1MFCH

High resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
211
Chain Sequence
EVQVQQSGTVLARPGASVKMSCKASGYTFTNYWMHWIKQRPGQGLEWIGAIYPGNSATFYNHKFRAKTKLTAVTSTITAYMELSSLTNEDSAVYYCTRGGHGYYGDYWGQGASLTVSSAKTTPPSVYPLAPGMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN)
publication title Recognition of a carbohydrate antigenic determinant of Salmonella by an antibody.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 44
structure length 211
sequence length 218
ec nomenclature
pdb deposition date 1993-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfcH01
1YN7B 1MPAL 2MQ3A 2A83B 4B41A 1BJ8A 1UWXH 1ZVYA 5FK9B 5MEPA 3VW3L 1W0WA 5GGRA 3A6BL 1CBVL 1B0RA 1FSKC 2VNCA 5DT1L 1K8IB 2GHWB 3MSPA 5AUMA 1LD9B 1EHLL 1R24B 5JW5B 5CUSH 1ZA3B 3RI5K 5E9DA 4IDLA 3WJJC 5EWIH 3VFSB 3MV7A 5KS9E 1JZ5A 1ZGLA 1CGSH 3S3JA 1VKXB 5DJCA 3BQUB 1A4KA 4HT1L 1W0YT 5KS9F 1G6RH 3PP4L 4ONHA 1GGCH 3LD8B 4QGTA 1NCAH 2F74A 2O61B 1U8KA 3JWDC 2CDGB 2GITA 3CFEB 4XPBL 2NX5E 2X10A 3TYGL 1FDLL 5HHXH 2E3VA 2BNRB 3LRHA 4TVSa 1HOCB 4U0QB 3EZJB 1IGML 3STLA 4PJCE 3SDDA 5DURB 1C7TA 3VWJD 3VXUB 5ACMA 4D9RE 3CFJA 3IXTB 4NFBA 3V7AG 1EMTL 5FUCC 4AG4H 3QXTA 4PJCF 4LPCA 3LRSB 1BFVH 3ARDD 5TPWH 5CJ5A 3ARFA 5E2WL 3WXWL 1KLGB 3Q6GH 3FJTA 4RDQF 4OGAD 4EI5D 1ZHBA 1EHXA 2EDYA 3PF2A 4JO4H 1IAIL 2BSRB 1JPTH 4JG1H 2VIRA 3FMGL 5E1AA 4PJXA 4NQUA 1T04A 3INUL 1TCMA 4Y2OA 5C0RL 3ZHKA 1DUYB 3UPRB 1CL7L 1XF5A 3U36B 2DDQH 4HXAL 4FG6C 3BW9B 1RZKH 4PJ8A 4X7FC 5SWSB 4DN4H 2R1WA 1WVZA 4HJGA 2OLDA 1CXIA 4OCWH 3RX5A 3HPLB 4KHTL 1HH6A 2DKUA 4YDLB 4RWYH 5J6GA 5CLTA 4KKLC 4AYFA 4Z77B 5HD8C 1GYAA 1HILA 2ZOLA 1E28A 4JFZH 3HAEG 4PGDA 5ITBH 3VE0B 4L4TD 5DVNA 2EIZA 5F7DB 4LDOB 2WIIB 1QFPA 4OM1L 5FV2A 3VXMD 4IIQA 4F7EA 2W9LA 3NFPA 1NUDA 1BOYA 2HVJB 4HF5H 1UWGL 4NYLB 1N4XH 5IGXL 1LP9A 2CMRL 3T0DA 3F5WB 1CFVL 2I24N 4PJGA 3HCVB 1SVZA 1RFDL 4NOFA 1RU9L 4MGXA 1KN4L 4HKXB 2E7BA 3FT4B 4B53A 4UNUA 5DEGB 1BZQK 3NIDE 3KS0H 5D4QA 4NO2A 5FCUH 2GI7A 3ARED 1O0VA 1FV1A 1WWCA 1MAMH 4R4FL 1MFAL 4G6JH 1REIA 3CMOH 4TOYL 4WFHE 3WFHA 4FP8L 3FO0L 3DXAE 1AR1D 2WP3O 3S98A 5ICXA 5HDQH 5FM5O 4LVHC 1FGVH 3I3BA 1KTKE 4U31A 4MXWH 1H9VA 4U3CA 4UAOC 5TDNB 3WDIA 4HUNB 4YAQA 1IM3A 4QRPE 3R0NA 4GKZA 4W4NA 5T1DL 4J3OC 3FB8B 2FATH 1ORSB 3JTSB 1PBYA 3VXNB 1I9JL 4RQQA 3VXPB 3UJJL 3LMJL 1RZIB 5IW1A 1ZVHA 5FGBC 1IM9A 5DVLA 1GPOH 1DQJA 3QNZA 2F5AH 4YQXH 3TZVC 4OZIA 5CD5D 4Y5XA 4RX4D 1S8DB 4TRPL 3S3PA 3I6GA 4WJ5B 5F93C 3BVNA 1U8PA 4EN3D 1P7QB 4O02H 4MYWB 4LU5L 1BF2A 3MFGB 2LU3A 2OL3L 4PJHB 1JP5A 4GKSB 5L7XL 1NGWB 3SEPA 4K7FB 5AZ2L 5JUEL 4UV4H 4WCYL 3HA0A 4ODWB 1YEDB 2MPAH 3O6KL 2IG2H 5LXGH 1ZMYA 3P9LA 4J6RL 2ZUQC 3LPWA 1Y0LA 2CK2A 2BSTA 1JGEA 4FFWD 2BMKA 1D6VL 1MCFA 3BZEA 4O58L 2VH5H 3TBYA 4IOSD 4P23B 4PRAB 1ZHNA 1G7LA 1A3RH 2FECI 5J06A 3V4UL 3DGGB 4XVSL 2FEEI 5DI8B 1F4XH 4ZTPL 2IGFL 2VE6A 1BHGA 1RJZA 5JQHC 4XAKE 5CGYD 1WZKA 1CIDA 2GSGA 3DGCR 1ACZA 1XGUB 6FABH 4MLIA 4XRCB 3VD4A 1S7SA 3DV4A 1CU4H 4L29B 3QXDA 1A1NB 1D5IH 1M4KA 1P4LB 1R6VA 3TP4A 4XT1C 2VISB 3O2VL 4ETYA 5DGRA 5E24E 5F6HJ 1F4WH 2DBJA 4NIKB 4UQ2A 1LILA 2C9AA 4TNWK 4BFIB 4C56A 2IH3A 3I75B 1V3JA 4ZQKA 2HTKC 4AIZB 2HVKB 1HI6B 1GCFA 4GMTL 2WWKO 2R2CA 1MLCA 2C3XA 1G7PB 4Y0GA 5L2KD 4GXUM 4FTVD 4KTYA 5IKCA 2KL6A 1CFQA 3KS0J 4HPYH 4U3XA 5C0AB 1OWRM 5J1AB 2EDKA 3CXDL 4NHUA 4P5TD 1F97A 1QFUL 1DDHB 3KNBB 5ID1B 4XAWH 1AI1H 3CUPB 4X5XB 5HDOA 1IEBB 3HG1B 1MRFL 5KW9L 3HS0A 4U6XA 3MGOA 4G80A 4HWZA 2ATPA 1YECL 3QEGH 1KC5H 3ZE0E 2NY3D 3KLAA 4XP6L 5B21A 3KLSA 3ZKMC 5HYJA 5C07E 4QRRB 1WT5C 3HRZA 5C0ND 1P5VA 3MYZA 4YHYC 2P5WB 4KU1A 5DS8B 2FJGA 3ZE0F 1A9EA 5B4MC 4KJWD 3MRBA 4EDXA 5CEZH 5MERA 4UDUA 2V5RA 1MCWW 4Z18A 3TCXA 1RIUL 3S35X 4ORGA 5ITFA 1A5FL 4QF1B 4HIJB 5C9JB 3KPRD 3LZFH 1AXSB 2O5XH 2Z92A 2ILLA 1NDGA 1ZTXL 3HE7A 1UKTA 5MHSE 2R23B 3GMRB 5HGAA 1A6VH 1U8MB 2V17H 1BVZA 1Q0YL 4UI2A 4NNXB 5GGTL 1YNLH 4Y4KC 3F58H 5ESQA 5IMLA 2ZZUT 1Q94A 3F7VB 5GRUL 1QFOA 2YK1H 5T3XL 5EU4B 4XXCC 4I5BB 4F3FB 3BGAA 4WY7L 2NNAA 4TVPD 4GAYA 2CQVA 2Q8AH 5GGSB 1FLRL 4ELKB 2F58H 1S7UA 3GMOA 3QH3B 3ILPB 3TESA 3IS1X 4JY6B 4ALAH 4ODVH 4OIAA 3LQMA 1S78D 2P5EA 3C5JA 1DBML 5K9KB 4NC1C 4V2BA 4PBVC 5B22A 4BZ2L 5JR1L 2IPTH 3BKCH 1UB6A 3TLRA 4D0CB 3N9GH 5BMFL 5KSBE 3B5TA 2F8VA 3OKEA 4D9LL 4HK3N 5HJ3A 4OCNC 4FXGB 2BXZA 3QP3A 1BIHA 4RGOL 5D6DC 1CG9A 1SY6L 4ZUVB 1MOEA 3BDBA 1ZANH 1ZE3C 4MDIA 3RWJA 5IB3A 4L3CA 1QFWH 4MJID 2Q3AA 4HC1L 4YFLF 1KTDA 4X6FB 2HFGL 1HH9B 4OF3A 3KPOB 2ENSA 4HGKC 4LLMB 2FJHB 5E5MA 1GGUA 1WCBB 4TUJB 5I8CA 3JTTB 2DD8L 3BJ91 3U1SL 2YUVA 1INQB 4CMHB 2I26N 5T3XE 3FRUB 3GBLA 2PN5A 3PWJA 2AQ3A 3B83A 2V6HA 4UT6H 5C09D 4AK1A 2FHBA 4R90L 3HC4H 1A21A 5FYJU 3WNLA 2ICEA 3MRHB 2BNUA 3S35H 3TBSA 1M7IB 1OPGL 2IPKA 3QXVA 1KJ3L 4JFHE 4KK9C 4AH2A 1MREL 1LGVA 3L5XH 5F3HA 4TTDD 2ZUYA 2ORBH 3OWEA 1FG2A 1ZS8B 4PB0L 4WHDA 1I9RH 2E6QA 2XZQH 4JFFD 3VMNA 5LKNA 1Q9LA 4L9DA 5ERWB 5E8NB 2JB5H 3BP4B 3BPOC 3L3HA 4Y4FB 4UT9H 1FH5L 4NC1E 5EU7C 5CSBA 3ECBB 5DJYB 3OGCB 4WHCA 4PB9L 3LB6C 3SPVB 3V5DA 5EC2A 1YEHH 4GBXA 3NVQA 4YHOH 1FFNB 1I9EA 2X5PA 1YN7A 1XGQB 