1MFAL

Structure of a single-chain fv fragment complexed with a carbohydrate antigen at 1.7 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
112
Chain Sequence
QIVVTQESALTTSPGETVTLTCRSSTGTVTSGNHANWVQEKPDHLFTGLIGDTNNRAPGVPARFSGSLIGDKAALTITGAQPEDEAIYFCALWSNNHWIFGGGTKLTVLGQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a single-chain antibody variable domain (Fv) fragment complexed with a carbohydrate antigen at 1.7-A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN)
total genus 26
structure length 112
sequence length 127
ec nomenclature
pdb deposition date 1993-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfaL01
1G6VK 2CUHA 2VDRL 4B7IA 5LWYH 5KVFH 3O4OB 2NNAB 5K59F 4Z7UB 4OD1H 4KGLA 1IAOA 4NGHL 5F96L 1LK3H 5K9JH 4F7CA 2AQ2A 4NJ9L 1F4WH 2OX5A 3DYOA 4RGND 4WO4B 3GFUA 5LG1A 1NCBL 1UH3A 3CFCH 1RUML 5D6DC 4ELKA 3QI9A 5CHNA 4AIXA 2XTJE 4UU9A 3GNMH 3SN6N 1U9KA 3CZFB 3PQYA 4KKBC 4OBSA 3T0BA 5F3BB 1T89C 4JHWH 1OSZB 4FQXD 2BOBA 3GSNA 4RFNB 4F9LC 5D1XB 2ITDA 2NY6C 2WUCH 3DROB 3SE8L 2IPKA 3DVGB 4Y16C 1R24A 3O6LL 4ODSL 2EH8H 4GW4A 1U8OA 4QHUA 3V0VA 3TBYB 2HJLB 1KPUA 2BC4A 4IMKC 4ZUUA 4F37F 5C0CD 3QUZB 2N1KA 3DECA 1FO0B 3PXHA 3X14A 1ZGLM 5ITFB 5IGXL 1I8IB 2Y6SD 4QRTB 4FQPA 1X5AA 3J8F7 4FFWC 5L7XH 1QFWL 2J8HA 3QR2A 3S6CA 4OKDA 4YFEA 1S9WA 3OKLA 4BH7B 1CFQA 5JUEL 1GGCL 3SJVE 4K9EH 1A6VH 1K3IA 1NGYB 5C09D 1H5BA 3L3HA 4XC3L 4NNXA 3MSPA 3ZE0F 1RHFA 1KJ3L 1JF1B 4MQXC 4WEBL 3WSQH 2DQJL 2NR6D 3BJ91 3MRMA 4RQQB 1AIFB 2DQEL 2GFBA 5GISH 4BYHA 4XTRC 1UVQA 1E4WL 1FFRA 1GAFH 4DJMA 3U0PA 1GAFL 3OKDB 3Q5OA 4JM2F 1ZT1A 2V5TA 1UB5B 1A1MA 4HS6B 5DEZA 2CLRB 3SKOA 4RGNB 2CKBA 4JFFB 3T2NH 4GG6F 2XQBH 1A3LH 4D0BA 1ZT1B 4JPKH 3VXTB 4QHMB 2XZAL 3UC0H 2CJUL 3VFTA 4LAQH 4UDUB 4BM7A 4ZNCD 3O2DH 4GW5A 4Y5VA 1D5IL 1AQDA 3O4LA 1CTNA 4QY8A 3OR6A 3X17A 1A1OB 1V3MA 4MXWL 3VXMA 1QD0A 3S3SA 2AK1H 5F7WC 1T2XA 1ZOXA 1HK6A 1TZHB 1JGUL 4IS6A 4BSVA 2CPCA 3QQ9C 3MRGA 4JJ5A 1JYWA 3QUZD 4G8GE 1RJZB 2VLLB 3KPSA 4OZFB 3PDOB 4PJIA 2F8OA 1FZKB 4P2QE 1FG2A 2G60H 4Z7UE 3FN9A 1VERA 1BFSA 4KVNH 3GMMA 3ZSSA 3QI9D 5J6HA 1Y6MR 1RZIB 3QH3B 3H9SB 3W11C 3HR5A 4MA7H 4NT6B 3FO0H 2APBA 2IALB 2HVKB 3U6RA 3CX2A 3IXTA 3DXAB 1BLNB 2IAMD 1MCLA 4NQED 1T7XA 5E2TH 1ULVA 3U9UA 1HQ4B 5IHUH 2Y1VA 1NFIA 4HIIB 4GXVH 3MV7A 1A02N 2D31B 4J3UA 4S0SD 5ICYA 3RU8L 2UZXB 1KJMA 4NNYA 1ZLSL 2FIKA 3WFDH 2X05A 1FVDA 1U8NB 2XWBA 3BOVA 2FGZA 4ZUTA 2EYSA 1DEEB 3QSKB 4YNYB 3T4AB 5FECB 4X9FA 5EZLA 4DEPB 1N5AB 1BD2E 4LF3B 5LQBH 4NNPL 2YMXH 3WDJA 1JPSL 3BEVA 4X5XA 4JY6B 1FSKB 4CADA 1UWGH 1EPFA 3FQUA 1KPVA 3UJJH 1L0XA 4PJEE 4MYWB 3VXRD 2Z35B 3QG6A 2IGFH 5GRVL 3N1QC 3BGFB 1JGEB 1W0WA 3PL6D 4KMTH 1LO2H 3WN5A 1S9KC 1IILE 2AK1L 1P6AB 4ODXA 4P23D 5DD0H 1KG0B 1HHIA 2AXJA 3Q5YA 2NW2A 5FYJD 1AGEA 4TVPD 1MFDL 2EZ0C 1TQBC 3BZDA 1G9NC 4LCIL 2BXZA 2MCG1 5H35A 1BOYA 3VXUD 1KCLA 3MRJA 2BFVL 4JR9L 4XP1H 5EA0H 1N64H 5GS1A 2XKNA 2IG2L 4W6WB 5HHXL 5D96C 5IEKA 1FNHA 4WUKH 1EEZA 3KPOA 3QNYB 5HHOE 4XXDA 1JTPA 4PJIE 5JOFA 3FN0L 1RHHB 1JNLH 4EI5B 2Z31B 4MQ7B 5E6YA 4KMLB 3W0WB 1NCAL 5KAQG 2FD6L 2VRAA 4KHXL 1QZ1A 3KWWB 3TN0D 4U7KA 4H26A 4R0LC 2B7DT 4K7PH 3PG2A 3U4AA 5HHPB 5JO5A 2J88L 3O9WD 1AGBA 1P1ZB 4PRPE 2WIMA 4LKCA 4GG8A 5IVXA 4NQCD 4JRYA 3QQ4B 2VLKA 1D5XA 4BKLA 4HGWA 2PN5A 1IAKB 5CBEB 2JK5A 4OLXL 4TNWK 4F7EA 1JWSA 5KTEH 1CBVH 1TVHB 1IEBB 3I2CH 4MCZB 5A16B 5KBNC 4OBRA 5KSAC 1I7ZB 2IGFL 4UINL 3VFVA 4C55A 5LGHH 2DM2A 4QXTB 1UA6L 1R3LB 3OTTA 1JZ8A 3HFML 4UOW1 5C0AD 4UAOC 2N7AA 1ONQA 4HUWB 4P57B 4AQ1B 1QBBA 2L7UA 5IB5A 1T5XB 5DJ0B 4ZG1A 2X7LB 3CC5B 1E6OL 3VGBA 2PCPB 2YZ8A 1DBBL 1H3WM 1YDPB 4JANB 4CMMB 3G5YB 2EKSB 5DMGD 1RUKL 2GY7B 4X9IA 4LMQI 5HVHC 4E0RB 3WDIA 1A6VL 2C5DC 3MLVH 3IU4L 1T04A 3GMPA 4B7LA 5L2JA 4GAYA 3NPSB 3QFJD 3G5YA 1GIGH 3H0TA 4L4VE 3U46B 3MGAA 4M1DH 4XNUL 2A6JB 4PJ8C 4QRQB 3MBED 4OD3H 1CDGA 5HGBA 4H1LG 5HHOA 3U46A 1PD6A 2HWZH 2OI9B 3CX5K 4X9GA 2R2EA 5DRXB 3SE8H 3UMTA 1ONQB 2CXKA 5D9SB 2VDKL 4Z18A 2Q8BL 2X4OB 5IR1A 2R2CA 4YEFA 2A9ML 3P0YL 4LRIA 3OXSB 3G04B 3V9FA 3P9LB 5FYJU 2BNQA 3W11D 2NX5B 3G5VB 4KTDH 5T3ZH 1D9KD 1NC4A 5FOBA 5L88L 2NXYD 4FXLA 2Y23A 4M5ZL 3OKNA 3E6HB 4NCDA 3WS6C 3L3DA 1J1OL 1BFVH 2WBJA 1D5IH 3QEQE 4C56D 3EJZC 4Q0XH 4FXGB 5ICXA 5IK3A 3LOWA 1A6WL 1ACYH 5D2NB 4EIZC 1G7JA 5BQ7B 4G6JH 3OKMB 3PQYD 2QQQA 3MA9H 4Y7MA 3T3PE 5JMRA 4NN6B 2C1OA 4PV9B 2H6PA 2EE9A 4OCSH 4HFWA 4EDXA 2X4SB 4XNMA 2VDQL 1RZGB 1TNMA 2AGJL 1DBAL 1G0XA 2VL5B 3P0VL 4PJCF 4RBPH 4OUUB 4KK6C 4NWTL 4YXLL 2NXYB 4PV9A 1T2JA 4RGMC 3HAEH 3VI4E 4RGMB 5MEOA 1EJ6A 4LSVL 4LVHB 2IAMC 1JMZA 4XCEB 2H8PA 5C0RH 4FQJL 5B8CA 2NY2B 4HS8L 2NY1B 4LSUL 5TH2A 4X6DB 1OGAE 2Y4SA 2ATPB 4E42A 3GJEA 2H8PB 1UACH 2C3GA 5EU6E 4NN5B 4U4BA 1F90H 1R0AL 5F9WB 5E8PA 4JE4B 1QLRA 2R9HD 4G6FB 4DW2L 4M1GL 4DQOL 1BOGA 1LHZA 2ARJQ 3ZMRA 5ISZA 5JR1H 1MRCL 4JPVH 4MHHI 2GI7A 2VE6B 1DCLA 3ARBC 1NC2A 3CFJA 1WBXB 2CRMA 3AAZB 4XB8A 1VESA 2DAVA 1FYTD 5TE4H 2BC4B 5FUOH 2VLJB 3MJ7A 2H2PD 1AD0B 2VOTA 4G8GB 1D9KA 1NC4D 4IIQA 3OG6B 1OM3H 5M95B 4QNPF 4BFGA 5DGQA 3RZCD 2F8XC 3U7WL 3P4OB 3UTSA 2BNRD 3MV8E 3V95A 