKL 1QPXA 3I2CL 3V7MA 3DO7B 4QRSB 2F53E 1NANH 1A6TA 1EEZA 4JM2D 1INQB 3NCEB 4PJDF 3OB0K 2DL2A 3ZDZE 2A0LC 4CRPA 2NMSA 1PY9A 4LGRB 4MXWH 5EA0H 1VACA 5E4EB 4N90E 5IOPA 1CQYA 4AJ0A 5GS3A 1QO3B 1HEZB 4RGOL 3G5YA 1FCGA 1JK8A 1BFOA 4LLMB 5B39G 1LO0L 3WFCL 3ARTA 1D5ZA 1OGAB 4XVSH 5E2UH 3IDUA 2D31B 4P46A 5MEQA 1MJJA 2PW2B 3UTSA 5L2KA 1T66D 4Y5XC 1P6AB 1HWHB 4K7PX 3C09C 3SDAC 2EH8L 3L6FA 1QFWH 5HGDB 5GS1B 4TTGA 1F6LL 3QUML 5I66B 3DVGB 4P2RD 4NM8L 2VDPL 1FSKC 1SY6A 5KSUB 3CSGA 2A73A 3MLWL 3QIUA 2V5YA 5FDYA 4KJYA 1YA5A 3D3VB 1SYVA 3QT2A 4L1DA 3SKOA 4OGZA 4O2CA 4YDKL 5SWZE 3OXSB 2WQRA 4NQEA 4LPYA 3U82B 4O5LL 1DBML 2GJJA 3QEGL 3RNQB 1CFNA 3OQ3B 4IBLT 4PRIA 4EUPG 2VXUL 3UYRH 2HMIC 1RZFL 5E6ZA 5D2LA 1BIIA 3MUGA 1BBDH 3QDJB 1AHWB 5DD1L 4XPGH 3MZTA 4L8BA 1MJ7L 3CVHA 1PG7H 1PX3A 1JGLH 1BD2B 1NFDE 2HFGL 1AJ7L 2R2BA 2BFVH 2GSIB 2AXJA 2NXZD 5KSBA 3ULVH 1ZHBA 4X6DA 4C59B 5F3BB 1ZLVH 1UQSB 2V5RA 3VG0H 3M45A 3BUTA 1ZT4B 3D2UD 2ZOLB 4FQ1H 2B5IC 3DTXA 3T4YA 4WW1B 1RZGA 4IRSD 4NHCH 5CAYB 1OW0C 4LHUB 5KVDL 2OR7A 1URLA 4ODTH 5I15L 4PB0H 3H9SA 3P4LA 3CSYA 3L1OL 1AIFB 4I0KA 5FUCE 1YDPB 1FIGH 5HYFA 5DQDH 1KLGB 1KT2B 2NTSP 3MBXH 4YHLH 2BOCB 3O4LE 1WBXA 5T5FH 2ICEB 2CRIA 3MREB 3G6AA 1MH5A 4FXKA 2AS5M 4X99A 4OF3A 4XZUB 1TPXC 2XWTA 4WW2B 3MUY1 2DDQL 4YDIL 4XTRC 3ULVE 1FCCA 2E8YA 3KLSA 5ICYB 4WIQA 3IFOA 3MGTA 4MLSA 2R2HB 3SCMA 4ZS7L 1D5MB 4UILL 1JZ7A 5FYLH 1SEQL 1A1MB 4YXLH 2O5XH 3R0NA 5F93C 1ZKAA 5EZJB 3TBWB 3DJ9A 1QHPA 3FQNB 3VGGA 1FFRA 2ZNXA 4EEEA 5EU6A 4XH2B 1JP5A 4M6OL 2LFGA 4QOKE 2CKBH 1G7MB 1J86A 2R1WB 3C5JA 3VH8A 4GQ9L 4PJEF 3MJ9A 3LIZL 1IRAY 4RGNC 4YPJA 4HMDA 3SY0A 3RJQB 3MNVA 3ILQC 3QCTL 1QSFA 5GZNC 1VENA 2LE9A 1UACL 4HH8A 1DEEB 1HKFA 2ZCLH 1DVFB 3C60C 3QWRD 4NZTL 4FA8A 3LOWA 3EDKA 4H88H 3CZJA 5DLML 3HCVB 4G9FD 5FYLE 3KPPB 5TPWL 1P4IH 1S7VA 1XR9A 3GSNL 2FEDD 4JKWA 1PLGL 1U6AL 5D7LE 2IQ9H 3G6DL 4OTXL 3VA2C 1WLHA 1C08B 1QNZL 3SGEH 4PBXA 4AEFA 5I30L 3B9KC 4G8FB 4PP2B 3AREA 1YMME 1K6QL 3MRHB 4JFDB 2A6DA 4F7TA 3CFIC 5IMLA 1KENH 5DC0A 2X2YA 3DSFL 2FR4B 3LKRA 2AP2A 4LSUL 4GMTH 3ARBA 3EGSB 3TESA 4EI6A 2GT9A 1PQZA 2ADGA 1B90A 4M1CC 5B8CA 2GJZB 5FCUL 3WMSA 3P4MA 1FVCB 2DYPD 2KZ1B 3HAEG 5D6CA 1X7QA 5I73C 5F6IB 2EKJA 1B6UA 3VFUB 5DS8A 2XA3A 4KDTC 3VXTB 4U4BA 1FNGB 1U93B 5KANI 1UXWB 3RIFK 4JPWL 1OHQA 1OGAE 5D70H 3PWUA 2RGSA 3PQYB 3IDNB 4XMLH 2KPNA 3MV8B 3OKNB 1Q1JH 3BJLA 3AUVA 4HIIB 4JEGB 4N9OB 1PYWA 1YEGH 2R2CA 3W11D 4RMRA 4LRIC 3GDBA 4ENEC 1HKLL 5HGAB 1JYXA 3U0TA 3RVVC 5JOPD 1MAMH 4F7PB 3FO2A 4K71C 3GSXA 3VRLF 1WWWX 4ZDHB 2NY1B 2AJ3A 4OQTA 5GGVL 3ZSTA 5ESQB 3LQAC 4HKJA 4PRNA 3D39D 1CBVL 2FGWL 2NPLX 1K8IA 3B9AA 5I8KH 4M6MH 2CJUL 1H8OA 2ZUUA 1KNOB 1I8MA 2X42A 1FORL 3O2WH 2DQTH 4G8EB 4U6TA 4JY6A 3AROA 3KLHD 5JOFB 1R5WA 4TNVF 3QDJE 4ZXBB 3BZFA 3MLSH 4PJCE 2OZ4H 4K2UL 5F7WC 1VDGA 1LO2H 4Y8AA 2NZ9C 2OQJB 3BKCL 2Y7QA 1BD2E 4P2YA 4XAKE 1QHOA 5L8KB 2A1WH 3ALXA 3LN9A 2CSPA 2PXYD 4X4YB 5HGHB 1LNUB 5T1MA 4UU9A 2AJZB 4JHBA 4PR5A 1JUFA 5HHMB 2C4FU 2NY2D 4P46C 1J8HE 2R0WL 3V4PL 1N7MH 1N26A 3BN3B 4PRHE 4X6BA 1GGTA 5IB4B 4CUCA 5JNYB 4EIGB 4OLZH 2LV4A 4BH7B 3DI2B 4O2EA 4NQCB 2IANA 2QEJA 1MIML 3NABH 3T1FB 1DJSA 1EEQA 4PV9B 4I0PA 1XAUA 4Q9QL 4FOMA 4KKBD 5I19H 4KC3B 1GL4B 3DMMA 4DAGH 4FZEH 2R23A 1WJ3A 3OJDB 4AZ8A 1W8OA 1ZHLA 3MXWL 3RHWK 3LKNA 4PGBB 4XBGA 1INEH 1DBKH 3GSVB 1RURH 1NAMB 3NFPA 4Z7VB 4LCYB 4J3XA 4HIEA 2BOBB 1K9TA 3PGDA 3VXOA 4QLRA 4NN6B 5F6HJ 2DMBA 1J0ZA 5FGCB 4A2LA 1MHCB 3RUGA 2XACC 3MPCA 4MJID 3WN5B 3K81A 4FP8H 1KBGH 4MXWL 5EA0L 4EBQH 1U8OA 5JPMB 5T3XH 3KPOA 1F4YH 3LN4B 2IMMA 1FNFA 1WIOA 4IOSD 1EEYA 1Q94B 4Z7OE 3I02A 4MXVE 5JW4R 4F80A 1ZANH 2L7JA 1S7XB 4XVSL 5E2UL 1X5IA 3MLRL 4NPYA 5E0QA 5T33H 4OFIA 4DW2H 4LLDB 4ZFGH 4GS7B 3GFUA 2BHYA 1TITA 3DX9B 3HB3D 4MNQD 1QFWL 4KV5F 4AQ1B 1IL1B 3LKPB 3CK0H 3S36H 3K8KA 4BQ6A 3KWWB 2BVEA 1QLEH 4HPYH 1QSZA 4X7SH 1ZS8A 2XG4A 2BVUA 2ICWA 3VD9A 2VZOA 3F7YA 2JJTA 4P4RB 4JO1H 1BJ1J 1P4BH 3MXVH 1U8JB 5AAMA 3LDBC 4BSWB 2MSPA 3NCYP 2BNUA 3UBXA 1BFTA 3CH8A 3UYRL 3NCYS 3QJHA 4PLOB 3ARXA 4QHUB 4JFDE 1BBDL 5DJ6A 5IMOB 1S5IH 4XPGL 1XGQA 1YYMH 4RA3A 3O9WB 2P24A 4U1NA 4G6FB 1CIUA 1KPRB 1PG7L 5ISZB 3V4VH 2F19H 3FMGH 1JGLL 4NO2B 1AGBB 5FHAH 2BFVL 3OXRA 3KPSB 3ULVL 5DHVH 3KPQB 4J6RH 4AQOA 3PJSB 3VG0L 4F9LA 3QNYA 4IOIA 4U2YA 2HJFB 4U1JB 2VR9A 1HH9A 4NHCL 1OSZB 4ODTL 4Z7WA 4PB0L 3FB7B 4Z76B 1A4KA 2CK0H 4ZYKA 1I75A 3OKEB 1G84A 1FIGL 2BY0A 3L3JB 4R96A 1T89A 5DQDL 3DURB 3MBXL 4YHLL 1EHAA 4K8RC 5T5FL 1AGDB 2JJSA 1VEMA 3LSOB 4LVNB 2FNBA 3MV8E 4YQXH 1TVDA 3FRUB 3P73B 4PJFA 5J13C 3D0LB 3LS4H 2PETA 2P8PA 5B38A 4L9LA 4NKMB 4WFHD 1Y18B 2E8ZA 2CLZA 1MCCA 3QEUB 5CMAB 3RGVA 3G08B 4JFEB 5F70A 5FYLL 4MCYB 1AR1D 1IC1A 4NQVB 4YXLL 4D9QE 1SYSB 5DK2A 5DQ9B 2PCPA 2O5XL 1UVQB 3I6LE 4P2OB 4WV1B 1VSCA 4J23A 5FOBA 