3JBG7 2A83A 3K80A 3QNYA 4JM2C 4RAHA 1GGBL 1KCSL 3PJSB 5FK9A 3EHBD 3RIFF 3MLSL 3EOTH 1T0PB 2BXYA 4NZUL 3WIIH 1ZEAH 1NDMB 3HZYA 1YN6B 3E6HB 2WAHA 3IDJB 4M5ZL 1HCFX 1LD9A 2DMCA 3WIFB 1R24A 5JW5A 1S7WB 1N0XH 1ZA3A 3DECA 1S5IL 1EJOH 3KPSB 2H32B 4K23H 2NY6D 5TF1L 1VKXA 3BQUA 4LSPH 1KENH 5HGGS 1LO2H 4D8PB 3RL1A 1X5LA 5I17A 4P4RB 5IP4A 3CXHJ 2O61A 4OTXL 4NRYB 1A0QH 3QXUA 2CDGA 3CFEA 3EYQC 5CILL 5LCVH 3W9DB 2BNRA 3MRGB 1HOCA 3P0YH 4MAUH 3EJYD 3L6FB 4KPHH 2ZOKB 3HTLX 4UB0L 4YXKH 4N68A 3VXUA 4ZDHB 2AJXH 3NH7L 3FL7A 3IXTA 4I9WE 4G3YL 5HGBA 1AIFB 2VXQH 4LKXB 3O2WL 1FRGL 2CUIA 5BO1H 1SM3L 2BRRL 1KLGA 4WV1B 1T21A 2BHYA 5EU7E 3FOMB 1RVFH 2BSRA 3B2UD 3ES6A 1ZLVH 3VFPB 1DANT 3ARGB 3PGFL 3UAJD 1SJHB 3MV9A 1T1ZB 4WEBL 3EDEA 4U2ZA 1KB5H 2CLZB 3CJJA 1NGQL 2VDOH 1IEHA 3B9DA 2VC2H 2FO1A 4I77H 1DUYA 3B9AA 1VB9A 2J2ZA 5D1XC 3ZT6A 3MXWL 3KXFD 3U36A 4PRHB 5EU6D 5LJYH 4OZHB 4JM2F 3BW9A 3GHEH 5I30L 2G60L 4QXWA 4HMEA 5D7SL 5SWSA 2QJDA 1NLDL 2J6EA 2YEZB 4MA3A 2WIMA 4FFYH 4YFDB 2FEDC 3UTTE 3HPLA 4AEIL 1JF1A 1NBZA 4OCYL 4M4PA 4U7SA 1OL0A 4WFGE 1R3IH 1P7KA 5K93A 4LRNH 4KXZI 4JO1L 3VE0A 2ARJQ 1U8QB 1XF4B 3H9SD 4DVBB 3S96B 5D1ZB 5LWYH 3CFCL 5F7DA 4FMKA 1LHZA 4P2CG 4HFUL 3V7AE 4PPTA 4UINH 4X5LA 3UTZA 5I8OL 2R9HC 1CZ8H 3O0RL 3WMSA 1N7ML 2VLLB 4Z76B 1UB5B 2NPLX 4NRXB 3AMLA 2HMIC 3S4SB 3F5WA 5I19H 4ZO6A 1MCBA 2EDWA 3SKMB 3HCVA 3TA3C 2D9CA 3GM8A 5F9JB 4HKXA 5IEHB 4WW2C 5DEGA 5L0QC 4TULH 4P2RA 1KB9K 1MF2H 1SBBA 3QI9B 3MODL 5IF0B 2Z91A 2X1WL 1F3DH 1MQ8A 3UROR 1A47A 2NY2C 3LSOB 3RZWA 3MOQA 3ARDB 1J1OL 4P2QE 3TC9A 1G7HA 3SBWC 1EEZB 3S97C 4PGBB 5H35B 3O6FD 1BWWA 1W0VB 4JHBA 4EI5B 4HLJA 1FAIH 2SEBB 4M3KB 4PG9B 5CZXC 4JHAL 1MNUL 3W0WD 3TBWA 1HIML 3MRQB 3V9FA 4E41D 1L0QA 4OFDA 2JJSA 3OB0H 3NFSL 5TDNA 4XWOD 3O2DL 1B4JL 1TENA 3BKML 5EU3B 1KACB 2BVYA 5BRZE 3FB8A 2GK0B 4X4XB 1ORSA 5HI5C 4Y2DB 2E8ZA 3VXNA 5GZOD 2RHEA 4RMUA 2IAND 1MRDL 3NCMA 4ZSOB 1EVTC 4JFQA 1I3UA 4TTGA 2FIKB 1DEDA 4WHYG 2CH8A 4XPTL 1XT5A 4LCYB 1A4JA 1T66C 2PYEB 1QVOB 1B2WH 3MREB 4ELMB 1S8DA 3R0MA 5HHOD 4MVBD 3O9WB 1LK3H 5FM5M 1UCTA 2UZYB 1QR1A 3L1OL 1P7QA 3NGBB 4YC2B 4HIHB 5HYSB 3O4LE 2WBWB 3V8OA 4PJHA 5A2LH 3OR7B 4M1GL 2A77L 1IRAY 1NGWA 4L4TB 4ZUWB 1F58H 4K7FA 3C5ZD 2YD4A 4XP1H 4NQCE 4ODWA 4JKKA 1YEDA 3BN9D 3QHFL 1X5IA 3DUUB 4JPWL 2XA3A 4WI7A 3DOSA 4NQSB 4DW2H 4WW2F 3LEYH 4RBPH 4M02A 4X6EA 3SDXB 5L9DH 2ZCLH 3U0PA 5D5MF 1L7TL 3QCVH 4JFED 4PRAA 5B38B 2QSTA 4NWUH 1I7ZA 3M17B 4I3SH 4HKBB 3SE4A 4TSCH 5FV1L 3CSYA 3AREB 2ZJSH 1OHQA 1JI1A 3VXSD 3P9WB 3O11B 4X4MA 3NIGF 1NMBL 2J3SA 3EFDL 3U30C 4ZFOL 3CFKB 4PBWD 4C4KT 1XGUA 3C8DA 2D03L 4XRCA 1ZGLM 5IUSA 1P4LA 2PKDA 4CVZA 4S0SD 3FQRA 1JZ8A 1JRHI 4D9QE 4MAYD 5FHBL 2QHLA 1FL3B 5T5FH 3VFUB 1DSFL 4KK6D 1FGNH 1NCUA 1OD7A 2VXVL 3VRIA 4BFIA 4NO0B 1H3UA 4Q9RH 4AIZA 1RK1B 4XMKH 2HVKA 1RZFL 2HLFD 1HI6A 1BVKB 3MBED 1U91B 1G7PA 3BH9B 5J56B 4Z7UB 1WZLA 5SX5H 1X6LA 3DNKA 1PDKA 2FZ3B 5C0AA 5J1AA 1TJHL 4JJ5A 4CJ1A 3KJ6L 5E8OB 1EO8L 3L7FA 2MSPA 5E1HB 4APQB 3CX2A 4QO1A 5C9KA 4L5FH 3KNBA 1F3DJ 5F97E 3CUPA 4X5XA 4N8CL 5F88B 1ODAA 1IEBA 2IBBA 4OGYL 5IMMA 1QEWB 4ZG1A 5TDOB 4EN3B 1DFBL 5FA4B 3QDGB 2UWEB 1K8DB 2Z0BA 2WM0A 4K8RH 1XCQB 4QRRA 2IBGA 3TWCL 2MWCA 4G9FE 4TUOB 2DQCH 2P5WA 5DS8A 4KRNA 2RJMA 3RPKA 4YHLL 3RDTC 1MCDA 5KANI 1SMAA 5EUOE 1MCPH 1ADQA 4IRJD 5CBAB 4MA7L 4HPOH 2VLJB 4Y19E 5FECB 2NX5D 5C9JA 4IEFB 1AXSA 3Q1SL 1KG0A 1NCBH 2ZCHH 3R1GH 5EUOF 1JK8B 2R0KH 3EFFB 3M45A 1YY8B 2VDMH 2CIIB 2R23A 3GMRA 1OAKH 3HMXH 3MJ8B 4KRPB 3HN3A 1U8MA 4RGNC 1DCLA 3KYNB 4PJ9C 1R5WB 5HI4D 4D9RD 3BE1H 4OGXL 4NNXA 3I6LE 4POZD 4OT1L 4KVNL 5DMIH 3F7VA 3DHJA 1QSVA 5DLML 5EU4A 5A16B 1GGTA 1OTUD 5E94B 1CQYA 1WTGT 4G9DB 5GGSA 3QH3A 3FO9B 3ILPA 3GO1L 1MQKL 1X9QA 2RIKA 2MCPH 1A6ZA 5K9KA 3IU4L 4P99A 3R06A 3B8SA 3V79C 4U3HA 1PEZA 5E4EC 2DF3A 5TFSH 1IC4H 4LNVA 2VRAA 5KSAB 5C2BH 5L2KB 4J3TA 2YPVL 5IIEB 1TZGL 4RFEB 4D3CL 5KOVC 4XC1H 4ZUVA 3FN0H 4NKMB 2WUBH 4OCRH 4U7KA 4P2OB 1X5FA 1HH9A 4OD3H 1RZ7H 3KPOA 4PTUB 4LLMA 4HK0B 3B9EA 1FNGA 2NY3B 1FAKT 1INQA 5E08L 4RGMC 3UTSE 3ZYJA 1QYGL 4PREB 2DWDA 3RWIB 2IFGA 1FNHA 2BCKB 3A0OA 3NZHL 4W6XB 3GMLB 3V0WH 4NKIL 4G5ZH 4RGNE 2FLBT 3SDDC 4XC3H 4UTAH 1M7IA 4ISVB 3MZGB 2ARJB 4AIXA 1X5XA 5KG9B 3ARFC 1OGAE 3P30H 1RUML 3IAQA 5ERWA 2ZUUA 2ESVA 3PQYD 1U3HD 4LLWA 2IC2A 1FO0H 3GKZA 3MGAA 4WFHD 3ECBA 1ZXQA 4PV8B 3OGCA 3DXAD 4ZO8A 3NPSC 3SPVA 3MGTB 4WTZA 2E9JA 1BPVA 1FFNA 3T4AB 3X11B 1V7ML 1XGQA 2R56H 3UZQA 3PJSA 2AGJH 4PJ8C 2EICA 2IBZX 3BHBB 3DLQR 3MFFB 3MUY1 1AE6L 5IFHH 5T1KD 2W1NA 3KPQB 1NDMA 1QZ1A 1YN6A 2P8LB 5E9DE 2BVOB 3MV7E 3WIFA 5HD8D 4OLZH 3KPSA 2H32A 1S9WB 3DVNB 4KDTA 3KPLA 1NAKL 4CVXB 1IEAB 2GFBB 1P84J 4X80H 4D8PA 4XP5L 2MOVA 4P4RA 4I1NB 2FJFB 4H1LB 2K3TA 3QAZB 4IIQC 3SN6N 3DV6B 4NRYA 3QPXH 1UQSB 3WUWB 1OAQH 3W9DA 3MRGA 2FX9H 3EBAA 5GISL 2M2DA 5EZIH 3GIZL 1Q0XL 2ZOKA 2PYFA 3T0WA 4ZDHA 4RIRB 1MHCB 5D70L 2J4WH 3J8F7 5C09B 1AIFA 1UYWL 2X4UB 4LKXA 3LS5H 4GRMB 3V5KB 5KVGH 1CFNB 3FOMA 3JZ7A 3L5WB 5F1OB 5DUMH 2WNGA 2HT3C 3ARGA 5JMOC 1SJHA 4NQXB 4PJXF 2CXGA 2CLZA 4XVTH 4KY1H 4HJJL 4LPXA 4XNMB 2JF1A 