2OXHA 4HAGA 3MGTA 4C4KO 2A0LC 1YPZF 5E2TL 1B90A 2RFXA 3T04D 4X6FA 4DKAA 3ULSB 2QKIA 3S5LG 3QFJB 1ZVHA 4GKNA 1F3DJ 1GGIH 3W9DA 2XIDA 5GXBB 1JYNA 1OWRM 3QUZA 3OKDA 1INEL 5KAQF 3UCRA 1JRHH 3K8MA 5I2IB 4ZQKB 5L8LB 3D85A 1WT5C 4LGRB 4JGUA 4LHUB 3HUJF 4PRID 1OTTD 1SEBA 1WIUA 3CSYA 3MOAH 1NUNB 4GLRH 4X7FC 4XMLH 2NW3A 4R2GC 4OLYH 4R2GB 1WT5A 4L4TB 4I77L 1QFWI 3VFWB 3F7VB 4I3RL 2GUOB 4FZ8L 2UYLB 3S35H 2GITB 1HOCB 3PGCB 4Z76B 2YA2A 2Q1EA 4GW1B 1FG9C 1OAKL 3QCVL 5GS0D 3D25A 4OCLC 3GRWA 1J8HB 2C26A 4Q58C 2DM3A 5FM5M 3B9KA 3R0MA 3VFPB 2IAND 1NFDA 1Q8MA 3ARPA 3WUWG 1QR4A 1YECH 3A6CL 3Q6FB 4KQ3H 5E5MA 4MJIA 5F21B 2VNCA 3OKOB 5C70A 1A47A 2EDBA 1GH7A 3GSQB 3V5DB 4XP9H 4Q9BA 4FQ1L 1DUZA 4J3TA 3JV6A 3JWOC 1KC5H 3B9DA 3MRCA 4UINH 4Y5VB 2QBWA 2VUYA 4YWGL 2X9YA 1VGEL 2CK2A 4LFHG 5T3XL 5B38G 1LNUA 5FUZL 3JTSA 4OFIA 1F3DH 5T3ZD 3EOYG 1BZ9B 2FEDC 2Q7YB 1FIGH 4R7DA 1BMGA 3ARRA 4J3XA 4NHCL 5E9DD 5IM7A 3ZDZF 3LMJH 4JFHD 4HAFA 1S5HB 4JN1H 2YD7A 5F88A 5A40E 3O8XD 4HJGB 4KKNA 3KPSB 5CWSB 1QBAA 4GW1A 3H3PH 3EJZD 3G5XB 1MCBA 4WU7B 4OSUH 5EFIA 2PUQT 5FYKE 2FECI 1WGOA 5DD6A 1C08A 1Q9OB 4NKOA 5E00A 3K8LA 4M6OH 5MI0C 5C0BB 5MI0B 3RWIB 4CADB 3QI9B 4IEFB 1PLGH 1MI5A 2Y06H 1FCCA 4RFOL 1SJEB 1DQDL 4UUJA 2A73B 3MLSH 1Z0MA 4LARH 5B8CC 1JGVH 2HT3C 4PRAA 5DRZB 2Z0BA 3ZL4L 3KPSD 3N9GH 3ALWA 4K07A 4X5WA 2C1PB 3G5ZB 5TE7H 3DXAE 2E6QA 2DQGL 2V7NA 3LZFL 4XP6L 5L2KD 5FUCE 2L0DA 2NY0B 3FO9A 3QA3B 1X4XA 3WJLA 4K3JH 1CG9B 1LGVA 2FJGB 2ZSWB 5IROA 3ARGA 3KLAB 5EOQL 4Z0XA 3N9GL 4YHYB 2GJZB 2BVOA 3C9NA 5GZOC 3FZUD 4DAGH 4ZFZA 4XP5L 5J3HC 4WCYH 1U8IA 3FFCD 43CAA 2YN5A 3OR7A 4WI2A 4PJBF 4R8WL 2R39A 3TO4A 1GJIA 4APQD 1YMHA 3LKPA 3VXPA 1M05A 5EU7E 3HZVB 2HFGL 2MCPH 2MPAL 1U0QA 1U95A 5IB4A 3KPNB 4FNLH 3MV8D 2NY3C 3QDGD 1W0WB 2W9EL 3LV3A 1MI5B 5DMGC 4S1RL 2G2RA 1RHHA 2NCMA 1J87A 1DLHB 1I1CA 4KH2A 3UXFA 1A9BA 5C0RL 3KXFD 5ADPL 1OVZA 1S9XB 4UILH 1T03H 4DEPC 4GRLA 3TBSB 2ITCB 3AB0B 5BO1L 3OXRA 5F1OB 1U3JA 4KTEL 1K8DA 3GSNH 3VW3L 4C56E 3WN5C 1CLYH 1EAJA 3P4MB 4PLJC 4JFPA 1XGQA 2FH8A 1NJ9B 25C8H 1HEZB 5DEGB 5I16A 4XBEL 3WCYA 3U7WH 4F7EB 1N64L 2JCCE 4KRMB 2VDPH 1S7RA 2H2PC 5B22A 4WVRA 3CVIL 2UY6A 3H2WA 5EUOA 4BFBD 1A4JA 5CP7B 1JNHB 4CVXA 3LB6C 5DT1H 2FEEL 1MCPH 4Y5XC 4OLZL 5E99H 1B6DA 1DUYB 3BIBX 3RNQA 3MLWL 3UAJC 2FL5A 3L9RB 2Q86B 3R06B 4V2CB 2G5RA 4Q2ZA 5HVWA 5ESAA 3RDTA 4N0CC 1WZ1L 3LQAC 3VXTA 2FBJH 4Y8DC 2OMNA 3RWHA 1A0QH 3GMNB 3ARFB 1EGJL 1AXTL 2DTML 5IF0B 5CJ5A 5FO8A 3UZEA 3BMVA 1TFHA 2VLJD 4PY7B 1VADB 4FQQB 1LO4H 5D1ZD 4KUZL 3OAZH 5EZIH 4JJHA 2E7HA 1TZHA 5DVMA 4DKFL 5ILTL 1IKNA 2UVEA 1VADA 4FQQA 1QBMH 3QDMD 1K6QL 4O58H 1L4IA 3TN0A 2KKQA 4MD4B 4QRSB 4MJ2A 4HH9A 4NQDB 1K2DA 4YX2L 1R5VA 3LQMA 1MNUH 1W72H 4JY4B 15C8H 1CE6B 1T7ZA 2VLRD 3FONB 5HHOB 3CUPB 4K2UH 5J6HB 4MXVF 1BQLL 3BEVB 4X5XB 5GRUL 5HHXH 4X6DE 4POZC 4RMRA 4UAOB 4JCMA 2X09A 3O2WL 1RZKH 2A6DB 3D69B 1YDPA 2VDLL 1A4KB 1UH4A 5KVGH 2ADFL 4LLVB 2VXSL 2FBOJ 3W0WD 4U33A 1SJHB 2APWA 1XIWD 5KSAB 1MRDH 2X4UA 1QLEH 1GSMA 1I1FB 1KN2L 2LE9A 4RMSA 4F33A 4NQCA 3FT2B 3UPRB 2P8PA 5F7YC 4ODWA 5H8DA 1NGXA 4TNWF 1TDQA 5ABDE 5LGHL 3L3OA 5E1AA 1BP3B 3EGSA 1K2DB 1QG3A 4ZSOB 3F62A 2XPGA 2NY4D 4P2OC 5HD8D 4ODSH 4OKVA 3ARVA 1MIML 5EULV 1BX2A 4OCMC 4EI6B 5BV7B 3MLUH 4Y19E 1MELA 5E6IB 1JPFA 1OTUC 1ADQA 3PWPB 2B0SL 2BY2A 2UUDK 2UY7A 3V4VL 3LKNB 2P7TB 1Q38A 3NTCH 2J8UA 4LAQL 5IBUB 3M8OL 1TZGH 3G6JE 2R2HB 4JM2D 3TH3T 2YR3A 1VACA 1A7PH 1YEGL 3EUUA 3T2NL 1KIRB 2YD2A 5T1KA 3TIEB 1QSEB 5HHOD 1FE8H 3FO1A 5KSAA 2IQ9H 3D3VA 3MTRA 2NYYC 4L3EE 5BZWA 3ECBB 4KVCH 1MQKH 3OGCB 1G1YA 2QJDA 2PW1B 2DQJH 4F3FA 4Y16A 4C83B 2BNRA 2PXYB 3KPRA 5JNYA 2C9AA 3LN4B 4G9FA 1NGQH 4IRJD 3V4PH 4UT9L 2Q76A 4OFPA 3G08B 1EUUA 1JN6B 3QDJB 3HZYA 2QHLA 3S8WA 4JHAH 4XPBL 3VFNB 3ZYIA 5IMKB 3OB0H 1BJ8A 2OZ4L 2HN7B 4AG4H 3MLZH 3T65A 1E6JH 1ZHBB 2FX8H 2L7JA 5E94A 1H5BC 1X5IA 3DPBA 1KEGH 2AQ1A 3FCTA 1CLCA 4NQXA 1YPZE 2VL4A 4HKJA 1FYTE 1W8OA 4K9EC 4PJ8A 5D7IA 3T0ED 4OF6A 1WBYA 3RVVC 3GMRA 3K2UH 1J5OL 5HYJB 1KT2B 4PJEF 4DGYL 1CIUA 4PJ5E 2I27N 3VXUE 5I74C 1AHWC 2E9IA 3FT4A 4QRUA 1AGCB 5I1JL 2NTFB 3D85B 4GKZB 5HGAB 1CGVA 2FHCA 4CW1A 3T0XA 2QL1A 2GK0A 4I4WA 1JGVL 5DEFB 4AMKL 3QHZH 5DI8A 4LHJB 3VWJA 2X4NA 4OGAC 4Y8AA 5I8KL 1SYSA 1T22B 2COQA 1F6AB 3CGTA 3RNKB 3IDGA 4TTGA 5A3ID 2UYLA 1LO3L 4JQIL 4NOBA 3UTQA 3WHXA 4XHJC 2DWDA 1PG7W 1YEHL 3WFHA 4PGCA 2ZJSH 5HDOA 4U1JB 4O5LH 2BDNL 2YN3A 2AK4D 3VI4F 1ZGLB 1OGAB 1Z9SA 1RV6X 1A7NH 3MRLA 4IHOA 5TDPB 3GSQA 1AE6H 1MJJB 4X4ME 3BEWB 3DLQR 4OCYH 3MBEC 3BQUA 4LDOB 5GJSL 4GAGH 5HI4C 5IHZB 3BGFC 3FFDA 4KHTL 2J1KA 2ICWB 3CFCL 3BE1H 5I1GH 2C1OB 1S78D 4PV8B 4QGYA 4EDXB 2P24A 4S11A 5EPMB 2WWMD 3HUJB 4XNXH 2R8SL 1TJHL 4HIEB 1NCDH 5I1EH 3TIDB 4L5FH 3FOLA 3L3JB 3RZCA 2FDBP 3C5ZC 1QLFA 4OIAA 3NPZB 4KTEH 2ADFH 1FNFA 3QRGH 5D7LE 3RA7H 5CLWA 4HIEA 2UV3A 1Z3GL 4X7SH 1CN4A 3FOLB 3L3JA 3RZCB 5DURB 3H6JA 4QHLA 5T1MA 2FNBA 2W1NA 4X7TA 2B5IC 5GRUH 4L4VD 1N0XH 1NMBH 4OCRL 1EO7A 4YO0A 1JZ4A 3MOAL 2BOCA 3QFJE 2YWZA 3F7RA 5BXFB 1CF8L 4PYGA 2AERT 3BPNC 5IVOA 4HQQH 5I18H 4TPRH 3NFSL 3HNSH 2XWTB 3LEYH 3FT3A 4MXQC 