5EO9A 3CFDB 1J05B 4L5FH 2FLRT 5ANME 5I8EA 2UWEF 3OHXB 5I6XC 3IFPB 3W82A 3IJYB 2N4IA 3BHBB 3L9RA 3UPRA 5C3TA 2CKBL 5BZWA 3ARGD 5LBSH 5D7IF 5TH2B 5CHNA 3V6OE 1TCMA 4L8DA 4P9MH 4PD4J 1PG7W 1MCHA 2H32H 1X5YA 4G6KH 2HFEB 3MUJA 1C1EH 5C07D 3RNKB 3AVEA 1QSEA 2JIXA 4GBXB 2ZCLL 1BQHB 3U0WH 2HVJA 4YDVA 3FT3A 1WWBX 4NNPH 5HHME 4H88L 1OTSD 4HUKB 1P4IL 3BQUD 4PJ8C 2HT2D 4ZPTA 2ENSA 1FL3A 3ARDC 2IQ9L 4OZHB 2FEEL 3OZ9H 4WU7B 4NQCE 1NBZA 2V7NB 1AH1A 1G9EA 5HJ3B 4ONGH 4ZFZA 3FO1B 3IFLH 4RA0C 3D69B 5GHWH 2NY5H 3VXUB 4WFEE 5E9DD 1G9MH 1CGTA 1KENL 1U41A 4N8VG 3HI1B 5B3JE 3LAFA 5SWSA 3O6MH 3V52H 4M6AA 5GGQH 4GMTL 1KN4H 1MWAA 4UOJA 3CMGA 4HHAA 4BKLB 1FPTH 3RVUC 4H1LH 4Z7VE 2P5WB 5K9OB 3P11H 4LKXB 4QHKI 4JFXB 5J56B 2CR6A 1CTOA 2Z93B 2A6JB 5FGCE 3JSSA 3TPKA 2MFNA 1ORQB 5CWSA 3PF2A 1U2HA 2BRRH 3IDYC 4F7MB 5IHLB 3VGBA 4KHTH 1R24A 4RRPG 4DVRH 2CO6B 1IQWH 3U4EB 3SKNB 4PJBB 3MCG1 4LBEA 4P5TC 3A6CH 1IAII 3PDDA 4HIHB 5D70L 4Z7UB 3E6HB 4JZOB 5I1AB 3IETB 4XMLL 2QSTA 3GGWA 1CICB 1Q1JL 2OSLB 1ZHNA 4KROB 5T3ZH 2E27H 1YEGL 3IDIA 4LF3A 1OOAA 5HD8D 4PV8B 3ALWA 5FYJE 4FQXC 4OIIH 1BECA 1MAML 5E1AB 1JNHB 3N85H 3DMMC 3ULUH 2O93L 2BNQA 1I8KA 2NY6B 3PXHA 3ZHLA 1H9VA 2E7BA 4GKZA 4M1GH 4ZTOH 5I8KL 4M6ML 4R6UA 5DT1H 4W6XB 1HHGB 3ARRA 3AMKA 4HIXH 4XC1H 4DUXA 4Z78B 1JNNH 4R3SA 5J0BA 4KTYA 4LOUC 1JBJA 5LGHH 4RAUA 2J8HA 3O2WL 5AG8A 2DQTL 3WSQH 1CDHA 3TPUB 1LE9B 2R2EB 4UUJA 4U6XA 4PGZA 3DYPA 4UAOB 1MHEB 3WDHA 3L3HB 3GO1H 1VFUA 1GZQA 3MLSL 5T3ZE 2OZ4L 1C8PA 1AC6A 2DJ4A 1LO2L 1QA9B 4JO2H 1ZA6A 4P5KB 4KQ4H 4I5BA 4WI6A 4HV8B 2A1WL 5EH1A 3HMXH 3KPSE 3V6FA 5GS0C 1ZSDB 4NHUB 5KS9B 5J3HD 3NPZB 1QVOB 3AM8A 4XNUH 5KW9H 5HY9B 1K85A 1N7ML 1U58A 3MBED 5I1EH 1NDGB 4DFIA 2ZG1A 4HDIA 5H37H 4P9HC 43CAB 4OLZL 3KXFB 4P4KC 5CJQH 4NC2B 5CKAA 5I0DA 4NKIH 1JFQH 4RX4D 4OKVB 4KKCD 4LMQI 5ACZB 3NABL 5C1MB 2WWMD 3WO4C 3H7LA 4J3WA 4DOHB 5I19L 4YHYC 1V05A 2F5BH 4DAGL 4FZEL 1GC1C 3OKMA 1LEIA 2DAVA 4DGYH 2IQAB 2IAMA 3CH1B 3ARVA 4ZFFA 5C0CA 3FO9B 4C55A 5F88B 1INEL 3J8F7 4QXTA 2FJHA 4KK8D 3JVGA 2A6IA 1RURL 2VLLB 1QBMH 1DEDA 4Y4HD 4XWOD 3VGDA 5KSAC 1VFAA 5IHZB 2MPAH 4KMQA 4G9DA 2HFFA 4OD3H 5D2NC 2BSSA 3PNWA 2VLJD 4FP8L 5C0EA 1HQ4B 5E00A 1KBGL 1MUJB 4JFEE 4EBQL 1YN7B 1DQLH 3WUWG 5T3XL 1F4YL 1QRNB 2R1YA 3PWPB 4MAYD 3RZCC 4PP1D 5A2LH 1T04B 1ZANL 5J8OA 4Y7MA 5DK0B 5EN2B 3HR6A 5T33L 1CDBA 3PGCA 4DW2L 1G7IA 4K9EH 4MSWA 4NBZB 4ZFGL 4PREA 5F89B 2A6KB 3EHBC 3PL6D 1J11A 1LK3H 4RQQB 2GY7B 5CKGA 2AGJH 2X5PA 2FRGP 4Y0GA 3MRGB 4X6EB 4JPIA 2OJEB 3CK0L 3S36L 3VI4F 4HPYL 1QLEL 2O26U 1T89C 4X7SL 1MF2H 4AIZB 1FZOA 4YIQA 3QG6B 4L9DA 5CEXB 4G43A 2Q76A 3LQMA 3HC0B 4JFOA 1L9MA 5HYQB 2FIKB 1SBBA 1K2DB 1QP1A 2XXCB 5HYJD 3QUZA 4JO1L 1P4BL 1DN2A 3MXVL 3KNBA 2I9LA 4L3EB 1SMAA 4M7JH 3QQ3B 5E70A 1NCWH 2Y9RT 4IHOA 2IADB 4HAFA 1JI1A 3BVNA 2Q20A 1S5IL 4WFGD 4IJ3B 4ZD3H 3HE7C 4I2XA 4IRJD 5GSVA 1YYML 2MJWA 1AO7E 3VXUE 1VHPA 3V4VL 3VJ6A 3NBNA 2F19L 3FMGL 3OAYK 2PYED 5FHAL 4HWEH 5DUPH 3TM6A 4UV4H 4PG9A 4HS3A 4K3JH 1NCAH 4J6RL 1WV7T 5ID1B 5HI4D 2H3NB 4ZUUB 1IT9H 1D5XA 4U1MB 4JFYA 3Q6GH 3OKKB 1CR9H 4CKVX 2VAAB 1FFPB 5D6DA 4PRBA 2IEPA 1NFIA 2CK0L 3HE6B 3RWEB 2D4DA 1UB6A 2NXYB 1BZ9A 3T2NH 1CDYA 4NQDA 4QRTB 4PJBE 1F3RB 2HJLA 1DN0B 2FJFB 4PBVC 1CGWA 5IHBA 4JFHE 4KZEH 5CZXC 2QQQA 4Z7UE 3C6LA 2D0FA 1FAIH 4JREC 4YQXL 3UCRA 4G8IA 2R0LH 1BIHA 3CCHA 2VYRE 3LS4L 4G3YH 4Z7WF 3IT8D 3K46A 4F58H 4XPHH 1EGJH 1EUUA 2EIZA 3VXMA 1X6LA 5J12C 4CW1B 4ETQB 1M7DA 5K93A 1HOCB 4G8GB 3AAZB 1CLCA 4QRPD 1PGRB 4LMQE 4PRPE 4D0DA 5IW6B 4PYGA 4OV5A 1YN6A 1YYLH 5GJTH 4WI2A 1R5VB 2EEAA 1BZQK 4F15C 3SPVB 4L5FL 1Q9OB 4OF7A 4L8SB 3G6JA 3T2QA 2B2XH 2NW2A 3KLAB 4EI5D 5LBSL 5IBTH 4KK6C 4EIZC 4HEPG 4PLNC 3DX6A 4YBQC 4P9ML 3QHZH 3RVXC 4G6KL 1U8HA 4P3CH 1DL7H 1KJVB 3IF1A 1CL7I 1C1EL 4DZBB 3A0OA 1TIUA 4JN2A 4ZS6C 3U79A 4OZGA 4F7EB 3U0WL 3QH3B 5F3HA 2X70A 2BNRD 5E6ID 4BZ1H 4NNPL 4U1KB 3WS3B 3NPSB 3GSOB 5B39B 4HLJA 4LDLB 2Z31A 3MV7D 3RX7A 3IXAB 2AERT 2VE6A 4YEEA 4ZUWB 3OZ9L 1EJ6A 3MMEB 3PHOA 3H3PH 4O2FA 1OAQH 2X7LA 3FN3A 43C9A 4ONGL 1DQTA 1A3LH 3IFLL 4DOHE 4KVNH 5GHWL 1M6OB 2IBBA 2NY5L 1QFPA 3B43A 1G9ML 4H20H 5F7MC 4OCYH 3LD8C 4PG2A 1JZ6A 3O6ML 4U7MA 3V52L 5GGQL 2F74B 4PJEB 2OMBA 1KN4L 1LO4H 1ZEAH 4R97B 3U36B 1FPTL 4F8TA 3P11L 4OI7A 5T1KB 2BRQA 5CJXC 2UYLA 1X3DA 3U9UA 2C4XA 3BOVA 3RKDD 1VESA 1II4E 1MCKA 2YPKA 5BRZD 3ILPB 3MRMB 2BRRL 4KHTL 1U95B 2CRMA 5I1HH 3ME0A 3QI9B 4H8WH 5HHQA 2V17H 3MLVH 3JV5A 4DVRL 1IQWL 1QRNE 1TLKA 2BSRA 1KXTB 3PWPE 4HCRH 2EZ0D 1UJTA 4W81A 3A6CL 2UZXB 1YEIH 5ADOH 1IM9A 1I7UB 3AM8C 2YPLB 2DIBA 2AXFA 5E7FA 3TT3H 3I85A 1G9NH 3ZL4H 4J1UA 5T3ZL 2VZ3A 2E27L 3ZYIA 1EJOH 3FAWA 4O58H 3HFMH 5AUMB 4OIIL 3UZEA 3Q5YA 1LE5A 3P4NB 4JCMA 4JB9H 5DDHB 1BQUA 3N85L 1U3HD 1E27A 3ULUL 2P7TA 4TRPH 1AXIB 3K0WA 2J8UB 2IAMC 4M1GL 