1MFCH

High resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
211
Chain Sequence
EVQVQQSGTVLARPGASVKMSCKASGYTFTNYWMHWIKQRPGQGLEWIGAIYPGNSATFYNHKFRAKTKLTAVTSTITAYMELSSLTNEDSAVYYCTRGGHGYYGDYWGQGASLTVSSAKTTPPSVYPLAPGMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN)
publication title Recognition of a carbohydrate antigenic determinant of Salmonella by an antibody.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 44
structure length 211
sequence length 218
ec nomenclature
pdb deposition date 1993-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfcH01
1O5DT 1A5FH 2GTZB 5ICXA 4YHKH 5A1AA 2ORBH 5FO7B 3RL1A 2MJWA 4K7FA 5KS9F 1REIA 1OTTD 1VA9A 2JJSA 4JQIH 2Y72A 3OXSB 3RNKA 3VWJD 1VGKB 2YS4A 4U0QB 5KZCB 2YUWA 1OM3L 5D1XA 2X44D 3VDCA 3E6FA 1U93A 2LAGB 2OI9C 5FYJE 4ZFOL 5BRZD 1Z9LA 1CLZH 1HKLL 3W9DB 3O3UN 1DQJB 1RMFH 3H9SB 1P4IH 1DLFL 3OPZL 4LGPB 3L5XH 4I0KA 3GKZA 4U49A 5FKAA 4U1LA 2FZ3A 4GRLC 5ID0A 5F3HA 1BQHB 3N85H 4X6CA 2WZPD 5CSZB 1XGQA 5LAXB 5EIIB 4G7VH 2XZQH 4JZOA 5C70A 4PRIB 1B4JL 3QH3B 4OAWA 4XP5L 1DQQB 3HE7A 4PTTB 3UTTE 3ALPA 5I30H 5GJTL 4DVRL 1CLOL 3QQNA 5GRJL 3SJVA 2IFFL 2C1PB 5D72L 1P7HL 2VLJA 1PW3A 5GS2H 4L29B 3R4DA 3FB6B 1YUHB 3G5VB 1RU9H 2UZYB 1W0WB 4YHPB 4P2QD 3O3DA 4NNYA 3IVKA 3LKPA 4CVWA 1X5IA 4BSJA 4NNPH 2B20A 1GZPA 3DBXB 1MHCA 4C59B 2I9TB 2CJUL 1B0RB 2FGWL 4M7ZC 1LEKA 3MV9E 3HE6B 3QQ4B 5C0FB 3U30B 4Q2ZB 4HXAL 4WTZA 2ZCLH 1OARH 1J5OH 4JY6A 4JFDA 4W81A 3TO4B 5HYSA 3MUGA 4J3XA 2HN7B 2NZ9D 1UC6A 3X11B 1OGTB 3ULUD 3CFJA 1K6QH 7FABL 4UIKL 1GOFA 1KCLA 2J3SA 3FOLB 3GMNA 2NXZC 1A3LL 1KLGB 4L3ED 3V5KA 4ODUA 1LD9B 1TPXB 1Y0LA 2ZG3A 3DSFH 4BELD 1U8JA 4KV5F 1R3LA 3DX6A 1S7XA 5T33L 2VL5A 2VAAA 4P4RA 4XH2A 4I48A 3O6LL 2VR5A 4KJYB 4Q9QL 3HG1D 5KSBE 2FWOB 25C8L 1FJ1A 3M07A 1QBML 4C56E 1PEWA 5CCKH 3DMMB 4HH9A 2HLFD 4P4KC 5FUOL 3QXVA 1T6WA 1OM3H 3REVB 2NY0B 1CR9L 5D8JL 5BZDB 2JELL 1UH3A 3SKMA 1VERA 4H0GA 3K2MC 1DLFH 3UTSD 4LSRL 3OPZH 1OP9A 5EIQA 3M45A 3TF7C 4Z7VB 2KZ1B 3MX0A 1S7SA 5AZ2L 2A6KB 5IJKC 1F3DJ 3O3EB 1U58B 2DLGA 3DYPA 3DUUB 5C0EA 3UPRB 3CFDB 3EOYG 3PGCA 2MCPL 1B4JH 4XP5H 3PL6A 3NZ8A 2EDYA 4XC3L 4E0RB 1S7RA 3L1OL 4BSVB 3BGFC 3M17A 1CLOH 5GJTH 4DVRH 3ISWA 5DJDA 1HINL 5GRJH 1T2QL 3I2CL 2IFFH 1FO0L 1IAIM 4K3EL 1B6UA 4J3VA 4ZQKA 4Q9RL 1EV2E 3KPPA 5I71B 2R2HA 3HR5A 4D3CL 1X5ZA 4NJ9L 3ARUA 4HJGA 5HYQB 1F2QA 4DKDC 4ELKB 5F9JB 1D3CA 4KXZH 3EJYD 1NGWB 2CJUH 2FGWH 5B3JE 2V7HA 1T0MA 2DM3A 2GI7A 4IMKA 3UZQA 3TFKC 3GEWB 4U1IB 4UT6L 1GZQB 3VRIA 4P2RE 3ARFC 1KC5L 4X4XA 5KSUA 2E6PA 3MNWA 5LG1A 2PCPB 4KROB 7FABH 1EO8L 1U3ZA 4HUUA 1FYTB 3H3PL 4UIKH 2QSCH 3GMQA 3HUJE 2OMNA 4MDIA 4HC1L 4LNVA 2WINB 5I76B 5JDSA 2AKRA 5DJ2B 1IGTA 1AXSB 5INCB 4CVZB 5BCAA 2GSGA 4MJIE 1A8JH 5E7FA 3VH8G 5T33H 2IGFL 3O6LH 2CK0L 4Q9QH 3C5SA 3PJSB 4WW2A 3O81A 25C8H 2Y06L 4NHUA 1XIWC 3PWJB 1QBMH 1QOKA 2NZIA 3KDMA 3RWDA 2AQ2A 5IW6A 3BP6B 5FUOH 4ZUSA 1FCGA 2HWZL 4M03A 4QGTA 4M00A 2AABL 3MCKA 3U0TB 4I0PD 5AG8A 4Y4HD 1CR9H 4X9HA 5D8JH 3MGTB 4GG6E 2JELH 1PY4A 3JZ7A 4ENED 1R3HA 4LSRH 3RVWD 1Q0XL 1QA9A 3C60C 4YO0B 5ANME 3QI9A 1NBYB 4XWGL 5AZ2H 1YPZB 2F19L 1BWWA 1TZHA 5A16B 1MAJA 2YD4A 1MVUB 2P47B 3RWHA 1UVQA 4KXZI 4KRPB 2MCPH 4Q6YA 3VXPB 3WFDL 4PP1D 3G04A 3L1OH 4MA1B 5DO2C 1QSED 4U1SA 3TA3D 3TYGL 2HMID 4KRNA 3PP3H 2DMCA 1HINH 4R6UA 4F7MB 1T2QH 3I2CH 1FO0H 4RIRA 4K3EH 1L4IA 4R0LB 1NCWL 4Q9RH 1A6WL 4HIIB 3HC0B 4D3CH 1U8NA 9CGTA 3H9SD 5IB2A 4R26L 3MPCA 3OHXA 3DVNA 4K2UL 4S0SD 4PJHB 3QULA 3MMEB 3O0RL 4X7SL 1XZ0B 1RHHB 4MAYB 4UT6H 5IVNA 5DYOA 1KC5H 4GW1A 4LHUG 5DURB 5ID1B 4OLZL 3CX2A 1JNJA 4JO3L 4Z9KB 4PRID 3GBML 2BSTA 3IJHA 4NWUH 5DJ8A 2ED8A 5IT2L 1EO8H 3SO3C 1V3LA 2X5PA 3H3PH 1PKQE 5DI8B 4QRTA 3MRQB 5SX5K 3D25A 4HC1H 1S8DA 3SKOB 3LQZB 4JFYB 4YJZL 4PJEF 3VFRA 2F5BL 3CPLA 4M4PA 2J1KA 2F8XC 2R9HD 1G9EA 1LNUA 2IGFH 2CK0H 1LILA 2Y06H 1M1SA 1OGAB 2A0LD 5TDPB 4KHTL 2YMXL 2VITA 1JWSB 2DQEL 1JNHB 3EDDA 2HWZH 2AABH 4QRPB 1UA6H 4N5ED 4GAFB 3FN9A 1ORQB 1L0YA 4JANA 4X8JA 4G42B 4WRLA 3CFEA 4NRXB 5JO5A 4CJ1A 1JYXA 1UQSA 1WITA 1EBPA 4UNTA 5D1ZD 4JQVA 2A74B 1Q0XH 1KBGL 1MCWW 4WI2A 4XWGH 3ZKXB 2XKSA 4E41D 2F19H 2PXYB 1AO7B 2M8XA 2DYPA 4YLQT 3VXOA 5EBGA 5F7UA 4PGBB 4Y4FA 4WV1C 3KLSA 1KGCE 4LRNL 5EO0A 5BZWA 3WFDH 5GGUB 1IQDA 1T1ZA 3RWFB 1IE5A 2VXTL 3HNVL 4XBPB 5D5MF 3TYGH 5GJSL 5IOPA 2CK2A 4AIOA 4WUUE 1AGBA 4PB0L 4Z7OF 4RWYL 2YD2A 1A6WH 1AGFB 3Q6FB 5C0ND 2LTQC 4NPYA 2CMRL 2X9XA 1KTLB 1UB5A 4R26H 4K2UH 3H2WA 3D0VA 4Z7WF 2HT4D 3DV4B 3O0RH 4GAGL 4OZFG 4X7SH 4MAUL 4XVSL 1YDPA 3FZUD 2VDLL 4BK4A 4OIBA 4OLZH 1NUFA 4JO3H 4U6YB 3GBMH 4N90D 5IT2H 1P2CA 3RY6C 4P2OB 3DX7B 4C55A 1V8HA 1I7UB 5AZEL 3LQMA 4NQXA 2F5BH 4IOFC 3MV8A 1LO3L 1SBSL 5IGXL 4HZLA 2ZP0T 2AW2A 3C9NA 3FQWA 4RCAA 4Y16A 3FHAA 1E0OB 4F7PB 5I1IL 3VFVA 4KHTH 2YMXH 5EUOE 1HWHB 2UY6A 3SDCA 2DQEH 2QADC 4Y2DD 3WL9A 3SE8H 4TOYL 2DM2A 4HAGA 1Z9OA 4MHHG 2E9IA 3I02B 5BJTB 1X7QA 4YHIA 3ZDZE 3CJJA 4XCCL 1MFEL 3AU1B 1C5CL 5L9DL 3NGBB 3FT4B 4QRUA 4NO0D 3HMXH 1KBGH 2GSIA 4IOIA 5HHVL 3ARDA 1KN2L 5EU4B 1NFIA 1MIEL 3VXRA 4WU7B 4R7NB 2VXSL 2R2CA 1ZWIA 3SDAB 