5CAYB 3KPQA 4LPUA 5EU3A 3I02A 4LSTL 4EUPA 4PP1D 1TCRA 4E41B 1OWWA 4J3WA 4R7NA 4G42A 3E2HC 1PJ9A 2IQAA 1OB1B 5EPMA 5IBTL 2BVOB 3A67L 4KJYA 3MRHA 3VH8G 1FJ1A 5ENWA 1SBBA 3S88L 5AWNH 2P8LB 4I3SH 4Z7UA 5GIRA 1BZQK 2DMKA 1FFOA 4MA8H 2OM5A 4GOSA 3TO4B 3HPJA 2GT9A 1FJ1B 5EBWB 5ENWB 4LOUD 3RAJL 5C71A 3EOAB 3V6FB 4M8QA 2YPLD 1A1MB 1FFOB 4WV1A 1DBJL 5CILL 1S7XA 3N85L 3S3JA 1D5BA 1AD9A 1CDUA 2C3HA 1HKLH 1MLCB 1DVFA 4U7MA 2BHYA 2Z35A 4FS0A 2AJVL 2FWOB 4PRPD 4LQFL 5CINL 1HINH 4MNQA 4P3DA 3RHWF 1DVFB 3BP6A 5J1SC 2IQ9L 1PDKA 5IMMA 3PHSA 4NRYB 5K59E 1BQLH 2YPVL 5F3HA 5F7MC 3E6FA 2CIIA 3HAEB 1A7PL 4XPAH 1Y18A 4P2CG 1T1XB 2ZUYA 1FFNB 2JIXB 3VWKD 2V2WA 3VXME 3P4MA 4XC3H 2F54A 4CVZB 3V4VH 3ZKMC 2OMBA 4FMKA 4HK3N 2I60L 3WKML 4LLDB 4X6BB 2ADIA 3S36X 5J13C 5J13B 1PYWA 4ETYA 3B43A 5J12C 4OZHF 1NGYA 4CVXB 4DGIH 3GUTA 2ITDB 5HTSA 3RRQA 4DOHE 5F7LB 4AH2B 1MWAA 5TE6L 3FQXB 4B53A 2ZUQB 4TN9A 5D7LD 4JZNB 5IFJB 3VWKA 4KI5F 4PP2A 5CMAA 1FZOA 1P4IL 5EIIA 5GGRA 1ZGLP 4XCFL 4U6VH 3TPUB 1S7TB 5CEZL 1XGPB 3ARSA 1U58B 5JIIA 3DIFB 4O02H 5IVNA 3QDJD 1FAIL 2CDEB 3GI9H 1N2RA 3SKUD 1GOGA 4TUOA 4BFIA 2CXGA 4KPHH 1PQZB 4M00A 2YMXL 3QNZB 3SGDI 4ZOAA 3V4PL 2EDNA 3DIFA 3OGOE 4HZLB 4O5LL 3QDAA 5DC4B 2G5BA 1WWWX 3SOBH 4C56B 2E6PA 3D0LB 2XQYG 1MVUA 4JRYD 1MCWW 2R0KH 2Y36L 1DSFH 3CH1A 2V2XB 4LHUG 5CP7A 3THMH 2GKIA 2BVPA 3OAZK 1DVFD 2FZ3B 1QFHA 3IFOB 1G0YR 2AK4E 4JM2B 3W9EA 2KBGA 4AJ0A 4L8SC 3VW3H 1CXLA 3OKOA 3F65A 5IESH 2FR4A 5FCUH 4NUJB 5A16A 3TF7C 3B9AA 1VKXA 1UWEL 5KOVC 2HKFL 1S78C 5E2JA 1FGNL 5E7FA 1EHAA 4KI5E 3VWKB 3WN5B 3KR3L 3VRJB 4ELMB 4JHBA 4XVTL 1SY6L 4UUJB 8FABA 2YWYA 1MI5D 5E8EA 2IMNA 1S7VB 2AW2A 2BMKA 1PG7L 3KAAA 3EJYD 1IT9H 1IGTB 5GSVA 1EAPA 1MIEL 1YEFL 1NLBH 4RWYL 1ZANH 4M93B 4MNGE 3SDCC 3IDIA 3RWFB 3MJ9H 2PTTA 4FABL 3G6JB 4JFYA 1DBKL 4LPCA 2HTKC 3N1FC 5HGHB 5F71A 3C6LD 3IJYA 4PGBB 4BSJA 1HNGA 2R29L 2CLZA 4FQIH 1QSEE 1MJ8L 1TJIH 1CLOH 4LLMA 5IOPA 1X7QB 2CKNA 2XWBB 5MP6H 2V6HA 3SE3A 3ELAT 4PGZA 5JOPE 5E99L 5H2BB 1FNEB 5AUMB 1KXQE 1FORL 5DFTA 2WBKA 3MYZA 3T0EE 4YHMH 4FQ1H 3TEUA 3RL1A 1J1XL 2VDPL 3BKCL 3U30B 3T2OA 1PX3A 2P5WB 3RKPA 4I5BA 5CLTA 3TH2T 3B9VA 2ENYA 3U6RB 1UENA 3KYAA 4MDJB 3R0NA 1BGXH 1BLNA 4CAGA 1YECL 3QISA 1IC4L 2R4SH 4UTBH 2BMKB 1JZ6A 2NLJB 3UBXB 1NQBA 5AEAA 2IBZY 1KENH 4JVWA 3ZKSD 5IB1B 2B2XH 2VXTL 1EJOH 4MA3A 1SMOA 1VACB 4JG1H 5ERWB 1YYMH 3QIUC 4JO1H 5DJXA 5I8CB 5L6YH 3WJJC 2NW2B 3BPCA 4HCRL 3LSOA 2MNUA 4MA3B 2A74A 4NC1C 2AKRB 3U0WL 2NY5C 4K7FB 2EYRA 4DKFH 4K7PL 3TCXA 2F74B 2HKHL 4ERSH 4XNYH 4LHUD 5ICXB 5IK3B 4KROC 1NCWL 1MJUL 3S7GA 1FLRL 5IEKB 5I76B 4CN4A 4NC2B 3LDBB 2FH6A 1FBIH 4HS3A 2B0SH 4IOIA 3MACL 4X6EA 1A6WH 4XI5D 4EEEA 2EKJA 3D1MC 4PREA 2HH0L 1KPRB 1FRGH 5D7KD 4CL7A 1CIDA 4YWGH 4JHWL 4NQXB 4KZEH 2AXGB 5BCAA 4B41A 3RJQB 2XT1B 3LS4H 4NZDA 2LAGB 1X5HA 4Y16B 1FFPA 4WW2A 4ZFOB 5E6IC 3HZMB 3WMSA 2OL3L 5L9DL 3GK8H 5KVDL 3I6GB 2GK2A 2H9GA 3QPQD 1T0PB 2VUOA 3ZL4H 3GHEH 2DKSA 5KVFL 5K9KB 2VAAA 3T0DA 1U3HB 3DTXA 3TBTB 1CLZL 3EYVA 3MLPA 3KXFB 3QCVH 5EUOB 2A77H 2VDLH 4WU5B 1PLGL 2GHWB 3JWDC 3LD8C 3O6FA 1PGRB 2QQLH 1CFTA 4M1DL 3SE4C 4HLJA 4PJDE 2X4NB 4Y16D 2EO1A 3FCTB 4YHPB 4FZEL 4ZD3L 3VGAC 4KKAD 3BP4B 1F6AA 3GSUA 4I1NB 3JZ7A 4P2RA 4W4OA 1PAMA 2I5YL 5DZOA 2FYYA 1JGLL 4M62H 4PBXA 1RIUH 1KLUA 3UTSD 4QXUL 3UTZA 3IVKA 3M17A 3O6ML 5AZ2H 3SCMB 5A2IH 1E4XL 3IDNA 1KLGA 4EOWH 3WFDL 2HTKD 1R5IB 3QIBB 4R4BB 3VXNA 3EZJB 5DUML 1MCSA 1MCQA 1I3UA 2AEPH 3QAZC 4QRSA 3RBSA 3LN5A 2I9TB 4MQXD 5T1DH 3GI8H 1BIIB 1RUPH 1QQDB 4IRJA 3RTQC 2O5ZL 3SDAC 4M1CD 1RK1B 2FBJL 1TETH 1QR1A 1S7SB 4GAYB 4F9PA 1ACYL 1G7PB 1YJDC 1A22B 4ZSOA 3L5WB 1BIIA 2ZNWA 4IRJB 2P5ED 5JQ6L 4S1QH 4PRDB 3FMGH 3ORJA 3SCMD 1FNGA 5FHAL 1UXWB 3JVGC 5ESQA 1TTUA 1F02I 3ZDYE 5L88H 4J3VA 5GZOD 5F6IB 4HIJA 1KXTB 1UADC 4TSCH 1IGIL 3QEUA 1KJ2B 4XPFH 1XIWC 2W0LA 3ROOB 3QXVA 2YRPA 1SMAA 4YBQC 4LLUB 5FYLE 2MTPA 5IEHA 5KZCB 2YBRA 4P4KB 4M7ZB 5DK0B 4QRRE 2V17L 1X3DA 1FYTB 4XPGL 5FKPA 3DUSB 3BKJL 1ETZA 4I9WE 5BO1H 3OXSA 2VABA 2CUMA 4PRHA 4HKBA 1N8ZA 1LQSR 3HE7B 3C5SB 5GRVK 4NBYB 5HSFA 4FXGA 5IMLA 2JJWA 5FYJL 3I6KB 1BFOB 3HCVB 5DSCA 5HGDB 1T1WA 4G6KH 5HGBB 2IH1A 1CXEA 4FN0A 5GRZA 3FT3B 4I2XE 3C5SA 4R4FL 2F53B 2W59A 3UYRH 3JV0A 3ULVD 4H0HB 4YUEH 3N50A 2D2OA 4NQVA 1BGXL 1UZ6F 3F6LA 3RX8A 2VISB 4PJ7E 3IJHA 1KSRA 2GJ6A 1J8KA 4DOHB 3UEZA 2K1MA 5CCKL 3QDGE 3NCCB 1UJTA 3MRPB 1BFVL 3RI5K 5I71C 4HC1H 5ACZB 3MZTA 4WHYG 1EERB 1KTLB 2ATPA 1AXSB 4XMKL 3G6JF 3B9EA 1LO2L 4KDWA 4YXHL 4KDTA 3CFDA 1BIHA 3QFDB 5DRWB 4MVBC 5JHDE 4GQPH 4G7YL 2D0FA 3AXLB 2VXVH 4KWUA 3GBMH 3BP7B 3D85D 1GGBL 3W5MA 3SJVA 4I77H 4P4KD 3UPAA 5D1XC 1T6WA 2VZSA 3G9VA 3STZA 3HKFA 1VSCA 2X4QA 5DVKA 1KFAL 3MACH 5L2KA 1JMXA 4DCQA 1WK0A 4H1LH 4JKLA 4QOKE 1YN7A 1MNUL 1I8IA 2DBLL 3HAEA 3INUH 3CIQA 2EYTA 2XTJC 3SPVA 5HPOA 4XX1E 4Z77B 1OAZH 3OKYA 5D93C 1J0KA 1D5MB 1RFDH 4NNXB 2R15A 4L1HA 5HHVL 4AEIL 4NGHH 5CUSL 1JF1A 5EH1A 4XI5C 4MJID 1MLCA 3HPLB 3FKUS 3UTTB 1KTLA 4P9ML 3BGMB 1KLFA 4U1JA 3PDOA 5CHNB 1QFUH 1A9EB 5CJXA 4HMEA 3IKCB 4X6FB 4P3CL 3AGVA 5DJYA 4NRYA 4TRPL 4OF0A 1EVTC 2R1YB 3C5JB 2X89D 