4ZTOL 5DT1L 5F8RC 4QHLB 1KTRL 4HIXL 4XC1L 1UWGH 5FO9A 1IEAA 1JNNL 3TJHC 4JZJA 5LGHL 4X4XB 4L3EE 1H3TA 3WSQL 4KRMB 2YUVA 4LLUB 5IFJB 1V7NH 3GO1L 4JGMA 1CCZA 1NGZB 1T3FB 5GGSA 1I85C 2VL5B 4JO2L 5C0GA 3U48A 4KQ4L 5H35B 1FL6A 2CRZA 2G75B 5ICZB 3HMXL 3HPLB 5IROA 4X9HA 2Q1EA 3GMMA 3EO1B 4NN7B 4PJGF 4OM1H 2KKQA 4XNUL 3O6LH 5KW9L 4JFQB 4MQXD 4DUVA 5I1EL 2VLMD 1UKSA 4Z0XA 1S9YB 2VO5A 4X5LA 3VFPA 3HG1A 1UXSA 5CJQL 3RDTB 4NKIL 1JFQL 3CVIH 2D3VA 4GW1A 4O51B 3U9PH 4QO1A 5ITBH 4OGYH 1GYAA 1D9KD 1BEYH 5K59F 4BQ9A 1X44A 4MWFB 3EFFA 3HUJF 4RGMC 3GMOB 1MJUH 2F5BL 4QY8B 3B9KB 5E95B 4DGYL 1A9EA 2P44B 3FFCD 4ZAKD 5DO2C 1C16B 5BO1H 4OLEA 3QUZC 1NJ9A 1QBML 4M93B 1CFSA 5EOCH 4F37F 1JF1A 2OM5A 3OR7A 3SE4A 1N5YH 4OD3L 3RWDB 2RCSH 3EYQC 3ZT5A 5C9JA 2EDEA 2BVQA 2Q86A 5GRZA 1FFOB 4TOYH 1G7JB 3PDGA 1WTGT 4G8GE 1H5BA 1DQLL 4K3HA 5FK9B 1UB5B 4NFCA 2OTWA 2ADJB 3VXSB 3HA0A 2YKLH 1JCKA 3QIWD 4K7PH 2DWEB 4S1DC 3EYVA 4K9EL 4FTVA 3WE6B 3MUHL 2UY7A 5F1SA 3VG9B 5IKCB 2YWZA 3GIVA 4BSVA 1LK3L 3JWNC 5C0BA 2AGJL 2A9MH 1LK2B 3SHSA 2D03H 2WANA 3KYNA 4QRRB 3TCXA 3D18A 3QDMB 3TYFB 3QUMA 1CVSC 4YK4C 1MF2L 4OFYA 4PJ7A 4JLRA 3DIFA 3S3SA 5FDWB 2Z8SA 5FO7B 4KXZH 1ZVSB 5LGJA 3QUXC 4WENB 3EBAA 1OTTC 3V0WH 5FAAA 4NNXB 1J0KA 1A4JB 3BZEA 1S7QA 2ZUXA 4M7JL 1AFVH 3L3IA 1IC4H 1NCWL 4Y19A 1L9NA 4QNPF 3SGJA 4Q6YA 1A6TB 1JPTH 4KUZH 4YPGA 4ZD3L 4JM2A 5FECB 1ES0A 4HWEL 5DUPL 4PJEE 4UV4L 1GHFH 1VACB 3AS3A 4K3JL 1NCAL 1ZTXH 1DANU 1DQJB 1IT9L 1HILA 1HHKA 1R3IH 3G5YB 4I4WA 5ESVB 4PIRF 3Q6GL 1JK8B 1BFOB 1CR9L 1W72B 2WV3A 1D5ZB 1S8DA 5MEQB 2H45A 3UTSB 2JELH 1SVCP 1P7QD 5L2KB 1G7PA 4YE4H 3NIFE 3T0EC 3T2NL 4GRLB 3VXRE 3EOBA 1EHXA 1UENA 4J3VA 2B4CC 3BPLB 3TBYA 3WL9A 4KZEL 2FO1A 4UBDD 2YPLE 1FAIL 2Z31C 4KVCH 5SX4H 3LCYA 4MDIA 2QSQA 2A73B 3QIUB 2R0LL 2EDQA 2XTJC 4G3YL 4KJYB 4JPVH 3FHQA 1SYVB 3DHMA 3SKOB 3MRBA 4F58L 4O2CB 4XPHL 2RQ8A 2B20A 3WNKA 4UINH 1EGJL 4YXKH 4NQEB 4P2QB 1CFNB 4LLWA 4PRIB 3H7BA 1FC1A 2J8UE 1O0VA 5D2LB 4PG2C 2NYYD 1BIIB 3MUGB 1Q9KA 1XGTA 4L8BB 5GJTL 1YYLL 3MV01 3W2DH 4HUVA 1NGXA 1DCLA 2DI8A 4OF6A 2P42B 3FJTA 3FQUA 4KRPD 4QTIH 1VFBA 4GAGH 3A6OA 3MJGX 2R2BB 1GAFH 3EYFA 2B2XL 4Z9KB 4PJ9A 1U3YA 1I9RH 5IBTL 4YGAB 3EJYC 4NO0D 3D2UA 3DTXB 3QHZL 3U4AA 4P3CL 2AK4D 1DL7L 4IRSA 4QKXB 4YGVB 1NCCH 5FA4A 5TDOA 4Z8FH 3ZKMD 1N8ZB 1WZLA 3RAJH 2JCCA 1GOFA 2ORBH 4BZ1L 2ZUVA 5TQ2H 3T3ME 1E6JH 1OF2A 3GSNA 1I1AA 3VFMB 1TDQA 5I1IH 4LLQA 2NY3B 4LEXL 1WBXB 5F71A 2AV1B 3G6AB 1C5DA 4N1EA 1MH5B 2J6EH 3H3PL 4FXKB 5FGRA 4X99B 3GKWH 1NGWA 2VLRD 2YZ8A 5IEHA 1OAQL 4HULB 2EIEA 2XWTB 4JKKA 1A3LL 1AQDB 1HYRC 4XP4H 4KVNL 1UCTA 4YXHH 4H20L 2GUOA 5HVGB 4LHQB 3IFOB 3MGTB 4OCYL 3VWJA 1JYNA 3SO3C 1TQBC 3SCMB 4Z77A 5D7IB 5FV1L 3WUZA 4M3JA 1I7RA 1V3JA 1ZEAL 1LO4L 5K9JH 1RJLA 1AC0A 5C0AD 2A83A 4AY0A 5H2BA 5DJXB 5GJSH 5T1DH 2PTUA 3KYOA 3BGMA 5I1HL 3MCKA 3FB5A 5F1OB 4H8WL 3RWCA 1G6VK 3VH8B 5KN5A 4Y2OA 2V17L 3HNSH 3MLVL 4HCRL 4HWZA 5ICXA 3VXSE 1V3KA 1CU4H 5E8DH 3SY0B 1X5FA 2W9DH 3TN0B 3X13A 3MNVB 1YEIL 5ADOL 1QSFB 2F53D 5C6TH 2E9IA 5EWIH 4NYLB 3TT3L 2H2SC 3W5MA 1G9NL 3ZL4L 4WGVB 4Y4FC 4N68A 3U7WH 1EJOL 1ND0A 1XR9B 5L2JB 4O58L 2EDDA 2ZSVA 3HFML 1BOGA 5J13B 1PKQA 4N90D 2EDTA 2ED9A 4QRRE 2NY0D 4MD0A 3QDME 4KU1A 4JB9L 1NKOA 4TRPL 3IDGA 1KCUH 3AREB 1RJZA 2VXTH 4D0BB 5JW4N 4WU5A 3GI9H 2A6DB 4N0RA 3KAAA 5IMLB 1U8IA 5HYIA 4Y2DA 5CZVH 2CDEA 3HZKB 2VQ1B 1UWGL 2E9JA 4LPXA 3OKLA 1NC4D 3LKRB 4BUHA 3ARBB 4IRZH 4TUKH 1G1YA 4EI6B 2IPUG 4TNWK 2ADGB 4HFWA 3P40A 3VU2A 5HPMA 5B8CB 1HSAA 3D85B 1V7NL 2E7CA 2ILLA 3P4MB 3BKYH 3EDDA 5D6CB 3GRWH 1X7QB 3F5WA 1OTUC 5DGQA 3GSQA 4OLYH 3OB8A 5F7DB 3IU3A 2YN3A 5J11C 2NR6D 2DM2A 4HUXA 5SWZD 5CIPB 1I8LA 4OM1L 5GRWA 1MAKA 3O6LL 3O6FA 4ELMF 1M05A 3WLWC 4MS8D 3PWUB 4MCZA 1GOGA 3UTSE 3ES6A 5H94B 5HBBA 5L2KE 3CVIL 3U9PL 3BRFA 3F12B 5ITBL 4OGYL 3CVHH 1BEYL 1BVLA 1PYWB 1T4KB 4X7EC 3G5VB 2E7MA 3O8XD 1Z9SA 1CFQA 2AEPH 2WBJA 1MJUL 1MQ8A 5DHXB 3MYZA 3X17A 2C1OA 2AKRA 2DQHH 5TGBA 3U0TB 3LKOA 3FO2B 3GSXB 4X4ZA 5FV2A 1XFPA 5DJAA 3DWTA 1RY7B 3TYGH 1I3UA 5KG9A 5BO1L 4HKJB 3VRIA 1KTLA 5ELIA 3D39A 2P8LA 3ZKNC 5DRZA 5HDBF 5EOCL 3T4AA 4NNYA 4OCSH 5SWQA 4Y1AD 4CVWA 1N5YL 2FX7H 1KYOJ 2F8XC 3JUZA 2RCSL 4NQEE 3FKUS 1HN1A 5A3ID 4N1HB 3SGJC 1I8MB 1FFNA 1A9BA 4JDVA 5SX5K 3CPLA 4TOYL 4PRIE 4WUUD 4JM2C 4F9PA 3L3DA 4ZNCD 1NMCB 4ORGA 3GJEA 5D2LE 1HHIA 1R5WB 3EOTH 4KAQH 4O9HH 3BZFB 2YKLL 4X5XA 3RBGA 1Z0NA 4HC1H 1VB9A 5F9WC 2I60H 3IRPX 4K7PL 1A6UH 3REVA 5CSZA 4L4TB 4ETYA 5KSBE 4IOFD 4XCYA 2PXYA 5T1MB 5IBUB 4CVUA 4UU9B 4PR5B 1JUFB 2X4SA 3OBAA 2A9ML 1BPVA 4X6BB 5BOZG 1T66C 3OKDB 3DROB 2D03L 3O4OB 5DJ8B 4PS4H 4DGVH 5BV7H 3DPBA 4O2EB 1RHHA 3TBTA 3PV7A 2IANB 3SBWA 4O4YH 1A8JH 4OZFH 4I0PB 3QRFM 5C9KA 2RFXB 3CXHJ 3DMMB 4QOKD 5D71H 2P5EB 2R23B 3RTQA 4E5XA 1ZHLB 2KUTA 3LKNB 3V0WL 4CADA 