4FQCL 1NL0L 4BFIA 1FVDA 5L2KA 4LRNH 2E7CA 4L1HA 4HS3A 5HHXL 2AXHA 5CP7B 4X8XA 2QSQA 3TBTA 4LP4A 4K7PX 1SJXA 1ADQL 4OGXL 4G9FE 2BVPB 3B3IB 4PB0H 4PPTA 1KELL 3S37X 1YN6B 2QR0A 2N4IA 4RWYH 4LHJB 3S5LA 4PG9B 1J18A 2OM5A 2DQTL 2CMRH 4MCZA 3OJMB 1AGDA 1WWCA 2Y23A 4OF0A 3V5HA 1KEML 2CIKA 4GAGH 2NY2C 3LN5A 4MAUH 3KXFE 5FO9A 4YHMH 4P2YA 1Z6JT 1YN7B 3QFJE 5DC9B 4PJCF 4JM2F 4PJ9A 4R4BA 3IU4L 2BXZA 2Z93A 4P59H 3P4OB 5I0DA 5ICYA 3D3VE 1CDBA 1TVDA 5E2JA 5CD5C 2L7UA 5AZEH 5D7IA 1FNEA 2XNAA 3HE7D 1QLRA 3CMOL 4PRNB 3KPOB 1LO3H 1SBSH 2FJHA 5IGXH 1I7ZB 1QUNA 3PDOB 3H9HA 4HS6A 4G8GB 3IDXH 3QIWB 1IAMA 2C3GA 3QDGD 4NHCL 3I6KB 2BVQA 5I1IH 3HAEH 1BIIB 4MAYD 4JM2C 5TE4L 5DURD 4TOYH 5MEND 1QNZL 1PBYA 1SVCP 4XAKE 2X1QA 2OXGA 4XCCH 1MFEH 2XKNB 3PG2A 1PEZA 1C5CH 3RJDA 3H8NA 5L9DH 3G5YA 3R0NA 4OM1L 3PABB 2DJSA 5HHVH 1KN2H 3L6FB 1MIEH 4NDMA 2AV1A 1F3RB 1DCLA 5C0CA 2VXSH 3O2WL 1P7QB 4OGAD 2CLZB 5IFAL 2DI9A 2OYPA 4FQCH 1RHFA 1NL0H 4PGDB 1KJ3L 1PQZB 3ET9F 5MI0B 4OFPA 4L8DA 2VIRA 1W8OA 4HK3J 5HHQB 5HHXH 4QRRA 2NW2A 3C5JA 5KVGH 5TJWK 1ADQH 4YFEA 4OGXH 4OV6F 5IFHL 5GRXG 3C8HA 5J6GA 1NANH 4LLMB 1FFOB 1S5IL 1KELH 2D7NA 3CGTA 2XWTA 2VLKA 4LSTL 3IB4A 2EO1A 2HFFB 4OFKA 3DTXB 2DQTH 3ECBB 1QACA 3S98A 4UIMB 3GJEB 3ZDYF 2Q3AA 3RKDD 3RGVA 1KEMH 5D7LD 2MWCA 2PXYD 3TBWB 5LBSL 3MLXL 1CVRA 1FH5H 3EHBC 1JIBA 1TJHL 2G2RA 1HYSD 2Z8SA 4PJAB 5BVJA 1QYGL 4NGHL 1RK0A 2IPUG 2NY1B 4WO4C 1DVFA 1RIHL 4BQ6A 4X7EC 4M62L 5HPMA 1QFUL 4NKOA 1PY9A 4OM0L 5FDWB 3PL6D 3CMOH 4ZAKC 1HILA 3SO5A 4JPKL 4FFWC 3GM8A 4MNGE 2D4FA 5DZOA 3BP7A 4FQXB 2J8UA 1I7RB 5JXED 3VDAA 1AC6A 1HKFA 3SE9L 4NHCH 1W2KT 1BX2B 1NBVL 1OAYL 3MV7A 4JHZA 2ICWJ 3MJ8A 4WFHD 4KHXL 3QDME 3FQNB 4FZEL 5ISZB 5DJ6B 2P8MA 5TE4H 3BWAA 5HHOB 2PO6B 1EUUA 2UUDK 3TNMA 2BHZA 3HZMB 4WHYG 1QNZH 3WS3B 1PX4A 2BX5A 1PG7L 5D7KD 4UTBL 4HPYL 3OR7B 1U2HA 2ESVD 4WFFE 2X4TA 2FIKB 5IM7A 4ODWA 4JFEB 4NNXB 2AK4D 3WFZA 4DUWA 4N8CL 2NCMA 3O2WH 3BUYB 1N6VA 2I24N 4W6YB 5IFAH 5IVXE 4JGJA 3TBVA 4JFOA 5J1TC 4MXVE 3MA7B 4HSQA 5H37G 3C09B 1S9WB 3PWPE 5IQ7L 4PUBH 2DLFL 2LU7A 4FFZL 1LP9A 2UYLB 1LO4L 1CGWA 4POZC 5ENWB 3VMPA 4XAWL 5IFHH 1ZVSB 1ZLWH 1T3FA 1X5GA 1S5IH 4FXLA 2FHBA 3FT2B 4QHLA 3WD5L 5CEXA 5C0BB 4LSTH 1QD0A 2B5IC 3MRFA 1AFVL 5J12C 4OD1L 1HCFX 4CVXA 5JHDA 1R5WA 3NFPA 5D1XC 3QEQE 1DDHB 4ALAH 2RFXA 5LBSH 3MLXH 4TNVK 5DS8B 3QI9D 1DUZB 1QYGH 4NGHH 2BY2A 5HVHC 3ALWA 4R4ND 3A67L 4NQDE 1C8PA 4PGCA 1NFDE 4ZXBA 3C5ZC 1RIHH 4M8VA 4M62H 5K9KA 1QFUH 5L8JB 2O5XH 3O6FB 4OLUL 3G6AA 4LLYA 4JFFA 2OR9L 4OM0H 3HRZB 5IB4A 4YDJA 4BSWA 2A9NL 4JQXC 4JPKH 1XGTB 3LEYL 1PSKL 2YPLD 4HWEL 4M7LL 3CX5K 2ENSA 5E8DH 5K59F 4YHZL 4N0FB 4BJLA 1CICC 1XGPB 3MJ6A 3SE9H 5C2BL 1XAUA 3HMWL 1NBVH 1PDKA 4NUGL 4EBQH 4KHXH 4FZEH 2GHWB 1VKXB 3ULVD 3O8XD 1NC2B 4CU6A 3VXTA 3EO9L 1F6AB 5AUMB 4JY4A 3ZKSD 5F96L 1PG7H 1F11B 5CBEB 2XFXA 1IEHA 4UTBH 4HPYH 1A4KA 2XWJB 3U83A 2AEQL 5DTFA 1MCWM 1DEDA 2VQ1A 2V9TA 3I75B 2DLTA 3AB0C 5T5NF 3AM8A 5DFTA 1W0VA 3EOTL 1U8QA 1QSFB 3ILPA 2ICWI 4G80A 2DTML 5SWSA 5IQ7H 5J9PB 2DLFH 4FFZH 1RJZB 2EO9A 4NO2A 1LO4H 4CW1A 4ZYKB 4TRPL 3MR9B 4XAWH 4LSSL 4PTUB 3WD5H 1NEZB 1OTUC 2AEPL 1TETL 4M43L 1ONQB 4TUOB 2HT2C 5DR5L 4MJ6B 4L4TB 1AFVH 1CDGA 1JZ4A 4OD1H 1VGKA 1FVEA 3U4EB 1S9VB 3RZCD 2EDTA 3OKYA 1IBGL 2VYRE 5DFVC 2R2BA 3AFLA 5A40E 1P7QD 3C6LB 3ZYZA 3B2UD 4HK0A 3IGAB 2J2ZA 3A67H 2VABB 1T7YA 4LVHC 1QZ1A 2EEAA 4XP4L 3TNNA 4OLUH 5CMAB 4S1SL 3GBLA 2OR9H 5LAXA 5EIIA 3PIQB 2BNUB 4U1JA 2A9NH 1A1NB 5C86A 3REWB 5IHLB 3LEYH 1PSKH 1SYSB 4S2SA 4M7LH 4FOMA 3T8XB 1RSFA 4YHZH 1M7DB 3UP1A 4G6JL 1N5AB 4XGZA 5INDB 1KTRL 4LCCC 1KTDA 4NUGH 1W72A 2VDQL 3QHZL 1TZIB 1YUHA 3G5VA 1I75A 4LL9A 3I6GB 4WEUD 4M3JA 3T0EE 3EO9H 1A6UL 3FB5B 2NY1D 3TBSA 2HG5A 3DBXA 5F96H 5HD8C 1KXVC 3QQ4A 4GOSA 4KK6C 5A2LH 1ZT7A 1IEBB 4NM4L 3MRIB 3G6DL 2F53D 4F7CA 4IIQA 1NPUA 2EKSB 3X11A 1OGTA 3DROA 1SMOA 3EOTH 3DIFA 3OJVC 1IGYB 5CP3H 4YGVB 5JPMB 5L7XL 1OSZA 4RFNB 2DBJA 4W4OA 3AXLA 1ZT1B 2DTMH 4LCYB 1XR8B 1Q94B 2E6QA 1KJMB 3QDHA 2FEDD 5DUPL 4Y4KB 3D2UD 5KS9E 1A3RL 1EFXB 3IFNL 1YZZA 2X4PB 4TRPH 1OB1B 4FQHA 5ISZD 3GDBA 4Y8AA 5HHOD 2O5ZL 4LSSH 3QQ9D 2FWOA 4WW2C 5CLTA 2AEPH 1TETH 4M43H 4Z7UA 1UEYA 3DX9B 3HZYB 3KYOB 5DR5H 3SDCD 3BT2L 3E6HB 1H8OA 3DMMA 4D9RE 3BKML 3RP1A 2GIYA 5ITFB 1KYOK 4ELMF 1IBGH 2XICA 3GK8L 1KB5A 1M05B 2D4DA 5F9OH 2D7OA 5T5NG 4JRYA 4OLYL 1BD2E 1N59B 3QIBD 5EOCL 1I7TB 1I1AA 4NM8L 4Z7VA 4IRJA 1ZVHA 4RAVA 3OGCA 4XNQB 1ZHKB 2BCKA 2DJUA 4JDVB 1T80A 4XP4H 1U58A 1JGDB 2X40A 3DUUA 3UPRA 4Y5YB 4S1SH 2ZPKL 3N06B 4ZNEA 4KJQC 1II4E 2DBLL 4WUKL 5EDXA 5GGQL 5L2JB 4NUJB 3FRPA 4E0RA 2NY3C 3GHBL 1E4JA 3V0AC 2Y36L 4G6JH 3QO1B 3GSOB 4CGTA 4JRXB 1JNLL 1KPUB 1DBKL 3STZB 1QSVA 2VDQH 4H88L 3QHZH 5J4MA 1EBAA 3MACL 4C54A 3ETBF 4FQPA 2M1KA 2CIIB 4ELKA 1A6UH 5F9JA 4U05A 1J12A 1IQWL 5F44A 5IMOB 3S3PA 5JW3L 3EJZC 3SE4C 1T4KB 3MRPB 1A21A 1A22B 4JG0H 4NM4H 3G6DH 4GAJL 2V5RA 3HLAB 4NYLB 3MA9L 1UWEL 1J8HE 4W68A 2PCPA 4ACPA 3IAPA 2HFTA 5L7XH 1AHWB 2ICCA 1FYTA 1QFWL 3T2PA 3WIFB 2DKMA 3RUGF 1HH6A 3KPNA 3KS0J 1OAUL 3V6BR 5TGBB 3ELAT 2WINA 5I76A 1YJDC 1AXSA 5DUPH 