1MFCH

High resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
211
Chain Sequence
EVQVQQSGTVLARPGASVKMSCKASGYTFTNYWMHWIKQRPGQGLEWIGAIYPGNSATFYNHKFRAKTKLTAVTSTITAYMELSSLTNEDSAVYYCTRGGHGYYGDYWGQGASLTVSSAKTTPPSVYPLAPGMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN)
publication title Recognition of a carbohydrate antigenic determinant of Salmonella by an antibody.
pubmed rcsb
source organism Mus musculus
total genus 44
structure length 211
sequence length 218
ec nomenclature
pdb deposition date 1993-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfcH01
4IRJA 1GRWA 4ZXBB 3RZCA 1OARH 1R24A 4L9DA 2JJTC 5ADPL 2ITCA 3PWVA 1FNEB 1GC1L 4JFZH 4OQ1A 5HGBB 1QSZA 4YDVB 3CDCA 5SWSB 5K9QI 4JZNB 3C2SA 3U4BL 1XR9B 3OKYA 2DM3A 4JPKH 5EA0H 5E7FA 3F7YA 4GO6B 4QTHB 4LVEA 4L8DA 1BEYH 1CE6B 3SGDI 2Q20A 1I1CA 2CRIA 2XRAL 1IKFL 3VRLF 3IDIB 5F7DA 5DHVB 3SY0B 3CVIL 4Q9BA 4QY8B 1OTUC 5JO5B 4HCRH 1ZLUK 3CH1B 3MOBH 4LLWB 2IJ0C 3ZDZE 4HWNA 3HG1E 3NTCH 3O3AA 2FHCA 1BBDH 2DLFL 1CD8A 3IJSA 5F3BB 1I9EA 4ODXB 4Q74A 4YFLI 1DANT 4CW1A 1R5WB 1U8JB 3D6GA 3WYRA 4YBLC 3W5NA 1U93B 4EQ2A 3BZ4A 2O5XL 4KQ3H 3CDGB 4IDLA 3VFOA 1S9YB 4G8EA 3HZYA 4P9HH 1HSBA 2Q87A 3V0WL 5C2BH 3GK8L 4PRBA 1S7UB 2CDEA 3ABZA 3LOWA 5DS8B 3KPOA 3MJGX 4ZUSB 1NFDE 2V9QA 1J1OL 2XOTA 4Z0XB 5HHPB 3ULUC 3MA7B 5IVZA 1FYTE 3NCCB 1BZ9A 3OHXB 5IOPB 1TQBC 2X42A 5D7JB 1BVLA 1DN2A 3U7YL 2AXFB 3SDXE 3C08H 1NL0L 4EI5C 1VKXA 4QRQB 1W0WA 3DSFL 4I0KA 2GJZA 3O3BB 3MRKA 4MSWA 1OAXL 1A7BA 5EZOL 1T04A 4DZ8B 2K1MA 2X4RB 4ZUVB 5DQDL 1KXVC 2IG2H 3CZJA 1RZFL 1GGBL 1JGLL 2DN7A 1P84J 1HIML 1LEIB 1MRFL 2J8UE 4PP1C 3UCRA 1D5BB 4NZDA 3RUGF 1CFNA 3QI9D 4P49A 2VH5L 2DDQH 3L7EA 3P9MB 4BSWB 1IARB 5F7LB 1Q38A 3PP3H 3WS6C 2NTSP 2OSLA 2DYPA 2P5ED 4CVZB 3W39B 1MOEA 4HH9B 1UB6B 2FIKB 3VWJB 5I8OH 4FABH 5I75B 3L5HA 4MAYA 3H3BC 5DR5H 5C0AA 1XGTB 2J8OA 1KIQA 2VDNH 3E6HA 1G7LA 5SX4I 1CF8L 1OB1B 3TGXA 4OUUB 4XNQB 4LCIL 4IDJL 4FQ2L 1N6UA 3AREA 2GW5A 2HVKA 5LBSH 3VD9A 4IHOB 5IW3A 1KEMH 3FQTA 4YR6A 4DAGL 4I2XB 2BHUA 1Q0XH 2I9TB 3RWHA 3WUWA 3H8NA 4PJ9A 5FOBB 1OAZH 4MJ4A 4Q0XH 3ULVC 4GG8B 5I1DB 4PJBB 2ZOKA 3CX5J 4GRMA 4MA7H 2ZSVA 3BP5A 4GRWB 5TH2B 4CNIA 5JW5A 2C3WA 1QBML 3AS1A 2PYEA 3GMQA 2AJYH 3VXMB 1MLBA 4NP4L 1A9BB 1EVUA 1LP9A 1QG3A 3GJEA 1R3JA 1MRCL 1MVUB 5TDNA 3OAYH 3MLUL 3MBEB 4NO3B 3WO4C 4EI6A 4WUUD 4OFKA 4AT6B 5HYJE 4HD9A 4K2UH 2YC1B 3LQZA 1KJVB 4TOYL 1U8OB 2IGFL 5DRWB 2H2SD 3CNKA 4LDLB 3TWCL 1QLFB 2LTQC 3SGJA 4OIIH 3UZVB 5DVOA 4HZLB 1CT8B 4YXLL 2Y5TB 4U7MA 2IALA 5IP4A 1JWUB 3L3IA 3QG6B 1JHTA 4A6YH 2P5WB 1Y6KR 1JTPA 43CAB 1FC1A 1T1ZA 3MLSL 2PTVA 4C56A 3WFEL 1EZVX 3MMEA 3MCG1 2Y25A 4XPHL 4F33A 3HA0A 5I16A 3GBNH 2O61B 1G6RH 2E9IA 4WVRA 3GSQA 3MRLA 1MFBL 4MVBD 2VO5A 3DTXA 3RY4A 1VFOA 2VLRE 4X7CC 2BVOA 2GAZB 3U83A 1CK0H 4L8CB 4FQLL 2OQJA 1TCMA 5ITFA 2AV7A 4G8GB 4FP8H 1Y18A 3NAAH 5HYQB 1QFPA 1UM4H 3TJHD 1RUKH 3CXHJ 2DBLH 1IFHL 4Y4KA 4XHQA 2IH3B 3DOSA 3FFCE 4XZUB 4ACPA 5IEKA 5BO1H 4U1JA 5C0JA 1MFDL 1KCSH 2BSTB 1JUFB 1C5DA 5GHWH 1FDLL 4KY1H 4NQTA 4E5XB 4N68A 3DROB 1N3NB 1D6EA 2YBRB 4HPOL 4N5EC 4ZS6C 1FN4A 1RQ5A 2X40A 3P0VL 4JM4H 1W2KT 2DMBA 4KK5D 3BHBA 4FTVE 1KJ2A 1C5CH 5T33H 2VIRA 2FX7L 3MLTA 1AGCB 3F7VB 2V9RA 5J1AB 4PY7B 5JMOC 3HE6D 1FFOA 4HIJB 5KSVB 3DMMB 4OM1H 2J4WH 1S7WA 4XC1H 4OKVB 5HPOA 3GEWB 3H0TB 4D8PB 3DBXB 1T0MA 3O2WL 1LO4H 1YJDH 1AQKL 4WU5B 2N1KA 1N8ZA 3GSVA 4KKLC 3VFGL 4KUZH 4ODVL 1ZAGA 4PJGB 1FE8H 4U7SA 4P57A 4HPYL 4UB0H 3MRIA 2H9GB 3HKFA 1YPZB 4JB9L 3BRFA 5CMAA 2IFFH 4JFDD 3T2NH 1AXSA 1JMZA 1NUGA 2UY6A 4Y5VC 1E4WL 1KCKA 5ESQA 1S9VB 1S78D 5CZVH 4LSDA 3N9GH 3U2SA 3ZKXC 1CICD 2VXQL 1IAIM 1DN0A 4U6XA 3QHTC 1UKSA 3G04A 1RHHA 4YPGA 1U6AL 3KPQB 4LCWD 4MX7A 1HWGB 1JGEB 4MNHA 4BFIA 4DVRL 5IMOB 3RL1A 3FB7A 1L7TL 1MIML 5A3ID 2WIIB 3OKEB 2BSRA 1MAML 3ME0A 1FVDA 2XRAH 1O0VA 1QKZL 1HHJA 4G6AC 5IR1A 4HC1L 4LHUG 5GGVL 3VGAC 4EUPA 1MQ8A 4X7TA 3WNNA 4QRTB 1VENA 3DETC 1UM5L 2DB8A 1MREH 4HGWB 1MHHB 1P7QB 3DRQA 1VA9A 2GK0B 3P9LA 5M95B 4OLWL 3WD5L 5CEZE 2A73A 3DUSA 1UB5A 5HJ3A 3LKNB 3GIVB 3W11D 1ORSA 2FX8L 1AGFB 1Q9LB 5DQJB 1CFTB 2VDKH 4HQQH 5AG9A 3E3QC 2O5XH 4XGZB 3KDMA 1D6VH 2WLZA 5JIKA 4QTIL 2V5MA 4K9EC 4HKBB 2XKUA 1J0ZA 1QA9A 5FECA 4NRYA 2IBBA 1UJ3B 3ZL4L 3MRJB 2F58L 2B39A 1J8HD 1J1OH 1Q8MA 3FO1B 5T3ZD 1RZIB 2IPKB 2OMNA 3C5ZC 3LB6D 4ZYKB 5KTEL 3OKMA 3D9AL 2FB4L 4M7KH 4LPCA 3WHXA 3BGFC 1OQOA 4JG1L 3BEWA 5JHDE 3QEQD 4NYLA 3FTGA 1KN4L 1QSEA 4HWBL 3MJ9L 2MFNA 4N5UA 4PJCF 1BX2B 2IFGA 3MREA 3O3DB 4NQSA 4OBSA 3MUGB 5J4MA 5ACZB 4ZPTA 1U8LA 3FB5B 3HTLX 3CU1A 4GAYA 1GGBH 1MLCA 3GO1H 5F97E 1OF2A 2YN3A 1AFVL 1FNLA 3VXNB 1CFVL 4OI9A 3TPKA 2C7UA 4ZXBC 3K80A 4KJWC 1HH9B 4N0CD 3V4PL 3OB8A 3EGSB 3IB4A 2VH5H 3BD3A 4HV8B 1KNOB 5E2UL 4OLYH 1FL3B 1M05B 2AK4D 4JJHA 4Q9RH 1ZEAL 1AXTL 3KXFE 3CC5B 3SQOH 5HSFA 3QUMB 4MS8D 3BGAA 3FJTA 2FGWH 1QHOA 2NZ9C 5E00A 2FWOB 3ESUF 3KHOA 1NBYA 3SCMD 1JCKA 1UC6A 3QDJB 4CBPA 2IANE 2CO7B 3L6FB 3T0EA 3HLAA 4Y5YB 3QI9B 3RGVD 3JV4B 2XTJD 1G9MH 4I3RL 3V5HA 1PZ5A 3KS0H 2FJHA 3QUML 1N4XH 5I8CB 5IMLA 1MJUH 1OY3B 1H3PL 5T1MB 4PJ7F 3TM6A 