1DE4B 2APWA 1R3KB 3H3PH 3BKYL 5JHDA 4PRHA 3MRKB 5IV2B 4OZHA 5ETUB 2HYMA 2XWJB 3B5GA 4DWHA 4XP4L 2R8SL 1DQLH 4OLVH 5E0QA 2YEZA 3H42H 2FRGP 5FUOL 2D3VA 4EUPB 2ZCKL 1FVDA 2X70B 4BH8B 5CHNB 3MJ7B 4PV9B 4S1QH 1U8QA 1XF4A 2EECA 4DVBA 3S96A 3GIVA 4Y5XC 4AENB 4XHJC 2G75B 4YDKH 1LP9E 4F2MA 1FLTX 5HPMB 2NY6B 1UB5A 4NRXA 3S4SA 3X3FH 1I7UA 5FXCH 1LP9F 3T65A 5DC9B 1LO4H 4FQ2H 3ALWA 1LE5A 4PJGF 4PJEB 4FOMA 3QULB 3ALXA 3HI1B 4F58H 5F9JA 2A6IB 5FA3B 4HCRH 4C55A 5DD5H 4JDTL 3BZDA 1JYVA 3QI9A 4U6HB 2W0FA 5IF0A 1SEQH 1GAFH 4KUCF 4YEEA 2NXZC 4YLQT 2DI9A 3RNQB 3LSOA 4KAQL 3VXRD 1I3VA 1TFHA 2WINB 3ARDA 5FEBA 1PX3A 3TT3L 4PGBA 5H35A 3VFTB 1T3FB 1W0VA 2AXFB 2NLJA 4EI5A 2SEBA 1XH3B 4MQTB 4CN1A 4PG9A 1L0YA 4WDIB 2YN3A 5D72L 2YKLL 1BECA 3P73B 1RUQH 1PG7L 3MRQA 4C58B 3IJSB 4P46D 4KGJA 4O2FA 1IKFL 2DQJL 5FDWB 4PP1D 3MJGX 3Q0HA 4ODXB 5EU3A 3ARYA 1TJGL 2GK0A 4K7PY 4X4XA 3WO4C 3JWDH 3KXFB 2HTKD 4LLYB 5EU6B 5T33H 4OJFL 4UV7H 3GSUB 4ZSOA 5IVZB 3VGEA 1YEEL 2VLKE 1FFOB 3RI5F 4OZIE 4ZUTA 5D7IE 3LIZH 5C0DB 5HVHC 1F90H 4NO5B 5FFLA 3X3GH 4ELMA 5IFJB 2IWGA 4OZIF 1ZAGA 4WU7B 3QUML 2X4SB 1YQVH 4CN6A 3RP1A 1FZJB 5IBTH 4HIHA 4MHHI 4U49A 1JNJA 5HYSA 4LMQE 5EULV 1T22B 3H9SB 1JWMA 3OR7A 1FNLA 2PR4H 4KQ4H 4L4TA 4ZUWA 3T04D 4ZD3H 1ZGLP 2V2WA 1IQDB 4DGIL 1UA6H 3VXMA 1CICB 2NR6D 4OD2B 1FYTD 3DUUA 5CEZD 3ZKMD 4JQVA 5F6IC 3MJ6A 4NQSA 4FABH 5FM8A 4MJ6B 3SDXA 1I85A 2YA2A 5D8JH 1QD0A 5DQ9A 5JW4Q 4M7KH 1WGOA 5B38A 2D31A 3M17A 2ADJB 2R2EA 4HKBA 2AXGB 3U7YH 4LSQH 3BIBX 4UDTB 2MFNA 3BP6B 3HKFA 3AREA 1R3LB 1QLRB 3QEQB 1A7OL 5T3XD 3W82A 4OI9A 4LDLB 3O11A 3MOAL 2QBWA 4ETQB 4FQ1H 5D7KD 2CXKA 3CFKA 3HE7C 1WBZB 4GOSA 2Z4QB 2CDEA 4KK5D 3N85H 4N9GB 1OCWH 2EC9U 5CSGA 1GZQB 3O6FB 4Y4KD 3BX7C 3VFUA 4C56E 5LGHH 4NO0A 1KPVB 25C8L 4YX2H 1J1PH 1FG9C 1RK1A 3RVTC 3SKOB 4D0DB 5E8PB 5ESAA 4BSVB 3CDFA 1U91A 1OP3K 5DD0H 3BH9A 1RQ5A 3L3JB 2CD0A 4Z7UA 4YE4L 3VGFA 1ZT4A 2Y23A 4TOYH 2I9LB 4OLWH 4EOWH 2V7HB 3MLRL 3NMEA 2F53D 4E5XB 4R2GC 5T1LD 4APQA 1MIEH 3V6ZB 2AI0H 2A38A 1MVUA 3V4VH 4XMPL 5F88A 5FYKL 4RX4A 5HHOB 2AJZB 2W9EL 4XNZB 5C0BB 1QEWA 1T0MB 2OK0H 5TDOA 4EN3A 1MCQA 2GJZB 2PO6D 4PRNB 1TITA 3QDGA 1CFSA 5TQ2H 2UWEA 5CKGA 1K8DA 1YC8A 1TLKA 4NGHH 3MV11 3C5ZB 1XCQA 1T7WA 4TUOA 5DRXB 2X7LB 4QHMB 4FRWA 2MMXA 1S9XB 1X5JA 1OP5H 2F54B 5CP7A 1TJIH 3TVMD 2BSSA 1CF8H 4N5ED 3X14B 1HHKB 3EAKA 5ENWB 4HWEH 2ZNXA 5CBAA 3TT1H 4Z95L 3NA9H 4ONOA 2FX7H 3GJFK 5L88L 4JFEB 4AMKL 2BJML 1JK8A 4K94H 3EFFA 5C0IB 5E2TH 1XZ0A 2VR5A 5I0ZA 1H3PH 3MJ8A 1Z2KA 2XXMB 3KYNA 3N1FC 4ERSL 2RBLA 1R5WA 4OF7A 1FYHB 3VXSB 4GXVL 3HI5H 1IGIH 3SGDI 5J57B 5EBWB 3DARA 3IDIB 2EEDA 5FYKE 5M7QA 4G9DA 5T3ZL 2P5EE 4LCWB 4DOHB 1ZV5A 5INCB 1AJ7H 2L7JA 5IBUB 2Z8VC 3PUCA 2OP4L 2X42A 4GBXC 1H8OA 3WKNA 1ZOXA 3QBTB 5K59E 5I1KH 3NABH 3G5VB 2IQAA 3RBGA 1T80A 1M6OB 1HDMA 1EGJH 2GY5A 5DJ8B 3W39A 5L2KA 1JUFB 3DUSB 3DMMD 2C1PB 1J18A 5IIEA 5K59F 4HHAB 4KTDL 4QWWD 1JGVH 5DMKB 3EO1A 3DYPA 1EIBA 4FQCL 1JE6A 4CU8A 5EFIB 4NKMA 3F6LA 2YD6A 4L4VD 1C7SA 3D39B 4OZFH 2W92A 2IMNA 1KULA 2X4RB 4P2OA 3C2AH 3BQUC 2FEEL 1JIBA 1BFTA 3O4OC 5DVMA 1JGLH 4PTUA 2VXSL 1PKOA 4HK0A 1YEKL 2N1KA 5F9OL 3LD8C 1U2HA 3OAZH 2DM3A 3B43A 2VB5A 2K9UA 4DN3L 4PREA 4G6KH 3RWIA 3RZCD 2BCKA 4LOUD 2R0ZH 1SQ2N 3L3KA 3U9PL 4LGSB 5T3ZE 1ZK9A 3QUKB 3ULVL 3UYRL 4YBHA 4XCFH 3HNSL 2CLVB 1JVKA 4ISVA 2WBJD 3NCEB 2ARJA 2F15A 4LEXH 1T03H 4DUVA 1T2QL 3OKMB 5KG9A 4H0IA 4XZUB 2P1YA 5CMAB 2DN7A 4D0BB 3GMMB 1XR8B 1RZ8B 1QBAA 1RK0A 4MNGB 5MI0B 1C08B 2LTQB 1ZLWH 2HTLC 3VWKD 3B6SB 2AJUL 3LV3A 2LAAA 1WITA 2A1WL 1IBGL 2ITCB 2QEJA 4PV8A 3AMKA 1OSPL 4I2XB 4MA1B 5CIPB 3MGTA 2V5YA 1PZ5B 3T4AA 3X11A 2GKIA 3UPCA 2LV4A 3OJVC 4WI2A 2EE2A 4F33B 1JTPA 3BHBA 2W65B 3MFFA 3EYOA 1BBDH 3KPQA 2XFXB 1X3DA 3HC0B 2P8LA 1KCVL 3P77B 5GS0C 5BRZD 2IFFL 5TGBB 3FZUD 4YHKH 4JJHA 4JFYB 1Z3GL 2Q7NA 3DVNA 2NTFA 2VXTL 3QUYD 3ARWA 3ULVE 5FO9B 5T5NG 1IEAA 2GFBA 4OCSL 3WN5A 1BOGA 5CGMA 4X7DC 1G6RB 2J6EL 3GDBA 4S2SB 1F6LL 2FJFA 4HDIB 5D7LB 2R9HD 4H1LA 4HZLB 5FOJA 5JOFB 3DV6A 2BNRE 3AFLA 3KG5A 1QBLL 4ODHH 4MJIA 3CFDB 3U7WH 5CBEB 4G42B 1FN4B 2X4NA 3BH8A 2NMSA 1HNFA 3RA7H 2H26B 3VXUE 5DJZB 3BPNB 3WFCL 1NANI 2C1OB 3RUGB 3GZKA 3S4SG 3T08A 5C09A 1NBVL 2X4UA 4HBCL 3H7BA 1CGTA 4L3ED 1WF5A 1HCVA 2O5YL 1KTRL 4GRMA 4N0UB 3V5KA 1A7NH 1CR9L 2H1PH 1E4XI 3VRJB 4YBQC 1KEGL 1FORH 3L5WA 4JY5H 2IQ9L 3PWPB 4WTXA 3VFGH 2Y06L 3MNZB 5HVWA 2E8YA 4NQXA 4PIRF 4JFFA 43CAB 1TVDA 2C3HA 3PQYB 5CKAA 4XNMA 1DE4A 1R3KA 3V4PL 3BEWB 3UEZA 1IFHL 3K46A 1QSFD 5GSRB 3MRKA 2VDNL 4HWBH 2JJSC 5SWSE 2XWJA 4LSSL 4XNQB 5EDXA 4MD5B 3THML 5E2UL 3VXTB 5HI5D 3LHPL 4KZEH 5MEND 5GRYA 1NUNB 3QA3B 4M6MH 4EUPA 12E8H 3LKOB 2DTML 2X70A 1PGRB 3WFBH 6CGTA 2XV6B 4OIBA 3G5XB 1FJ1B 3MJ7A 1T66D 3OQ3B 4PV9A 2HLAB 1FCCA 2D7PA 3IKKA 1DTUA 1RJLA 3N50A 4AENA 1JNLH 3I6KB 4YHML 4K2UL 3PV6B 2QLVB 2F9BT 1KN2H 2NYYD 2C3GA 3DX9A 1RJCA 4U0RB 3H9ZA 1T7XA 1MFNA 4N0YH 4PJEA 2ADGB 2CPCA 3QULA 1FZOA 3IXAB 2A6IA 5FA3A 4Y8AA 5HYSG 4DJMA 3Q6FB 4GQPH 3ZTJG 4P2RE 3CVIL 5IQ7H 3GMNB 4JCMA 1R0AL 4BZ1L 4BM7A 4LARH 3BDYH 3FB6B 5IBLD 2RFXB 4G9FD 2YD1A 1VFOA 