4U1KB 1A3RH 2R1WB 4GBXA 3IFNH 3OJDB 3B6SA 5IB3B 3ZYOA 2BNQD 1C5DB 2CLVB 1AXIB 5I1GL 5J7CC 1VACB 5F71A 4UV7L 5IK3A 3PDDA 4LLAA 4M7KL 1KPRB 5IB5B 3P9MB 3OKMA 4CN4A 3BT2H 1OAKL 3IXAA 1A7NL 2HJKB 3BKMH 5FFLA 3MCG1 4BQ9A 4EUPG 3G6JB 1C7SA 4P5TB 4ETQA 3LB6C 3GK8H 5D71L 5E2VL 3I3BA 4I1NB 2WQRA 2J12B 5T1LB 4QHNA 3MGTA 2HTKC 3DWTA 4GKSB 1XGUB 4QGYA 1ZHBB 4PJFA 5EOCH 1YYML 4YO0A 3WN5B 2BY1A 3W11C 2A77L 4NM8H 3AMLA 2NY4B 1H5BB 4PJBF 2V2TA 1IKFL 5D93B 2ADGB 5A16A 5DJCB 1MVUA 2ZPKH 2EXYD 3VFPB 4WUKH 2DBLH 5GGQH 3HA0A 3VXPA 4F15C 3KS0H 3EJJX 4HXBL 1BPVA 3IFOB 5SX4H 4NCC1 1YJDL 3SPVB 3GHBH 5C0AB 3HC4H 1EZVX 2Y36H 2QKIA 1IAOA 2KDGA 3NAAL 3MYZA 1JNLH 5FUCC 1DBKH 4HIIA 4FG6C 4H88H 3SGJA 4O51A 3MACH 4O9HL 4KK5D 1D5IL 3QPQC 1R24B 3RGVD 4KI5D 4NIKB 1IQWH 1QRNE 2G5BA 3S34H 5JW3H 1JTTA 5B8CB 2CDFA 4J3WA 4V1DE 2AGJL 4Z7NF 4C57C 1G9MC 4H1LG 1JPFB 4GAJH 4N8VA 5ID1A 1TJGH 2H2PD 3MA9H 1UWEH 4Q9CA 3U36A 2IFGA 4J4PC 5FGSA 1QFWH 2GY7B 1WWAX 5HHMD 1OAUH 2ADIA 4YIQA 3T0WA 4XC1L 4Z77A 4H0IA 3WFHB 3KPSB 1I8MB 3Q2CA 4UQ3A 2AJZA 3L3JA 4EI6B 5I1GH 3QJFB 4M7KH 3DYOA 3MV7D 5HI5D 2XA8H 4WDIB 3X3FL 5IMKB 4Y16C 2YSSA 5JLZB 4ETYA 1CD0A 1FNGB 1OAKH 4LKXB 4OUUB 1A7NH 2P45B 2H26B 2E3VA 1JN6B 1JNHA 3BHBB 4PLNC 2GEEA 4QRPA 2UY7A 3ZKMC 3RTQA 4XNUL 5E2VH 5SX4I 1VFBA 4G42A 3IXTB 2WP3T 1JF1B 2BOBB 3BZ4A 4K07A 5IEKA 2A74A 5E00B 4YWGL 1YYLL 2A77H 3ARDC 1G9ML 1SJHA 1IKFH 4WTXA 3TC9A 1MCOL 2PYED 1AO7A 1OD9A 3MUJA 1CWVA 1QR4A 2X1OA 5AYQA 3RY5A 5I8CB 4A2LA 1MI5E 1RK1A 4LLDB 4I5BB 4LEOB 2WQ8A 5GGUA 3FFDB 3WLBA 5C08B 4HXBH 3K46A 1YJDH 5IHUL 4XBEL 4PJIB 4GUPB 1MHHA 5HTSA 5ACZB 4IRSC 3NAAH 1DQDL 1FZKA 4OV5A 1AGFA 1JGVL 3VWKB 1KSRA 5EO1A 4HLJA 3FQTA 3S36X 4BH7A 3BIKA 4O9HH 1ZVYA 4J3TA 1ZGLP 2RQ8A 5IMMB 5JHDD 3RVUC 4X6DE 4NO5B 2Q7YB 1OAZH 5I1DB 3LN4B 4ZS6C 2AP2A 3AUVA 2AGJH 4FHBD 4FN0A 4P3WA 3MRHA 2VLLA 3RVTD 2XPGA 4Y1AB 2B7DT 1JI2A 1RI8A 4U6YA 1N2RB 2R2EA 5E6IA 3RNQA 2IG2L 1J87A 4P2OA 5CGYD 3UTSE 1A47A 5J6HB 1T0NB 4ZUWA 4QWWD 4OQTA 1I7UA 5IHBA 2N1KA 3KNBB 4IHOB 3GO1L 1FZJA 3T2OA 4XCEB 5TDOA 4TTDC 2K3TA 5J0BA 3GMMB 1G7LA 5DQDH 3MTRA 4YEEA 4EZMA 5JZ7D 4F7PA 3OKEB 3QAZC 5HHNB 5DC0A 5E6ZA 2NLJB 3DI3B 4XNUH 3EOBB 1LO0H 1NMAL 3T2NH 3I02A 1VHPA 3EYFB 5JDJA 5KANI 3CSPA 5J13B 2FHFA 2JB6A 5EA0H 1I9RL 4L4VB 4LOUC 3FT4A 3WXVL 4YWGH 1YYLH 3CFCL 1UJ3B 4G6AC 4TNVF 1F4WL 1PZ5B 1BJ1H 2P49B 1G9MH 4PRPE 4JZJA 2V2XB 1MCOH 5D5ME 3SDAA 1XR9A 3TH4T 4XNMA 1GGIL 4KKBC 5FA4A 3QCUL 4XHJC 4Z7OE 2Z31C 4AQOA 4AH2B 3FB8A 2D3VA 2HJLB 5IHUH 4XBEH 5LXGL 4CMHB 5JA9A 5DMKB 1HXMA 2BMKA 5J57B 1DQDH 4P5TD 4LGSB 1YN6A 3NTCL 1A6TB 1JGVH 4H8WC 3V4VL 3KPRB 4PRBA 2IANA 5GRWA 5BQ7B 2V9RA 1OLZA 2NNAB 1FHGA 1P6FA 4U1GB 2NY4D 1G0YR 3H3BC 3R8QA 3S5LG 4XX1E 4GRWB 2J8UF 4FQQA 3MYJB 4OZ4B 1JZ2A 1YN7A 1CK0L 1MLCB 4U1MA 1G6RA 4WHTB 5FO8A 1OCWL 1M6OB 2IG2H 1L0XA 4TN9A 2WP3O 1EEQA 5IVOA 5C0AD 3P4OA 1F5WA 3PQYA 1Q9KA 3VXQB 2CUIA 3LS5L 2X1WL 2NZ9C 4Z18A 3GO1H 5EU3A 3F12B 1FSKB 3EO0B 3V6FA 1FBIL 3STBA 2RBLA 5TFSL 3W0WE 4GKZA 4G8GA 4QF1B 1OSPL 1JK8A 3Q5YA 4NQCB 3QIWA 4HHAB 4ZOBA 5D2NA 1MCSA 5CIPB 1UM6L 2NQCA 2R0LL 1X6NA 3I6KA 2FL5B 3CDCA 1IC5L 1BIIA 3RWIA 1HEZA 3TVMD 4A6YB 1NCNA 3QWOB 1R3IL 4H8WL 3D48R 4LCIL 3N9GH 1LP9F 4XTRC 1U2CA 4KJPD 5D96C 1ND0B 1NMAH 1INEL 5GGTA 4F7TB 5CINL 3DVIA 1CF8L 4JM4L 1GL4B 3QNXA 3WXVH 1B6DA 3CFCH 4DCQB 5T3XD 1FFRA 1F4WH 4LVNB 2X70A 4PJ5E 1T5WB 1V3JA 4NWTL 2RCSL 3O4OB 5KN5B 3KPSD 2CLZA 1CFVL 4XXCC 1GGIH 3GBNL 4PGDA 3QCUH 2BVYA 2ZSVA 3OWEA 1FFPA 5HHQA 2C3HA 4LVEA 1CG9B 3VI3E 5CJQL 4JHBA 1WIUA 5LXGH 1BVLA 3CSYB 3QUZA 1BGXL 1YY9D 3TH3T 2AJYL 5B39A 3M1BB 5CEYB 1Z5LA 4ZFFA 5D2LF 3NTCH 2NX5E 3V4VH 4P5MB 3WHXA 1CDJA 1D9KB 3ECBA 3JUZA 4DOHB 1IAIL 5L6YL 4UIMA 3GJEA 3IDYB 5IESL 1T0PB 4JO1L 1LO2L 2Y5TA 1CS6A 4PJCE 3GMRA 4RAHA 2VN4A 5DEFA 1S7WA 1Y6MR 1WCBA 3CCHB 4OUOA 4PRDB 1WK0A 1NC4B 1CK0H 2YD6A 1BP3B 2JCCA 3HZKB 1NGZB 3BDBA 4IRJD 2WLZA 4WUUA 1OCWH 3BP4B 5C08D 5C0JB 3EAKA 1FZMB 4ZXBC 2GT9A 4OLWL 1I4FB 2V6HA 5FDWA 3FTGA 2EXWC 4E41E 3BH9B 2X4UB 4RZCA 5D9SB 3NCCB 3VWKD 4JGUA 1FBIH 2AV7A 4FQXA 3K1DA 1I7RA 5IWLA 2VKXA 3KPMB 1OSPH 2XN9E 1U3HC 3MLVL 1UM6H 1BX2A 2R0LH 2VRAA 2ERJC 4URTB 5IEHA 1ED3A 15C8L 1R3IH 4LCIH 2PO6A 1IL1A 4X5XA 3OR6B 4Y1AD 3FRUB 3HZMA 3G5XB 5ICZB 1INEH 4P2RB 5CINH 5LKNA 1CGUA 5IBLC 4HDIB 1BWMA 2VZVA 4DK3A 1A1MB 1CE6B 4JM4H 4RMUA 3ZT6A 1C16B 4DZBA 3SQBA 2H8PA 4RDQG 4NNXA 3H9YA 4NZTL 3B83A 3HUJB 4EI5D 1Q8MA 4IS6A 4NWTH 2RCSH 3JV5A 3BUYA 4X99B 4MLIA 3MOAL 5HVGB 2VZOA 1CFVH 2E8ZA 3GBNH 4MX7B 2AVGA 1FL6A 1VSCA 4MJIB 3MA7A 1T2XA 2BZDA 3RVXC 4F9LA 3CSGA 4GBXD 4PJ7B 5F9WC 2UYLA 2VQTA 4X5WB 5CJQH 1RZJC 5E9DB 1BGXH 1UT9A 2NXYC 3MC0A 4MNQE 3SCMB 2AJYH 1WFTA 3FT2A 2E7LA 1J1OL 1UZ6E 4GW5A 4L4VD 5E2WL 5L6YH 1FIEA 5IESH 1WTLA 4K71B 1JPGB 1K3IA 5ANMB 3PXHA 4UUJB 2A6IB 1B0GA 4K23H 1G7PB 1WBXB 5D1QB 3MRJB 5GZNC 1DUZA 2XKUA 2I9LA 2V17L 1T7WA 2ZUSA 4Y5XB 5F7FA 3RVVD 4UDUA 5CBAA 1LEIA 3FQXA 1BZ9A 3WUWA 1EAPA 3LSOA 2FLRT 1IFHL 4K9EC 4DKAA 3ILQD 4DFIA 4YNYB 5GRVK 5K9JL 3ROLB 4PJXE 3E2HB 4DZ8B 3ZSSA 1NGYB 4J23A 1VPOL 5FV2A 5FYJD 4Z5RA 4N0FA 