1MFCL

High resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGTVTSGNHANWVQEKPDHLFTGLIGDTNNRAPGVPARFSGSLIGDKAALTITGAQPEDEAIYFCALWCNNHWIFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN)
publication title Recognition of a carbohydrate antigenic determinant of Salmonella by an antibody.
pubmed rcsb
source organism Mus musculus
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1993-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfcL01
1CDJA 3RGVD 5ICXA 2YZ8A 4GW4A 1IGJB 1JP5A 5SWSB 4J8RA 2AP2A 3WJJC 2H45A 4R0LA 3ARDB 3B9EA 2Z92A 5IQ7L 3U0TB 5CJXC 2NY1C 3VFPA 3CDFA 2GHWB 3PV6A 3QISA 4LCIL 5FO9A 3SJVE 3VXMA 3BRGC 2MCPH 5L88H 4LLQB 1RHHB 1YJDL 4JKLA 1TETH 3C60C 3DX7B 1L0XA 4J3OC 3IU3A 3IU4H 3QFDB 1UT9A 3ILQC 4OT1H 5LG1A 3CX5J 3RGHA 3NZ8B 1OTSC 2X4TA 4PGCB 1DZBA 2W59A 1IAMA 2ADGB 4UOW0 5B39G 3MCLL 4M1DL 4KI5E 2B2XH 3FFDB 1DDHB 3CMGA 4GRLA 5HYQB 2BRRL 4DOHE 4X5WA 2BXYA 4Y1AA 1CLZL 4MNQD 4P46D 2VRAA 3B9KB 1QACA 3TN0C 5DRNA 2VLMD 2E7LC 3GEWB 4KZDL 1L0QA 3WNLA 3KPNA 1OCWL 1WT5A 3BAEH 3SOBL 5BQ7B 1J88A 1MHEA 1KXQE 4GUPA 1PAMA 4XB8A 2YD2A 1QEWB 3E3QE 1AY1H 4M5YH 1JZ8A 3SJVB 3F7RA 4HH9A 4P2CG 4OF3A 1MPAH 5SV4A 1PKQE 2A9MH 5KVMC 2G75A 5EOTA 4DN3H 3MCG1 3V0AC 5DJ8B 4LSTH 4LVEA 2FATH 2GSIB 2RQ8A 1G7QB 5EBMA 5GRUH 2X9WA 4XCFH 3QUMA 3VD7A 2E6JA 5GS2D 3GRWH 3MJ9L 1U2HA 5I1JL 1ZLUH 4XVUC 4ONHA 1S9KC 2FL5B 5BZDA 2F54D 3DRQA 1D5ZB 1T66C 3VXOB 4ZG1A 3QCUL 3OHXB 3LS5H 1I7TA 4ZOBA 3VH8G 2IH1B 1Z3GH 2PW2A 3B43A 3MGAA 1OB1A 1EGJA 2VKXA 1Y6NR 2R1XB 3DV6B 1QOKA 4HMCA 4KHTH 4TQEH 4MHHG 1FNEB 3TPUA 4BUHA 4Z7QF 1PKQB 1X5JA 2DTML 3MUJA 4TVSa 5EUOA 3FRUA 3IETA 2VZ1A 4UQ3B 4QYOA 2DS4A 3RKDD 3EJZC 4IDLA 4B0MM 2PNDA 5I73B 2EE3A 4NN7C 3VXRA 3Q5TA 2Z0BA 4ZMAT 4N9GB 5ESAA 4L5FH 4MMXC 1YNTA 3BJLA 5ESQB 2ZG1A 5F7EH 3K4AA 3C09B 4XBPB 5CJQH 5DJZB 5KSAB 2HFGL 3FT3B 2R2BB 1A6AB 1WCBA 4ORZC 4BSVA 3TBVB 3RX7A 1VFAB 3QXAA 3Q3GB 4X4ME 3AVEA 1UZ6F 4Z7OF 4G42B 5JORB 2A77H 1T0NA 2XN9D 4JZNB 5DRXB 4E41D 2QSVA 4Z7VE 4YLQT 4P23D 4BYHA 3RVWC 4C59B 1EAPB 4NQTA 3QUXB 4MNQA 1RZJC 4P46A 4PREA 2AJVL 3CFDB 2W9LA 3RVUC 2FSEA 1BVLB 2CQVA 3HA0A 1KB5B 3MRJA 4PLKC 2RCSL 5GGSA 4QRRD 2A6JB 5HHXH 2BSTB 1GGYA 3GSNB 4WTZA 1MEXH 