4XBGB 4NQSA 1XGYH 1LP9F 1AFVL 2VDNH 1IC4L 3NFPB 3UTOA 4XWGH 3ZE0E 4HIEB 1JPTL 4KUZL 5F1NA 3VXOB 4YEFA 1TTFA 4HGKC 3LRHA 5C0DA 3C9NA 2JTDA 3QP3A 3RUGB 4ZUSB 3TO4B 4MJIA 1NCTA 5D7IE 4K8RH 1GHFL 1U8OB 5D7LD 5IR1B 3S7GA 3V5HA 1ZTXL 3S3JA 1EEYB 1SJHB 1R3IL 4Y88A 1W8NA 1YMMD 3GM8A 4K23H 5IVZB 1P7KA 4NPYB 1CFBA 2JELL 2IGFH 3WNPA 4UIKH 4YE4L 4IRSC 1DLHB 4GKOA 3FCTA 2CPCA 4GJTB 3WFDH 2Q3ZA 1KJ2H 3VDAA 4KI1A 4MNQA 4DWHA 3WO4B 1QSFE 1YJDC 4IEFB 3GBLA 4L8CA 4KVCL 1ZS8B 5FM8A 5TF0A 2HTLC 3SKMA 3QUKA 5EC2A 1M71A 2EE6A 4GRWH 3F7YB 4ZQKA 4S1QH 4UINL 1EDQA 4YXKL 3S5LB 1BOYA 2C3GA 2C9AA 4E42A 2QHRH 3D5OF 2BNUB 1TQCC 3UBXB 2BY1A 1BP3B 1NLDH 1ZT1B 3IDJA 3VWJC 2IPKA 1OGAD 4PJIA 5DMJB 5DJ6B 2R8SH 2R39A 3W2DL 1NGQH 2I07A 4MJ6A 1CG9A 4U1NB 4QTIL 4GAGL 4J7RA 4EQ2A 3EDJA 4RISH 4RWHA 1GAFL 3AU1A 3OXRB 1Q38A 2CKBA 2Y5TB 3BGAA 1I9RL 4WDIA 1CGSH 1D6EA 2R15A 2O5YH 1HH9B 4FQHA 4OQTH 3WBDA 1NCCL 4XRCA 2W0PA 4Z8FL 3D3VD 4Z7WB 3WUWB 1A4KB 2IJ0C 4PRDA 5E5MA 3FZUD 4ZYKB 4U6VH 1IVLA 3RAJL 3BP4B 2ORBL 4YO0A 4P59H 2YMXH 3ZHDA 5TQ2L 1E6JL 5I1IL 2X1XR 1JPFA 1K8DB 3Q5OA 1VGKA 3QDJD 4KJQD 5KSVA 2J6EL 4DK3A 4HJGA 2FEDC 3GKWL 4PJFB 2VERN 1NUDA 1BD2D 3JUYA 4M9PA 4WO4B 1R0AH 4XP4L 2BVTA 1IAIM 2P8PB 2JCCF 5B38B 3L3KA 1I3RA 4YXHL 4L9LB 5IM7A 2RHEA 4KKLD 2CLZB 1A6VH 1F90H 3RGVB 5K9JL 4PJAF 5DK2B 3DV4A 3DI3B 4LHUD 2XRAH 5BW7A 4X6CA 5FOBB 5EO9B 2KH2B 1M1SA 5GJSL 5T1DL 2JB6B 5I8EB 3F62A 5KZCB 1JGVH 3L9RB 3UPRB 4MX7A 4MJ2A 5BZWB 2F5AH 4UNVA 5CINH 3HNSL 5CHNB 4L8DB 3H9ZA 1CU4L 5E8DL 2W9DL 5IMMA 5GGUA 1NCUA 1I8LC 1J12A 1JTPA 2EE2A 5C6TL 5L6YH 1QSEB 2JIXB 5EWIL 1U8PA 2MMXA 2HVJB 4YDVB 5I1LA 1IGJA 3FT3B 3U7WL 1A2YA 1O5DT 2VZUA 4L1HA 1FL3B 5CBAB 3FFDA 2V7HA 2OBGA 2PO6A 1IGFH 3ARSA 4XNZB 3H3BC 3W11C 4MJ4A 2VZ1A 1NBZB 2IANE 2M8XA 1I3GH 1KCUL 5CEZE 2VXTL 4ZFZB 3GI9L 3SJVA 2O61B 4Z7QE 5CZVL 3KS0J 4POZD 2MHAA 5FGBC 4IRZL 4TUKL 1MWAB 4P9HH 4HHAB 3BJ91 3QDHA 4KK5D 4IIQA 5GGSY 1DVFD 3BKYL 4AEEA 3GRWL 3RUGE 4GLRI 1V5JA 3KLHC 3M17A 1GC1H 1F00I 1S5HA 3F8UB 5CWSB 4DQOH 4OLYL 3BEVA 1P84J 2LTQC 1T0MA 4WNQA 1ZOXA 5CP3H 3JV6A 4HMCA 1PVHA 3IJSB 4LBEB 2PXYC 3AB0B 3THMH 3K3QA 4JFDD 1YEKH 3NGBC 3PHQA 2NY2C 1WZ1H 4J4PD 1RU9H 4RCAA 3GGWB 5GRVL 1OPGH 2ZG3A 4N0CD 1SVZA 3VFNA 3KG5A 3CVHL 1GIGH 3IDIB 4LF3B 2J5LC 3GMPB 5CSGA 1DDHA 2AEPL 1P6FA 4N5ED 3VCLA 6CGTA 3WNLA 4X9BA 2K9UA 2DQHL 3MSPA 4KRLB 3MOBH 4MD5A 3ZDZF 4KKBC 3KYKH 4APQD 3TYGL 2BNQB 3LY6A 1T7VA 5IVNA 4NZJA 4OI8A 3VWKB 4TSAH 4LQFH 4OCSL 5CJ5A 2WINA 2FX7L 1HXYB 4OCMC 3P9MA 2CUHA 4XP9H 4YDLC 4RAUB 1KIPB 2YEZA 4ZOCA 5I71C 1IGTA 1VCAA 1T5WB 4UUJB 2P8MA 5EOCJ 5D1QA 1N5AA 4GSDH 3EOTL 3TT1H 3PQYD 1IC7H 4KAQL 4O9HL 3MV8D 1ERNA 3QULA 4HC1L 4WCYH 5FIEA 5TE7H 1ZA6B 2I60L 3BYYA 5DJ2B 2QADB 2R4RH 4I5BB 1A6UL 4OZIA 3V6FB 2Q7YA 1E6OH 4LCCC 1IAIH 1ZA3A 5LWYH 4UIMA 4UDUA 3WCYA 2NY1D 2DLIA 1U58B 3UYPA 3KLDA 4D9QD 4HDIB 4PS4L 4DGVL 5BV7L 5I1CH 4Z7WE 3HB3C 3X3GH 4BH8A 1RQ5A 2CO7B 1P5UA 4O4YL 3RGHA 4UT7H 4LIQE 2VTFA 5BMFH 1IAOA 3O3DB 5D71L 3OKMB 1LEIB 3FOMB 1DBBH 4JDZA 2XI9A 4ZXBD 1UWEH 4ZFFB 5C0CB 3EIFA 3U46A 3ZYOA 1E4WH 1NFDF 1XGYL 4QXTB 2FJHB 1JN6B 4PJFE 3LEYH 2A6IB 2VDNL 2YRLA 4XWGL 3VI3E 3BPOB 1IKNC 2X09A 4Y4HA 3BGFC 3DRQA 2HFFB 4G9DB 4WRLA 5C0IB 4JRXA 5HHMD 2BSSB 3PNWB 1KB9K 2X4QB 4K8RL 5C0EB 4H5SA 3IDXL 3U6RB 5DHVA 4G7VH 5J1AB 1DUZA 2J8OA 2R1YB 1J0JA 2IPTH 4MAYA 1V7MH 2GAZA 3GSRB 2X4RA 4K23L 3RY6A 5KOVC 5CJ8A 3PHSA 3PGCB 2IGFL 1G7IB 4MSWB 4BZYA 4WFED 4UIKL 1JZ5A 4PREB 5LAXA 3CAFA 2KQNA 2RAMA 1FNEA 3WFDL 1J5OH 3ULVF 1KJ2L 2ATPB 4BQBA 4JPIB 5MERA 4AENA 1KOAA 1QSEE 1PJ9A 4XI5D 4WUKH 1FZOB 4NKDB 4G43B 4LSVH 2Q76B 3DX8A 2AEWA 3QQ4A 4JFOB 3GSWA 3TVMA 3CFEB 2DBJA 4S1QL 3Q1SH 3Q5TA 5HYJA 4YHIA 3OKOA 3KNBB 3T77A 2QHRL 3O81A 4C56D 3X3FH 4HT1L 1NLDL 4UNTA 2ZKHH 4IHOB 4GW5A 4BELD 1PEZA 3BVNB 2R8SL 4PUBH 4YHMH 4I2XB 5GSVB 1NGQL 4IRJA 3FT4A 1AR1C 5AG9A 3VJ6B 4Y8DC 5SWSE 3BP5A 4RISL 1EVUA 2PYEA 5BW7C 4JAMB 3V7AE 3ARUA 4PG9B 5FYJD 1F4XH 4HS3B 5JOEA 3L5XH 4MA3A 4FMKA 5CLTA 1CGSL 5I9QC 1EZVX 1D5XB 3QISA 4XNXH 4JFYB 1YNTB 4IDJH 4F8QA 2O5YL 4Y16A 2H32A 5CP7A 3VFWB 4OQTL 4BFIA 3ARGC 4PRBB 1F3DH 3JBG7 3L3GA 4XMKH 3WFEH 1KIRB 4JHAH 1F97A 4U6VL 1NC2A 4U33A 1UEYA 1UB6B 3GSUB 5D93C 1BZ9B 4P59L 4NQDB 2YMXL 2HJLB 5EZLA 5ENWB 4LSDA 4JQXA 2WSKA 2JLLA 2GCYA 1WWCA 1W0WA 2UV3A 3C6LB 1OTSC 3WNOA 1NCNA 1XCQA 2HWZH 2LVCA 2HT2C 3BQUC 4I9WE 4DK6A 3O9WD 4G8IB 3CCHB 4G6FD 5ISZD 3GMNB 1GZPB 5EBMA 1R0AL 2XKNB 3WJLC 3KPSD 1QR4A 2HLFD 3VXMB 2EIZB 3TLRA 1MFDH 5DQJB 5K9QG 3WIHH 1A6VL 2AXGA 1F90L 1ETZA 1M7DB 2BNQE 5DF0A 1WISA 1BGXH 2F54A 4H1LA 3EYOA 4QRPA 3CNKA 2XRAL 4NUJA 4OV5B 1XF4A 4U6HA 5B3NA 3U0PA 1TVHA 3MNZB 3VGAC 1PKOA 3G6JB 1JGVL 1IQDA 2NW2B 4IIQC 1AGCA 4TVPE 2F5AL 3RY4A 5CINL 1HHJB 1JV5A 3DX6B 3I84A 1ZK9A 1L6XA 2DQIH 5FYJU 1P7HL 1TFHA 