3MRNB 2YXMA 4KZDL 1RZJL 4PR5B 1QR1A 3MLVH 3D39E 4U7MA 3L3GB 2EDWA 4S10A 3MRRB 2VLRA 4RNRA 15C8H 3W5NA 4KKNA 5CZVL 3WCYA 3A6BL 2NY6D 1F3JA 2W07A 5AUMA 1I1RA 2HLAA 1SM3L 3OZ9L 2EIZA 4G6ML 5CD3B 4NT6B 2AXFA 3HE6C 3MBXL 3U30C 3QNYA 3UTTD 5DVNA 3V0WL 2AAVA 4EQ2A 2RB8A 4PJGA 4NZTH 5EUKA 6FABL 1U8OB 3I50L 3D5OF 3TO4C 3LEXA 4AIZA 1A6PA 1WFUA 1ORSB 3UAJC 3SGDI 5DD6B 3MOAH 1QSFA 1QKZL 1OTSC 4NFCA 3PWUA 3HKFA 5MEQB 4W4OC 1BOGB 3B9DA 3H42L 1ZSDB 3NOIA 1RJZA 4X6CE 1TPXC 3BQUB 1ZLSL 3OXRB 5C8JB 1NCDL 5FV1L 3QZWB 5T1KB 4Z7VF 3MV9D 5T1DL 3VXME 1SYVB 1MIML 1V7NL 1JYVA 1NEZA 2AXGB 3GB7A 3DGGB 5FYKU 1G0XA 3MJ7A 4TUOA 4NP4L 2H2SD 4MJ6A 3QEUA 4L4TA 3SJVE 2ZOLA 5E2WH 3DMMC 2VLJE 1FC2D 1S5HB 1TQBB 1W72L 5MP6L 2CXGA 5KSAD 2NY0C 4M1DL 5EULV 2J7LA 3C6LA 2W65A 5JW4M 4EN3A 1LO5B 2XQYK 4MJ5B 5JMOC 3KVQA 2V17H 1I1AC 1U8LB 2A6JA 2ITDB 2VABA 4HJ0C 4PJ8B 1FFNA 4X6EB 3QA3B 4Y19B 4PV8B 4JFDE 4QTIL 1IFHH 1YEEL 5K9JH 4C56D 2D0GA 5SV3A 1SY6A 4PRHB 5EC1B 1A1NA 3LPFA 3REWA 4FFVD 1VPOH 1HHIA 1CFNB 1KNOA 1BQHG 3H7BA 5CHNB 2EEBA 3T8XA 4O4YL 2K7PA 1MQKL 1M7DA 5D6CB 1T21B 4Z76B 4KTDL 2XYCA 4KZDH 1RZJH 5GS0D 2P5EB 3IETB 4LPUA 4ONFL 5E5MA 2P5WA 2XRAL 5I71C 3U6RB 1TZIA 3OBAA 4G9DA 2HTLD 3B9KD 4W4NA 1U91A 1NC4D 3A6BH 2EDQA 4LCUB 3FB5A 3FN0L 1SM3H 3OZ9H 1Y18A 4G6MH 3O6ML 3MBXH 5DQJA 4NFBA 1HE7A 3WJLA 1KB5L 3MRIA 3V0WH 1AH1A 6FABH 2N7AA 3I50H 4QLRA 3NPSC 2JIXB 4P57B 4DJMA 3ZE0E 3ZKNC 1SVZA 3ZHLA 1IGYA 1CIDA 4KROC 5F1SA 1QKZH 2FB4L 4DTGH 4LCYA 2QJDA 1A02N 3H42H 3O41A 5GGRY 4LPVA 1K2DB 3VD7A 1AKJA 4S1DD 4Y4KA 1ZLSH 1EFXA 4PJFF 1NCDH 2X4PA 1QVOA 2C3WA 3G9VA 4ZPTA 5T1DH 1KPVB 1FL5A 1MIMH 1V7NH 1YPZF 4LCWE 4P2RD 4FTVA 3P3YA 2OR8A 4NP4H 1CFTB 1D5ZB 3E6HA 1NSNL 2IMNA 3GRWA 4XP9L 2D31B 2IH1B 3X12B 32C2B 3ARYA 2EC9T 4EDXA 1W72H 5MP6H 4U3HA 2O61B 1INQA 1M05A 4M1DH 4MJ4A 3T65A 5IQ9B 1FGVL 1YMMA 1JHKL 1KUMA 1TTFA 2H32B 5DJAB 1HH9A 1TMCB 3EGSA 1N59A 3GUTB 4MJID 3FJTA 5IR1B 3W9EB 3PGDB 3TCLB 2APWA 4QTIH 3Q3GB 2K9UA 1YEEH 1UH2A 4KVNL 4Y5YA 4Z0XA 1R5IB 4OIAA 4PJHF 4G9FB 4KRPC 1XF2B 2HRPL 2VAJA 4DWHA 3D0LA 3TESA 5DMIH 3O3AB 4NUJA 5E4IA 4L3AA 1C7TA 1XCTB 4O4YH 3QEQA 1MQKH 2CSPA 4MA1C 4NKDB 5KG9A 4IDJH 5E24E 4GQ9L 4UTAL 3GZKA 3VGDA 5DMJB 3QO1A 4YFLI 4R0LC 4ONFH 4JRXA 2VISB 2VKWA 1KPUA 1S7TA 2XRAH 3BXNB 1ZHNA 4ZODA 3JV6A 5DHVB 3SGJC 4LARL 3MBEA 4OFVA 1FCCA 3KXFB 3MRBB 1I8LA 2CIIA 3ARGB 2O5YL 4HUXB 3WNOA 4J2XA 3O6MH 3QFJB 2D7PA 3C2AL 4J8RA 3MRPA 4HUKB 4MAYC 5A3ID 1KB5H 3P9LB 1T20A 3FN3A 3FHQA 1I1YA 4WJ5B 3FONA 5SWQB 2ZUQB 3BPOB 1VADA 2A83B 4WGWB 2GW5A 2FB4H 1MHEB 3P11L 3WIFA 5E95B 1HXYA 3OF6A 5TGBA 1DE4B 5EBMB 1Y6NR 5I2IB 2JK5B 3MO1B 3OJDA 5IV2A 2G75B 4OZIA 1JPTL 4MNHB 1VACA 1VDGA 5F8RC 5I8OL 4YXLL 4WTWA 3P9MA 3UO1L 1NSNH 3MRMB 2ARJB 4XP9H 2ICEB 4UV4L 3MRLA 4OLXH 3NABL 3O9WA 3L7FB 1ZGLA 5IFJB 2YN3A 4ZUVA 4PY7A 1QO3B 2FYYB 1EO5A 5T1LA 1FGVH 5DHXB 1S7VB 1JHKH 1KLUB 1ZHBA 4OGYL 5T1MA 3WNMA 4MB5A 4K3GA 2FO4B 1H5BA 4HF5L 2D0HA 3ZKXC 4LGRB 3IJSB 2FECI 4N9GA 2PXYC 5I9QB 1LEIB 1X4ZA 4KVNH 3S4SG 5DJCA 1BZ7A 2QSTA 4GW4A 3VFPA 4HS8L 2HRPH 5DJZB 4MVBC 4HKJB 3SE3C 2P43B 1MJ8L 2VUYA 1TZGL 4J3SA 3IFOA 4QCIB 3QUZD 2SEBB 3SPVA 4NC0B 4YEFA 1P84J 4GQ9H 4UTAH 2P24B 3EYQC 5B38G 5JOPE 5HHPA 4WWKA 3WO3B 1DN0B 3HS0A 3DRQB 4KPHL 4LARH 1HSAB 3EOAA 1PGRB 2Q76A 2X4OB 3P73A 5DJYB 3ARSA 1E4XL 3V7AG 1UENA 2O5YH 3MOBL 3LMJH 5B8CA 3V8CA 1KGCD 2MQ0A 3C2AH 3T3MF 3LPGA 5F88A 1HQ4A 1WIPA 3RDTA 1IC4L 4ZD3L 4WUUD 1N7ML 1SMAA 4U6TA 3AMKA 4JVPA 3N1FC 5E6IC 4YUEH 4P2OC 5KJRL 5ERWB 4XCFL 2WWMD 1O0VA 5J89A 2VZ3A 3P77A 3WFHA 5JW5A 1JPTH 1RFDL 3LKSB 3QJFA 3BW9B 3QDMB 1YQ2A 4N68A 4YBLB 1A6AA 5I8OH 2XWBA 1BVZA 1EHNA 4DKFL 1EDQA 4YXLH 1FG2B 5IMKA 3UO1H 5JLZA 2VZUA 1OLLA 1FNGA 3LRSA 4OCLC 2X4QB 4X4MA 3NABH 4WCYL 3VRJB 3VG0L 5FUCE 2VL4A 5CEZL 2GJZB 4ZUTB 1N4XL 2JIXD 2JLLA 4Z7QE 1MJJA 1JF1A 1MCCA 2BOBA 2YD1A 4OGYH 3IKCB 3VFTB 2BRRL 1A1OA 3AREB 3NGBC 4TUKL 3TJEH 4MD4B 4HF5H 3PWPB 4G43B 3SDAC 5I8CA 4LLDA 3QJHB 2A38A 4HIXL 4LEOA 3MUHL 4Q6IA 3EYVB 4XI5C 1MJ8H 5DHYB 2VDML 3HI6L 1L7IL 1TZGH 4OQTL 5FGCE 4PJIA 3V79C 4LHQB 5ACZA 5HGHB 1TITA 2D03L 3W39A 2R1YB 2W91A 3KWWB 3BPNB 3MV8E 1WVZA 2HYMA 4HFWB 1GGBL 2VXVL 2WLYA 3BN9D 2EZ0D 2E6JA 2EDOA 3ZE2F 5AYUL 4RGOL 1E4XH 1UJTA 2Q7YA 5DDHB 1PYWB 1NCTA 3LN4A 3QEHA 4ODVL 3MOBH 4BFGA 5DD3L 1VENA 3L3IB 1L9NA 4GMTL 1NFDB 1FYHB 5BS0A 4P46D 5EFIA 5E08H 3VH8A 1IC4H 4LLVB 1TCRB 3MLRH 4ZD3H 4G9FD 1GOGA 4GLRH 1N7MH 2W0FB 2NY7L 1BJ8A 3VJ6B 5HYJB 3TV3L 1UKTA 4OD2B 3KPLA 2EDLA 3ESVF 3VXRE 5KJRH 5FA3B 1T0NA 4XCFH 2W1NA 4XXDA 2QQKL 3KHQA 2KZWA 4IHOA 5DRWB 2FJGA 2YKLL 4N0CD 4YDVB 4Z95L 5L2KE 1RFDH 3KXFD 3VFGH 3WEXB 3U82B 3GMMA 3ARGD 4KDWA 5D2NC 3C6SB 3MQIA 3OKOB 3QIWC 4HX1A 5F9DC 3S96B 2IJ0C 4NZUH 3STLA 1BQLL 3QFJD 2G9HB 4U33A 4ZO6A 1CTOA 1ZS8B 3QG6B 4WCYH 3VG0H 3O3BB 2ED9A 5CEZH 1N4XH 3D3VD 4YC2B 3QXAB 1D5XB 5IJKA 4HFUL 4KK9C 3L5WB 1NDMB 2BRRH 5FAAA 4TUKH 4FABH 3QUYD 5DK3A 1U92A 3SQOL 4HMEA 4E5XB 1CDUA 1NJ9B 2V2XA 3DSNA 4M5ZL 3HPJA 2EDDA 1G6RL 4HIXH 2VLME 5MI0C 3GKWL 1TJIL 1TIUA 4AH2A 5HSFA 3HI6H 4HPOL 1AIFB 1L7IH 3G5ZB 4P9HC 2HJLA 4OQTH 