1JNHA 2Y07L 2P5EE 4WI4A 3VFTB 4DAGH 4MDJB 1RJYB 4ODUB 4JQVC 1SJVA 3DO7A 1X7QA 1DFBH 1TFHA 4X98A 4YBQD 1TCRA 1KPRA 2ZUXA 4JKPL 3FCTA 4GKNB 1WF5A 1U8PB 3O2DA 5E6ID 1X3DA 3RUGA 4AG4L 5C70A 1OGAE 3QDME 4Y88A 5ANME 4HIIB 2GHWB 1G0XA 1RZGA 3IDUA 2V2XA 1MRCH 4NDMB 5IB5A 1DQJA 5J6GA 1U8QB 1CGSL 4UNVA 4OI8A 1WV7T 4JY4A 4ZOBA 3T4AB 1CXFA 1YEDA 1L0QA 3GMPA 3NCYP 1UKQA 4EOWH 4ETQB 1B0RB 4Z78A 5INCA 3DXAA 3PGDB 3TWCH 2XIDA 3AM8A 5IB3A 1YECL 12E8L 1E0OB 4LASH 4PYHA 2IADA 3UDWC 4QHLB 5C0CA 1QR1B 5D7JC 4WUUB 5FYKL 4KTDH 1QFUL 2PXYD 5C08D 4P3WA 4G9FD 4TPRL 5CAYB 1C5BL 4HJ0D 5B39A 4OCYL 2NW2B 4YDJA 3C87A 3LEYH 2W0KA 2UWEB 2G9HB 2FECL 4XPHH 4DFHA 3I6KB 5IBUB 4MCZA 5GSVB 4Z95H 3RL2B 4XCCL 4Z7VA 1KV3A 3FAWA 1X5YA 1T1YB 4R7DA 1J0YA 2AJXH 1L6ZA 3D39D 3MZTA 1A7OL 3WIFB 1NSNH 3IF1B 4OZ4B 3RWDA 1C12B 1ZLSH 1TZHA 4LARL 1BQLH 4LP4A 1R3LA 3MLWL 3ORJA 4Y19D 4DKEH 5JZ7C 2R9HC 2RGSA 2VXTL 3PWJB 1PSKL 2AEPL 4UTBL 2HT2C 3OXSA 2HRPL 4F7MB 3GSUB 3SDAA 4Y7MA 4GS7B 3B2UD 2J88L 5DEGA 4XI5D 4QHUB 4Y89A 3F12B 3P0VH 5J0BA 2WWKT 3NCYS 1HXMB 5JORA 1CDHA 1YEFL 4X6FA 5IGXL 3DGGB 5H94A 2W60A 1T6VN 2FX7H 5I18H 2H26A 4N0UE 5D70H 2PW1A 4JFYB 1CFSA 4P2QA 2R56L 2EE2A 4QOKA 4N8PA 1XF5A 3JTSB 1E4XL 1OP5H 5GS0L 1JYWA 3TFKD 4IRJD 3MRRB 2FH6A 3RZCD 1JNNL 1B6DA 4JEGB 3NH7L 4Y1AE 5J11B 4I9WE 3IKKA 3U30C 4N8VB 1X4ZA 3DPBA 1OSPH 2YEZB 3TNNB 3HE6B 4JB9H 4XMLH 3RU8H 3TP4A 5DJ6A 3MJ8B 4ZFZA 1FBIL 3MBEC 3RVXC 1RUMH 4HKZB 3T65A 4OB5L 2A6DA 4HS8L 1GPOH 1MH5A 2AXJA 4OGYL 1OP3H 3GM8A 1MUJA 2E3VA 1T80A 2XXMB 1SJXA 3UAJC 4QLRA 2VXQH 1YY9D 4KVNH 2XNAA 4WFHD 1BQHB 4RNRB 2FSEA 4ZTPL 2V7NA 4UDTA 5IEHB 3H9HA 3TH4T 1M7IA 2A6IB 4QEGA 3Q6GH 1L7TH 4M1CD 4MAUH 1MIMH 4KROD 4JFDE 4FQJL 5I71B 3QUZA 1QKZH 3BXNB 3ESVF 3EYFA 1CICB 4RISH 5DYOA 5C9KA 4G80B 4AL8H 4F9PC 4LCWB 4WWKC 4U1LA 4PJEA 5TQ2L 3DRTA 3CFCL 1P5UA 1ERNA 4M8QB 1PKQE 2KQNA 1HQRA 4RFOL 1X5JA 3WD5H 4ODWA 1A02N 4GW4A 4I4WB 5C9JB 4O5LL 3Q0HA 3TLRA 3CJJA 1A7PH 4MA8H 5IW6B 1QHPA 3LZFH 4UDUB 4R2GD 1YNTB 1HHKA 1KC5L 2C4FU 4QTIH 4Z76A 4AEHH 3MV9A 5C07A 3L5JA 4ZFFB 4MXWL 5I30H 2XT1B 3RNQB 2DWDA 5CEYB 3ZL4H 2F58H 3G6AA 5JPMA 2DMCA 2AEQL 3DUHA 2DQGL 6FABH 1RZKC 3L3HA 1NFIA 5KTEH 3ARGA 3FKUS 1D5MA 4F8TA 2X4NA 3CMOL 2FB4H 1VERA 2B1HL 2LE9A 4QNPF 1CL7I 2QV2A 1IGTB 4GT7A 4OSUL 1ZHBA 4TQEL 5DFVD 3SE8H 4PTTB 1KN4H 2NTFB 4N1CA 3HAEA 1F90H 4NHCL 3RX7A 2VDQL 3MJ9H 1IT9L 3M17B 3IRZA 1J8HB 1FGNL 15C8L 4G6FB 3OPZL 1XCQB 2OR8A 2OS7A 5CJXC 1LO3L 1U91B 3A0OA 3V6FA 5FHBL 1NANI 1IC1A 2DYPD 1I1YA 1FG2B 3OV6A 4QWWC 1ZHLB 5CP3H 3QEQB 2Z92B 5JUEL 1INEH 5ERWB 1YN6A 4PG9A 5KS9F 3ZHKA 1PYWA 4JGJA 4MAYD 5T3ZL 5E2UH 3WCYA 5C0AD 1EHLH 1WZLA 1XIWA 4X80L 4LF3B 3L3OB 2VITB 3MR9B 4MLSA 5CHNB 3MRCA 4UTAL 4UT6L 1CVSC 1UYWL 2ZP0T 4PJ9D 4FNLL 1RUAL 3BO8A 1KLGB 1NCDH 1RK1A 1H3XA 2AK1L 3VFRA 1NC2D 1AY1L 5DUBA 3VFVB 4B50A 4QO1A 2AK4B 2P8MA 4I13B 4PJCA 4S2SB 2HN7A 3EJJX 4TRPL 1LDPH 1ZSDA 2PYED 4UT7L 5HGAB 3KNBB 1BJ1H 4FZ8H 3HFML 4KQ4H 2ATKA 2DBJA 3SCMB 2EDTA 1IAIH 4WI9A 5A2JH 1BOGB 5EU7E 5F7EL 2YZ8A 4JRYE 2XTJB 2F5BH 4LFHD 1ZXQA 1HN1A 5MHSD 4UQ3A 4HWZA 5CWSB 4G7YL 5F3HB 5FA4B 1AIFA 4XHJD 1I8MA 5HGHB 3QCVL 3K1KC 1JVKA 1KCVH 4WW2B 3VFWA 4Z7OE 5D2NE 5ICXB 3WS3B 4PGBA 2XV6B 3ROOB 4JRXE 3RVVC 4JQXC 4ZUTA 5MENA 5FCUL 2CGRH 2XZCL 5E6IB 3EO0B 3I3EA 5SX5H 5CBEA 4K94C 3O45A 1FZJA 1ZTXH 4C56D 4LDOB 2P44B 3JWDL 3Q48A 2F9BT 3Q5TA 4PJ7A 5FKPA 3OJ2C 3ARRA 1A9EB 4PJFE 5ESVA 1C5BH 3MLZL 3BAEL 5EORL 4H26A 3E6FA 4CMMA 5FO9B 4XBGA 3R4DA 4OFPA 1A47A 1SY6L 1NBQA 3C6LA 4EBQH 2HKHL 3CAFA 1B4JL 1GOHA 3OAUH 4Y4KD 2H32B 4FN0A 2IH1B 2KZ1B 3P4NB 4KUCD 4XCCH 3TYGH 1K6QL 2PXYB 5C08B 4G9FB 3PXJA 1QVOA 1YMMA 3B5HA 4LU5H 5EU6A 1A7OH 2HYMA 3MV7E 4RAVB 1PG7H 4X9HA 1YEGH 5K9OA 4PJHF 4LARH 1BVKB 5DJ2B 5ELIA 3UTTA 2N4IA 3QCTH 2ZUUA 4PJDB 1I7ZA 1A7QL 3OKOB 5J12C 4F80A 1IGJB 2AEPH 1MCOH 1JFQL 2J88H 1G9NC 1B6UA 4UV7L 1XGYH 4RGND 2PUQT 2DQDL 4Y5YC 1NCWH 1T1XA 3QI9C 3JVGC 1F58H 3QDGA 5IFJB 3MTRA 4QF1A 4Y16A 1G7MA 3D39E 4S1SL 3IU4L 1IEAB 1YEFH 2VE6B 4Y19B 5IG7B 5IGXH 3QZWB 3ET9F 4NM8H 2ZUQB 2GCYB 3V6BR 4NQDA 5HDBE 2OTWB 3MROA 3I3BA 1I1RA 3PUCA 2R56H 3MCLH 3F58H 5DRNB 1LO0L 3REWA 4N9GA 5GS0H 3W0WE 2I07B 3CX2A 3P11L 1JNNH 2VTFA 1OM3L 4DWHA 4X6DB 3ZO0A 3H42H 1HINL 4BFEA 5LWYH 1FBIH 4FXGB 4JZJA 2EDNA 5FUCE 4OGYH 2P8PB 3IDNA 5DK2A 1G6VK 4IRJB 25C8L 3RZCB 3ZE1E 1R24B 4OJFL 4OLUL 4OCLC 3MRBA 4OLEA 5MI0C 2ITCB 3PWVB 4S1QL 1D5ZA 2X1OA 5E2WL 4WIQA 1HHIA 1N0XL 4ZTPH 1QFWM 2VZ3A 3TV3H 1PG7W 1H5BA 2BNRA 4PJ5A 2OZ4L 3VGGA 4X6CF 1M71B 1MNUL 4FQJH 5ID1B 2CD0A 3HHRB 3F7YB 4Z7WE 3MJ6A 4GMTL 4L8DB 2H2SC 1UXSA 1VACA 5GPRA 5DC9B 1U58A 5F7DB 5HYSA 3CFCH 4X5WA 4ZUUA 4MA1B 4KROB 5I6XB 3O3AB 3IYLW 4HUXA 3PGFH 3IJSB 5HI3D 3GHBH 3HPJA 4LAJH 5GRUH 4CW1B 1KC5H 3QA3A 5KSBF 4KK8D 5IBUG 3H2WA 3BZ4B 1F2XK 3PWPE 5ISZA 3M45A 4GFTB 1F5WA 4MVBC 4D0DA 3VFOB 1CE1L 3G6JE 4MXWH 4G8EB 3HZYB 4QXGH 4MD4A 2GSGA 5T1KA 1HSBB 2DLGA 4RAHA 1QSED 3TJHC 1YEJL 4PRBB 2P49B 2CDEB 4ODSH 1T20A 4P4KC 3RA7H 4R2GB 3EDDA 1OSZA 2B1AH 3F65A 2BRQA 2F54E 3KPOB 1ZS8A 5MEPA 3U36A 5FFLA 1IAMA 5IVZB 2ORBL 3O6FC 