1U8HB 4JKPH 3EZ8A 2K1MA 1MCNA 3IF1B 3L7EA 4JN2B 3UROR 3SGDH 5L6YL 1OLLA 1QLFA 4R90H 4TUOA 2WIIA 2HVKA 2GKIA 2X70B 3MROA 2BNRA 5CJOH 5E6IA 1EERB 3MV9B 1UT9A 1U8MA 3QNZA 4QRUA 2Z31B 4LGPB 2IBZX 4JFED 5F9JA 2VE6B 2XTJB 3S9DB 1IGFL 3UAJD 3K74B 4P2OD 4WEMB 5GGVY 5HD8C 2CXKA 4GXVH 2IMNA 1FFQA 2FYYA 1I3GL 2X7LB 5A16B 1BWWA 43C9B 3T0BA 1KB5H 4XXCA 4CN1A 3U4BH 5ESAA 5KANG 1T80A 3BD5A 3IRZA 5F7NC 4D8PA 2W9LA 4NQTA 4PJCF 5DSCA 3V95A 1EMTH 5C0CE 2OI9B 4L4VD 4JVPA 4ORZC 4P9HL 3WDIA 4BJLA 4HEME 1IEBA 4JJ5B 3TCLA 4PJHF 2W0KA 1IAMA 2K7PA 3GM0A 3U9UB 1P4LB 4ZFOL 4GBXD 2QQNH 3WFHA 1E4XH 1GC1L 5BRZA 4DQOL 2VH5H 2CR3A 1JNJA 3HMXA 3BD3A 4YHKH 2YC1B 2BSRB 5F72S 4MNGA 2EO9A 3RWHA 5EUOA 1VPOH 4M7LT 5J3HC 3CZFA 3THML 1YEKL 3M1BA 1WZ1L 3BI9X 4CVXA 1RU9L 2VIRA 3VXUD 3J7HA 1BMGA 1OPGL 3MBEC 4J1UB 5T1LA 4JFFA 1GIGL 2L0DA 2XQYK 1YPZA 4U0RC 4WW2F 5HYEA 2FWOA 4KKCC 1CQKA 2P5WD 2X4TA 4LVOB 5C09D 1JGDA 2WWMC 3MOBL 4QNPE 4KK9D 4OD1H 5D7JB 2P7TB 3KYKL 2HP4A 5I74B 4XVUD 4N5UA 4PJ5A 4U7SA 4TSAL 1NBQA 4LQFL 4UDTA 2EEBA 2V5TA 1D5IH 5FO9B 4Z7OF 1IEAB 4KK8C 4XP9L 4JZJB 4MXVF 4Y4HC 4XWOC 4F33A 1CFVH 2E7LA 4JFHD 4GSDL 1P84K 1GGYA 5BS0B 3TT1L 1IC7L 4I2XE 4U1SA 3X11A 4FQCH 5GGSB 4W6WB 1IAKB 5TE7L 1ROWA 4KROD 2R4RL 5E8NB 3DRTA 1NL0H 4MAYC 1E6OL 3GMMB 1IAIL 4MLIA 4PP1C 3ZE1E 5LWYL 2V6HA 3LS5H 5IVXA 3DUUA 5KVFH 1A6WH 4Z0XB 2NY6D 1QFHA 4ODSH 3PL6C 3HG1B 4QHNA 1UXSB 4I0CC 5I1CL 2X1PA 3X3GL 5E2VH 4LLAA 4CL7A 3EDEA 2VN7A 4NQDE 5L8JB 4OZIF 4UT7L 3EFFB 1UM4H 4GAYA 5BMFL 3EYSH 3UDWA 1A9EB 1DBBL 1UWEL 1IM3A 3BPNB 4ZAKA 1E4WL 3JV0A 4GW4B 3LEYL 4JQIH 2NLJA 1NJ9B 1CFSB 4EUPH 3R06A 2DF3A 4HF5H 2XWBA 1JF1B 3OR7B 5JMOC 1A3RH 2ATKA 3VXME 1RK1A 5ERWA 5IG7A 5C9JB 2BVQB 4PTUA 4LGSB 2YD9A 2Q86B 1KG0A 5D1ZB 3ZDXE 4IRJC 1H5BB 4G7VL 1RIHH 1NQBA 2OTWB 4M61A 3KXFD 2HG5A 2IPTL 1V7ML 2FO4A 5J11B 8FABA 1N59B 2NY7H 2N56A 3G6JE 3C5SA 5HI4C 3X14A 3EYVB 4X9IA 1FIEA 4PFEA 2R1XA 3H9YA 1Y0LA 1EFXB 4FTVB 2LU3A 3TO2A 3C2SA 3GIVB 1B0GA 5C0BB 3I50H 1J5OL 4JGJA 1S3KH 1T1ZA 3KYNB 1F8TH 5EULV 3UTTB 4OCNC 1NUNB 3N0PB 3QUMB 4OZGE 1LD9B 4PJ7B 1VADB 4WUKL 1E4KA 3RVWD 4LSVL 3DIFB 3MV9E 4R4ND 2R0KH 1XCTA 2APWA 3CFCH 1FH5H 2EXWD 4YHNA 2N1KA 5I1KH 2XZZA 3DNKA 3WIIH 3Q1SL 1EGJA 2WUCH 2XTJE 3PWLA 5I76A 1QRND 2MCPH 3PWPD 2GFBB 2Z91A 1R6VA 2NY5C 4ODVH 4S1SH 3I6KA 3KR3H 3L3IB 3X3FL 4Y19B 1T7WA 2ZKHL 3CLFH 4XNMB 1HXMB 1NCDH 2A2QT 4NP4L 5DWUH 4PUBL 4YHML 1FZKA 1FV1A 3RA7H 1ES0B 4K07A 3ZT6A 5E4IA 1ODAA 1F4XL 5E8PA 1P5VA 3L5XL 5IB3A 2ZOKA 2V2WA 3KVQA 1HILB 1HHKB 4XNXL 4IDJL 5F8QC 4EI5C 3K1DA 4RFNC 1NSNH 3VDBA 1S8DB 4JG0H 4XMKL 3WFEL 4JHAL 1P7QA 1G7PB 1EX0A 4YFDB 1KEGH 4FABH 4XX1E 4Z5RA 4RBPK 2BDNH 2XG5A 4NRYA 4RMQA 4L3ED 3EOBB 3WL9B 4UV7H 5E6IC 1K4DA 5JPNA 1UWXH 4XBEH 5B3JF 2M26A 2HWZL 3ROOA 4MDIB 1LDSA 3ZTJG 4UTAH 3MFGB 4XHQA 3AMLA 1FN4B 5B22A 2CIKA 1S7SA 2X4PA 3MRBB 3LRSA 4P48A 1UC6A 1MFDL 3WIHL 1X5XA 4ACPA 1G7HB 4LLWB 3JTSA 2BVPA 3H7BB 2Q8BH 1BGXL 2H6PA 2DI7A 3VE0B 1Q9KB 2GQHA 5HVHC 3JTTB 1NGXB 2EDBA 2IALA 2MQ0A 3FQUB 3HE6D 1SBSH 4CBPA 2NXYD 3KPLA 3EYFB 3HAEH 4OBRA 2R56H 3MGOB 4L29B 3ESVF 5I16A 3RKDC 4PJ9B 3RBSA 1EXUA 5EBLA 1N0LA 4HCRA 2DQIL 1QUNA 2GK0A 4JKPL 5FA4B 5TDOB 4B7IA 4R90L 1FJ1A 4NT6A 2JCCB 1F2QA 2BC4A 5CJOL 1OD7A 3GSNB 1I1AB 4FZ8H 4UQ2A 4LLQB 1KJMA 3IJHA 4G8GD 1T1XA 4PJAB 3DGGB 2APFA 1R3JA 1C5DB 3HG1E 2X4NA 3L95A 1NGWB 4GXVL 1BQHG 4YNYA 2W38A 4KMTH 2VLRA 5HDLA 1ZGLB 1KB5L 4GG6A 3U4BL 4HPOH 3ZHKA 2XN9B 3RJDA 1U3HC 4OSUH 2GUOB 3VWJB 4ALAH 5TDPB 4XCEA 1EMTL 4Z77B 1SJEA 1I7RB 2OP4H 2VISB 1RJLB 1MCFA 1CDJA 1HE7A 3U7AA 4QGYA 2A83B 3WLBA 2X89D 1CZ8H 4L3CA 2Y06H 4NSKA 5H2BB 3ULUF 3WIFA 5C8JA 2FHFA 2QQNL 4IMKC 5DZNA 5LCVH 1E4XL 2XFXA 4ODUA 3KYOB 5EU4B 2VH5L 1I1FA 3GJFB 2CRYA 2WZPD 4YHKL 3MCKB 3FB5B 3L3OA 3RWCB 2ADIA 2P45B 1F42A 4PJXA 4LFHD 1T6WA 5INDB 1EBPA 2A74A 4YC2B 4OLVH 5IESH 1F3JA 1VPOL 3WEXA 5K33A 5D9SA 1CGXA 1I4FA 4XC3H 4YFEA 5MEPA 1NMAH 1JWUA 4GQPH 3T0VA 4MQXC 4NOFA 4FTVE 3MRNB 4M7LH 1WUNT 5C0BE 2ZP0T 3U30C 2ZSVB 1PKQB 4JR9H 1JWSA 4K3DH 4MD0B 1D9KC 5T1KD 5C2UB 2IH3A 4KTEH 4OD1L 3SDDB 3SO5A 1CF8H 4PJ7E 3IDGB 5DMKA 1RJZB 3UDWC 4FQ2H 4WU5B 2GTWB 5D5MA 3BUYA 2RBLA 4ZAKC 4Y2DB 4Y5XA 1D5IL 3QI9D 1XZ0A 3V2AR 1MJ8H 4KJPD 3MRDA 3OKLB 3SDAA 1HHHA 3CFBA 1YPZF 2BK8A 3T0WA 1CFVL 5HPMB 4Y19E 2X9YA 5D96C 3OGOE 1HSAB 3S96B 4PBWD 1SQ2N 1MCEA 2YPLD 4WJ5B 2E7HA 1MFBH 3QBTB 4FQCL 3F5WB 4QHKJ 3GSQB 3ESUF 3TA3B 2FECI 5JIIA 1J1OH 1GRWA 1NL0L 4PY8J 2VR4A 2X1OA 4Q2ZA 4HUXB 4DJMA 3O6FB 3QA3A 3LS5L 5BQ7A 4IM8A 1REIA 1M05B 4C4KT 1A6WL 5KVFL 4H25A 3HNTH 4ODSL 5I17A 5JORA 5HDOA 3QZWA 4YBLC 2PR4H 4X98A 2CGRH 5E2VL 4AIOA 5IFAH 1BVLB 4LL9A 2Z4QA 1UM4L 3FRPG 3QAZB 1CFQB 4BQCA 2WBJB 2DQFA 3EYSL 4PLJD 2C1OB 2AKRB 5TGBB 1CGUA 3LKOB 2BSTA 2WP3T 4EKXA 4KUCF 5GRUH 1OW0A 3UJTH 4CVZA 5KG9B 