1P4BH 2DI8A 4PJAF 3FFCA 5K93A 2JCCF 5F1IA 2UVEA 4GLRI 1A6ZA 3QCVL 4UQ2B 5D7IE 2D03H 1NMCB 3ROOA 1X5HA 5B4MD 3O11B 1T1YB 1KOAA 3RWCA 4G8IB 3KPRA 1EXUA 1EEZA 3BDYL 4O5LL 3TIDA 5MERB 3HC3L 1YY8B 5CWSA 5AYUH 2WBJB 5C09B 3GSQA 3BKCL 4W6XB 4HLZG 4ODVH 3R06A 5KVFL 3NCFB 4K3DL 4EN3D 4GMTH 5DRZA 1YEDB 2Y6SD 1AD9A 2K7QA 3MYJA 4OZ4A 5GGTL 4OI8A 2CDGB 1MLCA 3T1WA 4WHTA 4XNYL 5GGSY 3BP5A 1Q9LB 2NY7H 2NY1C 1KXQE 3WS6A 1IM3B 3TV3H 4YBQD 2C3VB 4HIJB 3HZVA 3T4YB 5I8KH 1NH6A 2EYRB 2X1PA 4QHKJ 4U2YA 5C0CE 4PGEA 2QQKH 2EDXA 4HT1L 1XIWA 4P5KB 3F12A 4R8WL 1CGYA 4Z95H 5TE6L 4Y5VB 5I1KL 2GKIA 3FMGL 4FQXC 4AK1A 4QRRE 1YEIL 5GZOD 2P5WD 5CIPA 5DMGC 3T0EB 3D1MC 3MLTB 4LSVL 1P5VA 4YFDB 3O4LA 4JCLA 3KPQB 4GG8B 1V3MA 2PO6C 4PLOB 4NQVB 2OI9B 1MY7A 2P46B 2VLKE 4F8TA 4XPBL 5IKCB 4PLJD 5ALCL 4TSAL 3OX8B 7CGTA 4HFUH 3UXFA 3DXAE 5E8OB 3QXDB 5JPNA 2GK0B 3O45A 1KCRL 3RWJB 1T22A 4DCQA 4KKLD 3FOMB 5GRVL 4ONHB 1DQML 5D7JA 3DO7B 5KN5A 1NBZB 1HHGB 4M5ZH 3VFOB 5KS9B 1G6RH 3H0TB 5EC2B 4TUJA 2HJFA 4GH7B 4NC2B 2ZKHL 4KUZH 3GNML 3GKWH 1AKJD 1TJIH 4KDTA 3C09C 3NCMA 4APQB 4F9LC 2AJSL 1H3GA 1K4DA 4HPOH 1NAMH 4JCMA 2VMFA 4KY1L 1WC7B 4OZFA 1MWAA 3MRDA 3LKNB 4QHMA 1JYNA 3QCVH 3M1BA 5CEYA 1JGEA 2LU3A 4FTVD 5TDNB 4MB4A 2E7LC 3UTQB 4GT7A 2J8UE 3BDYH 1E27B 4YHLL 4O5LH 5FKPB 4M1GL 3HC3H 3ARED 4EXKA 4JKMA 4KKAD 4AEEA 3PNWB 3MV7E 3PE9A 3BKCH 1BM3L 5IF0A 3LKQB 3V7MA 2FH8A 5KVFH 3PWPD 3BOVA 4K3DH 3IYLW 5F7KC 1P84K 2DMBA 3CFBB 4PRDA 1DANT 3SOBL 3HHRB 1U0QA 4XNYH 2Q86B 5DK2B 4NN5B 1CL7I 4G8EB 1FZMA 3AS2A 5AWNL 3U46B 1NLBL 3V6OA 2Q6WA 3O6FC 2PKDA 1JYWA 3QNZA 1BJMA 5KSVA 3GGWA 5DWUL 3NIFF 5ITBH 1ETZB 3GMPB 3IFPB 1M7IA 1AP2A 4HT1H 2X4UA 4HUWB 5D9SA 2ITCB 1FO0B 3VFNB 4R8WH 3QEQD 4WEMB 5TE6H 5LQBH 2ZSWB 3WNLA 5I1KH 2HH0L 5H2BB 1X6LA 1OT2A 3FMGH 1LP9E 1NUDA 4X4ZA 4XZUA 3HB3D 2BSED 1VEPA 4NQDD 4P4KB 1A9EB 1BF2A 4PJEA 3OR6A 4QOKB 3DETD 3FRUA 1WIOA 1OP5K 4O2EB 4QHKI 4XPBH 5ALCH 5C0GB 1J8HB 3IDMA 4DQOL 4TVSa 5JHDE 3LD8B 1C16A 1KCRH 2FGZA 4LSQL 2E5EA 2IF7A 1F4AA 4WV1A 1RUAL 4PY8J 2X4SB 3SY0B 5CILL 4Z78B 4HQQL 1DQMH 5ESQB 4R2GB 2IBBA 4MSWB 2ATPA 4I13B 3GJFA 2P8PA 1FN4A 1CT8B 2ZKHH 2VE6B 3GNMH 2MOVA 2P8LB 5E1HB 5IJVA 2AJSH 2FEEI 4PJ7A 4RMWA 1HI6B 4KY1H 1CD1B 4JFFE 5EOTA 3VFWB 1UG9A 2DOCA 5E9DA 1MUJA 5T5FL 2EXYC 4B0MM 1G7HA 5E8NB 2R23A 4XCYB 4YHLH 4OCYH 2Z91B 4M1GH 1RUQL 3LCYA 5DRNA 2F54A 3MFFB 3NCJL 1BM3H 1KIRB 5DRXB 2AQ1A 2QQQA 3INUL 3QT2A 2VUOA 2AXJA 2IAMA 5MEPB 3QUKB 4QRQA 3FCTB 5GPRA 3X13A 3C6LC 3TN0A 3JV4B 1CFSB 2Y7QB 3QDJB 4ZOCA 1WBXA 4KK5C 2W9DL 3ARFB 2DI7A 5D1QA 3SOBH 2OJEB 2B2XL 1VESA 3K4ZA 3SDDB 5AWNH 4I9WE 4F2MB 3CVHH 4U1NB 4Z7WA 4YNYA 4YPGB 3FO1A 5DWUH 3ROLA 4GRMA 5DC4B 1NMBL 2YPKB 3VXNA 5ACMA 4LU5L 5SWSE 2OJZL 1KG0B 2HH0H 1VGEL 3ZE1F 4YK4B 2BVOA 5DQ9B 4WWKD 1VFMA 2L0DA 4YAQB 2FNBA 2GJJA 3EIFA 3L3GA 3KJ4B 1UEMA 1DUYB 2L4OA 4ZTPL 1RUPH 3D69B 1I8KB 35C8L 3ES6B 3C8KA 3JV0A 3BPCA 2B4CC 2GK2A 5I16A 1XGYL 3DRTA 1QQDB 5CD3A 4DQOH 3BEVB 4D94A 3KYAA 4MWFA 1C08B 4KVCL 4M6OL 1JWUB 3FO0L 4LSQH 1LHZA 1A2YA 3NA9L 1E6JH 5CILH 4HQQH 2HKHL 4L3CB 1ORSA 4RGND 5J3HD 4ISVA 4OTXL 2BXYA 3EUUA 5HJ3B 3RY4A 4RFNC 2C7UA 2BOCA 4AM0A 5JIPA 3KGRA 1X44A 4LDOB 5FOBA 5FGRA 3O2VL 4Y4KC 4OZGB 5C8JA 1IAKA 1SY6L 1LE9B 5T1KA 4CN1A 1H0DA 5T5FH 1A0QL 1SYVA 3BO8A 3TIEA 2CKBA 1KENH 1X5XA 3HPLB 4MQXD 4PY8I 4F33B 1R3KB 1KEGL 4M3KB 1RUQH 5ADPL 4HCRA 5K33A 1S5HA 2PW1B 5DUML 4WW1A 2IQAA 3L3KB 4M1CC 3CUPB 3INUH 5EZOL 4GRLD 2LQRA 2B4CL 1FG9C 2W9DH 3NIDF 3MXVL 3SBWA 2VR9A 3CAFA 1IKNA 5C07A 5BV7C 1RY7B 3OKLA 1WZ1L 2B2XH 4PJ8A 3LKRB 3NH7L 5HDBE 5DUBA 3VG9B 5E8EB 4X6EA 3GMLA 4Y19A 3ARBB 2Z9TA 2A6DB 2E8YA 1JHTA 1WZMA 2KKQA 2IALB 1QBLL 1S78C 4Y5YC 1P7KA 4PYGA 1NMBH 3S9DB 1OD7A 4D9RD 4R7DB 4FP8L 1U3JA 4PRHA 1RUKL 2KBGA 5EC1A 5E94A 3KYKL 1UM4L 4LU5H 3DV6A 4B7IA 1VGEH 3TO2B 1OF2B 3D87B 4Z76A 1PLGH 3S6CA 3LDBB 2P5EA 1BD2D 3IETA 5E1AA 3HG1B 5KVMC 4X6DB 5BXFA 1NUGA 4ZTPH 5F70A 4KTYA 35C8H 1I8LC 4HV8B 3GRWL 4MDJB 2A73B 3VXUA 5FK9B 1XGYH 5IVZA 3S37L 1EX0A 5BS0D 3IU3A 3SKNA 4RQQA 3CZFA 1QHPA 4JRWA 2ZCKL 1DP0A 1G7QA 4KVCH 4M6OH 3FO0H 4PREB 4RAUB 5I73B 3UTSB 1DR9A 3E3QC 1RZGB 4LDLB 4OF5A 3K74B 2HKHH 1CGXA 1ZHLB 1A64A 4OTXH 4JRYE 5BV7L 4NZDA 1AHWC 1JJUA 3G6JF 4Z7VE 4JN2A 4YZFF 1WJ3A 1MCHA 2X7LA 1JZ7A 3MGOA 2YRPA 1AR2A 1XH3B 4QKXB 1K2DA 3JXAA 2QTEA 4GFTB 4ZNEE 3FO2B 4P4KD 1KPVA 3RX7A 1A0QH 3HAEB 4P0DA 1DLHB 1UWXH 1IGIL 1BQSA 4M4RA 4NO3B 4YFLF 2WANA 1KEGH 1CN4A 3PWNA 5ADPH 2IH1A 3X12A 5DUMH 1U8MA 1IZJA 1CLYL 3WNNA 1U8PA 1HHHB 4CKVX 5EZOH 2BJMH 1IC1A 3DPBA 4WO4A 1QBAA 2IPUK 2B4CH 4OFIA 4PRPB 2H32A 5DJAA 3RA7L 1IGJA 3MXVH 3GUTA 2N56A 3VGBA 1WZ1H 3F7YA 3NH7H 3AY4C 2NY4C 1H5BC 3PGDA 4HUVB 1GGTA 1V05A 4F7EB 4LSPL 3HCVB 4ZAKA 3RHWK 1FL3B 1GOHA 5D93C 1KF9B 2BY0A 5JIHA 1QBLH 2HVJB 3EFDL 1G7JB 1KB9J 1MCRA 5J56B 4I4WA 4FP8H 1XF2A 3V6ZA 1GGYA 1RUKH 4I3SH 1FYTE 3KYKH 3O3AA 4JKPL 1MNUL 3PV7A 1UM4H 3FFCD 4PIRF 3KHOA 4LPWA 4WFGE 5FB8B 1XCTA 4TSBL 3BX7C 4WI8A 4DVBB 3P4MB 3D85B 1DSFL 4LHUD 4RMSA 1XCQB 1FV1B 4LP5A 1HOCB 3R0MA 3P4LA 1V7ML 4DEPB 1N8ZB 1VEOA 3BXNA 4DUVA 2H9GA 2MKLC 