4OI7A 5EC2A 2BVUA 1BZ9B 5BJTA 4K23H 2A6KA 3KR3H 1H9VA 1QBAA 2OYPA 2E7BA 3KJ4B 1BVLB 4NHCH 3QIBC 4XVTL 3L5XH 1WZMA 2MJWA 2NYYC 1IT9H 1CS6A 1HQ4A 1JPGA 4KK5C 1VKXB 2XWTA 1W0WB 15C8H 1URLA 1K5NA 1FRGL 2GJZB 4PGCA 1LO3H 1QFOA 3MRKB 3T2PA 4MSWB 3EJZD 3SKJH 3VH8G 1SQ2N 4NGHH 3PL6B 3ZSSA 1RUPL 3HE6C 1EHXA 2M26A 3CSYA 1T04B 4MXVE 4TUKH 4PRNA 4ZUWA 2HKFL 2YKLL 1CQYA 4W4OC 1P1ZA 3BD5A 4X4ZA 1YNLH 4LBEA 1TTUA 1CFNB 2EDXA 4X80H 1RFDH 3L7EB 3CDYA 4M62L 2EKSA 4R3SA 1QLEL 3WN5A 1N7MH 2OSLB 4N8VG 2DYPB 1IVLA 4UT6H 1S7TA 3W5MA 2ARJQ 4ISVA 2ZKHH 3O4OC 1EERB 5GJSH 4ZFOA 1HK6A 4MAYB 2VLMD 2IPUK 3EYVA 2F19L 5C0AB 3KYMA 1R0AL 1FORH 1S78C 1KIQB 3E6HB 1G7LB 1U8NA 4TN9A 1KTRL 4TRPH 1TJHL 5FXCH 5J7CC 1EO7A 3AREB 2HVKB 1BQHG 2IPTL 4TYUA 3GHEL 4UT7H 5F6HI 3ULVF 5F1IA 2BVPA 3FQTB 4YR6B 3BRDA 4KDWA 4NC0B 2Y7QA 3BJ91 1EAJA 2EC8A 3RWHB 3WUWB 4PJ9B 5A3IC 2BFVL 2DQEH 1PX4A 2ICWA 3MLXL 4URTB 4MHHI 2ZOKB 4CADA 5KS9A 1DP0A 1K3ZA 4G7YH 4I77L 1NAKL 2ZSVB 3BP5B 4CNIB 4DVBA 5ALBL 1WC7A 5JW5B 3DXAD 2PYEB 3GMQB 1MLBB 3D25B 2FEEI 3GJEB 4NQEE 5F8QC 4ZSOA 1R3JB 5JOPD 3AS0A 5CSBA 5C0CD 1LP9E 1JZ2A 4EI6B 1Z5LA 4GKZA 3FHQA 3PV7A 4U4BA 1D7FA 1IGIL 4NNXA 4CMHC 2GUOA 2COQA 4CUCA 5DQ9A 3LQZB 5C8JA 3K74B 5GGTH 5I66A 3RIFF 4EEEA 1EHNA 2I5YH 3QNXA 1INQA 3K81A 3ZDYF 3V4UL 3NFSL 2JCCF 3Q6FA 4HT1L 1UZ6E 4L3CA 4OZHB 4K3GA 4JKLA 2X4OA 2GK2A 3L3IB 1JGUL 5GRWA 5CFHA 1SY6H 2VSDA 3VA6A 1T1ZB 4IIQB 4J8RA 4C56B 5L9DL 4CVXA 1G7PA 3L3GA 3MMEB 4RA3A 5I16B 3CFIC 1TPXC 2E7MA 1KB5H 3GSQB 4LRNL 4KRPD 4ALAL 3MRLB 1PX3A 1ZK9A 3SDAD 3DTXB 5I1LA 3CFJA 1IGML 1Q1JL 2BVOB 1T03L 2OQJB 3D3VE 5ITFB 2AV7B 1Y18B 4K71B 1JYXA 1Q0YH 1G7QA 3K7UA 2SEBA 4Y4KB 5H8DA 4WI6A 3I75A 5IEKB 4U1JB 5C0JB 5ABDE 5ITBL 1CLYL 1HEZA 2DQDH 4P2QD 1C5DB 1DQLL 4N0CC 1CXIA 1WZ1L 2B8OT 1DSFH 4QOKD 3IU4H 1D6EB 4MQ7B 3U4EA 5KVFL 3TCLA 2VN4A 2FJGA 5D4QA 4LHQB 2ESVA 2B5IC 4HK3N 3BHBB 1KJ2B 2BSSA 1PZUB 3N85L 4MS8C 2VIRB 3MLTB 5D2LE 1YEIL 1NMCB 4RGNB 1FFOB 5I1HH 5EU7C 1YMHA 1G1YA 1LE5A 2EDFA 1S7WB 2AI0L 3RGVC 4QXUL 2XTJC 3V5DA 2AKRB 2DIAA 2W1NA 5JMRA 1T0MB 4GW5A 1KJ2L 1UXWA 3PQYA 4KV5E 4MB3A 1JPFA 2X7LA 1N8ZB 3GSVB 3X13A 2F53A 4WW2C 3GSOA 4P57B 4YIQA 1IGFL 1HCFX 3O2VH 4RDQG 3MRIB 4NKDA 2ICEA 3SE3C 6CGTA 1T2QL 1FC2D 5CMAB 4YBQC 4JREC 4H5SA 1AXSB 2CLRA 5E6IC 5KAQG 3BZDA 2JIXA 2AQ2A 2VNCA 4OLUH 4JFQA 5BW7C 4FQXA 1QOKA 4UQ2A 4S1QH 5E2WH 3QUZD 3H7BA 3U2SB 3GGWA 5EUKA 4OF6A 1ETZA 5JDSA 3WIHA 1DN0B 4U6XB 5IBLD 2EIEA 5B3JE 3G04B 1RHHB 2OZ4H 4HMEA 4YPGB 5DMKA 5J1TC 3ZHDA 4LKCA 4MX7B 3SGDH 5TE4H 3HI6H 4MNHB 1MNUH 4YGVA 4GG6A 4BFIB 5T3XD 1XAUA 1DBKL 3FB7B 4GMTH 2AERT 3QHFL 4S11A 4WV1A 4ESKA 2BSRB 2QKIB 1IAOA 1FVDB 5IR1B 2GJJA 1HHJB 1JI1A 5GRJH 1L7IH 3A6CL 3U9PH 4OZGE 4X7TB 5F7NC 1FIGH 4G6KL 3V6ZA 1AXIB 1BWWA 5B8CA 3MFGB 2CKBB 3MV9D 5BVPL 4FQIL 5DRZA 5C07D 2A73B 3DUSB 1UB5B 5HJ3B 3QG7L 1NMBL 4BZ2L 1J1PL 1MIEH 2VJXA 1KGCD 1ORSB 4HFUH 5BOPA 5F7MC 4V1DE 4LLQA 5JIHA 1A7NL 3KDMB 2CKBL 3ARGD 4WI5A 2ED9A 5F89A 4QRPE 3GMNA 1JGVL 3VGHA 1HI6A 4HUNB 1WIOA 1YEJH 1QA9B 4NRYB 4CAGA 5JXAL 4YAQA 2CK2A 2ZUQC 3HUJF 1V7ML 4U1HA 3BH9A 3IAPA 3RNKA 1MFEL 3VWKA 5T5FH 4JR9L 4OGZA 1F6AA 3OKMB 4PGEA 3B2UC 4HHAA 4XI5C 3QDHA 3WHXB 1CDJA 1QBLH 3BEWB 1OTSD 4FFZH 3QRGH 3FTGB 4NYLB 3P77A 1QSEB 1FRGH 3QZWG 3MREB 2AJUH 1XIWD 1WGOA 2G60H 5KSBA 1VGKA 5FUCC 4ZPTB 1U8LB 3CK0L 4GAYB 4RMTA 1MHEA 4XPFL 3SOBL 1MLCB 5LQBH 4BUHA 2YKLH 3DHJA 4NOFA 3TFKC 2C7UB 4IRJC 3RZCC 4OT1L 1N6VA 1EBPA 4PUBL 2R0LL 3HZMB 2HP4A 5IHUL 5C0RH 2HMID 2Q7YA 1EBAA 2P45B 5DD1H 3QEHA 1AP2A 1P6FA 1HCVA 2AJZA 5SX4H 5E00B 4I5BA 4QRRE 1F45A 1WAAA 7FABH 5FUOH 3T0EB 3HLAB 9CGTA 2W9LA 3ZDZF 2B4CH 3V5HB 5I1AA 1YY9C 5GGSA 1PZ5B 3REVA 1KBGL 2QSTA 2IPTH 5IMLB 2AAVA 3QEGL 4PREA 1JNHB 2EDJA 3R06A 5KVGL 4LAQL 4M1CC 4KROC 3V7AG 2BFVH 5IESL 1QFWH 4QHKI 3DO7B 1S3KH 1Q72H 1X7QB 4X98B 2ADFL 4KWUA 5HHMD 5T1LA 5MEND 1TCRB 1KPRB 3BESR 1T5WA 3FCTB 5L2JA 3RUGB 5JR1H 4G9DA 3DHMA 3T0DA 1JWSA 1RZGB 2V2XB 3IXTA 1ZA3A 5D1QA 5IB5B 1DQJB 1NGZA 1NH6A 1PLGL 3JWOH 5J6GB 3IXAA 3S34H 5LGKA 4PB9L 1P69B 4JY4B 1IGIH 1YEDB 3GMPB 3O2DL 1YJDC 1IGYA 1IC5H 2WK2A 4KJQD 2R0ZH 4Z78B 5INCB 3WFBL 3GSNA 3DXAB 5IB3B 4RRPG 3C6LD 4U1SA 3OKKA 5D1ZA 4HT1H 4ZOAA 4MNQA 4QXTA 2VR9A 2IADB 1H8SA 5I1IL 2Y72A 5C0CB 4DKDC 2EDWA 3KJ4C 5AAWA 5JW3L 3GB7A 4WI7A 4KI5D 4QGTA 5DFWH 4NUGL 5FA3A 1PJ9A 1YMMD 1UWGH 5EU6D 5B39B 4YDJB 4NJ9H 4HK0A 2J8UF 2LFGA 4TNWF 2ZCLL 1S7VA 3UTTD 3BX7C 4PRHA 1II4E 3JUZA 5CILH 3HPLA 4MCZB 5DFVC 4H8WH 4Z7VB 5D7KD 2ZCKH 4RMRA 1MCPH 1QP1A 4D0BA 3O0RL 3QUKA 3VFMA 4R7DB 2NY1D 1SBSH 4P99A 1T03H 1MCBA 2R0WL 3QDGD 3RWDB 2DQIH 4Y16D 1NDMA 1TZHB 3PNWA 1FO0A 1R3LB 4JFXA 5ESAA 4N0RA 1WWWX 1NGPL 1NEZA 3SE4A 1YEKH 4NQDD 4NWTL 2PW2A 3OXSB 4KRPB 3SDAB 1OAQH 4L4VE 1MFCH 2JCCA 5C7XL 3AS2A 4K7FA 2ATPA 5DEGB 5BMFL 1U8KA 2XWJA 3HNSH 1NKOA 2FL5A 3FT2A 4R4ND 4KC3B 5L6YL 4P9ML 5TF1L 5JORB 1AGEA 4X6FB 5CGMA 1ZV5A 5H94B 4L29A 2W60B 3EOAA 3U1SL 3HCVA 3VDAA 2H26B 2WM0A 4PJBF 2PW1B 1CFSB 4EIZC 4FG6D 4LPVA 4OGAD 2FO4A 4PJ9C 2AI0H 3IJHA 4LLYA 4QXUH 4P2QE 1EGJL 3ZT7A 4QOKB 3AB0B 3SDYH 1XF5B 2OJZH 