3RFZC 2BSRB 2P5EB 2CDEA 3MREB 3RVXD 3BQUB 1SJXA 3H7BB 2VLJE 4OV5B 5GRJH 4GRLD 2DLIA 2VLKD 4HUUA 4P2QA 4U1HA 5DJ8A 4N0RA 4K3GA 2BRQA 4PLKD 1WITA 4DUVA 1K8IB 1QRND 1Z5LA 3EFDH 4JZJC 5EIQA 1PZ5B 2B1HH 1AI1H 2AEPL 1EV2E 3WHXB 1CD9B 1J05A 1NBQA 3BKML 3TIDA 3AY4A 4PJIB 3O9WC 1RULL 3EW3B 3NCMA 3OKKB 3ULSA 43C9B 3F8UB 2QLVB 3RL2A 4MX7B 3LEYL 3KLHC 3JWDL 3UBXG 3DBXA 1JNNH 1J8HA 4DTGL 2XQBL 2X9WA 3WNOA 3OKKA 3QZWB 1VKXB 3V0WH 3WDHA 1YY8B 3PWNA 5HDBF 5DD1H 3ES6A 5JHDA 2FLRT 2F5AH 2D7TL 2R4RL 4N9OB 3WFBH 2H2SD 4MMZC 1HINL 4JFEE 4OZIE 2WWMC 2JCCF 4WEBH 4PS4H 1G6RL 4QOKD 3SDAD 2VDOL 5DD3H 5DHYA 4ZUSB 1AKJB 3T4AA 4WHTB 4UDUA 3JUYA 2ZUWA 4Q0XL 4Y4HD 4D9RE 3LHPH 3VXSE 1JHKH 5FGBA 2DI9A 4X4XA 4NQUA 4EDWL 3EOBA 4NO5B 2B20A 4BZ2H 6FABH 2R0KL 2Y36H 1W0VA 4K71C 5MHSD 3TO4D 4J4PC 3MRRA 3KPNA 2DLGA 5GGSB 3BVNA 5GS0L 4EUPH 1MF2L 5C3TA 4D8PA 1C08B 2YD5A 4M02A 1TTFA 3DX8B 2CSPA 3VFMB 1Y6NR 3DX6A 1BBDH 2LU4A 1JCKA 3MRCB 4LCCC 5DFWH 5HYSB 4MDJA 4NZRL 2W0FB 1I3RA 3DX6B 1X6LA 1LK2A 3DUUA 1MHHA 3D69A 1MEXL 4ZUUB 1HHIB 5HHNB 5FA4B 4Z5RA 1CZ8L 1MF2H 3SDXF 1V7NH 5HDQL 3VJ6B 4PJBE 4MJ6B 5FGCE 4WY7H 3CFEA 4ODVL 1SYVB 4XVJL 5HHNA 2QR0B 2Y6SC 3ZYJA 1T4KB 4QTIL 3HI1A 2FD6H 4LCWD 4H0IA 4NNPH 4LSSH 4HBCH 2P44B 1D7FA 2ZSWA 1I7UB 1INDL 1ERNA 4LOUC 4LDLB 2N7BA 4JRWA 4M7JL 3MRRB 5C0BA 4JO3H 3RWIA 3C9NB 3LQAH 3WNMA 3P0GB 3HMWL 1T2QH 4FQXB 4H0GA 3TT3H 1IAIM 4GMSH 4PJEA 2R4RH 3V0AC 4YUEL 3QB7C 3SKJH 5IMOA 5D6DA 1QEWB 1W0YT 3LPGA 1UKTA 2QHRL 1GOHA 1OTSC 4UOW0 2CKBB 3DX9A 5E95B 5DD5L 2GQHA 2YUWA 3NCJL 3TYGL 3A6BL 3BE1L 4PD4K 4I0KA 4XH2B 2VSCA 2LABA 4HWBL 5JZ7D 3PHQB 1KIPA 2Z31C 2VZ3A 1GGCH 1P7HL 1Z6JT 2H3NB 4CJ0A 1ZLWK 1T20A 4F7PA 4OCYL 2IFFH 2K9UA 1URLA 3TBSA 1EO5A 1JZ5A 2ED8A 3S36H 3QWOB 4ZFOA 1EHNA 1LDSA 4DN4L 3ARWA 1A5FL 5HHMD 4YHZL 3VCLA 1P7QD 5K9OB 4R9HA 1U6AH 3PGFH 5H35B 5HI4D 4DZ8B 2DM7A 1WZMA 3GMQB 2DIBA 4YBQD 2NPLX 3QHFH 1TJGL 3W9EB 2XRAL 4U1SB 1A7OL 5EUKA 4JZNA 3SBWA 5FFLA 5IFJA 4PJDF 5EOCJ 2NY7L 1ZVYA 4P9HC 1H15B 3KPOB 3ILPA 3QNYA 1P84K 2E7LC 5D5MF 1XF5B 3CPLA 4XNUH 5BVJA 3I9GH 5C08B 5I1IH 4OT1H 1CXKA 1TXKA 5TGBB 1H15A 4P23B 4FXKB 4OQTL 4CGTA 3SCMA 4KRNA 3RWCA 2D9CA 4HKZA 5GSRB 4PRIE 4PY7A 5I8KH 1OQXA 2VLKE 3EFFB 4PJ8B 1RZ8B 3KNBB 2EDRA 3KJ4B 1NJ9A 1ZT4B 3VFSA 3G5VA 1SM3H 1KT2A 2DQIL 4YNYA 1KJ3H 1XGUA 4DN3H 4QXUH 5HBBA 1E6OH 4NQCE 4UTAL 4YX2H 4GG6E 3ARXA 5HY9A 5KSUB 2R2BA 1DL7L 2P42B 4M48L 1WAAF 1MJ7H 1DE4B 3SKMA 5CBEA 4OTXH 2ZCKL 4Z7OE 1G7JB 2ATKA 1MLBB 2GK0B 5J6GB 3H9ZA 4MA8L 2NZIA 4IRZH 4XCFH 1MREL 1OGTB 3VGAB 4J4PA 5I19H 3K4AA 1M7XA 5AYUL 2EIEA 4Y2OA 5GGTL 1M4KA 3GBLA 4YDVA 3VG0L 4JHAL 4KJWD 1GYAA 1S5IH 2J8UE 2X6MA 5E6ZA 5DK0A 3REWB 3LD8B 2HVJB 1PKOA 3QQ3B 5LQBL 1VFMA 5D70H 4HKZB 5GSRA 7FABL 5IQ7L 3UC0L 4C83A 1U8JB 1R3IL 4P2RD 2YD4A 3PGDB 5JOPD 4S1SL 5C0DB 2ESVB 3RTQB 1FL3A 4MHHG 5HJ3A 1OT2A 3RVTC 1V3JA 4HG4J 5CFHA 5EU6D 2ADJB 3O6FD 4YLQT 2HH0H 4I9WD 4N8PA 3LKOB 4GBXA 1BFOA 3JWOH 1S7WA 4ZPVB 3H0TB 4LVOB 1U8PA 4OZGB 4QRRD 4PUBH 5E6IA 4X9HA 2FX7H 1WC7A 5FUCC 5FO7B 3NACL 4YQXL 4P5TA 4GBXB 2C3VA 4KQ4L 3D5OF 4IBLT 4ZS7H 3QIWD 5ISZE 3O3DA 1ITBB 4NBXB 1I9JH 2MQ0A 1QVOB 3FB5B 3TV3H 1FV1B 3B9KD 4TSBH 1XF1A 5IJVA 3QBTB 3P4OA 3UTSB 1DLFH 4OCWL 3IJSB 4NRXB 5EG6C 3AROA 3MRIB 2Q8BH 5BS0E 3CMOH 3EJYC 5DRWA 2YS4A 5HGDA 4TSAL 4HXBL 1AXSA 5JPMA 1BQHA 3TNMA 5HYJE 1WBZA 4P5MB 4J4PD 4OI9A 5D7SH 2F19H 4YDIH 1MSPA 1WBXA 2DRUA 5D7IF 1QSED 1MUJA 2VE6A 1F4XL 3MJGX 2X4TB 4Y4FA 3QEQB 5JNYB 2DQHH 1U92A 3F12A 4X6EB 3BXNA 2X4QB 5CD5C 5FYJE 4HF5H 2HJLA 2BY0A 4XNQB 1JIBA 5DDHB 1AGDA 4F58H 1BAFL 2V2TA 12E8L 2GY5A 2K3TA 1NGPL 1UZ8B 3BUTA 4BZYA 1KB5H 1DJSA 4Z77A 5DJCB 2NY3B 4J6RH 3K0WA 4P2QD 3AM8C 5I9QB 1KLUB 5EU6A 3S35L 2AVGA 4RMTA 1LEKB 4HIXH 3VDCA 2QKIB 2EO9A 4NZUL 1KB5L 3LKSA 4OLYL 1D6VL 1GPOL 2AV7A 1MAMH 1R3KB 4F7MB 2R8SH 4ZFOL 5I30L 1FSKC 4K94H 3C5ZB 3LKSB 3S96B 1MCDA 3H3KA 1CI5A 3WYRA 1KNOA 4F8QA 1DUZB 5E8PB 1INEH 1FPTH 3OMZA 4QRUB 4M7LL 1EGJH 1JV5A 2AI0L 3F7VA 5F9OH 1UWEH 4PJAE 2YZ1A 4QTHA 4ZS6D 4UZGA 2XTJB 1M71A 4M6ML 5ESQB 2L4OA 1PBYA 3P2TA 4G8EA 4CNIB 2CDGB 3HI5L 3UTSE 3M1BB 4RFEB 3X12A 3BW9A 3KPLA 5T33L 4WO4D 4U3HA 3VWJC 4FFVD 2VQTA 3A6OA 1AJ7H 3DVNB 4X6CA 1AIFA 3FB7B 2GCYB 1F4WL 2JJSC 1QKZL 1QLEL 5J9PA 5H94B 5C09E 1IC1A 3BZ4B 1EDQA 1FRGL 2DN7A 3C2AH 4KHXH 1WV7T 4WNQB 1QBLL 1KJ2H 1P69B 1QFUL 3ARDA 1DDHB 2W9LA 2R23A 2JJUA 1L0YA 4XBEH 1J18A 3GKZA 1YEDB 2HT4C 4R97B 1CR9H 2IPTL 4CN6A 3MODL 4HUNB 4GMSL 3WE6B 1AGFA 4JLRA 4UQ2A 1PQZA 3BAEL 2X42A 5IHZA 3H42H 3EYFA 3BX7C 4G8EB 4CNIA 4GRWF 3T4YB 1NEZG 3NTCL 3OWEA 2J3SA 3MV7B 1ZA3A 2Y9RT 5ACLA 3IJHB 5HD8C 3MLXH 1T3FB 4NQEA 5D1ZC 3PNWB 4YBHA 3U0TA 4D8PB 2N4IA 1HCFX 2AJXH 1FGVL 5IJKC 1RZIA 4G3YL 3MRNB 4JPIB 4CU7A 4F57L 1X6NA 4MNGB 1JUFA 4XP9L 1KN4H 2X44D 3L3IB 3O8XA 2B1AL 4E5XB 2XFXB 4CN1A 4RAUA 1IZKA 5D1QB 3E6FB 5TE7L 1EEYA 3L1OL 4YDKH 3N85H 4PGDA 1M7IA 3B8SA 3HUJE 4M5ZH 4YDKL 3T08A 5KG9A 2J6EA 1TCRB 2VITA 4E41A 4Q6YA 5D7LB 2VQ1A 4R4ND 1U3HD 2GAZB 2FJFB 8CGTA 4Z7QF 3LS4L 1F4YH 1UGNA 5C8JB 1CS6A 3CK0H 1KN4L 2ERJC 4LLDA 4PJXE 3R8QA 2NY5L 4PJFB 3WL9B 1CL7L 3VD9A 1MAJA 