2YD9A 2QADB 5F1KC 2I5YL 3S3JA 3ARFD 3MRBA 4ZO9A 3GRWH 4QRSA 4I0PB 2EE3A 4D2NA 4HUXA 4Y4HB 3S37H 4EVNB 5B8CC 1BFOB 4JHWL 4IRZL 1JWMB 3FO9B 2ZCKH 3GSXA 4HIHA 4XP6H 3RDTC 1T7VA 3O6KL 1WBZB 3HTLX 4WJ5A 4HGWA 4XMLL 4KJPC 3TYFB 2AJVL 3H9ZA 2HFEA 4PJFE 5BV7H 2H6PB 5K9OA 3VFUA 1MHEA 1C5BL 1OT1A 4MA3B 5IMLA 4QEGA 5D4QA 1DE4A 1G7MB 3BPLB 5EBMA 4TNWK 1XIWD 3AS1A 4PD4K 3PHQB 3ESUF 5F3BB 2DAVA 1QRND 4X9FA 2G75A 2YA0A 1T04B 3TA3B 2PYFB 1QSEB 4MNHA 4XPHL 1XEDA 4IMLA 4V1DD 3WJJC 4OCMC 3ZL4L 1IGIH 4XRCB 3OMZA 3FQRB 3MRMA 1K9TA 2VJXA 2R1XA 3T0AA 3C60D 1FNAA 1ZT4A 2JKXA 4H5SB 2D2OA 5C9JB 4FXGB 4Y8DC 1CCZA 4PJIF 4ZFZB 3C5ZA 4PJ5B 1KJVB 3F6IA 2GFBB 4ZO7A 3CMGA 3ULSB 3TBYB 3BSZL 2IH3B 4LSPH 3IJSA 2G5RA 4JQXA 4LSUH 4M9PA 3VXMA 5DO2D 2PW2B 1YNTB 1FNLA 3CC5A 3EFDH 4NKIL 1SJEA 3KYNB 1CICA 5GIRB 4BZYA 4HKJA 1HSBA 4Q6IC 3GSWB 4JKPH 4B7LA 1AGCA 2BSRA 2SEBA 4J3OC 1L6XA 2IPKB 1DSFH 2P24A 4X6BB 1KT2B 1TNNA 2APVA 3KLHC 3A6OA 3BYYA 1V7MH 1JZ6A 1DN0A 2ICWB 1HHJB 3DRQA 5IHZB 1FLTX 1T6VN 2I5YH 2ZOKA 4WENB 2DQFB 5DJYA 2YA1A 4X7TB 1MI5D 1MH5A 3CH1A 2W59A 4JHWH 2NR6C 2OX5A 3ARBD 4IRZH 2QQLH 2YUXA 4QRPE 1C12B 2YZ8A 5D1ZB 1GH7A 3O6KH 5FF6B 1ZTXL 1U8HA 4XMLH 3L95A 3C2SA 2AJVH 3V5DA 4E41B 3LKOB 3EO1A 1C5BH 5ERWA 4TVPL 5JW4N 4KQ4L 1AO7E 3QIUA 8FABA 2DM7A 4XPHH 2FH6A 3JTTB 3T1FA 1T83A 1HWGB 3FQUA 4NQSA 4PJDA 2HFGL 1HKLH 4LKCB 1IM9B 4AL8L 4KQ3L 3JBG7 2Z4QB 3LZFL 3N0PB 1ODAA 4D0DA 5CEZE 4RFEB 5C9KA 2X4RA 4QXUL 4G6FD 5J13C 3QSKB 3WDJA 5DEGB 3CIQA 1UXWB 1UJ3C 3K81A 4R97B 1F97A 4JFPA 1K5NA 4NSKB 1AC0A 3LAFA 4G43A 3K3QA 4CJ0A 1J1XL 2Q8AL 4LCWA 5HI3D 3IDNB 3OB0K 1BLNB 3GSRB 4NKIH 2R4SL 3QJHA 4GRWF 5D72H 2JJWA 3TZVA 1FP5A 4ZUUB 5DHYA 4LCCA 5EU5B 1FVCA 2WIIB 4CMHC 2Q7NA 5IIEB 2R1YA 1M7XA 1IEAB 5EN2B 4PRPD 3E8UL 1DBJL 2F54D 4HXAH 4H26B 2EH7L 3F7VA 1GXEA 4QYOB 1F4XL 4Y2DB 1T2JA 5HPOA 5E5RB 1BHGA 3H3KA 3V0VB 5I1LB 3OG4B 1U41A 3L3IA 3ZO0A 3GMOA 5EB9A 1U8KA 4JPIB 2OR7A 1ZTXH 1A3LH 4NO0B 2V2WA 5EBWA 3F7RA 1P69B 4M5YL 4ODXB 3WLWC 4C83B 4IDLA 1MPAL 2Y1VA 2W0FA 4PJXB 3X17A 3VJ6A 5HYJA 1U8IA 4RSVA 4IOFD 3WS6C 2IC2A 2XG5A 4GKNA 4K3JL 3D85D 4U6HB 3VFSB 4TVPH 4KQ4H 4EUPA 5DA4A 3K8KA 5DRWA 1E28B 3C8DA 4OGZA 3D39B 1FSKC 4LAQL 2QADD 3V4UL 1J05B 3RI5K 3TPKA 5JOEA 2ZG1A 4OLVL 3WEXA 2P44B 1U3YA 3U7WL 3WMSA 3C6SA 5ICXB 1A7OL 1XF5A 4K7FB 2HFGH 4F8QA 5I17B 2B5IB 1OP3H 1JV5A 2G9HA 3S4SB 3QG6A 1WBYA 4AL8H 3O3BA 4KQ3H 3LZFH 3E6FB 1U93B 1JNNL 2IANE 3QXAA 1RZFL 2O93L 4X7CC 4QXUH 3N1QC 4L8CB 1I3RB 1R5VA 3WXWL 1D5BA 3L5WA 3BN3B 1NDMA 2BNRA 4N5UA 4ODHL 5B38B 5HVFB 1MCEA 5DK0A 5FKAB 4ODTL 4U1LB 4LVNC 3W0WD 1NJ9A 4JB9L 5ID0B 1YEKL 4LSDA 1JMXA 5F3HB 5D7JC 3VW3L 3NBNA 5FM4A 1J1XH 4YGAB 2Q8AH 3SGKC 4XC3H 3WO4B 4X6CB 4ELMA 2R4SH 1XGQB 2X42A 5KVDL 5E2TL 4X0KA 1J88A 3FT3A 4KDTC 2BC4A 4FQ2L 4D0BA 1UYWL 3HE7B 1P4LB 3PQYE 3QWRA 3U1SL 4NJ9H 3SJVB 4H1LA 1Y6KR 2VLJB 2YWZA 3QEGL 2EDBA 4WIQA 1EVTC 3QDGB 2MSPA 2NY2D 3T2QA 4L4JA 3SE4A 4PJ5D 1DBJH 5FUZL 1D9KC 4G8GE 3VFMB 5D2NE 3HNTL 2EH7H 2ZUTA 3O3DB 1F4XH 3E1F1 3IDYC 2WBJA 2ZUWA 4NNYB 5C09A 4EXPX 5GSVA 3IVKB 1ZKAA 1MHCB 5MENB 1LEKB 2UV3A 4XMKL 4UU9A 5F89B 5SWZA 5C07D 4JY6B 4JFDB 5CD5D 2CDGA 5HYSB 1VFOA 3HI1A 2V5YA 3BEWA 4M5YH 5GGVL 1MPAH 1NBQA 3BGMB 2CKNA 3CFJB 1TVBA 5IROC 2NX5D 5JNYB 3V6OC 4CAGA 2J5LB 1E4KA 3GMNB 4K3JH 4CADA 3V5KB 4ODUB 2XTLA 1R3LB 4JM2D 1S7XB 4LAQH 4EIZC 3V4UH 2VL5B 2VAAB 1JZ3A 2OLDA 2NTSP 3CXHJ 2X89A 3U7WH 1MWAL 4U0RB 2WWKT 4K55A 4UBDC 4WNQA 1A7OH 2OTWA 3RUGA 4DN3L 2FATL 3GSUB 5ETUA 3T04D 4HH9B 4AENA 3KPQA 2AQ3A 3PXJA 4GG8A 4X5LA 3LQAC 5KW9L 1K8IB 4PJ7F 3VCLA 2R69L 3QUMB 3VXUD 1JNNH 4NQVA 1P9MA 5IKCA 1RZFH 4P3DB 4XPGL 3U0WL 3OX8A 4ORGA 5D7LB 3SKMB 4M61B 3TLRA 3WXWH 2D7QA 1NDGA 2MHAA 4ODHH 3SKUD 4GRWH 3RWJA 4DAGL 4ODTH 1YEKH 2XN9D 4XVTL 2Y07L 3VW3H 1AQKL 2JCCE 4XVUD 5C0EB 4PFEA 1IARB 2OQJB 1KIQB 5KVDH 2BHUA 3VGEA 5E2TH 3NFNB 3PGCB 5I74B 2YR3A 4APQA 3PL6B 3NZ8B 4FQ2H 1NCWH 1UYWH 4JGMA 1S7RB 2I26N 3FKUS 4PJBA 3U1SH 1H15A 1BFTA 4QHUB 3SCMC 1IM9D 1A9BA 1QHOA 4OFYA 2GITA 3MNZA 1F2XK 3KPPB 2OP4L 2R2HB 3HR5B 3UTQA 5JORB 2Q3ZA 3EHBD 1Q0YL 4HJGB 5FUZH 5FKPA 5CIPH 3HNTH 4P23A 3T3PF 2X41A 1QG3A 3DUSA 1NCUA 1CBVL 1HQRA 4M6AA 4MYWB 1D6VL 4JVUA 3LKQA 1O7SA 2V7HB 1T0MB 4PLKC 1EH9A 4PP2A 4UB0L 4XMKH 2IAMC 4LVOB 4U3XA 4J4PA 5JW4Q 3TN0C 3BJ91 3VRIB 5D1QC 5KSUB 2ESVB 2Y25A 3MNWB 2ZUVA 4MNQD 4TULL 2AK4B 1FE8L 4Y5XC 3CSBA 2Q86A 4LF3A 5DK2A 3U46A 5F7WC 4JFEE 2JJTA 1XGRB 2XXCB 3GMQB 3OJ2C 2DQUL 4MDIB 3UZEA 2BSSA 1ETZA 3GMPA 4CN6A 5JDSB 2AKRB 3JSSA 3E2HC 1X5AA 4JAMA 1CDIA 3VFNA 4J7RA 3V8OA 4YR6A 2GSGB 4QTHA 1DEEB 3DI2B 1KACB 4OZFH 3ZYIA 4WW2B 1MWAH 3D9AL 4DN3H 2FATH 3BVNA 3B8YA 3MV11 1RZKC 4NQEA 3RWDB 5IW6B 4MS8C 4I2XB 4ZUSB 5C0IA 5KW9H 3MCKB 3KG5A 2R69H 4QOKA 5LVEA 2EKJA 5FECA 4XPGH 3IS1X 4DW2L 1R3HB 1QA9B 3QI9B 2YXFA 4DAGH 2ZUUA 1MJ7L 5GSRB 3SY0A 4XVTH 2Y07H 4POZD 5BMFL 2VXTH 3HNVH 1AQKH 4EEEA 1TZHB 2H3NA 3D39D 5GJSH 4K8RC 3RWHB 1UVQB 5F1NA 1K8DB 2E27L 3RHWF 3RPIA 1OWWA 4IRSA 2P8LA 3DX8B 3MZTA 3G04B 3MLZL 3BQUC 1CD1A 4U1SB 2YPLB 4XPFL 1F6FB 2ATKA 4OI9A 5D1XD 2PR4L 3SN6N 2OP4H 3EZJB 