4BSJA 2HLFD 4HUWA 4Y5XA 3OF6A 2PKDA 3VGDA 1F4WL 2EDBA 4P2RA 3DX6A 1VFAB 4M7LT 5A1AA 1IGFH 2YXFA 4D9RD 1ONQA 2BMKA 3TNMA 5DJ6B 2DI8A 4ZFZB 4WNQA 1IC4L 3BDYH 2BNRD 4PJ5D 1BJ8A 5KW9L 3T65B 4JJ5A 1P4BH 1MH5B 3RIFK 2D7TL 2ZJSH 5J9PA 1MUJB 1CGXA 3WXVL 1JZ5A 4KKBD 4XHJC 3Q3GB 3SGJC 4L5FH 4WHCA 4OLXH 1GIGL 1K85A 3S3SA 2XNAB 4WHDA 3TA3C 3MRQA 2FSEB 2V7NB 4M7LL 2ERJB 4UDTB 5J13B 3H9HB 1EAPA 3SJVA 3QUXB 3GMMA 2DLIA 2E5EA 3EOBA 4YHIA 1SJEA 3CXDL 4DN4H 2EIBA 3QUZB 1NUNB 3NCMA 3VXOA 2VISA 1LO5A 1V7NH 3JZ7A 3EYFB 3A6CH 5DYOB 1EPFA 2MTPA 2NX5A 2Y06L 4J1UA 3HE7A 1E4JA 4ORZC 1D3CA 2FD6L 1UENA 3ZYZA 4U1LB 4PJEB 3DRTB 5ISZD 4BK4A 4Y5VA 4ZNEE 5BVPH 4Y2DA 1A64A 1HQRB 2VABA 4ODWB 5I1EL 4R4FL 1G9MC 4X4MA 4JFFA 1SYVA 4XBPA 1KN2H 1J1PH 4BZ2H 5T1KD 3PG2A 1HH6A 3UPAA 5HI5D 4K71C 2VQ1A 4P4RB 1ITBB 1OOAA 4Y4KC 2UVEA 1A7NH 4X7SL 1HHKB 4AEEA 1B88A 1P84K 2CKBH 4YHZL 2VXUH 4P46A 2L7UA 3O6ML 5T3XL 4K55A 5BRZA 3P30H 2Z91A 1JGVH 4Z76B 1LNUA 3C60B 1OLLA 4M4RA 3MV9B 3LVEA 5C07B 5A43C 1UT9A 3I02A 1D9KC 2B20A 4FQCL 2DWDB 5BVJA 1A6VL 5JPMB 3IFNH 2C4XA 1V7MH 4NO2A 3IU3A 3L3HB 1NFIB 4JR9H 2VUOA 3ARGB 5MP6L 1D5MB 2CDFA 3B83A 2X4NB 3FO9A 1NMCC 4RGNC 4XP5L 4BJLA 2W9EH 4W6YB 5HHVL 1ZHBB 5EOCL 1CQKA 3KPRA 4MYWB 4XNZB 3RBSA 4PJGF 1MJ8L 3HAEB 4FMFA 2CR6A 1JI2A 4L8BA 1XT5A 2P47B 1YPZF 2YK1L 3RAJL 3H9SA 4P3DA 1BAFH 1FJ1B 3V6FB 4NWUL 5FV1L 1I1YB 2E6QA 5C0ND 3CX5K 1FCCA 3WFDH 3WDHA 1JNLL 4EDXA 1NFKA 1B4RA 1QEWB 4E41E 4OT1H 1DLFL 1YN6B 5F7FA 1G7JA 1PYWB 4PUBH 2R0LH 3BKCL 4HUMB 1K3IA 4M9OA 1XIWB 2A1WH 1AC0A 3V5KA 2BNQA 3QNZA 3VJ6A 3WKNA 4MQTB 2CO6B 3MRCB 5F1OB 3UO1H 4NM4L 4D2NA 4CJ0A 3IDXL 2BK8A 1DR9A 4PY8J 4M93B 5KOMC 2I25N 3BO8B 3MOQA 3FL7A 1RK1B 1NBVH 3KJ6H 3VFRB 5DUBB 4GXVL 1A7RL 4DKFL 2R23A 1OP9A 2BDNL 1KBGH 4NQCA 2P8MB 4ZDHA 2H6PA 4NZUL 3U7WH 4PJCB 3K2MC 4OGXL 1UZ8A 2HN7B 3SE9L 5FGBC 4NPYA 3DYPA 4OF0A 1ZSDB 2F74A 2NY7L 2WMPA 2ICES 1CD0A 4NNYA 2ATKB 5K33A 3SDCA 3OG4B 3NMEA 4XP4L 3ZMRA 4WO4C 2NY5H 5EZLA 1HSAA 1MCDA 2WQRA 4UQ3B 4HWZB 1Y6NR 2JJWA 4MMZC 1AIFB 1A5FL 1I8MB 3EOTL 4Z0BH 2XZZA 3OB0K 3C5JA 1FQ9C 3VFWB 4PB9H 5HHOE 1L4IA 3FO0L 4ZO8A 4PGBB 5D7LE 3CXHK 2VL5A 2W07A 3O2DH 3NZHH 3HNTH 4ZUTB 5MENB 3MV8E 4P5KA 2Q3AA 4MD5A 1RY7B 5HHME 1MJJA 4KK8C 3WFBH 4YLQT 2NXYD 3WIIL 5CBEB 3O45B 4JO1L 1FZJB 1KG0A 3HG1A 3HRZA 5E2JA 3GJFK 3QYCA 1EXUA 1EJOH 2EKJA 4PJ7B 5JW3H 4UUJA 2Y6SD 1EZVY 5D7SL 5FKPB 4D3CL 5IW1A 3DV6A 4JHAL 3S36H 5ESVB 3AC0A 4U3HA 4H26B 1C1EL 1KIUA 3E6FB 2HT3D 4C54A 4XBGB 4WENB 2CLZA 3QFDA 1EK3A 3A6BH 1ZMYA 4JKKA 2BCKA 2YUVA 3C6LB 4PJXA 4RIRA 5HVHB 1J05A 4O02L 3O0RH 5GS3A 1NFDA 3BP4B 1QVOB 1YMMB 1FYTA 5EU6B 1T7YA 2EDEA 4OM0L 1CBVL 3MFFA 5DVKA 5K9OB 3EJZC 3UTTB 2EE3A 3MRHA 1I7ZB 3FN0L 1NGPH 3NBNA 3SDXA 4MJ5A 3BT2H 4WRLA 5F1NB 4OQTH 4Z5RA 4CDHA 4DJMA 2DQFA 4PRPB 5TE7H 1SYSA 3Q2CA 1Z9SA 5GISL 4W70A 2NY1B 3WO3B 4XVSL 4RX4A 4YUEH 1T1XB 3QDGB 4GLRI 4QF1B 3LS4L 1G7MB 4Y16B 1L0YA 5GZOD 2NNAA 4XCNB 3DYOA 2Y1VA 2KKQA 1J0IA 1JK8A 3U1SH 3PQYD 2J8UA 3B3IA 4XBEL 2ADGA 1VGEL 5ICZA 3Q1SL 4NQDB 3M8OH 4OCWH 3MXWH 3IS1X 4B0MM 3MROB 2HWZL 4F3FA 2R69H 1EGJH 3W2DL 3VI3E 1FNSL 2CXKA 4WFGD 3REWB 2GKIA 4N9GB 2NLJA 1O5DT 5DD5L 4Z77A 1CYGA 5JW4N 3I50H 2AXGB 2PO6C 1CDYA 3NPZB 4FQXD 1BVZA 5C6TL 4O2EA 3MACL 5IM7A 5I73B 1FGVL 4PG2A 1IC4H 4JZJB 2R29H 1AO7D 1WBXA 5ECJE 4S0TD 1F2QA 5BV7L 2X2YA 3ARQA 5GGVY 3DV4A 5DD3H 1A1MA 3IDNB 1N5YH 3MA9L 4LIQL 4P59L 4WEBL 3MRBB 2FX9L 4JFEE 5FYLL 2X4SA 3AM8C 1GIGH 1W72A 2NY6D 4J3OC 1D5ZB 4WY7L 3LQAL 4D9RE 5DI8A 5EDXA 1H5BB 2BNRB 3B5GA 4OD1L 4PJ5B 4XNYL 5KVDL 1A6ZA 3ZTJH 2ILLA 4Y4HA 1OGTA 4TNWK 3CXDH 4OLZL 5FYJH 4MCYA 3T77A 1UXSB 2QLVB 1VACB 2UZYB 2J6EH 4K8RH 5HYJA 1U58B 2ZUWA 3ILPA 5HYSB 4X5WB 2CRYA 4ZUUB 1XEDA 2F8OA 2A9NL 4X7DC 2VDOL 1YYML 2BSED 1T7XA 2VLKE 2XQBH 4NZJA 5B39G 5AAMA 2NCMA 3DYMA 5F9DC 5D5ME 1B2WL 2DJ4A 3HPJB 4F7CA 2Z0BA 4X7SH 3QA3B 4AZ8A 4NJAL 3RDTC 4PGZA 4R97B 3VWKD 1P7HL 4KRPC 5I0DA 5ISZB 4Z6AT 4D0DB 5ISZE 1UVQA 4YE4L 4MD4B 3IS0X 3I9GH 2GSGB 1A6VH 5T1KB 4HXAH 4HF5H 3HS0A 1CL7H 1T20B 1NCCL 5IMKA 1OSZB 5EBMA 5HGDA 3L5WA 2VLRA 3LKSA 5MEPB 1ZS8B 1FFNA 3U36B 5ID0B 2VDRH 1ZGLM 5EC2B 5BJTB 4WU7A 1CGVA 2A6KB 2OK0L 3D2UA 4DN3H 4YDIL 3QQ3A 3QCUL 3FFCA 1JPGB 1HQ4B 1NANH 5C09B 1T89A 1FFPA 2XWTB 4TULL 1K5NB 5E6ZA 1FZKA 3RAJH 4PGCB 4WDIB 5FHAL 3PDDA 4YZFE 4HG4J 4WW1A 1I7UA 4PV9A 4TSAH 3CSYB 5SWQA 1XF1A 4FTVA 3UMTA 4PRNB 1VCAA 4O2CA 4ZUWB 1WFOA 4ZFGL 3WJLA 4HH8A 1P1ZB 3HMXA 2D7PA 5FOJA 4LBEB 1DEEA 4QRUA 4ZODA 1VSCA 1BMGA 3LQMA 2EKSB 4R3SB 2CK0L 1U3ZA 2O26U 4TVPD 3WN5B 4H1LA 2ERJC 1S7TB 1IM9A 4J6RH 4NM4H 3IDXH 4ISVB 1HZHL 5DO2C 2YUWA 1BFTA 5HPMA 1DZBA 4ZFOB 2VB5A 4WFED 4M6NH 4R6UA 3SKUD 4YXKH 3EYVB 5AYUL 3KYMB 4HX1A 1A7RH 1X5KA 2BDNH 5T1LD 4PYGA 4MDIA 2B0SL 4IEFB 3SE9H 5IBLC 2Q86A 4HJGA 4YGAB 4LCCC 2NY7H 3DX8A 3VRJA 5F1IB 2BVPB 4KRMB 1RULL 4ZFOL 4HULB 5D1QD 5GGRA 4RZCA 4MZ3A 2CJUL 2Q76A 4XPAL 1KCRL 2ICWB 4WTZG 2D03L 2D7QA 2PTUA 4NRXA 4JO2L 5KS9B 4CADB 2FEEL 4Z7UE 4ZQKA 4JPVL 5DGQA 3VGFA 5H2BA 2ZPKH 4U05A 4DVBB 1T22A 2A74A 3EOTH 1WC7B 5D1ZD 4MNQD 4ZSOB 2APXA 1EX0A 3TF7C 2QQKL 1Z5LB 