2DYPD 3ESUF 1DTUA 2YUZA 3K3QA 3MLSL 3B2UC 2CMRH 3CCHA 4NWUH 5F9JB 1QEWA 3LV3B 5EIIB 5JMOC 1ORSB 4MWFA 2VN7A 5FDWB 4O2EA 5AZ2L 3PWLB 3MV7D 3CZJA 1XCTB 2J4WL 5FA4A 4GQ9L 1XMWA 4MNGA 1ZT7B 4XNYL 1OP5K 1OP9A 4FMFA 1R24B 3DUHA 5BW7A 2YHGA 3SDDA 1CDJA 4GRLB 1ZT7A 4UIKH 4ETQA 4Y1AA 1M7IB 2LQRA 2VH5H 3NA9H 4ZFGL 3CLEL 3RP1A 1KCVH 1TCMA 4QRTA 3BZFB 4J3OC 4KRPB 2NYYD 2GT9B 4TQEL 4NZJA 1F2QA 1TNNA 3SDYL 5DQ9A 4CMHC 2CJUH 3T0EB 5L9DH 2KZ1B 3O11B 1VA9A 5D2NC 4LGSB 2DI8A 3V5DA 4HEPG 1JGDA 3QEGL 1ZKAA 3NGBB 4MQSB 5JLZA 1EUTA 5CD3A 1NUFA 1FCGA 4GAGL 2DTSA 1MWAB 3C08H 1KIQA 2AJ3A 4Q2ZB 3SGKC 2AEQH 1RZJC 2BSRA 2P5EA 3QIBC 4HGKC 3PXJA 3GUTB 2H32B 5JDSB 3UYRL 2QQNH 3VGFA 5BVJB 1UACL 2ESVD 3RTQD 3T0WA 4ZDHB 4V1DE 1OAKH 4ODTH 4YHIA 5T5FL 1TPXC 3H9SA 3MLTB 2X1PA 2HJFB 3FQRB 4PLKC 3ZE1E 3VFTB 3CFKA 2QSTA 4PRBB 3T3PF 4YHNB 4JZJA 1WEJL 1VEPA 2HP4A 4LSVH 4Q9CA 3ARED 1TZIB 3QQ4A 1A6AB 1AKJA 2X4PA 3D18B 1RZ8A 2ITCA 3KNBA 4LCCA 5HHVH 4AEIH 1CICC 4NWTH 4MB4A 4K94L 5DO2D 4G5ZL 2O5YH 3V8OA 4AT6A 3NBNA 3QJHA 4G9FD 2P8PB 1K8DB 1P4BH 4G80B 5DD6B 1OAYH 2A9NL 4YDLC 1DBMH 4C4KT 1Q9OA 1IQDB 3S34H 3RPKA 2YPLE 1JK8B 3T1FB 3BDBA 5I74B 3M07A 4GXUN 3V6BR 5L6YL 1NSNL 1WZ1H 5BRZD 1CTOA 4MAYD 5BMFH 5D71H 4PRAB 3BUYA 4K7PY 2A6DA 4DK6A 4OZIB 1WAAE 1A7RH 1A4KA 5I1JH 5K9QI 2APTA 3BSZL 4ZDHA 4F58L 5E9DB 4UDTB 3VFUA 4YHIB 3STBA 4LLYB 2CR3A 1CGSL 4ODWB 3ARYA 5C2BH 1FVCA 4Y19D 3QZWG 1JFQH 3Q1SL 3IDIB 1KLGB 4O2CA 2MQCA 5T33H 3DMMA 4Y5YC 3LKQB 3T2PA 4BSWA 4C54A 1CBVL 1UM5L 3U7YL 4GKOA 4KZDH 4FFVC 4LSRL 4XC1H 1BJ1J 5C0DA 5FECA 3L95A 2ZG1A 4PJDA 2WANA 2V9RA 2FO1A 4K94C 3C09C 5IOPB 4ZO7A 1IMHC 4FFZH 3GSRB 4EKXA 4L3ED 3D9AL 4ERSL 3P30L 5HYSA 3R1GH 4FQ2H 1N6QL 3L7EB 3QG6B 1MIEH 2DMCA 1B2WH 1CE6A 1AR1C 4HWZA 1MHPL 4R3SB 3FQTB 1ZHLA 3MLXL 4KKBD 1LEGB 4L29A 4ZUVA 2QADC 1XZ0B 2A2QT 4QWWC 1REIA 3HE6D 4JDVB 4AYFA 4FQLL 4P59H 4OLWH 4YHLH 4I0CC 5IJVB 5C0CE 2DKMA 1Z9MA 4HX1A 2IPUG 3U4BL 2R0WH 3GHEL 4NKQB 4YH6A 1HEZA 3BZEB 1T83A 3HG1A 4LLQB 1YNKH 4NQDD 1S8DA 2KPNA 3CU7A 4P5MA 5E24E 5DJDA 1R3IH 4JAMB 4MNHA 4MD5A 4K7PX 2ZOKA 4KPHL 3ZDXF 3BQUC 5IWLA 2WWKT 1FAIH 2R56L 1BECA 2M26A 4HXBH 3W0WE 2CRYA 2LTQB 3Q0HA 2JB6A 4MXQD 4MAYA 3MR9B 4DUWA 2JB5H 4N5ED 1NMAL 1MHCB 4OAWB 3TJEH 2X4RB 3TO2B 3H9HB 3QDHA 2VDKH 4TSBL 3I3EA 1C1EH 2VZTA 4NRZB 2ZCKH 2HKHH 1SVCP 3T1WA 4PIRF 2GSGA 3RZWA 1OF2B 3EFFA 2SEBA 5F89B 3D3VB 1YEJL 2AJUL 3VFGH 3WS3A 1OSPL 2XZAH 1FGNH 2VAAB 2FEDD 2CDFB 3AS1A 2BJMH 4RAVB 1WZKA 2FX7L 3QHTC 2WBJD 2CMRL 1Q72H 3DRTB 3C5ZA 4PRNB 2AXFB 3PWPE 5F8QC 1I9RL 1DANU 1IGML 4RAVA 1UZ8A 2CO6B 1N59A 3SKMB 1L7IL 4N0YH 2XN9A 3VFVB 4OCSL 1EZVY 2VXQH 1U36A 4J1UB 3MV9B 4U1LA 4XRCA 3WLWC 5E8NA 1AO7A 1MRFL 5EU7C 3QIWA 4M7JH 3SDCD 4M7LT 2OYPA 1LP9A 3RWGA 5I6XC 3MR9A 1I8MB 5I6XB 2W91A 2ZP0T 4U6YA 5DMJB 5ICZB 2PCPA 1NLDL 3OAYK 4EQ2A 5TE4L 3H9HA 5IFHL 3BIKA 1NKOA 3MRBA 4OF3A 1MQ8A 1BAFH 1ZHKA 3O41A 4K8RC 5DRXA 2E6JA 2QSVA 1JZ7A 1QFPA 3BT2L 1TJGH 2EC9U 4BUGA 1FVEB 3IFLL 3EYVB 1P7KA 3F7YB 3IDNB 1T66D 4JGJA 4Y89A 4ORGA 3JV4B 4ONGH 3SGKA 2OZ4H 1NUDA 3AREB 4PGJA 1F90L 1R0AH 5BV7H 3V79C 2F19L 3KJ6H 4BQ8A 4WW2F 4YO0B 1HWGB 3AFLA 1HYSC 4Z95H 2EDLA 1WFTA 3P9MB 1CFSA 1AC6A 4YHPA 5I66A 3M1BA 4LSUH 4RFEA 3X12B 5IHLB 5I15H 1INQA 1CU4H 2XN9B 3BI9X 4OCWH 5DTFA 3RY6C 3VI3F 3KG5A 3LB6D 5TDNA 1S3KH 2H2SC 3BN9C 3CVIH 1Z5LB 1UCTA 3PDGA 3L3KB 1NCTA 4LL9A 5CEXB 1CT8B 2UUDH 3MA7B 3ROLB 4FP8H 2BNQB 3TVMB 5D6CB 3DUSA 1OTSD 4XCEA 2FRGP 4JO3L 5FYKD 1QQDA 4AMKH 5EORL 3PWUB 1CGYA 4N1EA 1IAIL 3EOAA 1KJ2L 3NA4A 4KUCD 1NEUA 3OSKA 4RFNC 1QKZH 3MRFB 3BH8A 3DSFH 4G43A 4G42B 2CD0A 1T1WB 5D93B 4UMGA 1QLRB 1XFPA 1HHGA 1I8LA 1WIOA 3V52H 4ONHB 2BHUA 4KHTH 1NGWB 2IQAB 3ARFC 3ARZA 3QA3A 5GPRA 1SEQL 5L2KE 1F45A 2VC2H 2IWGA 1D5MA 4QEGA 4Y4HA 4HJGA 2VB5A 5D7LA 1AO7E 2AEWA 4OUOA 3OKLB 4WWKC 4YFLI 4NFCA 4YAQB 1B9ZA 1C5DB 4KJPD 3O45A 1FFNA 2FATL 2JIXA 4MNQE 3SKNA 5ID1A 3QXAB 1DBKH 4ZTPL 3V6OC 2CO7B 4JPKL 3VRLF 3VD7A 4N0CD 3L3IA 1YEEL 3ZE0E 1BQHB 1RUQL 4CVUA 1N26A 1A7QH 1F58H 3L7FB 3QIUB 4AIZA 3DHMA 1HZHH 2WNGA 3MUJA 4LQ1A 5I0ZA 1TQCC 3AXLA 5C09B 4OD1L 1JPST 4YGVB 4OIBA 3STLB 3S96A 1RUKH 2OSLB 2AP2A 3BXNB 5B39B 2CIKA 1RU9L 1NAMH 3W9DB 1UJ3A 3PL6C 4JFHE 2Y06L 1Z3GH 1OQOA 5CGTA 2ZUXA 1U41A 3IB4A 1OP5H 1FNLA 4OFYD 2CIIB 2GJ6B 3T0AA 1OTUD 1HXMA 1JJUA 3QNZA 3HAEG 2X1OA 4M9OA 5I73C 2PYFB 4GT7A 4OM1L 1CL7I 4UV7H 2HMIC 4L4TA 5I75B 1K5NB 3H3PL 3HE6C 3S37L 5L8JB 4GS7C 1TZGL 1UG9A 4LFHD 4N9GA 3B5TA 5E2VL 5ALBL 3P0YH 3CDYA 2BHZA 1MCNA 3JXAA 3P73A 5HYEA 3TA3D 1MCRA 1ZGLA 5F3BA 4NHCH 4DN4H 4ZNEE 5JLZB 3GMMB 3VFRB 2IANE 3C87A 1J8HE 3LDBC 4WTZA 4NT6A 5SWZA 3QXTA 4HSQA 1HHJA 2C4FU 2ARJA 1XT5A 4GAJL 3KJ4C 5GGTH 5L2KB 2VC2L 1A3QA 4PTTB 4ELMA 4N68A 4PY8I 1U8OB 4QHUB 4AEHH 3ZKQD 3QEGH 4K71B 4D0CB 4U05A 5B3JE 4YHNA 5FYKH 4WW1B 3QDMA 3BT2H 4GAFB 4WI9A 1UB5A 4ZTOL 2DIAA 4HMDA 1JPSH 4W81A 4XCCH 2PTTB 5IMMB 2A1WL 1XGTB 4M7KL 5HYSG 1S9WB 4BH7A 5DD3L 4AY0A 1E28A 4UQ3B 1HILA 1IKNC 4G80A 2HT2D 3FAWA 3DJ9A 3LN9A 4AT6B 4LF3A 1ZLWH 3CVHH 5F88B 1G7IB 5J9PB 3GJFB 4BQ6A 5CWSA 1S9VA 4N0YL 4JM2C 8FABB 4JFDD 5DD1L 1KCRL 