4JQIL 1KTLB 2P8LB 4N8CH 3D0VB 4HF5L 3T4AB 2NNAA 4R0LA 3GMRA 5SWQB 3MJ6A 1S9XA 2VQUA 4Y1AA 1A3RL 4LSSH 3TF7C 3B5HA 4CU8A 4OZ4A 3SKUD 1FFNB 1TENA 1A9BB 4JDVB 1JHKH 3MX0A 3BDBA 4KMLB 1YJDH 4WUUA 3QFJA 3CLEH 4Q9CA 3GJEB 4ZNEA 3I6GA 2C3XA 1RIHL 3IAPA 5CEYA 4G42A 1FO0A 3RDTD 4X5XB 4PJBF 2HAZA 1RPQA 4GKSA 5FO8A 2NY7L 1QRKA 3REVB 3MYJA 3AFLA 4Z7UF 5CSZB 3VGFA 1CGVA 3N1GC 3K2UH 1J1PH 2BERA 4K7FA 4Q6IA 4FHBD 2X4SB 2P48B 2AQ3A 1R3LB 3I50L 4JDTH 1S3KL 3QCVH 1BLNA 1F8TL 1RHHB 3TBTB 4C83B 3I3DA 2JCCE 1MQKH 1NANI 1FP5A 4CMMA 2R0KL 4UBDC 1FNSH 4QTHA 3TNMA 3CFCL 5DUBA 1FH5L 3H9HA 3RTQB 3D25A 3NN8B 5I1KL 3WIIL 2WUCL 1A1NA 2MCPL 4CADB 4NQSB 3VXSD 3NCMA 5F1IB 4ODVL 4S1SL 3KR3L 2BHZA 3CLFL 4O02H 3C60A 5F1NB 1NCDL 3O4LB 5DWUL 3C9NB 4GOSA 1B9ZA 1WK0A 3RA7L 3JV4B 2NYYC 3SE3A 4MJIB 3MJ8A 1OAKH 2G9HA 4Q74A 1AQKH 4XGZA 4KRPC 3V5HB 4P57A 1HZHH 4QRRD 2E6QA 3QDMD 4ZG1A 1F4AA 1D5BB 3R4DA 3LQZA 1NSNL 1MCPH 4OCXH 1P7KB 1VEPA 3QIBB 3OF6D 4FQJH 4JG0L 4BSJA 2HKHH 2Q7NA 4JHZA 3G5XA 4HUNB 4A6YH 1KEGL 1ZE3C 4FABL 3V6BR 3FCTB 2BDNL 4TUJA 2VZSA 4F2MA 4MNQB 1I7TA 1TNNA 4K3EH 1F4HA 4POUB 3ZKMC 5SV4A 4UV7L 3E3QE 4GAFB 4N0FB 1VFMA 4XBEL 5C86A 1OARH 1WAAF 2VDKH 4UTAL 1INQA 1LILA 1QBLH 1A02N 5DYOA 3SKMB 1WFUA 3QUKB 4E9LA 5MEOB 2EDLA 5EC2B 1M71B 1PKQE 4ZQKB 2CH8A 3TWCH 4EOWH 1QO3A 1WC7A 1WICA 4E42B 2Q8BL 1WTLA 3IDJB 4GKNB 4PJIB 2W65A 4UZGA 4N9GA 3UTSD 2D31A 4XCNB 2PW2A 4MJ6B 2I07B 2VNCA 5L2KD 1RUAH 1SBSL 4LLVA 3B2VH 2Q6WA 3FQTB 4GRLD 3AU1B 2R56L 3W0WB 2CKBB 1HWGB 1DQQA 5HGDA 5GGTH 5GS1A 4HIJA 4YWGH 5IWLC 1D6EB 1UYWH 2YA1A 4DEPC 5I66A 4Y5VC 4LAQH 4TSBH 1WWAX 3E2HB 4FQHB 1OCWH 5DJ0A 5IB5A 3CFKA 3QIUD 3CX5K 5D8JH 4Q9BA 3D3VA 1KLFA 4PRDB 5E5MB 5FM5O 5HYSA 1TTUA 3B9DA 4NQED 2DM4A 3C6SA 1KFAH 2B1AH 4P2QD 4PRID 3RNQA 4FZ8L 1JPFB 4LQ1A 2F15A 1AXSA 1VGKB 4CN6A 5KSVB 1P69B 3WHXB 1JZ8A 4HJGB 2DD8H 4KMTL 4WTWA 5MENA 1UJ3C 1BD2A 4HPOL 3TFKD 2GSIA 3L3KB 3MLRH 3GMLB 4OSUL 5IM7B 4ALAL 4LFHG 5JOPE 4MVBD 2CQVA 3NIGE 1OP5H 3KJ4B 2OP4L 2X9XA 3Q48A 1J88A 4WW1A 1XH3B 3N1PC 3DV4B 3D39E 2D7OA 1CZ8L 1HNGA 2Y06L 4LHUA 4WI7A 3MLTB 2KZWA 5EOTA 3TC9A 3DXAA 3GRWA 5LCVL 4JJHA 1AIFA 4H0HB 2JK5A 5I1DA 4MX7B 4R7DB 1KLGA 1KT2A 1KTKE 2EDWA 2NY3D 3K4AA 2YBRA 4GXUM 5HI3D 5L88H 5FKPB 2L7UA 3RVTD 2C5DC 4OLVL 5IESL 2ZUQB 3V8CA 2Z35A 4NJ9H 5IMMB 5GGUB 2NR6C 1FVEA 2AI0H 4ISVB 4U3XA 4XC3L 5BVJA 1NMAL 1JHLH 4KGJA 2YWYA 1U8PB 2CLRA 5I1LB 1IGJB 4M7LL 3BKJH 4MZ3A 4PJCB 1JJUA 3IYLW 2V5SA 4MS8C 5I1GH 1A2YB 1JE6A 3SCMD 4LRNH 4LNVA 2XNAA 1PD6A 3STZB 1D5MA 25C8H 3FFDB 3RFZC 4JR9L 1A6AA 1U3JA 5IJVA 2PO6B 4K3DL 4M1DH 3CDFA 3IVKA 1MREH 5D7SH 4KTEL 4PJHB 5E56A 3O8XC 1CF8L 1ZAGA 1J8HB 2V9TA 3FQNA 3KPRB 4FQ2L 3NTCL 3SJVB 4PRHB 1UZ6E 3RX5A 4XH2A 3NCBB 4HW6A 2C7UA 9CGTA 2A77H 1MJ8L 2CIIA 2J7LA 3E1F1 2MHAB 4FFVD 4LDOB 4R0LC 4GAJH 3STLA 4DKEH 2VB5A 3TN0D 2VZTA 4OT1H 3VGAB 2D4FA 5I75C 5AWNH 5A3IC 1QSFD 3LPGA 5CSBA 5FUCC 4IIQB 4F7CA 4NN5C 1HDMA 1MFBL 2MQCA 3UO1H 4HC1A 3M17B 2LU4A 4MJIE 1J1OL 3NAAH 5DEFA 3HCVA 3BEVB 4FN0A 3KPPA 5F96H 2DQJH 1S7UA 4WNQB 3SQBA 5IFHH 3R0MA 1G6RH 1RI8A 5GRXG 1PX4A 1VA9A 4IOFC 4Q6IC 3HNTL 3ARED 3PHQB 1EO7A 2PR4L 2Q8AH 2CGRL 5IFAL 4OZFA 5FYKH 3ARBD 3WHE0 3DUSA 1DDHB 2EDKA 4MNQE 1BQLH 3VCLB 4I48B 4AEHH 1FYHB 4MD5B 4D9RE 5M94B 3HTLX 3D85D 1CK0H 1E4JA 4Z7NE 5GRUL 3AS1A 3UJTL 1WBYA 4JRYA 4ONFH 4APQA 3AS2A 5J1SC 1DBJH 1MCWM 4N8CL 2WIMA 5K9QI 3GBMH 2WINB 4LSSL 2XY2A 5EDXA 4M8QB 3P9MB 4ODBD 5JA9A 3GBNH 1DZBA 2YEZB 2ZCHH 1JHKL 4X7TA 1YJDL 4LEOA 2P8MB 3O3BA 3CLEL 3CX2A 5D1QB 1N5AB 4PJIE 4GLRH 3SE3C 3NIFF 3PQYA 3QULB 3OKNA 4A2MA 5IW1A 3CSBA 1K5NA 2QV2A 3RIAK 4OZIB 1UGNA 1X5GA 2Q7YB 3W0WE 5HGAA 3K2UL 1J1PL 4D2NA 1ZA3B 2R0ZH 4QXGH 4UIMB 4DN4H 1A7BA 4JDTL 4ZDHA 2GI7A 1KJ2A 5ESQA 2L4OA 3QCVL 3BT2H 1OL0A 5TE6L 1S9VB 3GB7A 3BZ4A 3NIDE 4BH8B 4WWKD 2I9TA 1TVBB 1MQKL 3T2PA 1DE4B 4PB9H 1F45A 2YD5A 2J8UF 1FNSL 1B0WA 4KI5E 1IAOB 4I8DA 2LVEA 1LEGA 4YDJA 5JHDB 3U46B 1JI2A 1UZ8A 4MMXC 5E4EC 3T0XA 4O02L 4Y4HB 4L4TD 3DRQB 2XICA 4KWUA 3SDCB 5EPMA 2XWJA 4PJ8A 4XCFH 4HK3J 4JRXB 2Z92B 2YSSB 3ARDA 1A0QH 4DUWA 1OAKL 1AQKL 4H5SB 3TJEH 5DHVB 3BN9D 5IB4A 2HRPH 4NC1E 1HZHL 4X6CE 5ETUA 5JNYA 2IAND 5C6WH 3T3MF 2GAZB 2HJKB 3B3IA 2X4RB 1MCPL 3KPTA 5GS1C 5CEZD 4OCXL 3T1FA 4I0PD 1G7QB 4ZUVA 4FQJL 3H0TA 2BZDA 3QDGA 1U3ZA 2HKHL 3DOSA 2P5ED 3UZVB 4A6YL 1KIQA 5LAXB 4WWID 1Q0XH 4KHXH 1FNEB 3G9VA 4HKXB 1KLUA 4K3EL 4K3GA 5ANMB 5KVMC 1GPOH 3FZUC 5SX5H 1IGIH 2ARJQ 3GSVA 5MERB 4IDLA 3GEWB 4Z7VA 3HRPA 3VXPA 1HYSD 1JWMB 1OARL 2VDKL 4WTZA 2V9QA 1QBLL 1Z5LA 2IG2H 3TO4D 1EIBA 3DX8B 5I1JH 2OTPA 1RZKH 4KJQC 3GSWB 4Y5YB 1AHWC 3WN5A 3TVMB 1OGTA 1JZ2A 4UQ3B 1AGFB 3CC5A 4ODXA 3TWCL 3SE8H 4D9LH 3W81A 3OKOB 4P5TA 4EOWL 3BX7C 4DKAA 6FABH 4HJ0D 1MVUA 4PJHE 4U1GB 1P2CB 4C56A 1Q94A 5A2FA 3KPRE 4GW5B 3SJVE 3SDXA 