4GKZB 4R90H 4HIHA 4O9HH 4TNVF 4NNXB 2GUOB 5LGHH 5L7XH 5F1SA 5DQ9B 5C8JB 3WIIH 5I66B 3VE0A 5HD8C 2WZPD 3GRWL 3QNXB 5BS0E 1INQB 3KPPA 4PRHD 4XCYB 2JELH 3TBTA 3TT3H 3Q6FB 1S5IH 2FJFA 1D5XA 4OCRL 3K2UH 4JHAH 3LV3A 2VXSH 4XCFH 1QRNE 4PR5A 2C3VA 2X4OB 2ITDA 5I0ZA 3CLFL 2N7AA 3G5YA 2ED7A 3GKWL 3STZA 2Z31A 3TCXA 4JZOA 5F1KC 3KYNA 1MI5B 2PR4L 4J8RB 4CVXB 1G7PB 3L3GB 1X5FA 2D4FA 1OTSC 2D31A 4I0CC 2DL2A 5I1LB 5F72S 1CBVH 3CFJB 4NQVA 1ROWA 2L4OA 2PN5A 1VPOL 3UPCA 1XIWC 3MCKA 3NIFF 4WWID 2AS5M 1QD0A 4LVNB 3FN0H 5JHDA 3S35H 5F9JA 5EU4A 1G7QB 1EFXA 2SEBB 4LSTL 3D18A 2YD9A 1SVZA 4HS6A 2QR0A 3I75B 5KANI 1DANU 1YUHB 1LK3H 3AAZB 1HEZB 3BYYA 4M93C 3HB3C 3P0YH 2OL3H 3O3EA 1AD0A 2WBJA 5IFHH 2NMSA 1NBZA 3U4EB 2HMIC 3BP7A 4OLVL 5AWNH 2FJGB 3J8F7 3OF6D 1MCJA 2ESVB 3QWOA 4ZTOL 1RAMA 3DI3B 4P2RD 2BSSB 4M1DL 5HGGS 3VI4E 4XP1H 2HJLA 4GXUN 1K8IA 3TBSA 1T0NA 1JGDA 1U8HA 4IRSA 5DC4B 5IBTH 4Q58C 3KXFA 1DUYB 1LE5B 4Z7OF 4S1DD 1XZ0A 5DD5H 3V5DB 4WW2F 3OAZH 2G2RA 3P9WB 4GW5B 4OCSL 5C6TH 1UXWB 3PQYB 3PHQA 1CU4L 4PJHB 1JPFB 2X7LB 5SV4A 2IANA 3IAQA 3EIFA 5D8JL 3X13B 1FGVH 4HLZH 1Z3GH 2MKWA 1JYNA 2F53B 1ND0A 1X5AA 4PS4L 3GSOB 3PWLA 4YIQB 1NCAL 4GJTB 3JVGA 3D85A 1FZOA 2BNUA 5BV7H 4NKDB 2ICEB 3B2VH 5DT1L 1KJMA 4P5TB 1IKNC 4XX1E 4H5SB 4LIQH 3SJVD 4LLVA 2CLRB 2JIXB 4O00A 4WEBH 2FX9H 4JFQB 4NKIL 4PJFF 5EO0B 5FYLH 5TQ0L 4FQXB 5BZDB 5CJ5A 4OZFA 3QIWC 4UQ2B 1RURL 1YDPA 2P1YA 2R4SH 3Q5OA 3H7BB 4G7VL 3WSQH 4D9QD 3GGWB 5EUKB 1ETZB 5JDSB 3HE7D 4XNYH 2P24A 4EZMA 4MGXA 5CS7A 5DMKB 1OGAA 1RVFL 4LKCB 2RR3A 3QDMA 1AO7E 2DTSA 2R1YA 4YGVB 1YY8A 4Y2DD 3TBVA 4NN6B 4GG6E 5FCSH 4JFFD 4WV1B 2E9WA 3MPCA 2NY6B 1IAOB 3C6LC 2GQHA 3LRGA 3MGOA 3WIHL 1BGXH 4LSPL 3EKCA 4KJPD 4W6WB 5EU5A 3V6ZB 2A9NH 3KYKL 2ZUTA 5B8CB 4P46D 3CVHA 4KI5C 2MQCA 3EDEA 3VG9B 5BRZD 1IE5A 2EH7L 3T09A 2VC2H 4OTXH 3KYOA 2W65A 1AD9A 4NJAH 1EFQA 1N5AA 4LLQB 3S37H 2XG4A 4OV6F 1HILA 1MPAL 5F89B 2PCPA 3GMNB 1HI6B 3LSOA 4LNRA 1H15A 1T3FA 4Y16C 3KPRD 3QHZL 4BFGA 1ZA6A 3HMWH 3ETBF 4GQ9H 1F4YL 2I26N 1MJ7H 4YAQB 4JDTL 4U1HB 3BH9B 3VWKB 1NPUA 3RNKB 5T1DH 1F6AB 4M1GH 4BK5A 1TNMA 4JANA 2H3NA 4HHAB 4X6DF 1MF2H 4YDIH 5BXFA 2X4UA 5CKAA 4R4NC 4AMKL 3NCJH 4MJIE 3P77B 4M6AA 3WJJA 3EDFA 3QO0A 5D6CB 3FOMA 4KMLB 3ZE1F 3PIQA 4K8RD 2VUYA 5I73C 4FG6C 5DJDA 2MCPL 4OGAC 1F3JA 1CGUA 5KSBB 3LPWA 2FBJL 4NIKB 5FM5M 3CFDA 3ZDXE 3LQAC 2HLFC 2V5YA 4ZFGH 4DGVL 4M7JL 4UINH 3P3YA 4N0UA 5CIPH 4P4KA 1S9WA 3CZFA 1DQDL 3VGBA 4ONGL 1B0GA 1S9XB 1RIHL 3O6FA 4JVPA 4Z7WF 3I85A 1WUNT 2CK0H 2Q7YB 4NQCD 3V0AC 3EFFA 3VG0H 5E9DE 5EBLA 4C83A 1TQBB 2WINA 2V5SA 3QEHB 1AP2B 4WCYL 2D0FA 3QIBA 5F7KC 2ICWJ 5IHZA 2X1WL 2J1KA 5B21A 4RCAA 4I5BB 4Y1AA 1J5OL 1F13A 5JW4M 1IZKA 4ZG1A 2CSPA 4KU1A 1E4XI 3SDCD 1WAAE 2B2XL 2X9XA 2V5TA 1CDUA 3THMH 1O7SA 4MQXD 2Z4QA 5I1AB 4MB5A 5GGSB 3R1GL 3REVB 3R0NA 5I1JL 2VAJA 2FZ3A 4PREB 1JP5A 2Z8WC 3LEVH 1RULH 4EXPX 3R06B 3MUJA 1MRDH 2RJMA 4XPAH 2Z8SA 4TUJA 2OBGA 3QBTB 3CIQA 4WHTA 4JO2H 5T1LB 1V05A 4H0IA 4YHKH 1R5VA 1T5WB 4TVPL 1WCQA 2XQYK 1JPST 3MXVL 3ZTNH 2XZAH 3W9EA 2Z8RA 3BOVA 4G9DB 1KLUA 2P7TA 4R97C 5DJXA 4C4KT 5L8LB 1F3DH 3HG1D 5DWUL 3PF2A 1SMAA 4XNUH 3IXTB 1ZA3B 5D1QB 3G6DL 1NGZB 3UJTH 4AEIH 3IXAB 5IVNA 3KAAA 1JHKH 1U3YA 5HI5C 5E8DL 4TSCH 5GRXG 3UC0L 1IGYB 3EFDH 4HIXH 5DJCA 1B9ZA 1PKQA 3NCFB 4WI2A 2AJVH 3ZKMC 5DMIH 4NOBA 3X17A 3GSNB 3GRWH 4K3DL 1TITA 4U1SB 2E8YA 3OKKB 1J7VR 4MNQB 1KLFA 4QXTB 2YPLA 3EYOA 4BA8A 4D9LL 3QQ4A 1IQWH 3GB7B 3NOIA 3CLFH 5E08L 5FA3B 1FYTD 1BIIA 3GKWH 1R3HA 3GSNL 1FL6A 4HK0B 4PJIA 5CGTA 2Q8BH 4ERSL 1KPUA 1T2XA 2IPUG 1S7VB 5I9QC 4PRHB 1B3JA 3ULVL 3HPLB 4P2CG 1CR9H 4QRSA 2QL1A 4FQQB 3VD7A 4X5XA 4WUKL 1AE6H 3TZVD 4NCDA 1I75A 2RIKA 4D0BB 1IBGL 2HTLD 3LH2L 4F7PA 2ENSA 3QUKB 3VFMB 2A6JA 3NFNA 4RX4D 1H3VA 1VPOH 2Q7NA 1MEXH 5TFSH 5LCVL 1F11A 1NDMB 2Q3ZA 2LQRA 5L88H 3PNWB 1FO0B 4TSBH 1XGPA 5CD3A 3NA9H 5IB2A 3WN5C 1GGUA 4JFXB 5ESAB 2BC4A 3VXRE 3MSPA 1KELL 5IVOA 3F7PC 2JCCB 4K7FB 2ATPB 2VWEC 2EH8L 2Y5EA 1U8KB 2XWJB 1FLRL 5FB8A 1YEEL 1FO0L 1I9JL 3MLRH 2FL5B 3FT2B 3MLYL 4IRZL 1MAKA 5IHBA 2R9HD 4I18A 1AGEB 4JN1H 4M1DH 5DLML 1JHLH 3CPLA 4L29B 3EOAB 1NLBL 5EZJA 3S5LG 4RAUA 2EE6A 4F58H 3S9DB 1N59A 3IJHB 4LLYB 5IWLC 3R8QA 1WBZA 4HUWB 4U33A 4Y5XB 1LP9F 4DTGH 4OCSH 4HCRA 1CU4H 4P2RB 3WXWH 4M43H 4O58L 1PD6A 4WFFE 3DX6B 1OPGH 4PS4H 1OAKL 4UNUA 1NCAH 1AR2A 1ONQB 2BMKB 3TNMB 5DSCA 3A67H 1C16A 5JW4Q 4WNQB 4TNVK 5DT1H 5ADOL 5CUSH 2WANA 4JJ5B 4KVCH 5J9PB 4Y4HD 1CDIA 1RURH 3GI9L 4YHLL 5ENWA 2Q6WA 5LG1A 3W81A 3C8HA 4U1MA 4JRYA 5HYJD 3TIDA 3RGVA 3MRQB 5CLTA 5LXGH 4JN2A 1EAPB 1RJZA 2VRAA 4M5YH 3SJVB 2ZOLA 3GMMB 3ARFC 2EECA 3EOBB 4YHIB 3U0WH 4OKDA 5D2NA 1SJEB 2NXYC 3DVIA 3VXOB 2BY1A 2VISB 1LO5B 3RPKA 4JRXA 2EO1A 2VLLA 4J1UB 2NX5B 2NY3C 3HE7B 4L4TE 1SM3H 5IQ7L 1YNKH 1JWMA 2Y6SC 4LSQH 3LN5A 3X12A 2DLTA 4XPTH 4Y5VB 5F7UA 4Y2DB 4GAGL 2HT3C 2LU3A 2VABB 4JY6A 1RSFA 5DZLA 2B4CC 4JFFB 1SYVB 4XBPB 3ZKXB 1R3IH 1UWXH 1HH6B 3UTOA 2VQ1B 1J18A 4PJFA 5FM8A 1NLDH 1OWWA 4N9OB 1KT2A 3VW3L 2VLRD 4M6OL 3IDGA 4P46B 1ZANH 2Z91B 1LNUB 5BRZE 3D2UD 2QSCH 5GS1A 1AJ7L 2GTZA 3I02B 3LS5H 