3GJFA 4XVJH 4RGOL 3LQAL 3MRNA 5E8DL 2MJWA 3K4ZA 2D4FA 3QXDB 2W9EH 3O4LE 1L6ZA 4A6YA 4DVRL 2CKBH 3GDBA 1JTOA 4KMQA 4IRSD 1I1AC 4NP4L 2VLRA 4LPWA 1MEXH 5IW1A 2QV2A 2VERN 3I50H 4P23A 1L9MA 5EZOH 2M2DA 1ZA6A 2HVKA 1D3CA 3UO1H 1A1OA 5GRWA 5AYUH 3NGBC 4L8CA 3KJ6L 2BVYA 3CMOL 3KPSE 4OZ4B 3KXFE 4NO2A 1AXTH 2DTMH 5GGQH 4X4XB 2JB5L 3ARQA 2VXVL 1I7TA 2ZJSL 43C9A 1CGSH 4PJDB 2EYRB 3MRDA 3BKYH 3NCYS 4N5EC 1FC2D 3LZFH 4PYHA 1EEZB 5GGVY 1EBPA 5IJKA 3VU2A 1QRKA 4ZFZB 1BBDL 2FZ3A 3LQZA 2PW2B 2HA1A 5INCB 1AKJD 1T66C 4UTAH 5F97E 4LCYA 4H5SA 4Y4FD 1LO0H 4LLYA 4ZOCA 3RY4A 4A6YB 2EDTA 2HT3D 3QXWA 4HPYL 3DARA 1KPVB 4JFZL 1G9NL 1Q9KB 4X5WB 3Q3GA 2DI7A 2F53D 3O3BA 4RX4D 4AEFA 1XF3B 1RJYB 1FO0H 4TOYL 1CGTA 2FEEI 4ELMF 2O5YL 1DSFL 2OJEB 5IVZA 3KPRD 3U7AA 1Y18B 1J0ZA 1XGYH 4OT1L 15C8L 1BD2A 2V9TA 2ZWLT 4G6KL 4Z7WE 1JHTA 2YK1H 5DC9B 2HLAB 3HZKB 4JFYB 2ORBH 3EBAA 5GZNC 1MHPH 4L5FL 5AAMA 4LSDA 3WLBB 1EA9C 4XAKD 2P8MA 4NM4L 4ZAKA 1QNZL 1PZUB 4S1RH 2CRIA 1NBYA 4OM0L 4XTRD 3C6SA 5IGXH 2KQMA 5GGVH 2V17H 2AV1A 1OTTC 1BM3L 2PW2A 4R3SA 4K8RD 3NZHH 3RWDB 4YHZH 2BRRL 3HZYB 4PJCB 1ZEAH 1JGDB 2DQTL 4OLUH 4UV4L 4NO3B 3C60C 2X9XA 4JFDA 1K9TA 5I1DA 1EFXA 3N1MC 4CDHA 4NCC2 4BFIB 2VTFA 1Q9KA 1G6RB 4H25B 5C6WH 1K3ZA 3C60A 1KG0A 1SBSH 2Y72A 1J12A 3RY6A 1QRNE 4Q9RH 3MLTA 4LPTA 1UCBL 1JFQL 3DTXB 1J1PH 3VXRB 3QO1B 2OXGA 1RJCA 2PF6A 5LGKA 1MCIA 4OGXL 2V5MA 2Z92A 3MFFB 3KLHD 2OJZH 1T21B 1GOFA 2WBWB 1IGYA 3ESVF 3X13A 4TTDD 2NY0D 3B5GA 5GISL 3WLBA 3BDYH 5DQJB 1QSFD 3OAUH 1JNHA 4FQCH 3QCUH 3BP4A 4B50A 2IH3B 3GIVA 1G7PA 4U1SA 3NFNB 4M6OL 4F2MB 4OD3L 4QXGH 1T1ZB 5DJZB 1Q94A 3G6AA 4CU8A 1I8LC 3CC5A 1FNSL 3SY0B 4AENA 4X5LA 5GGRY 3VXQB 4BZ1H 3ARFA 3K80A 2LU3A 3KDMB 3W2DH 4PJGB 4AL8H 4Y4HC 4XXCC 5KSBF 1RIHH 2E8YA 5BS0A 3S98A 3Q5TA 3WFEH 3DO3A 1C5BL 3GSWA 1JYVA 5I1KH 3QWOA 4KKLD 3KYOB 2HRPH 5CSGA 1WFOA 1QSFB 5HYJA 3D18A 1P53A 1OAUL 4L1DA 1PSKL 3U1SL 2LVEA 1S7SA 4XNZC 5F6HI 4Z7WA 5T1LA 2HMID 2Y5EA 1A14H 3RGVC 3T8XB 4WDIA 4J1UA 2ICWI 5L2JB 1LILA 4XRCB 4QRRA 5JPNA 2RB8A 4DVRH 5JHDD 4TVPE 3TA3C 4OZHB 3L5HA 4HLZH 1YNKL 3MRQA 1YNLH 2FIRT 2GTZA 3NCEB 3UZQA 1X4YA 5C08A 5F70A 4EQ3A 2R0WL 5DJAA 5TFSL 4TRPH 3BISA 4AENB 4LEXH 2P24B 1FN4B 3WFCL 4OIIL 5EBGA 3QCTH 3U4EB 4LDEB 3KPMB 5CJOL 4TSAH 4X99B 1G9MC 3CXHJ 4IRSB 4M3KB 1B6UA 1ZT4A 1ZE3C 5IB2A 5C0IB 4FQJH 4MSWA 3WNNA 5D6CA 2NXZC 2AKRA 3ROLA 5B39G 4YHOL 3DYMA 5I1EL 3MXVL 3TM6A 5T1MB 3I84A 4X4YA 3F6IA 5IW6B 5FO9B 4Z7VB 3QYCA 3GZKA 5DYOB 3S97C 1C1EL 5C0ND 3QWRA 5F1IB 4ZSOE 4JRYE 2F9BT 2H6PB 5GHWL 4LRNL 4N8VB 1L7TH 3HG1D 5KN5B 3X11A 3L3DB 4DFHA 1QFWM 3FHQA 4P46A 5JPNB 4HWNA 1IEAB 1F3JB 4JAMA 5IIEB 1RQ5A 1NGZB 5EB9A 5FCUL 1FZMA 4FQHA 2WP3T 4Y4KB 5IQ9B 5D2LB 3NZ8A 5F7DA 3ZKND 5JQ6H 5EU6B 2HVJA 4UB0H 5GZND 1AQKL 1FZMB 3F58L 2NNAA 3SOBL 4OFYA 4PLOB 4HX1B 2P8LA 1ZHBA 3EO1B 4HDIA 3GGWA 4TVPL 3PP4L 5IEHB 4HC1L 1MPAL 3ECBA 4QO1A 5TQ0H 5EC1B 1A2YA 5HI3D 4L8SB 3OJDA 3BPOC 5CZVL 2ICCA 3EYSH 3WIFA 3VE0B 3GB7B 5DYOA 1HHGB 3ETBF 1YPZB 1IM9A 4HHAB 4P4RB 1TQBB 2DQTH 4MJ4A 1YN7B 1WFUA 4OZGE 4PPTA 4G3YH 2J5LC 4LCUA 4X6CF 5FO7A 5KS9E 32C2B 3KS0H 5GGVL 1OARL 3X14B 4PJ7A 1UJ3B 4NQEE 4Z7UF 1EHXA 1YJDL 2FB4L 1JF6A 3ZZ1A 3D48R 3TZVA 1PKQB 5L0QB 2X70B 1X5YA 3RDTD 1XGRB 3TO2A 2BSED 1WEJH 1NBVH 2NY4C 4XVTH 1JRHI 5D2LE 3C2SA 5A2LH 2QSCH 2FHFA 2A6KA 3VWKC 2VLJA 3MJ7B 1N5YL 2F54B 5D4QA 3FJTA 3QIUD 1AI1L 2Z8RA 3QPXH 2DWDB 1A9EA 3HE7D 2WBJC 2DQFB 4JZOB 3WKNA 1WF5A 3QUMB 3Q1SH 3W39B 3RWJB 1KPUB 2EE2A 1P7QB 1T7VA 4ENED 1QR1B 1NEZB 5EC2A 1JWUB 3QEQA 1JZ3A 1WCQA 3CLFL 2NY2D 3AMKA 1FQ9C 4PB9L 2CLRA 2FLBT 1U3YA 3RWEA 3N1PC 3SQOL 1NAMB 4KKLC 5HI5C 1AQDB 3O4LB 4HJJL 4PB0H 1IC7H 1J05B 4GMTL 3UDWA 5HYIA 3RAJH 4ETQB 1OOAA 3D87B 1IJ9A 1PZ5A 1T3FA 1U8KB 3QJFA 5CEZH 3CSYB 2KUTA 5FF6A 3TNNB 4XHQA 3MRBB 4W4OC 1AP2A 2YD6A 4KDTC 5EUOF 3VRIB 1FAKT 3O2DA 1UM6H 1XR9A 4MXWH 4LNRB 4M1CC 1RURH 2EEAA 4NDMA 3O3EB 4OLVL 4CBPA 1N3NA 3SKOB 1AR1D 2DQUH 4KKAC 4R26H 2EEBA 4IOFC 1T83C 4TNVF 3TJHC 4LPYA 3U36B 1YJDH 2FB4H 4JO2L 1N6VA 4XPAL 4RISL 3VXMB 2IALA 4LEXL 3KYNA 3QUXB 3IAPA 4F9PC 4LASL 4WJ5A 4NO5A 3RVUD 1Q0XL 2ZOLB 3ZLQC 1AGFB 3U2SB 2X41A 2BVQB 3SO3C 4BH8B 5TF0A 2MWCA 4D0BB 2Q7YA 3FB6A 3MCLL 2ERJB 1F3RB 3TNNA 2P45B 3T2QA 1MCOL 2D0HA 5BV7C 3EO0B 1I9IH 4YAQA 4U1GB 1X7QA 2A83A 4QWWD 2FSEA 1CXIA 4WY7L 5CSBA 3DX8A 2A73A 1MRCH 3CDFA 4KTDL 3PNWA 5T3ZL 5LKNA 3S3PA 1BWMA 4YEEA 5EFIB 3MMEB 1B0WA 3CLEH 1I1RA 2EXYD 4YK4B 1NC2D 3L7FA 3QIUA 4AIZB 2BOCB 3S88H 2OLDA 2P5WA 4XHJD 2YC1B 3VXSB 4DGIL 2HG5A 4OZIA 2IANB 4OLXH 2H26B 4M3JA 5C0BE 3WUWB 1X5GA 2HWZL 2D31A 2BNQD 3ARGC 1JGEA 5ICYB 4P3WA 1BZ9A 3DRQA 3VXSA 4LU5H 1PY4A 4WHDA 3RVVD 1H3GA 3U2SA 3SCMC 4K8RL 2DM4A 2NY1D 4HUXB 3QUML 4YXLH 1MFAL 4KJPC 2C7UA 5A43C 4KJYB 1DBAH 4Y4KD 5C3LD 3KPTA 4MA1B 4RAHA 5EU4A 1MI5E 1D6VH 4HUXA 1A21A 3IU3A 1YC7A 2EIBA 3KVQA 2PYEA 4KK6D 3BPLB 1MCFA 1NFDE 4Z7QE 5FB8B 5CIPH 1X5XA 1GCFA 5GGSA 3CCHB 1OM3L 3WV0A 5C1MB 5CEZE 3O8XB 5KANI 3GSOB 3BRGC 5C0NC 3IS1X 4WRLA 2XFXA 3MV11 4MQ7A 3PUCA 2NY2C 4K3DL 2R1YA 3C5JA 1E0OB 2CIKB 4HMCA 4MB3A 4P3DB 1TJHH 1ZLVH 3VXPB 3FRPA 2ARJB 