4U6HA 3V2AR 2Z35B 4OM0H 1OD9A 2I9TA 1G9NC 4WGWB 4LCUB 3SE4C 1A7RL 4JRYB 2WINA 4TQEH 2F19L 4I13B 2P8MB 1NFKA 3VFTA 1T3FA 2AXFA 3KPMB 1BQSA 4WTWA 1PW3A 5B38G 1G9EA 4LAJH 4WDIA 3MLWH 1JHTB 4TSAL 2LAGB 2IMMA 2EDQA 1KBGH 3P73A 1G9NL 1K4DA 1DBKL 1UH3A 3IJSA 4BFEA 2D7MA 3HI6H 2EDEA 5FDWA 3ETBF 3SQOL 3ZKND 3NCYS 3MRCB 4ODXA 3C6LB 5IFAH 4W68A 2XIDA 5EOTA 4NQDD 3KXFA 2X4TA 2HWZH 5EU6A 3WUZA 1TPXB 2LVCA 2AJVL 4G3YH 4JKWA 2YXMA 3NZ8B 3GSUA 5IVZA 2FNBA 1A1MA 5F44A 1IC5L 2EXYD 1BVLA 3OKDB 2EYTB 4NO5A 3SOBL 4DCQA 2IADA 5IFJA 4WU7A 4UIKH 4PJHE 4UBDC 1F4HA 3RY4A 3N0PB 4DEPB 1TETL 2ATKB 2ID5A 5KVMC 2HKHL 1MCOL 5I18L 1F02I 5DMGC 3H9SA 4RA3A 2YMXH 1DLFH 4CDHA 4PJHF 3EW3B 4JZOB 3BP5B 4G6MH 1IQDA 3MJ9L 1TVBB 2DQIH 3IDUA 4KQ3L 4OD2A 1U93B 1MJ7L 2Y6SD 2C4FU 1IC7L 1AR2A 3DVIA 3JWNC 1A6WH 4MJ6A 1B6UA 3T2NH 5HYFA 5KTEL 4QT5B 2ADJA 4RMQA 1RZJC 2AXGA 3GRWH 3QDMB 35C8L 4UDTA 3BP6A 1R3LA 4X4ME 3WHXB 2WUCH 2XRAH 1QLRA 3QEQA 3RGVD 2Y36H 4FQPA 4IM8A 1VACB 5GGVL 4PTTA 5L8JB 1P53A 4PRDB 2FBJH 4ETQA 3MYJA 5IB2B 2B2XH 1WBZA 4AEHL 2RR3A 5J3HC 4WWKB 4X8JB 1RZJL 1ADQL 4M61B 4X6CB 3O6FA 2LQRA 2P49B 2NY4B 4F37K 5ICYB 4M8VA 2P45B 2PTVA 4ZAKB 1CYGA 3W0WA 4UNTA 1KPVA 3HRPA 3BPLC 4J3VA 4P46B 1CGWA 1YEFH 1CI5A 3OHXB 4WO4D 1ZA6B 3SKOA 3C60B 3VCLB 2O5ZH 5E6ID 4D0DA 2XY2A 2I60H 1B6DA 4JE4B 5C0AE 2OZ4H 4FZEH 3L3JA 5CJOL 2GSIA 7FABL 3O41B 3C2SA 1AGCB 1KEML 2I9LA 2DQTH 2V7HA 3GSOB 2ICCA 4WUKH 4IHOB 4F7TB 4E5XA 3HG1E 4DAGH 3ZTNL 2OYPA 3OAYH 5HGHA 5J12B 1R3JB 4YJZL 3IDXH 1IAII 1HSBA 4GSDL 5HHOA 2AJZA 5AYUL 4FZ8H 2CUHA 3QDHA 1T0MA 2EDBA 3QQ4A 2XTJB 1NL0L 2GJZA 2Q3ZA 1F3JB 4PRNA 3NFSH 5E9DD 3QRFM 2GW5A 4M8QB 3BEVB 4QRRE 3ZYIA 3QSKB 3TFKD 1YY9C 1QUNA 5GS2D 5KVDL 2P5WE 2VLRB 5DUPL 3C5ZA 4HS3B 1CL7I 1INDL 2X7LA 4QHMA 1BGXL 1S9XA 2QQLL 1IGCL 4M93C 1FYTB 4K3HA 2NXYB 4JG0L 2UVFA 2ZUXA 3IJYA 5EA0H 1CGVA 4PYGA 1HHKA 5ENWA 3X14A 2C4XA 5HGDA 1WEJL 5HI3D 4CMHC 3B2VH 1OQXA 2BVEA 3VGDA 2W60B 4JFEA 5A2FA 1HXMB 3RWGB 1AKJD 1LNUB 2D4FA 4K9EH 5C0IA 2VERN 5A40E 2YXFA 4NQVB 2DQHH 4KI5C 1RD6A 2GTWB 3GK8H 5INDA 3VXSA 5IVXB 4I3GA 1BAFL 1HQRB 5EBWA 5TQ0L 3UO1H 1UKSA 3GI9H 2VQTA 3EOBB 3IDIA 2ZUVA 5F6HI 3D69A 4I48B 4MAYA 1VFUA 3T3PF 3KWWB 1ZHLB 1KIUA 1FZMB 5F9WB 2XKUA 1Q38A 1OLLA 1JBJA 3PG2A 1JNNH 2X9WA 3L5HA 3SGJA 1MY5A 4LVOC 3G5VA 1E6OL 3MBEA 1M6OA 8FABB 5DJ8A 1JUFA 3DUSA 1WC7A 2C1PA 4NHCH 4HHAA 4JPIB 3BMWA 5ADOL 3WCYA 2RCSH 5ALCL 5LVEA 2F53B 5EFIA 1SYVA 5GRJH 1N2RB 4HQQH 3D39A 3TO2B 4KDTC 2X4RA 1K6QH 1I8KB 1MAJA 3DX7A 1C5BH 1UCBH 4XCCL 5F7LB 3OF6D 4FN0A 1QLEH 4QHLB 3QDAA 2HH0L 2ZSWA 5HYQA 3BRGC 1UWEL 3BT2L 4NBXB 5I8KL 2PNDA 4FXLA 4KI5E 4P9HH 3UCRA 4H1LG 3WLBB 3I50L 4KK8C 2AEPL 4IRJA 3WUWG 2CLVA 4KI5F 3ROLB 1MIMH 2XA8H 1I7TB 4XPAL 3OL2A 4JM4L 4NJ9H 5MP6L 3OKMA 4XZUA 3O81A 4D0BA 4WV1C 1DL7H 4BJLA 3WFDH 3GMMA 1HZHL 1RZ8A 4MNGA 4PLJC 3GBNH 2HT3D 1QNZL 1C08A 3VD9A 4LHJB 3B6SA 5H37H 5IR1B 5LGJA 1KCRH 3ARXA 3ARGC 2ITCA 3QIBB 4KV5E 3UJIL 5DRNB 1A3LH 4I2XA 1A6AB 2J5LB 5CIPA 2ICWB 4X0KA 3ZSTA 4L1HA 3SDCB 1R3HB 2Q8BL 3MRLA 3EO9H 3QPQC 3WDJA 3LS4L 2Q6WB 4GLRH 3KGRA 3OJDB 4GKNB 2W65A 1NAMH 3TJHD 1I75A 1IQWH 2XFXA 3H9YA 5FO8A 5DD1L 3KPSE 3S37H 2VZ3A 2F5BL 2N7AA 5TGBA 4J12A 4JFYA 3DMMB 1IGJB 1N5YH 4P9MH 1PKQB 3W11D 5FO9A 2VLKD 1A9BB 4XHJD 1G6RA 1FNFA 5DRWA 4EUPG 2E5EA 4S2SA 4HDIA 5GJSL 5D7LA 4HZLA 1IVLA 4B0MM 4L4VB 5JOFA 1G84A 4PS4L 4PRIB 1HKLL 1MQKH 1P5UA 5CBEA 3G6JA 5I1DB 1FN4A 4NN6B 2EIBA 2HRPL 3FO1B 5DQDH 3BWAB 3P9MB 2H26A 1HHJB 4A2LA 5DJZA 3VXOB 3WHE1 4L8BB 3U4AA 1MJ8H 5C7XH 2C1OA 2D0HA 4HS6A 3WNKA 3RUGA 5IB4A 1NC2D 4NQED 3RZCB 4DZBA 4RFNB 5CD3B 1SEBA 3U7AA 5EB9A 2EEBA 5J4MA 4N0UA 3BPCA 3QI9C 2NXZD 3VRJA 3IFOB 2WBJB 2QHRL 3AS2A 3IETB 4RA0C 3TN0B 3FCTB 4YHNB 1UJ3A 2Y25A 3ARDC 3P11H 1CT8B 3MROB 4S1DC 3P0VH 1KB5B 4EI5C 4OGAC 43CAA 4BUGA 3I9GH 3MACH 5DYOB 3CLFH 3PQYA 1U3HA 3AS0A 4PRHE 4ODBD 4OZHE 3VWKB 5C6WH 3BEWA 3H2WA 4JN2B 2BK8A 3KYMA 4GJTB 4XCNB 5D7JD 5GSRA 1E0OB 1RHHB 5JTWA 3TEUA 4UT7L 4B50A 5HY9B 3ARUA 3JWOC 1CIUA 1IT9L 3IFNH 4MD5A 3VXTA 1VEOA 4OZHF 3BGMB 5I1EH 1HK6A 4P49A 2XZZA 3HMWL 4YFLI 4NM8L 4YXHL 1ZLSH 4C56D 5JORB 3QA3A 2Y5TA 3BDXA 5AD0B 4LRIC 3LKOA 4JREB 3SJVD 4PR5B 2CO6B 2JELL 5DMYA 5KVFL 1XGYH 3G5XA 5T1KA 3JWOL 2HLAA 2YRLA 1CFTB 2EH8H 2JKXA 3FAWA 4FFZH 5DHYB 3PV6A 3O9WC 4PJAB 4U6VL 5HDLA 3UZVB 3QUYB 4O2CB 4WVRA 4YC2C 5FYLL 4NZRH 1X4XA 1P1ZB 4NZTH 4PLNC 3OXRB 2V9QA 4NN5C 1NCDL 2ADGA 2G5RA 2FD6H 1BIIB 1IKNA 2IF7A 1CK0H 4JQVC 4ZFFA 3TJEH 4DTGL 4PY8J 1J9CT 1EFXB 4OQTH 4S0TD 1NGPL 1L9MA 1I85C 3FB6A 4Q9QH 4OFIA 2R1XA 2RFXA 2R15A 3RTQB 2NQCA 3A6CL 4J3XA 3MA9L 4WFED 3VGBA 5EH1A 1NCWL 1N3NB 1UXWB 4KZDH 2G9HB 4CADB 1A1OB 3CU7A 4LCUA 1ZT1B 2Y72A 4QGYA 4L3EB 3AREC 1WWBX 4Y5YB 5DFWH 1EVUA 3HE7D 3MR9A 2CRYA 1JHTA 4JPKL 2AV7B 3W2DH 1RURH 5EOQH 3F7QA 2OXGA 3MRCA 5B3JE 2XN9B 4ZSOE 5FYLE 4S10A 1QSFB 3RVTD 5LBSH 3NZ8A 5B3JF 3DRTB 2YA0A 4NPYB 2PYEE 5FYKD 4UOW0 2B1AL 5EO9A 4ELME 2P5ED 3OKDA 1O7SA 4F7MA 5GGQL 3NACH 1INEL 1Z0MA 4ELMF 4MX7B 4R2GD 4MLSA 4JZNB 4L4TE 2ATKA 1UVQA 4APQC 1MFDH 1U6AH 5F1NA 5IESL 1JTTA 4ODSL 5LAXB 1YJDH 5CD5C 