1S7XA 2VWEE 4IRJB 1RUAL 1CLOH 3FT4B 2HYMA 3B2VL 3BP5B 4FQXA 1G0XA 4TTDD 3DX9A 1PZ5A 1B0RA 3MJ7B 4HKBA 4MA3B 5GGTL 4YWGL 3AY4C 1UYWL 1YQVH 4LAQL 3N1MC 4TSBL 4Y16B 3WD5H 2H32B 5CP7B 4I3GA 2EEDA 1OCWL 2J88H 3QPQD 3L3GB 5D8JL 1WEJH 2CDFA 2BSED 1QPPA 1NC2B 1EHNA 2HH0H 1VEOA 4WW2C 5EZLB 1KFAL 1J87A 2B1AL 4CAGA 3P9LB 1RVFH 2GCYB 1IE5A 1W0WB 1UKTA 3OJVC 3C5ZB 1CFTA 4QHUA 5IMOA 1XCQB 2JF1A 4JANB 2HTKC 1V3MA 2DD8L 1WBZA 2R9HD 3MRIA 4X83A 5ISZA 3TIDA 3MFFA 4NO2A 3W39A 1OWWA 1MVFA 3UZQA 5EUKA 3TNNA 2AXGB 4RFEB 2VDQH 5DC4B 3MRPA 2F54B 5IQ7H 1X6NA 4H1LB 2XV6B 2CUMA 4P4KA 3EYOB 4QRPB 4I18A 4POZC 2B8OT 4NUJB 3NA4A 4U6HB 3M8OH 5C08A 4ZFOA 3U0PB 1TVHB 2KDGA 1X5KA 2DM7A 4BA8A 3OKEA 1OAYH 1IQDB 3JXAA 4KK5C 3ALPA 1DVFC 3LHPH 5T3XE 5L88L 4E41A 1BFVH 3KGRA 5FHBH 5CP3A 4LHJB 4UI2A 3HPJA 3LSOA 2DMCA 3O41B 4NJ9L 3P73A 5KSAA 1RAMA 3MC0A 2AI0L 4WO4D 4MD4B 1JHLL 4OZIE 1QLFB 5D2NA 3STBA 2H2PD 2WIIB 1DANT 2HVKB 3TGXA 3EW3B 3VH8G 3BKJL 5I1GL 1U8MB 4NKMA 5FYKD 5DVKA 1Y18A 4EVNB 5BV7C 2GJ6A 4LRNL 4QRUB 4J4PC 2EKSB 1S7WB 1FG2B 3RGVD 25C8L 4U3CA 3QEUA 5J89A 4MCYA 4N0CC 4NQVA 3SE9H 3RZCA 4M1DL 4U49A 1KF9B 1MREL 5D7SL 2FYYB 5IP4A 3NOIA 3CFDA 2CXGA 3RU8H 3PABA 5D2LF 5KZCD 3IFPA 3IJYA 4D8PB 3BHBA 5HPOA 2A77L 4APQC 5DFTA 4CGTA 1MFAH 3L5IA 4HK0A 2VRAA 5JHDE 4Y4KB 1YC8A 5TH2A 4GAJL 4L4VA 4DKEL 1IEBB 4JO4H 5JHLH 5KSBF 3TCLB 4OT1L 4X6DF 5AWNL 2HFEA 2HT3D 2IH1A 1K4CB 4BFEA 1XF2B 1FLTX 1QSED 1JGUH 2JIXD 3B4NA 2C3HA 1Q72H 1BQHA 4JRWA 3WFHB 3UO1L 4FXLA 4JRXE 5CZXD 4K7PY 3NAAL 1T5XA 5F96L 3HN3A 4LK4A 2DQJL 2WM0A 3CUPA 4MMZC 2WBWB 4HSQA 5IFHL 4OZHA 1G6RL 4MNGB 1P1ZA 3RWHB 5EUOB 2VC2H 2V7NA 1XR8A 4EN3B 2N7AA 1NBVH 3HE7A 2J2ZA 3M1BB 3OAZK 4CVXB 5JO5A 2Q8AL 2B7DT 4NWUH 4M3KB 5T1LB 3O3EA 1Z0MA 4JFFB 5FYKL 5EU5A 3RWFA 2DM3A 2NY4B 1YPZB 3RI5F 4Q58C 3ZE0F 1BQLL 3LEXB 1T2JA 35C8H 2DI9A 2X4TB 5FYKU 4AEHL 2LU7A 2DWDA 1Y6MR 1JGDB 1RHFA 2P5WA 3Q3GB 4LKXA 5C09A 2XA8H 1CK0L 4B53A 4XMPH 4ONFL 3LRGA 4PJ5B 1DBJL 4POYA 5KAQG 4KH2A 1T7XA 4ZXBC 4LNRA 5GGRA 3GBML 4F7MA 1EV2E 3FHAA 2XY1A 2VLKB 5HYJE 3GBNL 4GUPB 4GH7B 1Q9LA 2ZCHL 3SKNA 2FB4H 4ZPVA 5KTEH 4HIHA 1U8NA 3N1QC 3RL1A 4U1SB 5I1AA 3IETA 3X11B 1KJ3H 3O45A 4EDXA 5CILH 3DRTB 4PGDB 3DVNA 1B4RA 4EXPX 4PV8A 4L4JA 4ZUTA 2AJSH 1MEXH 4NZUH 2R0ZL 1AD0A 4QXGL 1AO7B 4DN4L 5IVXB 3DUUB 4MA8H 2BNQD 2XOTA 3BT2L 1JF6A 2P4AB 4U1IB 2NX5D 3BXNB 3VWKD 1T2XA 3V8OA 4QHNB 3VFGH 3IXTA 3FOLA 1HHGA 5IBUG 1T03H 3FQRA 3MO1A 4RAVB 4Z78A 4PB9L 1IFHH 4PY8I 4GAYB 1MI5A 1T83C 2G2RB 4NN6C 4XI5C 3QXDA 4TVPD 5F9AC 2AABH 3M07A 2WWKO 1T1YA 1IM3B 5AZEH 1TZHA 3WN5C 3VA6A 3V4UH 3ZO0A 2NLJB 4ERSH 3PWJB 5TJWK 2QADD 2FL5B 2XWBB 2PTTB 5E6YA 4XPTH 2GEEA 4X6FB 2ATKB 4V1DA 4NHUA 1NGYA 5KS9A 1RK1B 1YUHB 4XCFL 3ULSA 3TH2T 4PTUB 1A0QL 3VXNB 1KG0B 4AM0B 5HY9A 4OFKA 2F54E 3S4SA 3TJEL 4QRPE 2HRPL 4M61B 3KXFA 5FA3A 4XT1C 3GMQA 8FABB 5L0QC 2IWGA 2X6MA 3X14B 2EYTB 3C5SB 4QWWD 3ZDYF 4PRPB 4H26A 1UADC 3EJZD 4FFYH 1QBAA 3TO2B 1X4XA 1Q0XL 5GXBB 1B0GB 1FGNH 4KHXL 4QXWA 5KAQF 3DHJA 4HJJH 2Q87A 3VGEA 5F88A 3TZVA 1GPOL 5CJXA 2FCBA 1T1ZB 4GXUN 1IGIL 1U36A 4X7DC 1BVKA 5MI0B 5ALBH 1U91A 5AD0A 4NKOB 1INDH 4JVWA 4LCUA 4P3DA 2BNRE 2IG2L 5I1JL 1RZKL 1N6UA 4YHNB 1HQ4A 3IKCA 3O9WC 1YN7A 3SE8L 3ARFB 3PWLB 4D9LL 2UVFA 5I76B 1X9QA 3T3PE 3WIHA 6FABL 4MA1B 2Z91B 4Y89A 3DVIA 3ULUE 4HD9A 2HLFC 3ZMRA 4B7LA 1MLCA 4R9HA 1T04A 2X40A 5A2JH 1FZJB 3BH9B 3FN0H 3OR6A 2Z0BA 1CLOL 5FFLA 2F58H 5HHOA 3S5LG 4I18C 1D7FA 1VGEH 4HS8H 4YR6B 4RQQA 1N2RA 1CTNA 1MLBA 5D7KE 3UBXG 5E8PB 4FQQA 1MFCH 1KIUA 2ZOKB 4OIAA 3MRJA 2V2WB 3ARQA 4P5MB 3Q6FA 2OJEA 4MHHG 1YQVL 4NRZA 4CU6A 2JB5H 3WD5L 3V5KB 2J88L 4M02A 3QG6A 3MRCB 2YUXA 4OLXH 4PJDA 1WEJL 3HC0A 4HX1A 1KCVH 4LVNC 3ARWA 2HH0L 2KBGA 4DKDC 3PWNA 5M7QA 5JXED 4TNVK 4MNGE 4NRYB 2ESVD 5EUOE 3TEUA 1I3VA 1RVFL 3QQ3A 4Z7QF 1GJIA 3VGHA 1K4DB 5JPNB 1UWXK 2YD2A 4OM0H 1I85A 4FNLH 3ROOB 1MPAH 1KB5A 2PNDA 4JFFE 3QEQA 1YPZE 1S7SB 4WV1C 3LRSB 4ZTPH 3KHOA 1OAZH 1YY8A 2Y4SA 3BAEH 3R8BB 3P4OA 3RUGF 4JY5H 2VDQL 3JWDC 2HA1A 3JTSB 4U1MA 1ZGLM 4RFOH 2H6PB 3EO9H 1CGYA 4PJ5E 5IQ7L 2VAAA 1RUQH 2W59A 1U8KA 3U2SB 2MTPA 5JW4M 3UX9B 3M8OL 5B38G 2IALB 2XKSA 4R2GB 3BP7A 5D1XB 4KRPB 3RWEA 2VLKE 2FDBP 3S34H 4NQDD 4KKNA 1OAYL 5I16B 1DN0A 4M48H 5MP6H 4GBXC 3LHPL 3U83A 5EZOH 1EXUB 1BFVL 5EBLB 5FHBL 3C6LD 1JHTA 3OX8A 4OFDA 2APTA 3WS6C 2GK0B 5DZLA 1BM3H 5IEKA 1OWRM 1C7TA 1A3QA 4NIKB 4DVBA 1FVDA 5JW4Q 4KDVA 5HVFB 1FJ1B 1RUMH 4NT6B 1TJHH 4QCIA 3VXMD 2VZVA 2R29H 2BC4B 1CXHA 2DTSA 2VKWA 3QHFH 4CW1A 5IVXE 5ECJE 2R69H 4UQ2B 5K9KA 1KJMB 3IJHB 2VLME 1T1XB 4YBHA 3SE9L 1I7ZA 1R3JB 2YPVH 5FKAA 1WZKA 1MCWW 2X4NB 3L95B 2ZSWB 4NOBA 4YNYB 1R5VA 5DTFB 1MHHA 1NEZA 1PY4A 3C87A 3VFSA 3RU8L 1T21B 4L8SA 4CJ0A 3F6LA 3DBXA 5DHYB 2UY6A 5IF0A 3MUZ1 2QL1A 1S7TA 2F8VA 4XVUC 3G04A 5DJDA 1MFAL 4HFUH 