5HI3C 1MY5A 2W0FA 3R8BB 1IGFL 5HHPA 3IFPA 1FH5L 2P49B 4MS8D 4Y1AB 5F7NC 3SDDC 4M6NL 1FFPB 4PJGE 5BOPA 4OZHE 3ZKNC 3QO1A 5D7JC 2ICWJ 1CDYA 3ARBD 4KK8D 5E2WL 4U6VL 2NZ9C 4M6AA 4HZLA 1VENA 3HI6H 4WFED 3MX0A 1DLFL 3DBXB 2HTLD 2X10A 4O2EB 2VQUA 1G7IA 1HH9A 2IBGA 1V05A 3IRZA 4IOIB 4OF8A 3UJTL 3O2VL 4R90L 2RJMA 1A3RL 4XPTL 4EI5D 2VR5A 3RWHB 2BSSB 1NDMA 5CIPA 4MVBD 4O4YL 4JKPH 4AZ8A 3TT3L 4Y0GA 5CD5D 3VXMD 2IADA 5BS0B 4APQB 3ARUA 4JN2B 5A2JH 4G6JL 3O6KL 4X7CC 2VXTH 3WIHA 4LSRH 3ZE1F 1Q9LA 2P43B 3PABB 3QEHB 2G5BB 2WIIB 4TOYH 1S7VA 1NCCL 4IJ3B 2ADGB 1CVSC 2JLLA 3B6SB 3V5HA 3TCLB 5I17A 4HULB 4L8CB 3CXHK 5E5RB 3P4LA 3QUZC 4NKIH 1Q9WA 5BW7C 2BFVH 3MOBH 5FGRA 5SWQA 3B3IA 4J3SA 1DQLH 3VFMA 3BP5A 3QJHB 3W82A 5ETUB 5F7KC 1R5VB 1DFBL 4UT7L 3GHBL 3OAYH 4MXVE 1CFBA 2LVCA 4Q97A 3TN0B 1HDMA 1PSKH 1QPPA 2OCFD 1LEGA 2MOVA 3ILQC 3U1SH 4JFOA 4N0UA 1EVUA 3BP5B 3EDJA 3QUYA 5ID0B 1SY6A 4XB7A 3GSXB 3VG9B 1OAXH 3IF1A 3KYMA 3GNML 5I1AA 5D72L 4JREC 4TPRL 3GBNH 1T04B 3GMPB 3FQNB 5D5MB 1FLTX 5LXGH 2PO6A 3E8UL 4R4BA 3VXNB 4Z0BL 4EZMA 4O9HH 4Z8FL 1NPUA 4P2YA 5I8OL 3OPZL 4ODUB 1MCOH 3L5JA 4JN1L 4U3CA 1NLDH 3DV4B 3NACH 1X5FA 3DETD 2CLZB 3HHRB 5C0CA 1XCQA 1I7RB 3OF6A 1CFVL 2A6JA 3MRIA 4OZHA 3OKNB 3HNTL 5F44A 3IYLW 4NO0A 3N0PB 5JW3H 3O2WH 5AUMA 5H37G 4PRHD 1UXWA 2J8UB 5EUOE 1MUJB 2LFGA 3PWJA 2W65A 2DQEH 1ORQA 4JO2H 3DX9B 2JJTA 1YEGH 2YRLA 3EGSB 4WWKA 1P2CA 2DQDH 4PJCA 3V8CA 4DGYH 1IL1B 3M8OH 5KS9B 3TO4C 1OHQA 3O3BB 1ED3B 2AXHA 4P4KA 1R3JB 3TWCH 1IKFH 1WICA 5CILH 4LBEB 4TQEH 3UDWC 4KVNL 3OB8A 1IFHL 2E27H 3CJJA 4LIQH 1NANI 3GGWB 3IJSA 4NRXA 1U91B 3BKMH 3MLYH 2XWJA 4R6UA 2F5BH 1MIMH 4EN3B 4D0DB 2NMSA 4NQCB 1A1NA 2OL3B 3SGEI 3ULUD 1U2HA 1CGXA 5IUSA 4HLZG 5TE6H 2DICA 5CZXC 3B5HA 1CDCA 5DUBA 5J7CC 4PJ5D 2E9BA 2OBGA 4PR5B 4XVSL 2VLMD 4ODHL 1PVHA 1IFHH 2E27L 4LIQL 3RWDA 2EIZB 4Q9QH 4EI6A 1AO7B 2ILLA 1IM3A 3B2VL 2NY6D 4GKSA 4S1QL 1NBZB 2E5EA 1JV5B 3LKOA 2PO6D 1FC1A 3SDCA 4XVUC 1V3KA 4P5KA 4MD5B 2Y07L 4N0UE 4X6DA 5E8DH 1PKQA 1QO3A 5IESL 1JN6A 1OW0A 4KJQC 1A6UH 3UTQB 2I07B 3MOQA 4QRPD 3EYOA 4P5KB 3U4BH 5EC1A 3KDMA 1FYHB 4LBEA 4PJ5B 2PR4L 3RVWC 4LP5A 1EXUB 4JM4H 2N56A 4W6YB 2R69H 5LBSH 4M8VA 3SGDH 3CVHL 3CK0L 2WQ8A 4WW2B 1BVLA 2XICA 4Q6IC 4JANA 4HHAA 3WD5L 3M45A 3HC4H 1ADQL 2OL3A 4RRPA 3QRGL 3RA7L 4GKNB 3UTTA 4M43L 2YPKA 4WFEE 5FM8A 1JPTH 4U3XA 3BP7A 4M7KH 2RCSH 4HKJB 2APXA 3ZKMD 3U79A 3MO1A 4XP4L 5DI8B 3WXWL 4P5TC 2J6EH 5JPMB 4ODVH 3UJTH 1S7UB 3BGAA 2AXFA 3TVMD 1NAMA 4OLUL 3RQ3A 4U1KA 2DQHL 3MO1B 1AGCA 2WMPA 5DLMH 5IMKA 3WJJA 4N90D 3UO1L 1RZ7L 3UJJL 5ITFA 5J56B 2EH8L 3T77A 1I85A 4JLRB 4UQ2B 2I26N 1KOAA 3D39D 1I8MA 1U8HB 2OP4H 3WIIL 1CVRA 3ALPA 5IKCA 3TVMA 3B9KB 1I4FB 4OLZH 1SEQH 1I85C 4PJAF 4TULH 5DJ6B 4PJ5A 5K33A 3KPPA 4HUVA 2E9JA 5J89A 1H3UA 1WIPA 3NAAL 3I3DA 2V7HB 3VGHA 3U0TB 1NCBH 1W8NA 4NKIL 4IMKA 5FV1L 2ZCLH 2GFBB 1DQTA 2HT2C 3BAEH 4PJ9B 5JQHC 5DUPL 1MOEA 3BWAB 2C4XA 4FP8L 4PGCB 1I1AA 4NKMA 5FO9A 4CJ1A 4NOFA 4N1HB 4G9DA 5LWYL 1BJMA 4S10A 5EO0B 4PRHB 4HPYH 4PJAA 4GRMA 2Y07H 5M7QA 4WFFD 5E8NB 4AIOA 4WJ5B 3MGOA 1K6QH 1KGCD 2B4CC 1MJJA 4YIQA 3UAJD 3AM8A 5B21A 2D7TH 2Q20A 3O45B 2F53A 4RX4A 3DOSA 4HK0B 5EU5A 3DETC 1GGTA 1KJ2A 4X99A 5KS9F 5FGBC 4E9LA 1RUQH 2ZPKH 4P0DA 3WUZA 4I3SL 1NL0H 2ED7A 4ONGL 4HUVB 4F80A 3HUJA 1F8TL 5E00B 3D6GA 1WJ3A 2B4CH 3U36A 3O6FC 1A6ZA 3NIDE 4JPWL 1ETZB 4V1DB 4YPGB 3FTGA 3GSVB 4OZFG 3OX8A 1T0MB 4MAUL 3UTTE 5TFSH 4ZXBD 5FDWA 3QDME 4P46C 4WUUA 1OP3H 2C1PA 3HNSL 1IM9B 3WUWA 3ZT6A 3BKCH 2BVQA 3WNLA 3BP6B 1H0DB 2VN4A 2PO6C 3O9WB 4RGOH 3FFCB 3EHBC 2DOCA 4C59B 1GIGL 3P77B 2R0ZH 4ONHA 1IAII 4QHNB 4U1NB 1N0XL 1NMBL 1DL7H 1A7RL 1XF2A 4ISVB 5CEXA 3DVIA 4G8GA 4XGZA 1OD9A 4KAQL 1F5WA 3MRPA 3EDFA 5C0FB 4ZXBB 4ZUTB 5ACZA 5FDYA 4EVNB 2F54D 1MQKL 1RIUL 2NTSP 3ARDC 4ZFGH 4GXVL 5IB4B 2CH8A 1IGMH 4QTIH 2R0ZL 2GSIB 1R3KA 1TMCB 2VLRE 2JELH 3ZTJH 4OSUL 3IDYC 4RNRB 2FWOA 1MFAH 3HFMH 4RRPG 5FYKL 2ICEB 1VFAA 4NIKB 4PG9B 3K4DA 3DV6B 3JWDH 2R1XB 4QXGL 4GO6B 2C3XA 2ZUSA 3RKDD 5KTEL 4E41E 5I2IA 2XWTA 1S7XB 1UM6L 3UYPA 2OI9C 1IGJA 2OTWA 3TZVC 1CLZH 1SEBB 3EDKA 5F1NA 2PXYC 3L5XL 4PJHF 3ULUF 4F7PB 5MEPA 4PJXA 1DEDA 5TQ0L 1CL7H 3MJ6A 4X80L 4OQ1A 4JFFE 1UYWL 1M05B 2A0LD 1B4JL 1S7RB 1KB9K 4Z7OF 5I1CL 5FHAH 5IMOB 5HYQB 1OGAD 3TWCL 1H5BB 1H8NA 4L8BB 4D2NA 5IBLC 1JK8A 1EMTL 4LVEA 1A9BB 4LVHC 1A4JB 4M61A 2BSSA 1KIQB 2AJ3B 3MRMB 4RFOH 4RQQA 3L6FA 3CXDH 5HYQA 1J0IA 4UBDC 2O5ZH 1Q0XH 4MA1C 1XF5A 3CPLB 3S34L 5ANMB 2ZUTA 2MHAA 2H3NA 1UWXH 4MDIA 3QZWA 4UIKL 4LPXA 3VXSD 5EO9A 1OT1A 4PRBA 3H9YA 1ZV5A 2NXYC 2GTWB 5FHBH 2FIKB 4Q6IA 3O2VH 4R90H 4U6XB 4HV8A 3IJYB 3VA6A 2I60H 3WKMH 4LGPB 4H1LA 5CJ8A 4H20H 3K2UL 4P4KC 3TESA 1S9XA 2VWEE 2GJJA 3OZ9H 3DXAA 5GGUB 5CJOH 2D4DA 1CICB 5DURD 3LQZB 3P73B 5INCA 1KULA 4KUZH 5EZIL 3HC0A 4NN5C 4KZDL 4MQTB 5C86A 1G9MH 4PJFF 3ILPB 1EEUA 5DLML 3EOTH 2IH3A 1GZPB 5EOQH 4NO0D 4XMPL 4JCLA 1NANH 4KTYA 4OZFA 2EDQA 4NUJA 4YXKH 4UI2A 3ULUC 4MB5A 2MKWA 5ADOH 4I8DA 3UBXA 5I1AB 4HJJH 4PB0L 2OJEA 5IVZB 1PX4A 3LIZH 2H26A 1MCPL 4Q7DA 3LIZL 5ERWA 5JW5A 4O2CB 3GM0A 4I0PD 5F7FA 3R06A 1VDGA 2AK4A 1RY7B 