1I1CA 4AL8L 1JV5A 2XZAL 1TVBA 9CGTA 4EN3C 1YNKH 1W72H 1U93A 5H94B 5J9PB 3SDXE 3OBAA 5C0CD 2V9RA 1QACA 2ZCKH 5KZCD 3DRQB 3SDXF 4EBQL 2YR3A 3IS0X 2YBRB 4QT5A 3OX8A 1D7FA 1VSCA 4TUKL 3TCLA 1FIGH 3QDMA 4NNPL 5EORL 4FFWC 4Y1AB 3WHXA 4HIXH 2OTWB 1KIQB 2G2RA 1VACA 3PE9A 1OAZH 4I3RL 2VSCA 5ANMB 3ROOB 4PRDA 5F7EH 1GGIH 3VXRA 5IB2A 2D2OA 4WWKA 5H2BB 5I1GH 4KDVA 4X6CA 3HC3H 1LMKA 5HHVH 5CGYC 3VDBA 4N8PA 5ICYA 1FBIH 2LABA 5EO0A 1KLUB 1OQOA 3PL6D 3SE9L 3LH2H 1HKFA 4P46A 4BK5A 5I1AA 1J0HA 1NFDB 1ZA6A 4NRZB 3C60A 3VCLA 4Z7UE 3JUZA 2R0LH 3LY6A 4YGAB 2QQNL 3OXSB 1GOHA 2A2QT 3B5HA 4Y5VB 1FPTL 3WL9B 3DIFB 3BESR 4GBXD 5C92A 3V6FA 2D7TL 3O41A 1BP3B 1K5NB 4Z7UF 1AGCA 5M95B 4KVCH 4N0FB 4IHOA 3ZSSA 1HSAB 4F7TA 5GSVA 1IC1A 5IBUG 3CLEL 1R3JA 3BYTA 2ED9A 5FYJH 2CR6A 4LASH 3UTPD 3EYUH 3QDGE 4MA8H 2UWEE 1GL4B 3X17A 4RMTA 4M8QA 4XVUD 3BP7A 2VLRA 2W07A 1FNSL 3BQUD 4MSWB 2UWEF 5KSBA 1E4KA 1X4YA 3WFEH 3OJMB 4HS3A 1S5HB 4P2OC 5K9OA 1KSRA 3ZL4L 3UJTH 3ULVD 1XIWB 2VDRL 3PIQB 1FYTA 4I0CC 4JO2L 2VLJE 4ZXBB 1J10A 2FLRT 3WDHA 3NAAL 4H26A 1Q9KB 1ZHKB 2NY3C 3WV0A 4Q0XL 1A7QH 4MZ3A 3RWCA 5F96H 2BNRD 3IKCB 3VG9B 5C0NC 5F71A 3Q2CA 3VU2A 5HYIA 2W60A 4NJAL 3AROA 1HXMA 3MLYH 1LNUA 3RWGA 5FDYA 3KDMB 5I73B 1F4AA 1P4BL 4OLEA 1DQDL 4NQVA 4XBPB 5I71B 5F9DC 1W2KT 3D0LB 2GTWA 4QXGL 1CDCA 3RGVB 3STZB 3EO0A 4GAJL 5D9SB 1KGCE 2QQKL 4DGIH 4DKEL 3VI3F 2CKBH 4OLYH 4LIQL 4CU6A 1HQRA 1SBSH 2CK0L 2JLLA 2YWYA 4MS8D 3STBA 4XP9L 3QEUA 4Y4KA 5A1AA 5JQ6H 4I48A 2DLIA 3KWWA 1SVCP 1ZHLA 3CNKA 4HXBL 1FZMA 3MLZH 5JXAH 3NCBB 8CGTA 4JY4B 2VUYA 4CVWA 2VKWA 1I9IL 1NGYA 3BZFB 4PP2A 5C1MB 2FR4A 5ISZB 4YIQB 5L2KE 2XYCA 5E6IB 3N1QC 2C7UA 4R7DB 3Q3GB 4X7EC 8FABA 1S78C 2OTUB 1YEJH 5SWSD 4XVJL 3OZ9H 1UM5H 4IMKA 4TVPL 2UY7A 2F53A 5T1LA 2FGWH 4N8VB 2VAAB 3KYKH 1N2RA 3UXFA 3TO2A 3L3GA 1I8KA 2A74B 2PO6A 5E2JA 4FQLL 2HFEA 5BXFB 3KPPB 4DQOH 4KMTL 3HPJB 1NEZG 4QHLA 3QAZC 3GSNH 4LIQE 3MLUL 3DX6B 3N06B 4I0PB 2HN7B 5ECJE 1J0KA 4LBEB 3D9AH 3IU3B 3TVMA 3OPZH 4XNXL 4M7JL 3O3BB 4X5WB 3ROLA 2HAZA 5DZNA 2AK1H 2BOCB 2VDQH 5I1HL 1JPSL 1ORQA 1AKJB 3MLXL 1WJ3A 4OAWB 1MFEL 3VGAB 2HT2C 5SX4I 1F4YL 1FO0B 1T7ZA 1XGPB 1YDPB 4P3DB 5BVJB 5IR1A 1P4IH 5AZEL 4QRUB 1DBAL 1LO0L 4TTDC 3QIBA 4TVPE 5DRNA 1V8HA 1A6AA 2YUWA 5C71A 1NCCH 3GHBH 3VFMB 4CMMB 1C5DB 1DQML 3SDCA 1MEXL 5FGCB 1R3HA 3FONB 1XCTA 4WI6A 1UADC 2Q6WA 3KYOA 3OJDA 1RIHH 1C5CH 4ZS7L 4GKNA 2UZIH 1FFPB 1ETZB 4M3JA 5CJQH 3MTRA 3RU8L 4HX1B 4UOJA 4MD4A 3EHBC 3DMMA 4C59B 1AFVH 2EIEA 1DN0B 3S5LB 1L7IL 1A02N 2OS7A 3OV6A 4NSKB 4W4OA 4YHZH 5T3ZH 4MJIE 2V7NB 2R69H 4L4VA 3S88H 4J1UB 3WXVH 5DJAA 1NBYB 2NY6C 2QADB 1RULL 1UM6H 3RWDB 5I1DA 3MRJB 3U4BH 1KJ2H 2OP4H 3CCHB 1B90A 4J7RA 3BWAA 3P9MA 1HHJA 1BZ7B 4KKAD 3VXOA 3LN4A 3WSQL 4L8BA 2XWTB 5JIIA 1DR9A 1F42A 4OIIL 5C09E 1NPUA 1UH2A 3GSWB 3RZCA 2PXYB 4F57L 4V1DD 1CN4A 1KPRA 3GGWB 3EJYC 5IW3A 1D6EB 1TZHB 4JR9L 1Q72L 4AEEA 3GBML 1H3VA 4P23D 3HUJB 1TDQA 4OKVB 1QP1A 3IFOA 2WBJA 3IETA 3TN0A 3FCTA 2VXUH 3CVHH 4QHUB 3E8UL 3MROA 1CD1B 2VXSH 2OCFD 4QEGA 1YEGL 4CNIB 3K2UH 3MV01 1KB5A 3GNMH 2N56A 5DYOA 3MUGA 1Z0NA 3QG7L 3TPUB 3B2UC 4LSUL 3VWKA 2CR3A 2E7HA 4JN2A 4FQQB 1UC6A 2AV1A 2EDNA 4UTBH 5K9JL 1UEMA 4JEGB 4XXDB 3UAJC 2ICES 3BMVA 3FRPA 3L9RB 1ITBB 4EIGB 3BGMA 4YDVA 1WZ1L 2XQBL 1GZPB 4FQIH 4R26L 5FGRA 4IJ3B 5JORA 2VZVA 4NM4H 4H25B 3AC0A 5FHAH 1WLHA 4PR5A 3DX8B 1KELL 4R8WL 5GXBB 3CC5B 3DETD 4B7LA 5BRZA 3K8LA 1CFTA 3RRQA 4UBDD 5DHYA 3TPKA 2BHUA 4PJAA 4PJIB 5DMGD 3QUYA 4O2CA 5E99H 2VDKL 1NC4B 3BKJL 1GHFH 1KCUH 1VGEL 3HG1D 4JCLA 4H20H 1P1ZA 4PJEE 3OXRA 1WWAX 3E2HB 1TVHB 3WD5L 2EDJA 2YRZA 3C9NB 1BIIA 3V95A 1WFTA 4PJEF 1BEYH 4HG4K 3Q5TA 4PLKC 3HNTL 2VAJA 3G08A 4QRRD 4CUCA 2VZOA 2NW2A 2OTPA 1EFXA 1X5KA 3DJ9A 4KDWA 2P5WD 3DYMA 2AABL 1I4FA 5KVEH 2GJ6D 3RTQA 1NC2B 4TPRL 4NQEB 1N3NA 2G9HA 4CADA 1ZT1A 3QIUD 4JQXA 4L3EA 1LEGA 2A9MH 3PWNB 5GS0H 3HFML 4UNVA 1YUHA 4Y5YA 4XHQA 2DBLH 1J0IA 1UZ6E 1NSNH 5KBNC 3SBWA 3QCUL 4KHXH 1P84K 3UC0H 1B3JA 2FSEB 3BAEL 3O6FC 1I8IA 5BW7A 1UZ6F 4LCIH 3KXFE 2CGRL 4NBZB 5EU6E 2QSVA 1S7XB 2PUQT 2XN9A 3T2QA 5D7JB 1QSFA 1AGEA 3IDNB 3DRTA 4JO3L 4XWOC 3I2CH 2H41A 4NPYA 3OR6B 5MENA 4O5LH 5GZOC 3SJVB 3SO3C 3ZKSD 1U8OB 3H9SE 3CFBA 4MX7A 1E6JH 4JZNA 3VFNB 1OAYH 3U9UA 3GSRB 3MXVL 4XPFL 1D5BB 2DIBA 4P57B 5LAXA 3MCKA 4XNZC 4ZUUB 4MVBC 4QCIB 2DQEL 3GKWL 4OZGA 3Q5OA 1YYLL 1OTTD 4WI9A 4Z8FH 5H94A 1J1XL 3BI9X 4K3JL 4RISL 1JZ6A 3OJ2C 4G8FB 2VZSA 3C5ZC 3O6LH 3VI4E 4ONGH 2Y07L 3RAJL 3DRQA 3BN9C 3ORJA 3V0VB 2YBRA 1JMZA 2AEQH 3VI4F 3QEQE 4PFEA 4Y7MA 4O4YL 2X9YA 4PBXA 3UYOD 1MH5B 2OTWA 5JMRA 3QJFB 1KIQA 3SKNA 4MD0A 2IJ0C 5ANMA 3ROOA 1AXIB 4YPGA 4KI5D 2VSDA 3L3IB 4PJFB 5I0DA 3QWRD 5H2BA 5ALBH 4DGYH 4GW4A 2FHFA 3PXJA 4AJ0A 4JKPH 3PHQB 1PVHA 4H88H 1CDBA 3CK0L 5DDHB 1AGBA 1G0YR 1KLUA 3NCFB 1CLYL 4Y4FD 2AJYH 1EDQA 4NP4H 1NFDA 3OKNB 1C1EL 4TSBL 4MAYC 4DVRL 4IDJL 1JZ3A 3V52L 3OXSA 4KKBC 5FAAA 3WL9A 3DIFA 4NQDA 5EZOL 3DSNA 3FHAA 3G6AB 1K5NA 2FH6A 4NUGH 5TE4L 2LU7A 4JRXB 1KXQE 4N0FA 1ERNA 2HLFC 3SGJC 1XFPA 5HHOE 1VPOL 3MBEC 3BO8B 4L8DB 1G9MC 3C08L 3LQZA 4HIEA 1RI8A 1IAIM 3DSFL 