3D87B 4Z8FL 2VR4A 4KMTL 5BVJB 4M5ZL 3FFCD 1XCTA 4JY5H 3BEVA 4JDTH 1ACYH 2M1KA 4NO2B 2NY2D 3IU3B 1A2YB 1IGCL 3AFLA 3MV7A 5E2VH 5I2IB 2CDFB 2DI7A 4KV5F 3FO9B 3JWOC 1I3RA 1AKJA 3NVQA 4X83A 5DJ0A 1ZVSA 3LKPA 4M48L 3RY5A 3JSSA 5C86A 1MHPH 4LQFH 5GZOC 4YHOL 3KPRB 4CL7A 3PABA 4QHMA 3UJJH 2EE9A 1RIUL 4AJ0A 4LCYA 4NSKA 2VAAA 4XMKL 4I3SL 3TJEL 1EEUA 2VMFA 4Q9QL 3H9SB 4P3DB 1I9IL 3RI5F 5C0EA 1FH5L 2MCPH 2VZOA 1CXHA 1M7XA 1GL4B 1I7RA 4HUVA 3CLEL 4M7JH 4WHYG 1S5HA 2XN9E 1IM9D 3LKOA 4EDXB 5FK9A 1E28A 1DQDH 4U6TA 3FRPA 1G7JB 3TN0A 2R8SH 4FQXC 5FYJE 1RIHH 3HC4L 5FM5O 5D71L 5DUPH 4RSVA 2R0KH 3B5TA 4K9EL 4H8WC 5AZ2L 1PAMA 3V5KB 3W0WA 3PP3K 4WCYH 2BNQB 5TDPA 3QNZB 5E7BA 3VJ6B 3WKMH 3EO9L 1TZIA 4PB0H 5LKNA 1QSVA 4OZGF 3IGAA 5IUSA 1JF1A 3ULUH 3QWQB 4NN6C 1WZKA 4I0PA 1YQVL 2G5BA 4ZS7L 1N64H 5IVXE 2NY6C 2R23B 3R1GH 4NQCB 1HWHB 4ZDHB 5I1JH 2HJKA 1UZ8B 2Z35A 4NPYB 4X6BA 4PRIE 2F74B 5B8CC 4OFVA 4LHUA 4A6YA 3VG9C 4NNYB 1UH3A 3SDCB 2VDPH 1MCWM 1G6RA 1HSAB 3BGMA 2NY0D 1F6FB 1EJ6A 4JPWH 1KYOJ 4Z7WA 3LKQA 1A6UH 5CEZD 2I60H 3G5XA 5C6WH 4FHBD 5FUZL 3C5JB 3LMJL 4XB8A 1P2CA 3BDBA 3OAYK 5E2TL 5E8DH 2VL5B 1UFUA 3FB8A 4P5KB 5TE6L 2PTTA 4MD5B 3GSRA 1MJJB 2APTA 3NCEB 1NC4A 1FYHB 2DQUH 4YHPA 4L3EE 2Z31D 3VWKC 1BWMA 1KG0B 3HG1B 5F96H 5B4MD 2OTPA 3HRZB 5F9WB 1SJHA 5IIEA 1MWAH 4U1NA 3TBWA 1EXUB 2FH8A 1E27A 5HYEA 4UUJB 1U8MA 3BE1L 3RVVD 5KJRL 5IW1B 4I8DA 2R2CA 5E08H 1HDMA 4GSDH 1JTOA 3H3KA 3PWPA 4YHMH 4KTYA 3G6JA 2CLZB 2YSSA 5I19H 2HTKD 1BD2D 5KZCB 1QNZL 3QFDB 1J11A 2APBA 2QADD 4RIRB 1X5HA 2BCKB 3ULVH 2KH2B 4BH8A 5JHDD 3H3PH 4JO3L 3S6CA 1EFXD 4PJXE 4TVSa 2DQCH 3TO4A 2FATH 4WUKH 3P40A 1LD9A 1J05B 3ARTA 3ALXA 2F54A 1NFDB 3GKZA 5FF6A 2H2PD 1FYTB 1H8OA 4HZAA 3MFFB 2ZWLT 2WBJD 4XNXL 2A0LD 1MVFA 2DQTL 3MRHB 1JZ8A 2IQ9H 3BSZL 2C1OA 4MJ5B 3SDXB 4Z5RB 4KHXH 1SYSB 3ZHLA 4YQXH 1I3GL 2VL4A 3KVQA 1I8KA 1Q9WB 2P4AB 4IRSD 3MRGA 1CDBA 4HKXA 3KXFD 1I9JH 5E5RB 3INUL 2NNAB 4KPHL 5DLMH 5DUMH 1SEQL 1JK8B 2YA0A 4DEPC 4ODHH 2QQNL 2J8UB 1CFQA 1XGQA 2ADGB 5ICZB 2IAND 4KTEL 2J2ZA 2YD1A 5K59E 1TJGL 4F3FB 3D85D 3S3PA 3FQXA 1J1XH 4M03A 3V4VH 2NLJB 4Z77B 4H20L 4GKSA 4NBZB 1CTNA 3ZKSD 4QTHA 1OAKH 2CXGA 4O2EB 5ILTL 1T7VA 5IM7B 5D1QC 4OD2A 3K3QA 5GS2H 3BYTA 1WBXB 3DO3A 1OGAD 1VEPA 3DV4B 1WWCA 3QDMD 1Y0LA 4JHZA 3CUPA 3VMOA 1A1MB 2E7HA 3CH1A 4K7PX 3V8OA 3JUYA 5D96C 5JOEA 4MA3A 3GI9H 5MEQA 2BVYA 2X4SB 1INDH 1TZGL 1W72B 3UZQA 3ZT5A 1BHGA 5D1ZC 3CCHA 3BWAA 2OTUA 5INDA 5C6PB 1KFAH 3AXLA 1XF3A 1NC2A 5DI8B 4FMKA 2DQHH 1A6ZB 1CCZA 4K7PL 4G8IA 1N6QH 3OJMB 4R7NA 2DQJH 4Y4HB 1OGTB 1IM3A 4Z7VF 4NQEA 1W72L 1P9MA 4MCYB 3T77B 2W59A 2VERN 3U30B 1RZJL 2X89A 3LDBB 4ZD3L 3GNMH 4WGWB 5CJQH 4NT6A 5IQ7H 5HYJB 2HFGH 2VZVA 3UP1A 3ILPB 4YWGH 4WI3A 4DW2L 4GH7B 4GAGH 1RMFH 3P4LA 3ZT6A 3BPNB 3OR7A 2RCSH 2DTML 4K3EH 4F7CB 3TA3A 3HI1A 3VW3H 3X3GH 4M6OH 3SE4C 3MOAL 1J87A 4IOSD 4KAQL 2YPVL 4FFWD 4L3AA 4F7TA 1UVQB 2HVJA 4KMTH 4BM7A 1NAMA 4M5ZH 1QUNA 1GZPA 1CLOL 3JV6B 5KN5A 2O5YL 3HS0B 3NFPB 1AC6A 1JV5A 5IMKB 5EBMB 4WWKB 3L5WB 1B0WA 2VLRB 3LKSB 3OKLB 5HGDB 1FFNB 5A16A 2O93L 1CG9A 1QLRA 4DK6A 3D3VA 5CKGA 1DQML 4WU7B 3ARBA 2WUBL 4F57H 4YHOH 3D2UB 5FDWA 4ZNCD 2UUDH 3QQ3B 2DICA 4U6VH 4Y5XC 3FFCB 1JZ4A 4G6JH 4P4KD 1FFPB 4XAWL 1DBBH 3X3FL 1FZKB 2NY2B 4F15B 4Q9QH 1WLHA 4LEXL 4Y8DC 3O6FD 1T7WA 5HDQH 1LEKA 3IETA 5D7IE 3SKOA 4AENA 3FQUA 4OF7A 4WW1B 1ADQL 1I7UB 4PV9B 3WNKA 3CLEH 5SWQB 1D9KA 1FCGA 3QIBD 3GIZH 4FTVB 3UTSE 4A2LA 4S1DC 2NYYD 4O2CB 4UILH 5C0BE 1J0HA 4Y1AD 4I9WD 1BF2A 5D2LA 3VMNA 4EN3C 1DEEB 2QQLH 2MMXA 5D71H 4QRUB 4GG8A 4UOW0 1A14H 1JRHI 4H1LB 1IM9B 3WEXA 5E94A 5DVNA 3TVMD 5I8KH 4MWFA 1RZKL 1A9BA 3HMXL 5CD5D 4JDZA 2GITB 3MBXL 1YYLL 5GJTH 5EIQA 4ZS7H 4HX1B 4LSVL 4PJEF 4UIKL 5AZEL 1DL7H 2H41A 3E8UL 2O5ZH 1P53A 3HE7C 3MGAA 3STLA 4HJGB 2Q86B 1GGIH 3BPLC 3DX8B 4NO0A 3GJFH 3PWNA 4P2OD 3VRJB 5JIPA 3NCBB 5ADPH 4Y2DC 5I1GL 4HZLA 2CKNA 5GGRB 2NY4D 4DQOL 2Q76B 3RX8A 1GC1H 1H0DA 4G6ML 4OD3L 4PV8A 2YD6A 2QEJA 4NRXB 4EDWL 3U4BH 1A3LL 4ZQKB 4KJPC 4F8QA 5H2BB 1GXEA 1G9EA 1T22B 2A74B 2DIBA 2P5WA 3GBML 4NRZA 4P46C 4Q6IC 5FUZH 3DUUA 3LMJH 3NABL 3JTTA 4X4YA 2ZUVA 4AH2A 4CU7A 2YPLD 1HKLL 3L1OL 4TTGA 4OZGA 1IKFH 3MGTA 3RVWD 4HIHB 4ZO7A 5TE6H 2NY0B 1T66D 3WHE1 3CVIH 5FGBA 1OL0A 3VE0B 1LO2L 3KPPB 5BZWA 2DLFH 2MNUA 1OHQA 3TBTB 2FJFB 1D5XB 4V1DA 4WO4A 2YD2A 3WLBA 4PR5B 5DHVH 1CIDA 1AH1A 2ITDB 3G5YB 4E5XA 3RI5K 2WW8A 4QRPA 1I7TA 3R8BB 3STZB 5CEZL 2Z31B 2AABL 4JZOB 3KYNB 4G3YL 5DURD 1OLZA 2GJ6A 3V0WH 5DJ8A 3O6LL 3GK8H 5JXEA 2VQUA 1AGCA 4GRLA 2D31B 4WJ5A 4R4BA 2VDML 2GI7A 2IC2A 2W0FA 3KPLA 4D8PA 2HFFA 4K8RC 3MCKB 4HEPG 2QADB 3PP4L 5JHDB 1BD2E 5F9JB 3BSZH 5EU4B 4QHNB 1EFXB 3F62A 3U7YH 3D18B 4LVOC 4GLRH 1A0QL 3SPVA 1I3GH 4Z7QF 1NL0H 1WEJL 1TMCB 1WIUA 4HS6B 2QR0B 4KK6C 3DSFH 5GGQL 3SHSA 1ORQA 1QACA 4K94L 1Z6JT 5ALCL 4JG0L 3RWCA 1OAXH 3O3EB 2EZ0C 3INUH 1AD0B 2WBJB 3FO2A 5EZOH 4ORGA 3BP7B 5IK3A 5DQDH 3QWOB 3S88L 1RZFH 1JGLH 2EDOA 1HIMH 1MRFH 1TJGH 2HJLB 1K8IB 3TBSB 1T0NB 3BW9A 1U92A 3WFCL 3DGCR 1U8HB 4IRSB 4J3UA 5E99L 3KXFB 3SDCC 1Q9OA 3HI5L 3KPQA 5GGUA 1T83A 2X1PA 1XZ0B 