2YD8A 1Q0YH 2OL3B 4F37K 4XVSH 5IB2B 1CVSC 2VDLH 4QXTA 1RZKL 1CBVH 4PG2C 3O8XB 1TQBC 1D6VH 1BVKA 2WWKO 1LE5A 3QXTA 2VLRE 3QULB 3BE1L 3QUXA 4UB0H 5B3NA 4WU5A 3ORJA 3JV4A 4UILL 2Y7QA 3BZEA 1ZA3B 3SBWC 1IKNC 3GSVA 3DLQR 2GJ6A 1FE8H 3VXMD 2BSTB 4PJ8C 3IJHB 3SDDA 5DJ8B 4XWOC 1TLKA 5EU6A 1LWRA 4F2MA 4PJGE 4YPGA 2NW3A 1T89A 3D25B 3SJVD 1CICD 3WNPA 1FGNL 4MMZC 2VLJD 3VXSA 5TF1L 1QSFE 3GJFH 4K8RL 2IPTL 3VFRB 3CPLB 1X5JA 5L8KB 4ERSL 1KG0A 4TNWF 1LNUB 2W9EL 2EDEA 4EJ1C 5DQ9A 4OKVA 3QXWA 4NQTA 2YK1L 3LVEA 3PP3K 2Q1EA 2CUHA 1DUYA 2CKBL 2VITB 5DFWH 2BVTA 4BA8A 4DUXA 5IUSA 3D69A 1I8KA 4JFDD 3VWJA 4OT1L 5IG7A 4AG4L 4GQPH 4L4TE 2OSLB 3RZCB 4X8JB 5EBLA 5FYLL 4HCRL 5JO5B 5BRZA 4MXQC 1ZK9A 2CDEA 1FAIL 4DW2H 5I75B 3S36L 4OCXL 4UNVA 3MXWL 1MJ7H 2Z31A 1CTNA 5DJXA 2V9QA 4IJ3B 1GIGL 4ZPVA 1VFAB 5FYKL 5HYFA 3DVGB 2DYPB 2R4RL 4WHCA 3VXOB 3S3SA 4ZSOA 1PD6A 2E27H 4Y4FB 1A7PL 5BZWB 4R90L 3SDXB 1OTUD 5F7DA 3D18A 1T1ZB 4XBGA 4X98B 1K4CA 2HT2D 3MLZH 4UOW1 4OZGA 4BH8B 2W0KA 5IOPB 1LE9A 3EFFA 5CKGA 1AGBB 3ZTJG 3PHSA 4CRPA 3DXAA 3HPLA 4JREB 2PR4H 3CDGA 4LQ1A 1Z0NA 1NEUA 1JTOA 1IT9L 5DFVD 2WUCL 4J1UA 1A14L 1R3KA 4G5ZL 1N6QL 5J1AB 4GAYB 3QZWG 4X83A 2OK0L 1RZKH 2PW1A 3RRQA 2XA3A 2DB8A 2P5WE 4P2QA 3D0VB 3L3KA 4GMSL 4G8FB 1DL7L 4NZJA 3BE1H 3HMXA 3K0WA 3P4NA 5I1JL 4YHOL 1YDPB 3IU4H 4PB9L 4UILH 4KGJA 2F53B 3LKRA 1J0KA 1FPTL 1V3KA 4LCWD 1EERB 2W60A 4ZFGL 3ZE1E 4NFDA 2Y9RT 43C9A 5LGJB 4WI4A 5FGCB 1FGNH 4L3EA 4R7DA 1Q9OB 1HHKB 1F90L 5TF1H 2GTWA 4K8RH 2A1WL 2IPTH 4NQXB 1D6EA 4M9OA 3D2UB 4ERSH 3MV8B 1JVKA 2W9EH 1OF2A 1F00I 4HZLB 1AR1C 3C9NB 3MROA 5F72S 3FQWB 5HD8D 1UACL 2YK1H 3VFVB 4KK6D 4A2MA 2CKBH 3SDCB 1NANI 5F7EL 4OT1H 4FTVE 5IBUG 2WM0A 4OM1H 3EZ8A 2A73A 3ZTNL 2XY2A 1JRHL 5FYLH 4HCRH 1X7QB 3UTZA 4YHIB 1ZLVK 4BQ8A 4RWHA 2B39A 1MCDA 4XCNA 4XXCA 4QRUB 3S36H 5CJ5A 4AT6A 2GSIB 4PREA 4OCXH 1T1XA 1KJ3H 3MXWH 3QIBB 3CXHK 1RZGA 3RPKA 1YMME 2DQCL 4TQEL 1ZHLA 1GIGH 5FYKH 5TH2A 2ZUQC 2X4NA 3BH8A 3BPOC 4NN7C 2R4RH 3MRKB 1Z3GL 2VZSA 3UJJL 2GUOB 1NCCL 4BFIB 1A7PH 1CQYA 1FVDB 4LPTA 4R90H 1N0LA 4W70A 4HS3B 3ZYJA 4MB3A 5F93C 2DWDA 3PWLB 3WKML 3TBTB 1ZE3C 4HAFA 4Q97A 4KU1A 4WHYH 4POUB 5DD1L 5FHAL 4LBEA 2WUBL 3P30L 1IT9H 2WUCH 2VOTA 1A14H 4G5ZH 1N6QH 1KJ2B 5EZLA 4PRAB 2OK0H 1TJHH 5DVMA 3NIDE 2DWEB 5IB1A 4JRXE 5M7QA 5CZXC 4YPJA 5A2JH 2DKUA 1HHHA 1AGDB 4GMSH 3V5HB 1DL7H 3BMWA 3LN5B 2KQNA 5I1JH 4YHOH 3BD3A 5D2LA 5H37H 4PB9H 2OTUA 5BW7A 4KJQD 4HH8A 3OKKB 3NPZB 4N0UA 2AJXL 4PS4L 3QRFM 1FPTH 1RJYA 4F7EA 4PJ9B 5HI4C 4R4BB 4E9LA 4MQ7A 4ZFGH 1KFAL 2NY3D 3E3QE 5I9QC 2Z93B 4JFHD 2HVJA 1G7JA 1GSMA 3BJLA 1F90H 2DS4A 5T3ZL 2EYSA 1U3HA 5D7IB 1OAYH 5GS1B 3UTPE 3QWRD 5FB8A 1WWBX 3T0DA 4HWUA 1H3WM 3L7EB 4DVBA 1MCIA 1XF4A 2BNQB 3AAZB 4HS6B 1RJLB 1XCQA 3H9HB 3THML 4S1RL 4M93B 1AQDA 1UACH 43CAB 3U2SB 4HULB 4OZIE 3RI5F 3EJZD 2NMSA 4F3FA 5F7EH 1JCKA 3OL2A 3ARZA 5JXAL 3ZTNH 1Z9SA 4I0PA 1JRHH 1N0XL 4Y4HA 4N8CH 1HNGA 3EYOB 4OCWL 1Q9WA 3LV3A 5LCVL 3FO9A 3G5YB 3WV0A 2DQDL 1YECL 4PJDF 3UJIL 1WBZA 2DQCH 4TQEH 5JOPD 2H32H 4OF6A 1ZV5A 1J0ZA 3V2AR 4AEHL 1Z3GH 3UJJH 5TF0A 1NCCH 3UBXI 4GKOA 3EDFA 1QLFB 4L8DB 4KKLC 1S7QB 1G7MA 1X5KA 2GTZA 2NW2B 3C5JB 5FO7A 3WFEL 3QIUC 1K3ZA 3MJ9A 4RISL 4S1QL 3TA3A 5F7YC 1QSEA 5J6GB 3OXSA 5M94B 4YBHA 5FHAH 4MXVF 3J7HA 4YBLC 3P30H 3IDJB 3LB6D 3I3EA 3TJHC 5CJXA 4XRCA 3T0BA 1BEYL 1T83C 2XWTB 2HTKD 1IZKA 2D7TL 2ADJB 2FR4B 2ED7A 3W9DA 1DQJA 3H9SA 3RWGB 4LLWB 1EEUA 2C4XA 3W11D 4ZMAT 1WF5A 3RGVB 5C9JA 4FXGA 3ZMRA 1BQHA 1KJVA 2DYPD 4UOW0 2WMPA 3I6LE 3OQ3B 2APTA 5CSZA 5CFHA 1RK0B 4Y4FD 2AJXH 4PS4H 4PRIA 5KOMC 3QH3A 3TBYA 2IH3A 4LIQL 1DVFB 1DQQA 1KFAH 5HPMB 2DRUA 4PTTA 4HWEH 4L9LB 4KMLB 4PBVC 1JRHI 1EUTA 5HHMB 4RGNE 5GIRA 5T3ZH 2C1PA 5C2BH 1MAKA 3TZVC 3HMWH 3ALXA 4L29A 1HYRC 3E0GA 3FB6A 4UT7L 1AI1L 5D6DC 2XV6B 3QPQD 2J8UB 1W0WA 3B5GA 4YHPA 3THMH 4FQJL 4S1RH 4F58L 2FD6L 3MV7B 5D70L 3BPNC 2ICWA 3MJ8B 2I9TA 3N50A 1J86A 1B0RA 1HHJA 5IHZA 3HE6A 5C0FA 2P8MB 4Q2ZA 2AEQH 2DQFA 3TNMB 5D96B 5JXAH 5L0QC 4FRWA 3TO4A 1N0XH 2H1PL 2HN7A 4RA3A 2YZ1A 4J4PD 4X4ME 4OCWH 2QV2A 3VD3A 5HVWA 3HRPA 5LCVH 3RAJL 3I85A 2QHRL 1C12A 2DQDH 4MJ2A 2EDFA 1CD9B 5D1ZA 1YECH 3FOLA 4HW6A 3UJIH 1KLGA 1FC1A 1T66C 5EIVA 4XPAL 1ZANL 1LD9A 4Y88A 4N0RA 3LKOA 4AEHH 3MV8D 2PYEB 4Y7MA 1ITCA 4JFOB 1A6VL 2ZG2A 4TVPE 4KJYA 4Y16D 4D9QE 3BD5A 4KJWC 4F80A 3WFEH 1ACYL 4RISH 4S1QH 4B5EA 1T3FB 1XFPA 3ZKMD 5H94B 3JTTA 5HYEA 3REVA 3U48A 4QHLB 5BOZG 5CEXB 1BEYH 5EZJB 4PJIE 3BRDA 2D7TH 2KUTA 5BZDA 4I3RL 2YD5A 3MRFB 4HMDA 5DD0L 1J0JA 4Q58C 1JP5A 1SEBB 5JHDB 3ARDD 1R5WB 3NFPB 2XXMB 3VXRD 4RFEA 4YC2C 2C26A 3GIZL 2A6KA 1UGNA 1QLEL 2RFXB 4WFEE 3O3EA 3NMEA 5L2KD 3CFDA 1UXWA 2R39A 4PGCB 5LJYH 4LIQH 4ZXBB 5BS0E 4UT9L 5B22A 1MFCL 5BO1L 5K9KB 1R3JB 1BLNA 4BSVA 4LLYB 1GAFL 4IRSD 3NN8B 5IB4B 2VR4A 1A7QL 4BSWB 4QXGL 3EYUL 4ZUUA 1JZ5A 2XTJC 4UT7H 1AI1H 3RVUD 2C4FU 5HYQA 5IIEA 1TFHA 4F58H 1GVIA 1NMCC 4ZS6D 2FD6H 4HWZB 5D70H 2W92A 4KMQA 1NGWA 5EOCJ 5EN2A 4U1IA 4H26A 2J8OA 1GZQA 4NRZB 4Y2DA 3VXTB 2WBJC 3V0VA 2VLMD 2XFXB 4PJ9D 5I1LA 3UDWC 3RAJH 4KV5E 1J5OL 1J9CT 5DTFB 4NO0A 2VQ1B 1MJUL 