1RMFH 2PW2B 1FFRA 3KPSD 3RVUD 5EN2B 1G9ML 4ACPA 2F54E 3VD7A 3AAZB 3E1F1 1KFAL 5MEOA 4OI8A 4R97C 1XIWA 3PIQA 1J5OH 2R2BB 1Q1JL 4ZXBA 1Q9KA 1ZHKA 5DQJB 5C0CB 4DGVL 4F9PA 4JFEE 3IKCA 1OARH 4EI6B 1P69B 3IDMB 1FE8H 1WAAA 1ACYH 1F8TL 2YN5A 5DR5H 3HMXA 4IRJC 3D0LA 1AY1L 1CGYA 1PSKH 3VXSE 3RGVA 5JPMB 2JIXB 1J0JA 2GCYA 3RVXC 4J3UA 2GUOB 5DEZA 3QT2A 3L5IA 4UILL 1ES0B 4PLJD 5B39B 1EEYB 4LCWE 4DOHE 5GHWH 1EK3A 5MI0C 3BZ4A 1FHGA 3A67L 3U0WH 5HI4C 3QCTL 4GMSH 2LTQC 2CLRB 3ARGD 4POZC 4RNRA 2EZ0D 1R5IB 1A6UL 2APBA 4ONFL 4EDWL 3TBVA 3PL6B 4JY4A 3PV7A 4WIQA 3I85A 3AUVA 4OLXH 5AAWA 3C5SB 3BZFA 1OTUC 3G6DL 4WO4A 1FL5B 5ISZA 4YIQA 3WKMH 2JK5A 5E6IA 4R7DA 2I5YL 2A9NH 3K4ZA 3Q3GA 3ELAT 2OTUA 1A14L 5JIKA 1DANU 3ABZA 4QOKB 1QLFA 2NY7L 3MRDB 3D39E 3J7HA 2DLFH 4XPHH 4N8VA 2VAAA 3CX5K 2XKSA 2YPKB 4U1GB 5IMKB 4IBLT 4K3DH 1A6TB 1CLZH 5D1ZD 4U1LA 4M48H 2DOCA 4K7PH 1HQ4B 4ODUB 1EXUB 2IEPA 2OJEA 5I66B 3KPPA 5DZLA 5JPNB 3DPBA 5CUSL 2MKWA 1FVCB 5EWIL 4YEFA 3DX6A 2BVQB 1CGSL 4LBEA 1J7VR 1H3TA 1YQ2A 3MUHL 3LRGA 5BQ7B 1EZVY 3IU3A 5CZVH 4HWNA 1G6RL 1P6AB 2XWBA 3BPNC 1GGCL 5D6CB 2F8XC 3P0GB 1TTFA 1OAUH 2V5MA 1NCAL 3O3BA 3C6SB 4M43H 4X5WA 5F7FA 1MVFA 2Z93B 1LK2B 2GEEA 2BOCA 5HHXL 2EDRA 1AKJA 5EBMB 5GZNC 2VL5A 3T77A 4YWGH 4MNGE 5A3ID 3QI9D 4F37F 1CDGA 1KV3A 1VDGA 4YHIB 1VFMA 4QKXB 5J0BA 2BP3A 1EUTA 1FO0A 1QBMH 4P3DA 4S1DD 4I2XE 4M7LT 1UJ3C 4AG4L 3W9EA 4QRUA 1BFVL 5IB1A 5TPWL 4MCZB 1MCSA 3MPCA 4JG0H 3WIHH 3Q6GL 3VFMA 1C5DA 1U3HC 4XBEH 4HIIA 1K3ZA 3FONA 4JO4L 2EDOA 2MNUA 1JPTL 4XMLH 4JG1L 1T1WB 5ICZB 1RZKC 4WUUD 2AK4D 4JN1H 3FN9A 3IRPX 1FFPA 5CP3H 5D93B 4Y2DD 4DK6A 1ETZA 1ED3B 1WSST 3PGDB 4JHWH 5IK3B 3FB7A 2YZ8A 4OUOA 4HX1A 3VA2C 5FYLD 3REWB 1JGUH 2NY1D 3QISA 2DDQL 3FRPG 1RZKL 1DN0A 2PYED 5D7LE 4NSKA 2AEWA 4DN4L 3BISA 3O9WD 4OCWL 4C83B 1PAMA 2V7NA 3ILQD 3G6JE 4RWYL 4ZFGH 1NBYA 2YD9A 4G43B 3P4NB 4Z7VB 3RWFB 4JFZL 3RWDA 3RVVD 3CCHA 4U0RC 5ITBL 3G6JF 3IFPB 3OF6A 1CLOH 1BZ7A 4NWTH 3RUGE 2VTFA 2YD8A 5A43C 1EBAA 4I18B 1IKNC 3GSWA 3MZTA 2B4CH 4FS0A 1XF1A 2PXYA 3RUGF 4HF5L 1NGZB 1N4XL 4N0UE 2X1OA 3GGWA 1D6EA 1TZHA 4OLUH 3W5NA 3MMEA 3HUJA 1KB9J 2GT9A 5KAQF 4OKVA 4RAVA 2WLYA 4QHUA 5JW3H 5E6ZA 1CD1A 3PQYE 2Q76B 5FCUL 4OD1H 3NIDF 4P2YA 1MAML 4G6JL 3TPUA 1JPFB 4D94A 5I1CH 5IT2H 4K3EH 1NCTA 1I3RB 3CMOL 4XXDA 2UZXB 3SHSA 1JRHH 4NKOB 1CE1H 3NTCH 3WYRA 3L9RA 2ZKHH 1KIRB 4XCEB 1GZPA 4YXLH 4NO0D 5JZ7C 5HDQL 4H25A 1G7QB 1AXTH 1TPXC 1YMMD 4X98B 1LEIA 4O2EA 1FGVL 4MB3A 5FKAB 1U8HA 3DX8A 3MC0A 2GQHA 4MXWL 2JJVA 3CC5A 2CSPA 2KKQA 4ODTH 1URLA 5E2VH 2W0LA 3QQ3B 4M7LH 5HHQB 4PJIA 4APQD 4DEPC 1VEMA 5GRXG 2VLKA 1NC4A 1GPOL 5D7IA 4N90E 2D7NA 4Z0BH 5DK0B 4GG8B 2F5AL 1N5AB 4Y16B 4YQXL 5C0FB 3C9NA 5SV4A 1CXHA 3QDGD 2AJSH 4PGEB 2IH1B 4JAMB 4IOIB 4HCRA 4O02L 4QRTB 5J7CC 1K9TA 4IRZH 4UV4L 1OP5K 1ZVSB 4RMSA 4JM2B 4JRYE 2E27H 2MPAL 4JB9H 1NC2A 2IG2L 4NQEA 5IW6A 5DJDB 5LXGL 5I16B 4V1DB 3SE8H 2VLJD 1VFAB 4P4KB 5ILTH 2DQGH 3LKNA 4RMVA 1SJEB 3PWNA 2EE6A 5CJ8A 4LP5A 2VH5L 5JW4R 1EUUA 4J23A 4KRPD 1T1YB 1A3RL 4WWKC 4XNUH 2KDGA 2R1YA 2FSEA 3F7RA 3SDAD 1F4XL 4KGLA 1KGCD 2NY4C 2PF6A 4IOFD 3FQTB 1S7XA 5KJRH 2DLGA 5D7JA 3RHWK 5IHUH 6FABL 3IYLW 3UZEA 3IDNA 1YYMH 4AZ8A 4P46C 1CU4L 1D5IL 4PP1C 3C60C 3OR6A 3F65A 3IJHB 4HV8B 2A0LD 3QUMA 4LSTH 5D96C 3P4LA 4Q74A 1DUZB 1F4WL 1KYOK 1T7VA 3TO4D 3SJVA 4PUBH 3TM6A 3QWOB 2V5TA 5BZDB 3VFNA 5KSAD 5E8EB 4OCXH 3GSRA 2VQUA 1D5BA 2HKFH 4KUZH 2DQUH 5SV3A 4P57A 2KBGA 1D5XB 2PETA 5I9QB 2OMBA 2X41A 1G7MA 3RWHA 4ZUUA 4MQXD 1FC1A 4QCIA 4HGMA 1U36A 4HPYL 2XTJC 3FOLB 3QDJD 2AJ3A 3MLVH 4OFYD 4P2OD 5IROC 4G8FA 4XAWL 1AI1L 1E4KC 4R4BB 4TN9A 2VITB 3QEHB 1Z9LA 3GI8H 2NR6C 3V0VA 1N64H 3QDME 2EYSB 3OAZK 3BSZH 3ULUH 5GGRY 2DLTA 2FH8A 3QEGL 1A2YB 1KC5L 1MJUH 4HZAA 4CVUA 1OB1B 1MH5A 2H45A 4DKAA 1GIGH 4ZUSB 2GJ6B 3VXRE 3QJFA 1BM3H 3PGCB 1N8ZA 3WLWD 4X6CE 4PJFA 5CEZL 1QBBA 5AWNH 1T0NA 3QIUB 4JGUA 2Q86B 4X6CF 3PHQA 3DVFA 3LZFL 2O5XL 4L1DA 2I25N 3RNKB 3U79A 5DDHA 5DFVD 4G7VH 4KK5C 5F7HA 5DGQA 2UYLA 2FB4H 1A6VL 3OKNA 4P3CH 5TF0A 2V17L 15C8H 4GUPA 1U9KA 1YNLL 3TA3B 3F58L 4OV5B 3NFNB 5F9WC 4M5YH 2YK1L 3G6AA 2H3NB 1RPQA 5I1LB 4JRXA 2JTDA 3TNMA 1GC1H 2Q8AL 2F58L 5D5MB 3BO8A 1S3KH 3G9AB 4LLAA 5JHLH 2FO4B 4FNLH 4ODVL 4ALAL 2XTJE 4P5KB 1FL6B 2PW2A 4QHNB 3VMPA 3C09B 2R4SH 4CRPA 5DD3H 2NY2B 4IMKC 2IPTL 4CGTA 4GXUN 2BRQA 2VLRE 3BKCL 3IF1B 5ESVA 1IGTB 5EN2A 5JOPE 3N9GL 1FYTE 3AAZA 3WJLA 4PRPB 5CEZE 2G5BB 5KSBF 2P43B 2PO6C 2QSCH 3O3EB 2R2BA 2VN7A 4N8VG 5DQJA 5C0CA 4YUEH 1TQCB 2XI9A 1QRND 1ZANL 1OSZA 2BY0A 1VENA 1QFWL 2E6JA 4Q97A 2A73B 2H2SD 4EI6A 5JXEA 1NEUA 3IDMA 3TVMC 1AD0B 1BQLH 4AIOA 2QKIB 4N5EC 5F1IB 3X13B 1VEPA 4JDZB 5IVXE 5JPMA 3K1DA 5D7KE 2GUOA 1QG3A 4UT6L 4XCYB 1OTSD 3PWVB 2EE9A 3WE6B 2ADFH 2HT2D 3HC4L 3MUJA 3JV0A 1YEIH 1D5ZA 4YDIH 3S35L 3O6MH 3BRDA 2CLRA 4P0DA 5GS1A 3ZZ1A 4IRSB 4OF0A 2DTSA 4H0GA 4XPGH 1BX2A 3L5XL 3PL6A 3QIBC 3SCMD 1KXVC 2J5LC 4U1KB 3S36X 2ORBL 4LQFH 1I9RL 2XZQL 3C5SA 4I4WB 1UM4L 3SDCC 5EPMA 2JB5L 5JA9A 4UT9L 3CSPA 1EGJA 2DB8A 3ARTA 4L8SB 2EEAA 5BV7H 2F53E 5I15H 4PJ5D 3CMGA 3LAFA 1YEHL 4QOKA 5EU5B 