1XF2A 4MQXC 4ODBD 4H20H 5J12B 2G2RB 5HI4D 4QRRA 2FLBT 3PHQB 2IANB 4YDKL 1OCWL 3OTTA 5EUOE 3VFUA 1S9KC 3B6SB 1ND0B 4YHYB 4JRYD 3PWLB 4MD0A 1KF9B 2FCBA 3D85B 1FZOB 2BNUB 3BI9X 3MV01 3OKDA 1CF8H 4LCIH 4IDJH 1KJMB 4FQ2H 3TEUA 4MNGE 2GK0A 2QHRL 2P5EB 4FQPA 4LLVB 2ADIA 1OP3K 3MNZA 4EIGB 1WK0A 2GYSA 1G9NL 5JPNA 4OZFB 1YDPB 5L8KB 2WP3T 5F9WC 1AGFA 4N0FA 4JRXD 4YEFA 3EOYG 4UI2A 4E42A 2P24B 1U95B 1OGAB 2XACC 3QDMB 4KXZI 5ANMB 2E27L 4HK3J 2R1YB 5E95B 2PO6A 3TBVB 3R0MA 1QBMH 2X5PA 4FFVD 4NP4H 4ONFL 3OGCA 4KI5F 2YWZA 3MRNA 3MGOB 3MLUH 3MJ9A 2MPAL 2VYRE 5EU5B 5EU3A 5LGJB 4GRWH 3CVHB 4TOYH 3LIZL 2IGFH 5CZKA 3QQNA 3U82B 4ELKA 1AQDA 1WTGT 1VB9A 2W9DL 5MI0B 1NCBL 3VXSE 4PY8I 1XH3A 3DVNA 1HKFA 2D7NA 3KYOB 5CP3A 4YXLH 5KVMC 2W65B 1AD9B 2L7JA 1N5AB 4YFDB 5JW4R 3DIFA 4M6ML 1T21A 3TZVC 4ETYA 3MV7D 1HILB 3UROR 2HTLC 4BZ1L 4Q7DA 2XZQL 1AKJD 2PCPB 5IQ9A 3VXTA 4M8VA 3MLSH 3LSOB 4LNRB 1H15B 3WFEH 3GMOA 4RWHA 1ZT1A 1ZA6B 1DQQA 3TESA 3IFLL 2F5AL 2UZIL 4XP6L 2DD8L 1AHWA 3BN3B 4CGTA 1MFBH 4OZIE 4QGYA 1JF5A 4JANB 4FQLH 2H3NB 2V17L 5BXFB 4IMLA 2X4UB 4U2ZA 1IFHH 1MCWW 4YNYA 3U6RB 4XAWH 2FWOA 3X3FH 2JJUA 3RDTA 4L4VA 3QO0B 3TN0D 1MFDH 2FEDD 3MRMA 3FOMB 3PIQB 1FDLH 1ADQH 1FNGA 4N90E 4PG2C 3W0WD 1F3JB 4HPOH 3CFDB 2RBLA 1DCLA 2VQTA 4N0UB 4P4KB 1S9WB 1RD6A 3CZFB 4U3XA 3RVUD 4I0PD 1WT5A 4C58B 1F3RB 1B0GB 3O4LE 3O6FB 5I74C 3C8DA 1RZJC 4Z7NF 3PHOA 3EFFB 5EBLB 4C83B 5F7HA 1YEHL 5CSGA 2WINB 5GRVK 3UZEA 3QIBB 5IHZB 3KLSA 4XPGL 3O2WH 4LHUD 3MBXH 4LLUA 4Y1AB 1AQKH 2I24N 1KENL 4Y4HC 3VFGH 1QSFE 4ODVH 1D5IL 4UIKH 1K4CA 3IAGC 4YC2C 3LDBC 4HPYH 3ARWA 2Z4QB 4H1LH 2R2HA 3J7HA 5D5MF 2YD5A 1JZ7A 2HT4D 2EDHA 2FZ3B 3NPSB 3WDIA 1E4WH 4NKOA 5HHXL 4DQOH 5F6IC 4F2MA 4TUJB 5CJOL 4CRPA 4HKJA 4J3WA 3VXUE 3BPNC 3QXVA 2MCG1 4Q9CA 1GZQA 4NN5B 1R5VB 1U6AH 3EYUL 3IT8D 3W9EB 1NC4D 2UWEA 4JFDB 1ZHKA 1KLUB 2P7TB 5DJXB 4PJAE 4DVRH 3O4OB 3NABH 4N8CL 4B5EA 5CZXD 43C9A 2PNDA 1DJSA 3JWNC 2NY4B 1MAMH 1DDHA 1HKLH 1XF4A 3L1OH 4X6CE 1QBBA 4KDVA 5EZIL 4HC1H 3VGEA 4NN7B 3HC3L 5GGVH 2YMXL 2EEBA 4HUKB 2V2TA 3PWPD 4LCCA 3O11A 2PETA 1UM5H 4ZNEA 1PKQB 4R8WL 1LO2H 4OLWH 2G75A 3FT3A 1ZLWH 2YPLB 3EYOB 4YZFF 3TO4D 1TNNA 3QQ4B 2FX8H 5FO8A 2YPLE 2H8PA 5IT2L 5M7QA 2F54D 3OGOE 4JHWL 1T89C 2PF6A 1ES0A 4KZEL 1BIIB 1FG9C 1NUDA 4IBLT 5TJWK 2NY2C 4F15C 1R3HB 1GGYA 1FL6B 2AABH 4RBPH 4PJIB 3MO1A 1MFAL 1KPUB 4OCXL 5J3HC 4PJIE 1HXMA 2CDGA 5EH1A 4AEFA 5EO9B 3IVKB 4QRSB 5CCKL 3F5WB 3X11B 1CGWA 3VH8A 1KXTB 4X5XB 4U49A 3T4YA 4CMHB 5K9KA 3WJLC 4F7PB 3ULUE 2A6JB 3NFNB 3T0WA 4PRDA 1FL5A 5FGCE 2QSQA 1OT2A 4LMQI 3MRFA 1F11B 3D9AH 1KJ3L 5SWZE 3L7FA 1XGPB 3RGHA 5CD3B 5IFAL 5DURB 4JFHE 4JG1H 2D3VA 5IB2B 1A0QH 1ITCA 3KPTA 5C3TA 1WEJH 2BC4B 4HWBH 4LLMA 3BN9C 2WV3A 1MCSA 5E4EC 1AI1L 1OAUL 4K94H 4HFWA 5E4IA 4KHTL 5DEZA 2AGJL 5FB8B 5DXWA 4AK1A 4I18B 2VSCA 4E41A 1OARL 1TPXB 3CPLB 1AFVH 1LDSA 5D1XC 1CFVH 4Z7UF 5EZJB 3F8UB 4H1LG 4ONOA 2BOCA 3V4PH 4RAUB 4JFZL 5DMGD 4CDGC 1N59B 5IEHA 4IOFD 1ZEAH 1AXTH 1F02I 1WBZB 5I76B 5EA0L 3BPOB 1U36A 4CJ1A 4U1GC 3F6LA 2X9YA 3GSWA 3GDBA 4UIMA 1OCWH 1HOCA 2GTWA 2VZSA 2I9LA 5JOFB 2VZTA 3DSNA 5LJYH 4I3RH 3QUMH 2AV1B 2B5IB 1H3PH 2NY0C 4HCRL 1H3TA 1KTKE 2Y07H 1P4IL 3MOBL 1G9NH 2DI9A 4NQED 3NTCL 5IROA 5ENWB 2X89D 1A1OA 3GUTA 4X9IA 1UG9A 4U1MB 2VLJE 4JRYB 4YJZL 5IB4A 1AR1D 2JK5A 3TIDB 3RGVB 4JKPH 1V3MA 3BJLA 2E27H 4JN2B 3ARDA 4IJ3C 4AG4H 1RJZB 3MRPA 3TYFA 4U2YA 3QXDA 2ZOLB 5C0DA 1LK2A 4ZFFA 1J8KA 1U2HA 4IM8A 2C3GA 5D2NB 2Z31C 5B4MC 5HHOA 1H3UA 1SMOA 4JLRA 5C2BL 5D7LA 3L3KA 1PW3A 1CGSH 4NCC2 4JRXB 3TA3D 2VLLB 1R6VA 3MV8A 3S97C 1JWMB 4RMUA 3LIZH 3LN5B 1IKNA 4JREB 3X12B 3MNVA 1ZKAA 2W9DH 3GFUA 5ACMA 2X70A 4FXLA 4JY6B 5D93C 3QIWA 1YECH 4HG4K 12E8H 2HTKC 2NTFA 5B22A 2QADC 4LSRL 2HFEA 4PJFB 5FYKH 1QFUH 5KANG 1KT2B 4M6MH 4TPRH 5E70A 1U91A 4BZ1H 3IDGB 2XZQH 4OCYH 3MUY1 3UTZA 3D3VD 2H2PC 5BCAA 5GQBA 3VI4F 3ARBD 5HHNA 1ZLVK 5GS1B 2WBJC 2A0LC 3FQNA 4L9LA 2GTZB 1KXQE 3FOLB 5H37H 4AIZA 5DJAA 2UZIH 4XP6H 2BXZA 3WUZA 2VR5A 3BEVB 2RFXA 3IDMA 3QFJE 4X0KA 1SEBA 2BY0A 4HLJA 3WHE0 3OG6B 3BVNA 3MV7B 3WLWD 2DDQL 4HAFA 4LF3A 2V17H 5DGRA 1I3RB 1AKJB 4IRSC 2GSIA 1ZVSB 4JFOA 3LKPB 1S7QA 2BVEA 1D9KD 3MLWH 3GMRB 4ELME 1UACL 3PABB 4QHMB 2VXTH 1PSKH 3QIUC 4UTBH 1GSMA 2HRPH 4LCYB 4NSKB 2VAAB 5DR5L 2P46B 3OJDA 5T5NF 3CFBA 5C0EB 1MHCA 1JMXA 1H3WM 4YHYC 3D39B 4Y4FA 1I7RB 4HUVB 4B7LA 2Y4SA 1S5HB 1S7RA 3LKOB 1KPVA 5FK9B 1E28B 1KEML 3HZVA 1Q0XL 3TN0B 1OAZL 3ES6A 4BH7A 4Q0XL 1NCNA 1X6NA 2A2QT 4GG6F 1KUMA 4MA7L 4PGDA 3W0WB 5EPMA 5TDPB 1E4XH 5EULV 1TZIB 2Y36L 5GGTA 4NO0D 2AJYL 4UMGA 3IGAB 1JF1B 3VDBA 3SKNA 3NH7H 4I0PB 1FVEA 1HNGA 5KSAA 2G5BB 3WS3A 1NGYA 2XKNA 4OZFG 4OAWA 3KLAA 5C92A 3K8LA 2DKSA 4DOHE 2HJKB 1JTTA 1FV1A 4OB5H 2Z35B 1CTOA 4G42A 4HS8H 4R0LA 1A6TA 2P5WD 4X6BB 4JFEA 5HHXH 1SY6A 4A6YB 4HWEL 5MERA 4OIIL 1FVCA 1REIA 3B9KA 5IJKA 3TO2A 2BVTA 4Y8AA 4LOUD 1G6RB 1KB5A 3BGMB 3MQIA 1CDCA 3FMGL 5HVWA 3BISA 4KFZC 4Z7WB 1IL1A 3LKQB 4KKAD 3QISA 5F21B 3G5XB 3U0PA 1T7ZA 4JHBA 1P2CB 3TPUA 4V1DD 4WO4D 1G6RL 3FB8B 3RRQA 3WE6A 2PTTB 5HVFB 1K8DA 3GSRB 2UZXB 4QRPD 5TQ2H 1NC4B 2R2EA 