4NO3A 4NFBA 2BY2A 1B6DA 4JO4L 4PGCA 5JHLL 3REWA 2X89A 5CGYD 1KJVA 3PIQA 3E0GA 3ZT7A 4NSKB 2PKDA 3MRFA 1Z3GH 1JGUL 3WIFB 3PUCA 2HLAA 5J4MA 1Q72L 4ODUB 3QH3A 3MV9D 4U1KA 1NCBH 3V7AG 2ITCB 3GSOA 5B39A 3QUXA 5J6HA 2Z31D 3X12A 3L3OB 3OWEA 1CXFA 1IKFH 3LEVH 1T20A 2XTJD 4X8JA 4ZUWA 5IIEA 2A74B 3MMEA 1F3JB 2VC2L 3WEXB 5D9SB 5B4MD 1NBVL 4BM7A 1I4FB 2AVGA 1T1WA 5MEPB 1JWUB 1MY7A 4G6MH 4NWUL 1TMCB 2NY6C 4BK5A 4PJFF 3WYRA 1EAJA 2OJZH 5LG1A 3VI3F 2F74A 3NCFB 7CGTA 2CMRH 2XT1B 1U8QA 35C8L 1JWSB 3SGKA 2FJGA 4JHWH 5EC1A 2IH3B 2XA8L 2VL4A 4HMEA 4P99A 1F58H 4XMPL 1BQSA 4XPAH 3DX7A 4NQUA 5C0RH 3L5WA 4UAOC 4EUPA 3EJYD 3ILPA 3T0EA 1YEDA 2EDRA 2FLBT 3IDMB 4Y5XB 5F7LB 1NBYB 2YUZA 1XZ0B 3QI9A 3C09B 2HN7A 3MRDB 3SDAB 1HHHB 3CFBB 4J3SA 1E28A 4BUGA 4AIXA 2FB4L 3K4ZA 4CN4A 5KTEL 3ARZA 4AEIH 5IV2A 1FSKB 4LEXH 2QBWA 5GRJH 1CDIA 1KJ3L 3VMPA 1DLFH 5CILL 3RIFF 1XF5A 1LMKA 1OT1A 5BXFA 4X4MA 4YFLI 3VW3H 2AJSL 1AKJA 4KFZC 1MEXL 4AYFA 4NZUL 5DEGB 4WHCA 3P4NA 3QA3B 3QUYA 5BQ7B 5D7JD 3ZLQC 5DDHA 4MA8L 1GVIA 4H25B 1WAAE 5DFVD 5I17B 5JORB 1LWRA 3QZWB 3VFGL 1Q9WA 4LCWA 3MACH 5HTSA 3TZVC 4QHLA 2D7PA 3U1SH 1NPUA 1T03L 4MGXA 4OJFH 1IFHL 4BQ8A 4PD4K 2C1PB 1H3VA 2ZZUT 2DQFB 2AABL 1QEWA 1CWVA 4HXAH 2B5IB 3EUUA 3RVWC 4JQVC 2BSTB 4R4NC 5AZEL 5IFJA 1HQRA 5BS0D 5T5NG 4CVZB 3V4UL 3VXRB 4ERSL 3OV6A 3BWAA 2B39A 2NNAB 3GMRB 2G75A 1S9XB 4XPTL 5E2TH 3K8LA 3VXQA 4WEBH 1NFKA 4P23D 4OZ4B 4BK4A 2AJUH 4MA7H 4LP5A 1JRHH 3QFJB 3BDXA 2NZIA 1R5IA 1N3NA 1S9YA 2ZG2A 3I6GB 4MQ7B 5CEYB 3H6JA 3HG1D 5EIIB 3RDTA 1TPXB 1M7IA 4GKSB 2Y23A 1C5BH 2P49B 4FFWD 3KS0H 1OAXL 3MYJB 5INCA 1CE1H 5IQ9A 7FABH 4K7FB 4QY8A 3B83A 4FFYL 1TZIA 1Z9OA 1FGNL 3FB6A 1H3GA 4KXZI 2WW8A 4HJJL 1FYTA 3EZJB 4TSCH 1KCLA 1BLNB 1C16A 5CBEA 5ALBL 1DUYA 3RHWF 1INDL 2O5ZH 2OL3H 5HSFA 4CMMB 2ITDA 4ZOBA 1FG9C 4QTHB 5KJRH 3TNMB 5ABDE 5DUBB 3WDJA 3H9HB 3D25B 5D1ZD 5GS2D 1FBIH 4RGNB 1A1NB 2DIJA 2J4WH 4I13B 2OX5A 4HBCH 2NCMA 2RIKA 4GG6E 4KPHH 3C60B 2AXHA 3KPMB 1MRDH 3FN0L 3MR9A 5E2WH 4Y4FA 4X5WA 1EFXD 4FTVD 5CGTA 3V79C 1NDMB 1TJGH 2F58L 3WE6A 3GI8H 4NBXB 4DFHA 1VGEL 3HAEA 4HS8L 5C0BD 4XGZB 4LLYA 3QG7H 2EYSA 1MFCL 3HE6C 4UMGA 3UTTD 2NXYC 3KHQA 5SV3A 3TYFA 3TP4A 3UP1A 2JB5L 2VABB 3OTTA 2ADFH 3LQZB 4OF0A 4OLXL 4OI9A 5SX4I 5ID0A 4MXQC 1KCVL 1J0IA 1DBAH 2VSCA 2DLFH 3G5XB 5FOJA 3TV3H 5T5NF 4PJXE 2D9CA 1K3IA 5DVMA 1RV6X 1T0PB 4F2MB 1I7TB 2Q3AA 2IF7A 4B0MM 4Y19D 4OM0L 2W9EH 1RJYB 4FNLL 5I73B 2UUDK 4DKFH 3MOAH 5BOPA 3MOQA 1XIWD 5DYOB 1MPAL 5FECA 3FTGA 5IK3A 1CDUA 4N1CA 4ZTPL 3LKSA 1IGYA 3MLZH 1OAZL 5IB1A 5MHSE 1NH6A 3BAEL 1ORSA 1WC7B 4HGMA 4JCLA 4L8SC 4JY5L 1DQJA 4ZSOA 1JNLH 1UM5H 2PYFB 5ESVA 4RFOL 3EO9L 1W72A 2W65B 1JZ4A 1RUQL 4G80A 4N9GB 5D5ME 2FATH 3E6FB 5DD6A 4S2SB 1PDKA 4LLVB 4PTTB 1SHMA 2Q6WB 3WKMH 3S34L 4GRLA 5CLWA 4IS6A 5DRNA 4M48L 5HHPA 5MP6L 1DQQB 3MLYH 4K71B 3BIAX 2C3VA 4HIJB 1XGRA 1JTTA 5EZOL 1BBJA 1F11A 3NPSC 4N0YH 1A7PH 3JWOC 2QQLH 1BM3L 5DJ0B 5IB5B 3WFBH 3CFKB 3CFJA 4KZDH 1I8IB 5JW3H 2H9GA 1A14H 3IS1X 5HYSB 3FT2A 2YD4A 1RUML 1EEZB 1TJHL 2R29L 2CDGA 1BVZA 4YH6A 5JIHA 2AJYH 3C6SB 3QHFL 4P2QA 4XHJC 2R69L 1FZMA 5I2IA 1AXSB 2YPVL 4KDWA 5IOPB 1CE6A 1NUFA 4R97C 3QYCA 1FO0H 5MENB 3SGKC 3QCUH 5BJTA 3MCLH 4P46B 1AP2A 1MJJB 4M8VA 4PJ9D 4HFUL 3ECBA 1OP5K 1JPST 3GHBH 1QBBA 1S9KC 3QI9C 1A22B 4RBPH 5E8EA 3L6FB 4KJPC 4YGVA 1XGUA 2I25N 3QXTA 4UB0H 3PP3K 5CFHA 3ZE1F 1Z3GL 5EOTB 5J6GA 4Y1AE 1KPVA 1C5CH 3HKFA 1N4XL 2D7NA 2HFTA 1JGEA 3DXAB 3OAUH 1N8ZA 4P2RA 1NCBL 2JK5B 3N9GH 4WUUE 5I1DB 1I1AD 3L7FA 3QFJE 1UA6H 3VFMA 1IKFL 2YBRB 3LEVL 4ZNEE 2G60H 4YHZH 5E94A 2HTLD 3HC4H 2AV1A 1KGCE 1CD1A 2OTUA 2PUQT 5EZIH 2I24N 2Z35B 2ICCA 3MQIA 4UNUA 3WJJC 1FVEB 2SEBA 5BVJB 4U0QB 2BY3A 3QUYC 1AQDA 2XN9D 3RWGA 1GGCH 2UWEA 3BPCA 4G6ML 2VDRL 2CLRB 5F97E 3VWJD 4UT6H 4XX1G 3CVHB 2OJZL 2E6JA 2ZUSA 4JFZH 2XNAB 5D7IA 2CMRL 1A6AB 5IJVB 1KSRA 5GQBA 1NUGA 5IJKA 5KSBB 3IVKB 1ZHBB 4JHWL 1H0DA 4X6DB 4PY7A 3RWIA 1F58L 3D6GA 1JPGA 4XP1H 4PLKD 2DLHA 2F8OA 4XPAL 5DJXA 4PLJC 5C0RL 3ZDXF 3INUH 3T4YB 1QTYT 1RZGB 5GGRY 5DC9B 1GGBH 1X5AA 2C7UB 4X7CC 5CD5D 1RK0A 3VD3A 4RGNE 3BH8A 3H9SB 4PGEA 2RJMA 3CJJA 2CIIB 3CSYB 3G6JF 3STLB 1P53A 3UTQA 5JZ7D 3TN0A 1KELH 1NKRA 2GIYA 2BVOA 4NQXA 4NN7C 3VFVA 4AEIL 4F7CB 4Q7DA 4QRQA 1HDMB 4FS0A 4NYLA 1W0VA 4QXUH 5GRJL 1DLFL 3UXFA 3P3YA 4FFZH 3MRQA 1ZT7A 4I77H 5DEFB 3DETD 1HCVA 5L2JA 3RDTC 1WCBA 5HHNA 1S7UB 3VW3L 3LDBB 4OZGF 4GMSH 1S78D 2D7TH 3SDDD 4ONOA 32C2A 4IMLA 4D0BA 5BV7B 4Y2DD 3MACL 3HZKA 1TJIH 3U1SL 2VQ1A 4JKMA 4UTBH 5DRXA 4I1NB 4WEUD 4OJFL 4OZFB 4OD2A 2X41A 2XTLA 4M93C 5FCSH 4TN9A 3DUSB 1LDPH 5EU6B 4HXAL 5DEZA 4ZOEA 3SDYH 3C5JB 3D85A 1EHLH 4NO5A 1WBYB 4JRYB 4APQB 4KJWD 1ED3A 4YJZL 5GSRA 4FQLH 1QFOA 3TA3D 2G5RA 5E2TL 4WEBL 5F7DA 2APXA 2YRPA 2JJWA 2Z8VC 2AJUL 3P30H 5CIPA 4MA7L 3O6FD 1JRH<