4YHOL 1U42A 3MRDA 3KYAA 3BXNB 3VDAA 3HNVH 4ZOBA 3JV5A 2YPKA 4M6NH 1MFCH 3DMMC 4XB8A 5IMKA 1Y6KR 1K8IA 1A6TA 3P4MB 4QWWC 3ARBD 3HE6D 3EOTL 4W4OC 1S7TB 3WIIL 1HQ4A 1ZEAL 4LEOB 1EXUA 5I66A 3VFSA 2EH7H 3H6JA 4LLQB 3T8XB 1EJOL 1FVCA 3S5LG 3RBSA 2BVQA 1JFQH 4K23L 2VR4A 4NN6C 5AEAA 4LSPL 1KENL 1LO2L 5BQ7A 1HEZB 4IS6B 3D18B 5D6CA 5I2IB 2R2HB 3C6SA 3CLEH 2Z93A 1A0QL 4GH7B 1LK2A 5C6TH 3RZCC 3MA7B 4LOUC 3TH4T 1N59B 5LCVL 3P0YL 43C9B 5EBMA 2C4FT 4CW1B 3F7YB 4MAUL 1JHLH 4KPHL 5L6YH 4WHTB 1YNTB 4YXKL 3LRSA 2WBJC 2AJXL 4JQIH 3TN0C 2QV2A 5AAMA 1IGFH 3Q5YA 2VXQL 5BO1L 4RWHA 1QHOA 3GJEB 3BUYB 1MHPH 4J4PA 4JGMA 1DZBA 4Z5RB 3VWKC 1RVFL 5J11B 1T1WA 1U3YA 4NCC2 5ICZA 1NAMB 3S36H 2VZTA 3UPRA 1KB5L 3SGEI 2VDOL 1ED3A 5IK3A 1RUPH 2FL5B 2VC2L 5FGSA 4I77L 2OR9H 1FC2D 4PLOB 1PKQE 4JREC 5FYKU 1MI5D 4MZ2A 4M6OH 2CRIA 3GHEL 4K07A 4X7CC 1KNOB 1D5MB 5DHXB 4L4VE 3TV3H 3FFDB 4FFYL 4Z77A 1Y6MR 3CZJA 1AGDB 2DRUA 3FZUC 4RGNB 4C83A 5J1TC 1LDPH 3IVKB 1MCCA 1LWRA 4AY0A 4G43A 4ZFZB 4LSVH 3P4NA 1H15B 1R3IL 3QUYC 3RWFA 4Z7VA 1NLBH 2YSSB 4M1DH 1BMGA 4LRNL 2Z31B 2WIIA 1CICD 2ZG2A 5T1MB 5LWYL 3M8OL 5DVOA 4O9HH 3U46B 2HVJA 4QTIH 5TE6H 4NYLA 4I18A 4UINL 3B3IB 4PLKD 1X4ZA 1CZ8L 2VN4A 2FX8H 4XVJH 1OP3H 1NGZA 1UACH 1N6QH 5I19L 5HXMA 3QWQB 1A3QA 4OUUB 3FT4A 3RTQC 4FQXD 1ZLUK 1BQHB 2ICWJ 2WZPD 4ZS6D 4MNHB 4HUWB 1TMCB 4BQ6A 2VR9A 5MEPB 5I6XC 1W0WB 4G8IB 4LDEB 3LQAC 1IMHC 1B0RB 3QEQD 4QXUH 2CJUH 1JZ7A 4JQXC 1Y6NR 2Q76A 4TULL 2YUZA 5AUMB 1PLGH 4Y5YC 4GRWH 1MF2L 3HZKB 5A2JH 2N4IA 3EIFA 4YDJB 1DVFD 3K3QA 1KCKA 2B20A 5DJCB 4HWBA 1I3RA 3LQAL 4NKOA 4U1SB 1T5XB 1ITCA 4ZTOH 3L3DB 1T20B 2UUDK 5BW7C 4ONHB 1KIRA 3PWLB 1FAIL 4BQ8A 3B9KD 1U8KB 2EDTA 1G7QA 4X98A 5FKAA 4WUUB 4XI5D 2AK4B 5DJ0B 5IHZB 3GJFH 3JTSA 2VLME 1CCZA 3VXPA 4PJAE 2QL1A 1AHWB 1RZIA 3QQ3A 4LNRB 5LQBH 3CFJB 2NY1B 5HHQA 1SJXA 2WMPA 5I76B 4HGWB 5L8KB 2ERJB 2WQRA 4PJAF 4HH8A 4UOW1 4F80A 2OI9B 1N0LA 4YZFE 2EE3A 5DK0A 4GG8A 4NO3B 1DBBH 1ZHBB 1N5AA 3BGFB 4WJ5A 5C0BD 5C0FA 1LK3L 3D6GA 4GKSA 2VIRB 3BIAX 3EJZD 4YZFF 2NYYC 4PJXB 1JHKH 4NT6B 4HULB 2IH1A 4IOIA 4QRTA 4HJ0D 4LVEA 5BVPH 4NC2B 1A7PH 1H8NA 3D87B 1QSED 1YA5A 1F58L 3ULSB 4QXTB 2B39A 1G0XA 1V3KA 2F54D 4XP1L 1G0DA 4MNQB 3GSQB 4X7SH 1XF5B 2VDPH 4OQ1A 4CN4A 2VZUA 4YPJA 5DJDA 2VDLH 4L3EE 5I16A 4PJ8B 4V1DA 2LU4A 1U92B 1VFAA 2W9DH 1TZIB 4P4KA 3MQIA 4DW2L 4HJGB 2WQ8A 3LEYL 3D5OF 4P23A 5L9DL 5IBLC 2ZCLL 1HH6B 5IWLA 5C0EB 3QCVL 3DGGA 2X4QB 1UZ8B 5CCKH 5DI8A 1F45A 4A6YH 4NWUL 3EDJA 1T1YA 3NCYP 4I3SL 2I07B 4PGDB 2R0WL 2YD5A 4MXVE 4TSCL 3JXAA 2XN9E 5I1JH 2EIZB 2ZJSL 1QSFE 3FQTA 1RUKH 3SGDH 3ME0A 4L29A 1A1NA 3WFZA 3KLDA 2VISA 2ADIB 2RAMA 4LCWD 5MENE 1EV2E 1Z5LB 4KKBD 4PJGB 1CS6A 3ZKNC 4HV8A 5T5FL 4Y5VC 4R0LB 1FGNL 1NMAH 4NN7B 1DUZA 3I75A 1Q8MA 4PGCB 3VG0H 1YMMB 3QWOA 1E4WL 5BZDA 3T0EB 3FQNB 4Q9RL 5JNYB 2EXYC 4XMKL 3MJ9A 4NO2B 4OZGE 1H8SA 4NCC1 2ENYA 3FOLA 1DDHA 4OZGF 5ID1A 1W72B 4LSDA 3D39D 4GAGH 2KQMA 3HG1A 1JCKA 4AM0B 4L5FL 4NZJA 2XZCH 4K8RC 4OZ4B 3WS6A 2VITA 1F5WA 3DBXB 1XIWC 2B0SH 3RX7A 2EYSA 3WNOA 3N1PC 2Y6SC 4Y1AE 4ZXBC 1IM3B 1A2YA 5FUZH 3V6BR 4F9PC 5ANME 4K8RL 3D3VB 3VG9C 3QO0B 4ZUSA 2GJ6A 4XNYH 2DQCL 2P44B 1UENA 4NOBA 2AQ1A 3BYYA 3ARZA 2R29H 4ENEC 1WTLA 4QF1A 3QIUA 5I71C 5KN5B 3U2SB 4HIJA 2B5IB 3RVXD 3RGVC 2Q7YB 1RUAH 1LO3H 4LSRH 2Q86A 4OCLC 4OGZA 2L4OA 1NCBL 2ZCHL 3R1GL 1PEWA 3RNKA 1NFDE 1U8PB 2R0KL 1QKZH 5I8EB 4RCAA 3AS3A 2EDLA 3SDAB 1OAKL 3HMXL 4NQDE 1NFDF 4JFXB 4LKCB 1LEKB 3BE1L 1RIVH 4I5BA 2OZ4A 4F3FA 4OV5A 5DMIL 5B39G 3NFNA 4G7YH 4L4JA 2H3NA 2KZ1B 4ELKA 2B1HH 2FYYB 1VFBB 4WO4C 4RFOH 4JY6A 3KLHD 2BSTB 5E6IC 5K9QG 3BZEB 2FO4A 4CDGC 4TYUA 2BHZA 4P5KA 3TO4B 4QHNA 2MCPL 1ZHNB 2BERA 2APXA 4D0CA 2QQQA 4QRQB 3EZ8A 2X44D 4KMQA 2DQDH 2H6PB 3BAEH 2BY3A 1MHHB 1IGTA 2VE6B 3RKPA 5TFSL 1IC4L 1OM3H 4HS8H 4FXGA 4JPVH 5C2BL 4LAQH 2BDNH 4PRPA 5E03A 2X6MA 3K1KC 1CD9B 5B3NA 3QDJB 5D7LD 2NCMA 3IFLH 3QQ9D 3DV4B 4XC1L 5E8DH 4JZJB 3TFKC 2GY7B 3FN0L 1V7NH 4OZFG 2WUBL 4X6FA 3MCLH 5TE7H 4KKCD 4OCRL 2FJHA 1WK0A 3FT2B 3SKJH 1WAAE 1WCBA 4GFTB 4TUJA 2W0PA 3M1BB 2A73A 4S1SH 3WO4B 1JYWA 3JTTA 4OD3L 1RZ7L 3PP3K 3CZFB 1M1SA 4LFHG 2QKIA 1HINH 3ARSA 3FRUA 1WAAF 2E9IA 4H0HB 4JDZA 5HI3C 3BWUC 2VZ1A 1MLCB 1I8MB 5GZND 3MBXH 2UV3A 2CKBB 3ESUF 3GKWH 3V6OE 3MRHA 4XCYA 3V0WL 4BSWB 1CDIA 3PWVA 4G5ZL 3QWRA 5IEKB 1X5ZA 5CINH 3VGAC 1E4XH 4XC3L 3GMPB 4MB5A 3KR3H 1M05B 2VQ1B 3PWPD 4GAFB 4UTAL 1SYSB 3DROB 3S3SA 1T89A 3QHZH 2ZG1A 1ZS8A 2NY5H 4IRSA 1KJMB 5E8NA 2R4RL 3MGOB 5ISZE 4HWZB 4MQ7B 3G5YB 4NQTA 3UTOA 1DJSA 3BP4A 3P30L 4I4WA 4QRSB 4Y4FA 5I74B 5I1IH 4U1NB 4FQJH 5HYJB 4S1RH 1L6XA 5DJYA 3HRZB 1FO0L 3RJQB 2ZPKH 3T09A 4L8SA 3KAAA 4LCCB 1P6FA 1ZWIB 2JJUA 4N5UA 3BXNA 2R56L 1S9YB 1RJYB 3ZYOA 4XWGH 5KSVB 2AGJL 4DKFH 4AQOA 1NDGB 3E6HA 3P4MA 4M62H 3IDJA 3GFUA 5IFHL 3PDGA 3ZLQC 3QRGH 2AKRB 1Q9WB 1S7WA 5HHMB 2OJZH 4LEOA 4KTEH 4LLQA 1MRCH 3GSNB 4IDJH 4OLZL 5GJTH 1QPXA 4DVRH 1CD8A 4RMWA 3T8XA 2DYPB 1HNGA 2QADC 4I8DA 3HB3C 2JB6B 4X80L 4N90D 4P59H 1HEZA 4IS6A 3FFCD 3K8KA 2R2HA 1S7UB 4GQ9H 1VPOH 1QRNB 3BN3B 1B0WA 5BJTB 4JVWA 3MRFB 3QPXL 4OB5H 3C5JB 2PXYC 