1YN6B 3B4NA 1CG9A 2Z93A 1HILB 5GS1B 1I7RA 5K9JL 5KSUA 1FP5A 4YPJA 2A9NH 2YD8A 5C0GA 1DEEA 3QULB 4RMWA 4JKWA 1RFDL 3L7EA 4LLMB 4I0PA 1N5AA 2XPGB 1QACA 2M8XA 2EDWA 4WEMB 1QFOA 4EI5A 5H2BA 5MEQB 1FLRH 1OGTA 3MNZA 4XCYA 5DXWA 4Z7WF 5I8EB 5J8OA 4ALAH 2AJSH 2IJ0C 1EFXD 4FQCL 1J11A 1F13A 2UWEE 3RZCC 5IHBA 3X3FH 2D7MA 3PP3H 4P48A 2WZPD 5ESVA 4H5SB 1QSEA 2Y5TB 4FFWD 4TNVK 3ULVF 3DV4A 2PXYD 4IM8A 1OLLA 2BNUB 2EIDA 2D7PA 1KYOJ 1OPGH 1CD1A 3QUYC 2F74A 1WISA 5E9DE 1DBBH 2JIXD 4RIRB 1QA9B 3WFZA 1KENL 4LLVA 3S37X 4Q9RL 2GSGB 2X5PA 1IC4H 2R4SL 1RJLB 3ZT5A 2OTPA 2Y7QA 3OJVC 1X9QA 3QNXA 4N0FA 1KC5L 3OJMB 1QA9A 4MCYA 3CLFH 4QT5B 4QKXB 3E2HB 2IFGA 4U7SA 2Z4QA 3U9PL 3F5WA 1H8OA 1AGBB 4U0QB 5F7EL 4HD9A 3VFNA 4WWID 3IFNH 1RUPL 4MAYB 3BSZH 2YXMA 3QDJA 4CRPA 3C8DA 3OF6D 4HPOH 3GIZL 5I8EA 5JXED 4WEUD 2A38A 1CK0L 2BY3A 3NIFF 4HEME 2PTUA 1NKRA 2FHBA 1HI6B 2XI9A 5EOCH 1L0QA 4LEOA 1T89A 4DUXA 4OZIF 5FAAA 3GMRB 5I1KL 1BVLB 3ULVE 3LEVL 5JXEA 4Z8FH 1BZ7B 2DWEA 2F58H 5I1HL 3GJEB 1QSFE 4R97C 1WBZB 3O81A 1KIRA 4JFQA 1DVFC 2EDHA 3TBVA 3F7YA 2X1XR 1IQDA 4KXZI 4LPVA 4PRNA 1OAXL 3C6SB 4I18B 4GG8B 5IVXB 4HIXL 1OY3B 1U3HA 2W0PA 4HT1L 1CGWA 3CXDL 5D1XD 3QIBD 4YZFE 5KVEL 4XPHH 1F4YL 1KCKA 2WAHA 3RVUC 4PRDA 3EYSL 1K4CB 4IRSC 3RWGB 2PXYA 3ZDYF 3UTOA 4NFBA 2EEDA 4IDJH 5A1AA 4ZOEA 5JORB 5E5UB 1LP9B 2XYCA 1EK3A 1X5KA 3IDGB 5FYLD 4PJHA 3C6LA 3VXRE 1Y0LA 3QIBA 4FXKA 3DX7A 5IB3A 5LCVL 5GGQL 7FABH 1F4XH 3L3GA 1GHFL 2OR9H 1HHKB 2VMFA 5DUMH 3PQYE 3NCBB 5C0AB 3BWAA 3HE7A 5HY9B 4O00A 5CKAA 4QRPA 1XGUB 3UP1A 3S5LB 3P9MA 4F15C 4FG6C 1E6JL 1GC1H 3QEQD 4CKVX 3PGDA 1L7TL 2FO4A 5CJBA 5T1LB 2X4SA 5GHWH 5T5NG 3SO5A 1SYSB 5FIEA 1IBGH 3WO4B 2FJHA 3GKWH 4BQCA 3MGOB 5C0JB 2F8VA 3CX5J 1RIVH 5D2LA 1XIWA 4GRLC 3GSXA 2AGJH 2VISA 3P0VH 4KV5E 4YR6B 4YDVB 1JRHL 4Y4KC 5D2NE 2YBRB 1KTRL 1SY6H 3TYFB 2JKXA 5JOEA 4JDVA 5GQBA 3C6LB 3ZHDA 3LH2H 2VO5A 1ED3A 3MZGB 4S0TD 5EOTB 5AYQA 4UIMA 4JM4L 4XPGH 2LV4A 5GGSY 2VL5A 3WIHL 1DR9A 4M9PA 2AEQL 3O3DB 2HAZA 3FQWB 5E56A 1V5JA 4G8GD 3MXWH 3PP4H 4W70A 5C0EA 4S2SA 1LD9B 3FTGB 3GSVA 4G8FB 3LRGA 4LSQL 4CMHB 2YKLL 3PWVA 2P4AB 4TSCL 3FO2B 3AREA 4KV5F 5I15L 3DVGA 3VDAA 3JTSB 1I8KB 3SE4A 3FN3A 1NGWA 3MRLB 3TFKC 4DFIA 3G6DH 3BKYL 2EE3A 3TC9A 2K7PA 5KS9A 4PGDB 2ED9A 3MJ9A 1JPGB 4KDVA 1X5JA 3PV6A 3CMGA 4NC0B 3QXAA 4NQEB 4ZYKB 4DW2H 2NY4B 1A5FH 5D7KE 3EAKA 4JB9H 5DC0A 5C0AE 4WO4A 5D7JB 2PYFA 4KK5D 3SDXA 5EZOL 3FRUB 3V5KA 3BYYA 4JY5L 4EI5C 3VGEA 3OB0K 1MRDL 4OGYH 1UXSB 1VCAA 3RUGA 1NBVL 1BQHG 2CDFA 5KSAD 3SDDD 2DS4A 3LS5L 1SM3L 3I02B 3H42L 3HC3L 3O9WA 4KAQH 4WI4A 1C5CL 4J6RL 3OJDB 3U48A 1AFVL 4XAWH 3F12B 2AV7B 5J11C 1JZ2A 2X4TA 1HXMB 5T3XH 3GIZH 1NCNA 3TT1H 5D1ZB 4U49A 4LCUB 1FO0A 1AGDB 2V5YA 5HHQA 4XP1L 5EA0L 4MLSA 5EO1B 3PL6B 3QDGA 4D0CA 4L9DA 4ZXBA 1DQQA 3N06B 5DHVH 4P23C 5FV2A 2UVFA 5SWZE 1OSPH 1T1XA 4YHKL 2PTVA 1QBML 4O58L 3A6CH 5ADOL 1T6VN 3X3GH 1CDBA 1UVQB 1JI2A 2QADD 4HC1A 1UKSA 1OLZA 2VKWA 5TPWL 3SPVB 3N1GC 2P5WE 5B3JF 2B4CL 4RMQA 2BVEA 4M5YH 5I19L 4WFGD 2XQYK 4RGNE 3QFDA 2AABL 3MNVB 3RI5F 1NMAH 1RD6A 2BX5A 2GCYA 4U0RC 3AC0A 4KROB 3C8HA 1UWXK 1JWUA 3IETA 3RWJA 4WV1C 4CDGC 2H1PL 3OL2A 3PDDA 2IPKB 2J4WH 2DQCH 2YOCA 3OHXA 3FL7A 1U93B 3TBYA 3IKKA 4ZS6C 4QXWA 4NWUL 4PY8J 5GS3A 3BKJH 1MVUB 2PYEE 1FL6B 4Z78A 2A6KB 2PR4H 2WQRA 4P2OB 1U93A 3AUVA 1A7BA 2X4PB 4LCCB 2GJ6E 2XZCL 1CICA 4K23L 5DJ8B 2E8ZA 3LEXA 3TP4A 1CXFA 5GGUA 1KBGL 2BVUA 4WI3A 5DZLA 1NFDB 1F11A 1YYML 1WFNA 3QUMA 5DMKB 1WVZA 4X7TB 5ANMA 1BD2D 2ENSA 3AVEA 4O2FB 4G9DB 4LNRA 1WWBX 1GZPA 5C9JB 1HSAA 3U0PB 1H3XA 2Z8WC 4HWEL 5DHYB 1MCHA 5TQ2H 3RGVD 2FJGA 3JTTA 5CSZB 2ZSVB 4C56A 5EBLB 1IGTA 5T1LD 5T1DL 1EO8H 1CXHA 1YY8A 4G7VH 3VFUB 2GJZA 3DO7B 2AK4B 1RPQA 1TZIA 4XT1C 1YEIH 3L5XH 5H37H 2F5BL 4GFTB 1RULH 3C5ZD 1S5IL 2G9HB 4GW5B 5DVOA 1FVDB 1LP9F 1U8NA 2J6EL 1XH3B 1B88A 3BH9A 1BD2B 4IRJC 4DAGL 4HFUL 1JHTB 5ELIA 1I75A 1OW0C 1BQSA 1K4DA 4JFXB 5CBAA 4GUPA 3FB6B 3GEWB 4UNUA 2E7BA 2GIYA 5HDLA 3BH9B 2IBZX 1A6ZB 3H9SD 4FQXA 4MX7A 3RGVB 3QWRD 5I30H 4AM0B 2O93L 1KCRH 4XP4H 5DMIH 5DHVB 3MMEA 2Y25A 2YPVH 4JFEA 4FQXC 5E4IA 1RZFL 4UT9H 3PWNB 2RBLA 3IU4H 4EN3C 2WSKA 2BK8A 1MVFA 3RIAK 5ECJE 5KSVA 1EEYB 3VMPA 5FKAA 4RAUB 5D1QA 1WCBA 2DL9A 1ZTXH 2DDQH 2YXFA 2YA0A 1UC6A 4BH8A 5DQDH 4JY5H 5C0GB 5FKAB 5I8CA 5BRZA 5SX4I 1KB9J 5FCSH 3U9UB 3C8KB 1MCJA 3DUUB 1G7LB 4PJFA 5JXAH 1G7MA 2XTLA 1A6PA 3ULVC 5GS2D 1U8IB 4FA8A 3CSBA 3WLWD 1AC0A 2Z4QB 5M94B 4F15B 3HI5H 3RGVA 2OP4L 3WIIH 5CIPB 5JW4R 4PRPA 1PYWB 3MBXH 4YDJA 3RDTC 1FL5B 3WO3B 4D3CL 1ORSA 1EFXB 5IVXE 2Z31A 5I16B 4NO3A 4N8CL 3SJVD 3SE9H 1DQLL 1U95B 3C60B 5DJZA 4PP2B 5CMAB 1YEHH 3DRQB 4WO4C 4IRZL 1T1YA 4HCRA 4JGMA 1UQSA 1U58A 3U9PH 5SX4H 1HI6A 1NH6A 2X4RA 1Z9OA 1LK3L 4LLWB 1I3GH 1H3VA 1WWCA 2BERA 1P1ZA 3VCLB 1A8JH 2C7UB 1IAKA 1E4JA 1T5WB 4MZ3A 3UTPD 1RUAH 5C7XH 5ESAB 3RDTB 4JRYB 4PGEB 5SWQB 1KIPB 2JF1A 3TBTA 4CVWA 3MBEB 2O61B 4H1LB 4OI7A 2D03L 2CK0H 2JTDA 4JG1L 3UX9B 1RU9H 1KACB 2CK0L 1H9VA 2R2BB 3WSQL 1IE5A 1ND0A 5C07D 4P9MH 4MCZA 2P46B 1JVKA 3HE6A 3G6AB 1E4WH 3PJSB 3HMXH 1HZHL 3PHOA 4K2UL 1NCDL 3P40A 4Z7NE 3VWJD<