4QT5B 1ZANH 1U42A 5DJ2A 5INCA 1W0VB 4YDIL 1GRWA 4CVZA 1EIBA 2KL6A 3ILPB 2YPVL 4TTDD 4G80B 1E4KC 1A6VH 3VXSD 2O5ZH 1EGJA 3PJSA 4BFBD 1E28A 2DQJL 4HUNB 4CW1B 3PWJA 1ACYH 2VDRL 5F8QC 3UROR 4Y5VC 3BP6A 4KDVA 3CH8A 3ZLQC 5K9QI 3U0TA 1U9KA 3FFCE 4BFEA 2GCYB 5MEOB 3T0EC 2WK2A 5FM5O 5I17A 4I3RH 4LOUD 5CCKL 2VSDA 2P7TB 3S4SA 5DD0H 4OLYH 1FVEB 4G6AD 2NPLX 3KPRE 4F37F 1NBYA 1P9MC 5C0CD 1YMHB 3GIZH 5SX5H 2R2BB 4MQXC 4OZHB 1QLEH 4L8CA 2DQIL 1I3RA 1DN2A 1YPZA 2LVCA 2B1HL 4HK0B 3L3DB 4KKBD 4XHJD 5CP3A 3ZSTA 5DEZA 3BESR 2NYYC 2Z31D 1ITBB 5FM5M 5B38A 4GRWE 4D8PB 1S7UB 4R96B 5A2KH 4UT9H 4QRRD 1MFCH 5BO1H 3TNNB 5IW1B 1WFOA 1GAFH 4F7MA 4U1JB 1A7QH 4QXGH 4R0LA 3EYUH 4APQC 1AGEB 3GIVB 3UZVB 2VLKD 1P4LA 4S2SB 3HC0A 4OCSL 3MRCB 4EUPH 4PYHA 1I3VA 3DXAD 2EDKA 4XGZB 1YNLL 3QDGA 1KTDB 3I3DA 1W72B 4PJHA 3MMEA 1XZ0A 1RHHA 3VFMA 4NQCE 4MAYA 5EH1A 3W82A 3TVMB 4P23C 4MXWL 2YA2A 3TBSB 2BP3A 2HG5B 3O4LE 5MENA 1DVFD 2D0FA 1ZT7B 3OG6B 5J06A 5F89A 5DI8A 1I85A 4F7CB 3MRQA 4IIQB 1MJUH 1Z2KA 2YBRB 3SKOA 1MCNA 4B50A 2DDQL 3DROB 3LQZA 3DIFB 3BGMA 4JFYA 4YDIH 4NN5C 5HDLA 5JNYA 1OSZB 2YPVH 2C4FT 2QSCL 1G7IB 2JJTC 2BERA 3AXLB 4WVRA 2JTDA 4UV7H 4KK8C 2DQJH 3P2TA 1EAJA 1OVZA 4DGIL 1OGAA 4JN1L 2VDRH 1IGFL 1RUML 4FQHB 5TDPA 5I6XB 1DZBA 1JWSA 4XTRD 1UKQA 1ZMYA 5B21A 5D71H 1ORQA 4Z7UB 5ADOL 4H1LH 3GSUA 4NRXA 4JZNB 4YHYB 3IRPX 5ESVB 1K8IA 1YYMH 3QUMA 2FBOJ 4P3DA 1KB5B 4AJ0A 4DOHE 1NLDL 5D7LA 2DQIH 4M61A 2PXYA 2B1HH 4JRYB 2HT3C 3LD8C 1WEJL 5GS3A 1WCQA 3K4DA 1I1AB 3SGEH 3K8LA 4PGBA 5M95B 4IRJB 4RAVB 3OGCB 3SE3A 2Q20A 3ZT7A 3UMTA 2BCKB 3RWFA 4R2GC 1CDHA 4XBPA 2OQJA 1KIQA 3NFNA 4LDEB 5HBBA 1RZIB 2MQCA 3V6OE 2L7JA 1LEGB 5ELIA 4OCSH 3Q6FA 1QFWI 4QHUA 1D5IH 5DZLA 3BRFA 1KTLA 3AVEA 5JXEA 1YNLH 5IP4A 5ESAB 3DV4A 5JORA 3WSQL 2UWEB 1BJ1J 3L5JA 4KKCC 4MXWH 4LK4A 4ZXBD 3QUXC 4PJEE 4Z0BL 2OTPA 2CPCA 5A43C 1U95B 2XZCL 3DX7A 3RU8L 4JFFD 2IMMA 2ESVA 2EXWD 3NPSB 2AK4A 3PWVB 4EI5B 2DDQH 5F6IB 1MRFL 4XC1H 3SDDC 4NWUL 1CXKA 1MFAL 2QBWA 1XGRA 4JFQB 1F3DH 1HH6B 1R6VA 3KPNB 1T89C 1U3HD 4O00A 4F9PC 1H8SA 4GBXB 3X3FH 4DGIH 4UI2A 4JN1H 3B6SB 1IGFH 1RUMH 3SGEI 1DEEA 4YK4C 4WI5A 4PJ7E 5IK3B 5DVOA 5J8OA 5ADOH 5IBLD 3IDGB 1DQLL 1AE6L 3OKMB 5E9DE 3ARWA 5BJTA 5SV4A 3IXAB 3KJ4C 2IBZY 5JA8B 4I2XA 1IGML 4NZRL 1OTTC 3AU1A 4I9WD 3VWJC 4ETQB 1UA6L 1UZ8B 4OZGF 5EU4A 2F5AL 1NLDH 4WU7A 4QHNB 3UEZA 4R7NA 2F54E 3BIBX 2DL9A 4LMQE 2GYSA 4PJFB 1WEJH 4JO4L 5DLML 2DD8L 5SWSD 3RVXD 5GSRA 5FYJU 4NOFA 2V2TB 4X9IA 3NIGF 4M02A 5CP7A 1X4YA 2NXYD 1K8DA 2BVPA 4YX2L 3B3IA 3QWQB 3CLFL 3ARRA 1G0DA 3DX8A 2XI9A 4Z7WE 4PG9A 1ZLUK 4FXKB 3T3PE 2YPLA 5KZCD 2EE2A 2QKIB 1IAOB 4N9OB 2BRQA 1FFQA 3ULUF 3ABZA 3Q48A 3S97C 3UYOD 4KRLB 2M26A 2OL3A 3WSQH 4O51B 5GZND 4P99A 4LLUB 2CLRB 2LV4A 3O8XA 4LAJH 5DXWA 2NY6B 3VRLF 2G5BB 3QFDB 1N64L 3FAXA 2CDFB 4Z0BH 2YOCA 4IEFB 2HA1A 2XZCH 3RU8H 4RDQF 1ZA3A 3GSNB 3B43A 3G08B 4N8VB 3UTTB 4X6DF 3U36B 1MRFH 3VG9C 2V5MA 3CZJA 1MFAH 3ULUC 4PRNA 3ARBC 3KPOA 2YWYA 1CYGA 2ZUYA 5J11B 3VA6A 4DN4L 1I7ZA 3PDOA 4S0TD 2ADIB 4YIQB 2DQHL 4Z77B 1WFNA 5FCUL 4UQ3B 3LN9A 2AJZB 3L3JB 4NKMB 5C0RL 4AZ8A 2P1YA 3MV9B 4U1HB 1MLBB 2FO1A 3WUZA 3LDBC 3RJQB 2YSSB 1DQLH 1AE6H 3LIZL 3OAUL 3HE6D 3O2DA 1IGMH 4NZRH 2XKNA 4TSCL 1I9RH 5F6HJ 2DQGL 2HLFC 3DHJA 3TO4D 3PABA 3SE8L 3L6FA 4K3HA 3RTQB 2OSLA 3UAJD 1CD8A 3RZCA 1VFBB 2F5AH 5KSAB 1N5YL 5FYLE 1OTSD 3BZ4B 6CGTA 1P7QA 3KJ6L 2ADFL 4JO4H 5IEKB 5DLMH 4OFDA 3HMXL 2DD8H 4D0CB 5I73C 1PQZA 1SJHB 3TPUB 1VFAA 4ZDHB 1G1CA 5FYKE 3F7QA 5KSBB 3DVGA 5JR1L 5C07E 1L7TL 2OMBA 4KUCD 1RK1B 4YX2H 1IMHC 2QQNL 4NOBA 4C56B 3ULUL 4LLMA 1FFOA 3CLFH 4Y19E 3SDXA 2YRLA 4X98A 3WLBB 2UUDH 1MCBA 4BH8A 4NN6B 5CAYB 2HFFA 5HI3C 3DMMD 3DTXA 1MHHB 3C08L 2YD3A 4PRHE 1CXFA 1FZKB 4OV5B 2NY0D 3CU1A 1DBML 1H9VA 4QO1A 5EO1B 3FQTB 4BH7B 4HK3N 3BIKB 5J1AA 3TBWA 4GAYA 2R29L 1ZLVH 4JRYD 3B9AA 2P5EE 4J12A 4X6FB 3B9KB 3GI8L 1I1AD 4PJAA 4HJ0D 3RKPA 4G8FA 2PF6A 1N64H 3EJYC 3TP4A 3CX5J 3MRHB 2VLLB 4YHML 3VXUE 2WNGA 2XPGB 2NTFB 5BW7C 2ARWA 2V5TA 2F53A 2R2EB 3LS5H 5E6IB 3RNQB 1HZHL 2VH5L 1FORL 4HG4J 4JJ5B 4QXWA 4P59L 3UPAA 1EHAA 3CLEL 5LGJA 4ZUWB 5TFSH 2IWGA 4DN4H 2PTTB 1Q9OA 1HHKA 2D7MA 4U3CA 2DQHH 2APXA 3U79A 2VTFA 3D2UA 5FCUH 2DLIA 1FZJB 1IC5H 1CQKA 5TDOB 3DURB 3FQNA 5ISZA 2KPNA 5C0RH 5CKAA 5DJ6A 4H8WH 3Q6GL 4HWBA 3RX8A 2LAAA 5HHOA 2J6EA 1G7LB 3IDXL 3RQ3A 5I0ZA 2A9ML 3WS3A 3LIZH 3OAUH 4DEPC 4U7KA 1CF8H 4XB8A 4UAOB 4TSCH 1TXKA 3OR7A 2DQGH 2GQHA 2FIKA 4JPWL 4JFEA 4I0PC 3ZKND 2HVKB 1N5YH 4Y4HC 1DBBL 4MD5B 2ICES 4KROD 2JB6B 4LLQB 5CUSL 1FYTD 3KJ6H 2Y5EA 2ADFH 1JPST 4WFGD 3PUCA 4ENEC 3QIBA 3RVWC 4LFHD 1S9WA 4JZJB 4YHNB 2DICA 3PP4L 4HMCA 5JR1H 3MRKA 1XR9B 1KCUL 5ENWA 1L7TH 4XNMB 4MMXC 5FA4B 4LASL 1ZVSA 2GUOA 2QQNH 3ULUH 3MLSL 4UZGA 3ZDYE 5F6HI 3ARVA 4OLEA 3BPLC 3FB8B 4FNLL 1X5YA 4OCRL 5I1HL 1CLCA 3PWLA 4PP1C 5C0BA 5KVGL 4OI7A 3C08H 1HXMB 1IAIH 2BMKB 3TA3C 2HMIC 4GG6B 4JO1H 1LO2H 5CJXC 1T1WB 1DBMH 4PBXA 1JE6A 4PRBB 2DTSA 3VI3F 1DDHA 2IANB 1KJ2A 4PRAA 2W0LA 2R29H 1OPGL 5DS8A 4ZTOL 1EJOL 1PAMA 2DWEA 2HP4A 3GI8H 4FFYL 3HAEG 3BAEL 4O2CB 1TQCB 2EDNA 3ARTA 3B4NA