2VLKA 5H37G 4P48A 1CK0L 3FQRA 4YHPB 4RFOH 3ARPA 1E6OL 2KPNA 4PJDA 1SJHB 2WWMC 5IIEB 4U1NB 3NAAL 4FFWC 3TBWB 4O5LH 5D5MA 1RUKL 2GJ6D 4M02A 3RKPA 3L3DA 5JXED 1U8MB 2HLAA 4MXQD 1HDMB 4GRLD 4JHWH 2WUCL 5BO1L 3FAXA 3WJJC 1KCSL 3DMMD 3PWPB 4ONHA 5GHWL 4W81A 3G6JB 2YSSB 3BFOA 4P23A 1NKRA 1VDGA 4OV5A 3FN9A 3BKML 3PWUA 4BH8B 2AQ1A 4JM4L 2QBWA 3TO4B 1BREA 1LD9B 2H1PL 3RP1A 2AEQH 3KLDA 2DQGH 5AG8A 4K3JL 2F54B 4O51A 1K9TA 3MX0A 5FF6B 1V3LA 5DRNA 5E03A 1CGTA 3CMOH 5A2IH 1ZT7A 2J4WL 4XC1L 2ICCA 2B1HH 3HUJE 5IFAH 4OSUH 4TQEH 2JLLA 1WAAF 4X6EA 4O2FA 3O41A 3VFSA 2X05A 2VDQH 1YJDL 4XCEA 3VMPA 2XQYG 2EEAA 3QXUA 4KGJA 4JVWA 4KUZL 3ILQD 1FGNH 5B3NA 1I8KB 1FE8L 1VFBA 3OPZH 4H88L 2FLRT 3MRGB 4HKXB 4UT9L 4UB0L 2J12B 5JNYA 5FHBH 3FT4A 2IFFL 3T2NL 1Q9KA 2PYFA 4G5ZL 1VHPA 4QRRD 4F9LC 5JUEH 3QPQD 4HAGA 1CFQB 1XGQB 3VCLA 3NPSC 1C7SA 3EHBD 3TVMC 5CZVL 5T3ZH 5CD5C 3N9GL 1F4XL 1EEZA 3FQXB 3IKCA 4M4PA 2J5LC 5SWSE 2DM4A 1P7QD 1M71A 4NN5C 5ID1A 4GKSB 4UTAH 4POZD 3SBWA 1U3HA 1UYWH 4P2OC 5A2FA 4FNLH 1RUAH 3WL9A 4OD2B 3ZE0E 1RIVL 2NY4C 2AK1H 1AY1H 2FHFA 4JGUA 4JGMA 4NN7C 1Y0LB 3CUPB 1MREL 1P4IH 3CFKA 2X4PA 1Y6MR 2PO6D 4MA3B 5MEQB 4PBXA 3I2CL 1YZZA 3HFMH 3D69A 4N0YL 3O3UN 2EYSA 2KBGA 2WLYA 3CCHB 3BWAB 2OTUB 5D72L 4U0RB 3SKMA 5INDB 5F7EH 5IWLA 4Z7UA 1UH4A 3AXLB 1WBYA 1XF3B 1NC2B 5DMYA 2VDKL 4HQQL 4RRPA 5E56A 3RVWC 4GRMB 1D6VL 4GMSL 3RWFA 1T66C 3C09C 5CJ8A 4G8IB 4R7NB 3QCVH 1IM3B 4NQEB 4LP5A 4QKXB 3U9UA 1LP9B 5DTFA 1I9RL 5TDNB 4NT6B 4DUWA 4V2BA 5FCUH 2XZCH 1J12A 2ICWI 1NDGA 5BS0A 4BQ8A 2NPLX 4M7KL 1TQCC 1QR4A 3JWDH 4H0GA 4LSRH 3OR7B 2KQMA 5GZNC 5EC1A 1LVEA 1QRNA 3TA3B 3HI1B 1TVBA 2IALB 3MLZH 2JJSA 3BAEH 5EORH 2ARJA 3PL6A 1W8NA 3ARFA 1JHTB 4F7TB 2EYTA 3FB6A 1UM6L 1GCFA 1M6OA 1WISA 1XR8A 2HKHH 1B4JH 2HVJB 3GO1L 1NAMB 1GZPB 5E8OA 4I18C 1K6QH 4F33B 5KN5B 3QDJD 3RDTD 4L4VD 1JV5B 2K9UA 3BKJL 5A16B 1CG9B 1QLRB 4OLYL 3D3VB 4Q9RL 3ARBB 3SQOL 2W92A 5FDWB 1UACH 2V6HA 1NAML 5I1KL 1A7QH 2H32H 3VRIA 2FGWL 1MCEA 2EICA 3BPOC 4DCQA 4S10A 3TBYA 5HDOA 4UBDD 1JFQH 2WBWB 1YN7A 4UV7H 2EXYD 1C7TA 5BQ7A 1LEKB 3BQUC 3IETB 3SKOB 4AENB 3FQUB 1G9ML 2ZG2A 4KDTA 5HY9A 2EC9T 2CH8A 4U6HA 2OI9B 4S1SH 1N4XL 2NW3A 1I8IA 1MJUL 1D9KB 3P73A 4W6XB 4XAKE 1FN4B 4LNVA 2EDDA 4PJ8A 1JRHL 4L8SA 1NUFA 5HI4C 5D2LB 2OXGA 5I8EA 3KYAA 4I2XE 3LD8B 1NCUA 1DFBL 5FYKD 4P9HC 1UADC 1LO0H 2WSKA 4PJBE 1DTUA 5GGSY 2Y36H 1QFWI 2X1XR 2ZUYA 3P11H 3EJYD 3QR2A 4GRWE 1OM3H 3T0BA 3WEXB 1T0PB 5E94B 3D25A 1F00I 4MWFB 4JDZB 3VXME 1HINH 5D2NC 2EO9A 4HBQA 2WIMA 2W0LA 4EOWL 3STLB 1OD9A 3NACL 2QSVA 2NR6D 1BFOA 5DO2D 1ZLUH 3S4SA 25C8H 4HWEH 4NO0B 3PWNB 4OJFH 5EBWA 2DLHA 4FFVC 5ESQB 3B9DA 4LASL 2VKWA 3SEPA 4OZHA 3BP6A 1H0DB 1RJLA 3LPGA 1A21A 1N0XH 4PV8B 1J0KA 4KTDL 5KSUA 1KCUL 3HR6A 3FMGH 3BMVA 1PEWA 1VFUA 1AO7A 1J88A 3LEYL 1ED3A 4IIQA 4NRZB 3DUUB 3RL1B 2P5WE 3JTTB 3WBDA 4X4YB 5IMMA 2AJ3A 2VZUA 3P0GB 4AH2B 2MSPA 5HDLA 5E8NA 5GS1C 4PIRF 4Z95L 4XP9L 2FHBA 4OZGB 3MGTB 3SQBA 4EUPB 2AJXL 4GAFB 3TIEA 1U2CA 4YFEA 3D5OF 1E6OH 1NSNL 2V9TA 3DRQB 3P4OA 1ZLSL 3P9LB 5GS0D 5BZWB 1BQLL 3BIKA 4G8GE 4DKEL 2OJEA 4V1DB 4WO4B 3ZYIA 2WUCH 3WLBB 1QQDA 1UGNA 1IQDA 3S98A 3UTPE 4QRPB 2ZNWA 3SDDC 1I7TB 4PLJD 5HD8D 1VESA 4MQ7A 4X8XA 1CE1H 3BKMH 3K8MA 2MQ0A 1CXKA 4M7ZC 5TDOA 3TH2T 2YD8A 4ZAKC 5MEOA 2GJ6B 4XVJL 1MY5A 5DJ8B 2H1PH 3G5ZA 4K3JH 5I18L 3M07A 2GJ6E 2EEDA 5D70L 4GRLB 1RPQA 4WJ5B 5FECB 4R4BB 3UYOD 3TN0C 1GHFL 2ORBH 2W0FB 1DQTA 2FEDC 3KPLB 2HFFB 2XA3A 2AKRA 5F93C 3T3PF 1FNAA 4MJIA 5IVXF 2B7DT 4XVTH 4E41D 4APQA 3SPVB 1NGWA 4EKXA 1RZ7L 5H35A 4H88H 1ORQB 3RVUC 4UT9H 4GOSA 4BZYA 1EA9C 4I0PC 4NQSB 1OSPL 3FRPG 4PJGE 3KPMA 1W0VA 4XMLL 3RU8L 3RWCB 1UA6L 2XY2A 3G5VA 5AUMA 3SGEI 1I1AA 1RUPH 1RUML 3FO2B 4ORGB 1YPZE 3RQ3A 1C8PA 5IK3B 3T04D 4G5ZH 2X09A 1GPOL 4DGIL 3RKDD 2EDLA 1OF2B 2HKFH 1W0YT 1F4XH 1U92B 3BW9B 3HB3D 4NNPL 4KVNL 4M62H 3QUYC 5E9DA 1Q9OB 5GGUB 1QLEH 1XF2B 3VXQA 4XRCA 2LV4A 3Q6GL 4MAUL 4QRRB 1FPTL 2HT4C 3C6SA 2QKIA 3PJSA 4KK9D 3BUYA 3HR5A 1RIVH 1NBYB 3VFUB 5D9SA 2F19H 1R0AH 4MD0B 4RISL 3SO5A 2CUIA 3OKDB 4AL8L 1TJHH 3ARDD 2CKBA 3D0VA 4MLIA 2FJHB 3WNPA 3GHEH 3MNWA 3U48A 2ADIB 3I2CH 3MNZB 1K2DA 4N0YH 3DX9A 2C1PA 3N1FC 5JPNB 5HHOD 5CZXC 5D7LD 5D72H 4N0FB 1HYRC 1A7PL 4KJYA 4MA8L 3QPXL 3LZFL 3MV8D 4U6YA 3MLXH 4E42B 4GMSH 4I77H 3ULSA 1NAKH 4PJXF 3BZFA 4U3CA 5ALBH 2PO6B 3AY4A 4AEHL 3QIWD 3OGCB 5I30L 1NFDF 1I9RH 3MRNB 1IMHC 1BP3B 2Z93A 6FABL 3TO4C 4G6FD 5EU3B 2XI9A 4AIXA 2FNBA 5E0QA 4OIBA 5DFTA 5JLZA 2D0HA 1LE9A 4ELKB 1AQDB 3EUUA 2YR3A 5EFIA 3SDXF 3UPRA 3SE8L 3V4UH 3NFSH 5F88A 3DLQR 1XH3B 1UCBL 3DVNB 1X9QA 1F90L 3VFNA 3CSBA 1PFCA 5ETUA 1WTLA 3KS0J 1MCHA 3DIFB 1T21B 5D6DA 3OKNA 4S0SD 3WFZA 5I17A 1JGUH 1GC1C 3VXTB 5IQ9B 1UM6H 3V0VA 5K59F 5L9DH 1UKTA 3GMOB 2E7LC 1ZT1B 1INEL 1DQQB 2QJDA 3BKJH 4LRNH 4ALAH 1AHWB 3HZMA 1EHLL 4GBXA 1IGMH 2ADJA 1Q1JH 1DBML 3WDJA 5CEXA 1E6JL 2R1XA 4Y4FD 1NAMH 3IFOA 5I1KH 4IMLB 5GRVL 4HDIA 2BZDA 2LAAA 4YNYB 3VXRA 3BZEA 3EAKA 3RDTB 3MUHL 4L4VB 5ITBH 1CLYH 3MRMB 3QDJE 1NCDL 1U8IA 1X44A 1OAYL 1RJCA 1DQLH 2EXWD 1WZ1H 3ZE2E 1FNGB 4G43A 4WGVB 2AEIT 5DMGC