1N59A 1OAQL 2FX9L 3L6FA 43C9A 3QG6B 1BZ9B 3LKPB 5EZIL 1NUGA 3F7YA 4CW1A 5ADPH 4X6BB 3OAUH 1B88A 2J88H 1QFHA 1YNTA 1XF3B 3GMQB 4JRYD 4H8WH 3OKEB 5HJ3B 5LG1A 2J4WL 1J12A 1X44A 4WV1A 5DVKA 5EOCH 4EIZC 4BUHA 5FGCE 3LS5L 4HUMB 1CG9B 1DBJH 2YPLD 3EYSH 3GJEA 3VFPA 2EKJA 3NCJH 5KVGL 3BUYA 3QUZD 1HYSC 2PTTB 4MDIB 4OSUH 3RWJB 5DUML 1T1ZA 5IB3B 4MJ4A 1KTDB 3SCMB 2P42B 3K4DA 3C6LD 5I8CB 5JZ7D 3TIDB 2OXHA 4XVTL 5DXWA 4KY1L 4K71B 2FL5A 4MCYB 4IJ3C 3H3PL 3PWJB 1D3CA 4PJ5B 3TJHC 1MFBH 1D5MA 1DQLL 4OLVL 3ESVF 3H42L 2BNUB 3FFDA 3TBSB 1RZGB 1PX4A 1Y18B 4KRLB 4X9BA 1I3GH 3IVKA 2AERT 4ZFZA 1CDHA 2H2PC 3JV4B 1H15A 3W11C 3ARBB 2YSSA 5D1ZA 3HE6B 5F3HB 1KJ2B 3F6IA 5EG6C 2Z31A 5M94B 4HUXB 4S1QL 1LDSA 5T1MA 4HUUB 2BFVH 2VLLA 1QRKA 5CZKA 2OSLB 4Z76A 1MHEB 3B3IA 4YDKL 1OF2B 3SKMA 1MPAH 3V5DB 3X3FL 5EC2B 3HUJE 1LO4L 4FQ2L 4OUUA 3VW3H 4UQ3B 2OMNA 1WFNA 1U95B 1IL1B 3A6BH 1U2CA 1BQHA 3QNYB 4LHUB 5IEHA 3OKKB 1CBVH 4MNHA 3HUJF 1J8HB 4HUWA 1VESA 4NC0B 1YZZA 4F58L 5BS0D 3QDMD 5DT1H 1P7HL 1EAJA 3AU1B 3CVHB 4G8IA 4HCRL 1EHLH 4HLZH 5F21B 5DD5L 3HZYB 3WNNA 5MEQB 3U4EB 2EKSB 3HZKA 4BFGA 2AVGA 4WWKD 4HT1H 4YDJA 3U6RB 1SEQL 1GAFL 4WI3A 1EEZA 2BNQD 5GGVY 2E7CA 3PP4H 3L3OB 5GQBA 2JJTA 3O4OB 1WBYB 4U1SA 2NY4D 1T5XA 3RL1B 3L3DA 1T20A 4KRMB 5I17B 2NY0B 3PWLA 4XPBH 4ZAKD 3TYGH 1FDLH 1U8JB 5JDSB 5D7JC 3S34L 1IGMH 4FXKB 1FVEB 1RUQL 3C60D 4WUUA 2AK4A 4U1HB 5DJ0A 5IHZA 4Y2DA 1DN2A 4LRIA 5EIQA 1EMTH 4PJIE 1AHWA 4LNRA 4LPVA 3L7EB 1WUNT 3JWDL 5E2WH 1MI5B 2FIKA 5T33L 5HGBB 4UV7L 3WXWH 5I76A 4HGWA 2X09A 4WI8A 4LCYA 4PJIF 2PYEA 1QVOA 3MREA 4JKMA 1IAIH 1T21B 3LIZL 3O9WA 4NO3A 1F90L 5D7IF 5GGSY 3FMGH 2XTJD 3X3GL 5EOCJ 3ES6B 5E7BA 3INUH 3D85D 1YQVL 5C0RH 4YGVB 4NT6A 1MY7A 3ULUD 5IBTL 3C8KB 2VLRD 3MV9B 2OQJB 5TJWK 4GW5B 4KQ4L 2PR4L 1CL7H 4LPUA 4OQTA 5F89B 4ZD3L 5JOPD 3ULSA 4YR6B 4QXTA 4HXAH 4NQEE 1UA6L 1FCGA 4MNQA 3GSQA 2NXYD 1T6WA 3EDFA 3LN5B 2EYRB 3CFIC 1U92A 1TZIA 4KHTH 4MA3B 4FABL 4B7IA 1VADB 4FQXB 5D8JL 1JF1B 1NBZB 1WIOA 2GAZB 5DUBB 4M7KL 5C0EA 2X4QA 1UZ8A 1P7KB 3IDYB 2HFFB 3TBTB 5CSZB 2I07A 2WWMC 5C70A 5DA0B 5A2IH 4LL9A 4OM1H 3U7YL 4LSQL 1EERB 4GRLD 1I8LA 1UWGH 5IGXH 3UTZB 1DVFB 2CMRH 1D9KB 4FQ1L 1CFVH 4JFPB 3ZYZA 2ADIA 3N85L 2XY1A 1OCWL 1FL3A 1RFDH 3FB5B 3H9HB 1Z5LA 1RU9H 1KN4H 3SJVE 3B9KB 3QUXD 3LKRB 4R0LA 5FUCE 2X1PA 5LGHL 4JFDD 4YO0B 4PGCA 3I84A 1YMMA 1BVKA 4YX2L 3T0EA 1J1PL 3FQNA 5JNYA 4R4FH 1HHHB 2YA1A 1MFAH 2DI8A 4P2RB 2FZ3A 3UBXB 5DD0L 2Z91B 5E8OA 4FP8H 3FO0H 2LVEA 2EO1A 2J7LA 4OLWL 5L2JB 4EOWL 1W72A 1G7HB 4AM0A 2MKLC 1MIEL 2AI0L 4OZ4A 4PD4J 4W81A 3V4VL 3WJLC 3DBXA 5FA4A 4GW1B 1I1AB 2OK0L 3TBWB 5T1DH 4JFOB 5TQ2L 2HP4A 3B9VA 1QSEB 1I9JH 4NGHL 3LMJH 4WFEE 3UJJH 3D3VA 3QO0A 3GUTB 4YHPB 4PJFE 5JXEC 4K94C 4KROB 1TJIL 2VLJA 5F3BB 4JFQB 5FB8B 5FECA 2DM4A 3U2SA 5KN5A 1CF8L 4J3SA 4PJFF 4HWEL 1FNEB 4TRPH 2Q7YA 1A4JB 3TT1L 4OKDA 3KJ4B 3NA9L 2GK2A 3D2UD 1UKQA 1YY8A 2FX7L 3I02B 4LU5H 2CIIA 2OL3H 1QR1B 5L7XH 5SWZD 4K94L 5I8EA 5E2TL 5EO1B 3HR5B 5AZ2H 5JUEH 1KLFA 4WCYH 4DUXA 1BFSA 1H3PL 3SDAA 5D1QD 3O6KH 4PJDB 4JFXA 4LKCA 5GS1C 1LEKA 3QIBD 2W0KA 4J6RH 5A16A 4JRXE 1C16B 4O00A 1BFOB 3PL6C 3HI5L 1IGIL 5E94A 3SDCD 4Y4HB 3FO9A 1D6VH 2FYYA 1VFBA 2XQYG 1MWAB 4O58H 3MRPB 1AO7D 2XICA 1GOGA 4X6EB 4W70A 2O93L 3U0PB 3V4UH 1AJ7L 2H9GB 3TO4A 4Z78B 3GSXB 5DRZB 3ZMRA 3DUHA 4XVSH 2HFTA 4ZTPH 1I7ZB 2IGFH 4QRQA 4Q7DA 1PD6A 3CSYB 5KSAA 1JWUB 2H6PA 1MHHA 5I1KL 3NABL 2PTUA 4LQ1A 4MJ5B 1CQKA 1EGJL 4RFEA 4U1GC 4R7NB 1Z9MA 3DYOA 2MJWA 1JGVL 3NCCB 3QDJA 3MNWB 3O2VH 5C0CE 3DI2B 4OFYA 4JZJA 1EA9C 1RV6X 2JJWA 4PRID 4CVZB 3FQRB 4PJBB 1VGKB 1V3MA 4XVUC 3SE3A 3S7GA 1QPPA 5DF0A 3FT2A 3NIFE 1WV7T 3VRIB 1IARB 4R4ND 3C2AL 3M1BA 3ULVC 1MCEA 4QY8B 3F12B 4MJ2A 4ZOEA 1JGLL 4GMTH 3CZFA 1Z9OA 5EZLB 4MMXC 3NIFF 4ZO7A 3P40A 1YPZB 3GMLA 3VMOA 3CXDH 4X9GA 1I8MA 4G6KL 2CKBA 2R0ZL 1QFUH 4BSWA 4JJ5B 5IEKA 3L7FB 3F62A 1MRFH 3GMPA 4XCFL 5KW9H 3TN0D 1M05A 2VQ1A 1NFIB 3RHWF 1SYSA 3DROA 4XTRC 1NBQA 1YECH 5IMMB 1BBJB 4LEXL 1T03L 1KJMA 1ONQB 1XMWA 4MQ7A 4XP6H 3G5YA 2XT1B 2APTA 4QRSA 4MS8C 4U1NA 2XKNB 4J4PC 5IQ9B 5GRVK 3T1FB 5H37G 1T5WB 5JDJA 4M4RA 3D25B 1AQDB 4QOKE 3SDYL 3T1WA 3CH8A 1RIUH 4LCCA 1A5FH 1JF6A 5D93C 1ZWIA 1K3IA 1S9YA 1ZTXH 1RJYA 3UTPE 2YS4A 2ZSVB 2VUOA 5KSVA 1KG0B 2BVOA 5HVFB 1BBDL 2AKRA 1Q9WA 4YDLC 2VLMD 1Q0YH 1NEZB 5GGTH 1GH7A 1BQUA 1S9WA 3QIWD 4AT6B 4X4YB 3GSNA 4CVXA 5GRUH 5T3XH 4YHKL 1AH1A 2BC4B 2DYPA 2CRZA 4WY7H 4UIMB 3EDKA 1FLRH 2E9WA 3ULVF 2JB6A 3BPLB 5EZJB 1UQSA 3WUWA 1TQBB 1DBMH 5GRWA 1QRNA 3QB7C 3U83A 5BJTA 3MRFA 4I18C 4U2YA 5JR1H 4BZ2H 4ODHL 3U7WL 7CGTA 4JVUA 1A6ZB 1EFXD 3IB4A 3R06B 1ROWA 3QG6A 1BZ9A 2X2YA 3RA7L 3LKPA 3RTQD 5BMFH 4X6BA 4D9LH 4RIRA 1MHCA 1Q9OB 3GMQA 1XF3A 3NPZB 4HMDA 2OM5A 3MX0A 4RGOH 2ZG3A 1W8OA 3UBXI 1SY6H 1X5YA 1CFNA 1BQHG 2APVA 4HC1H 1A7NL 2H1PL 2HFGH 3ZKXB 2PTTA 3ZT7A 1FORL 1DQTA 1XF2B 4JY5L 1YC7A 1QR4A 3RIAK 3SCMA 2DD8H 3VFGL 2Y4SA 3U1SH 4M93B 1EHNA 2XN9D 3TIDA 3W81A 2X89A 1X7QB 1FNGB 3UX9B 5I75B 4G6AC 1OVZA 4MCYA 5IV2A 5ETUA 4R90H 1JZ2A 2DWDB 1MCJA 4HWBL 3CDYA 3EYFB 4PJ5A 3F7PC 1OPGH 1KJ3H 4BH8A 4KZEL