3FO2B 3O6ML 3NPSB 3MUZ1 4X6CE 4BQCA 2J88H 3H3PL 2KZ1B 3DUSA 3UEZA 1F11A 4QXTA 4YHZH 1YY8B 1CU4L 1WAAE 4TUJA 1RIHH 4BQ9A 1U95A 4ZPVA 3LOWA 4H0IA 4PJ9C 4P9HL 5ID1A 2YS4A 4IRZH 4D0BB 3ZYIA 1EEQA 2O5ZL 3BPNB 4OCWH 2Q3ZA 3MRNB 5HI4C 4ODSH 2MHAB 4NKIH 4APQD 1XIWC 4Z7VB 1INDH 4WUUA 5JDJA 1JL8A 5J0BA 1NCWH 4YR6B 4DKEH 1JHTA 5D5MB 4Y5YC 2XRAL 1IC4H 4F2MB 1DE4B 1T4KA 1WISA 2YPVL 1T7XA 1UKTA 1PG7L 2YA0A 1U36A 1WZMA 4FQ1L 1MREH 3VU2A 1NBYA 1IEAA 4O58L 3TEUA 1CTOA 5ELIA 4GAYA 1CE1H 3S8WA 1ES0A 1EGJH 5D72H 1AGBA 1C7TA 3VA6A 1KNOB 1BVZA 3TIDB 3BPOB 2PYFB 3F7QA 4KY1L 4QRQB 1IILE 1I9IH 3DX6A 5DYOB 1MFAL 5IF0A 5J89A 1F00I 2LTQB 2E27L 4G8GE 3HC4L 2E9JA 3NFNA 4O2EB 2X4PB 2A73A 2X4UB 4KHXH 5EUKA 3SBWA 4M4PA 4HUUB 2OI9C 4HW6A 1F2QA 2R1WA 5FYJH 4OZGA 3X11B 2Z91B 2B1HL 4MVBD 5JLZA 1EXUA 1V7NH 2EZ0C 1B0RA 3CZFB 2I07A 2BZDA 4HLJA 2YKLH 1Q9WB 3V6FB 3WE6A 2H32H 2PR4H 5I18L 1IGMH 1NLBH 2DDQH 1XR8B 2JELH 1MIEH 3CUPB 3Q5OA 4A6YA 2PF6A 3ZE0E 5EWIH 3UX9B 4NBYB 2BJML 3ARRA 4EI5C 4DUWA 2EDDA 4NQCE 4NN6C 3S4SG 4F9PA 4HF5L 3G9AB 4CGTA 5T3ZD 2F5AH 4P23A 2VXQL 4BSWB 5FOBA 3MOAL 5IW6B 2EXWD 1DN0A 2CIIB 1YYMH 2ED7A 3WS6C 4U1NA 4G8GB 1R3LB 1A6VL 1BQLL 2ZJSH 5INCA 3NOIA 4NZRH 3BWUC 4MJ6A 4LAQH 4ZNEA 2QQNH 3O6FD 2H6PB 5HXMA 5HHOE 5GISH 4ZAKD 3WFCL 3EOAA 2QKIB 3BHBB 2FX9L 4X9HA 4FABL 4QRRA 4X4ZA 5IQ9B 1VACB 3JV6B 2AXFB 4NN5C 4G7VL 4OCSL 4ONFL 2C3GA 4I5BB 2X9XA 4MS8D 4PFEA 1UQSB 2NY3B 5CSZA 3ET9F 5IW3A 3BQUC 3FB6A 4LLUA 4R7NA 3ULUC 2NTSP 4XP4L 4NQCB 5DJ0B 2ATPB 3MPCA 3UDWC 4JLRA 4APQA 2AEIT 3I9GH 3S35L 3NBNA 4D0DB 2P24B 2GTZA 4PB0L 1TZHB 3M1BA 4FTVE 3P11L 3QIBC 4P2RE 5ETUB 2CMRL 1OAKL 4XWGL 3BFOA 2Q86B 2DYPB 4YGVA 3VA2C 3VXSA 2VN4A 3SCMA 2DICA 2DKSA 3DTXB 5HHOB 3ARFD 4P2OA 3VXTA 2R23A 4G43A 2GCYA 4U6TA 5T5FH 4PRBA 5T3XL 1RPQA 4PB9L 3PWUB 4U3CA 3MRMA 2H2SD 4NJAL 4D9LH 1BFVH 2AXHA 1JZ6A 3CJJA 4O51A 3BH9A 2W0FB 1IAIL 2J8HA 3ECBA 1HZHH 1PSKL 4WU5B 1BEYL 5D7SL 2A6IA 5INDB 4FQXC 5GS0L 2X41A 3HNSH 1FVCB 3CK0H 5D93C 1ZANL 4XNYH 3KPTA 3RWJA 3FB5B 3C5ZB 5MHSD 4WWKC 5GSVA 1SEBA 4HZLB 5J57B 4HT1H 4FTVB 4P2RB 3W2DH 1R3JA 3P0YH 4XBEH 1KELL 2R8SL 3ULVE 4P49A 4OAWA 4WEUD 4P57A 3FOMA 4YE4H 3T65B 4FQJL 3D3VD 4PUBH 2COQA 5K9OB 3K3QA 4I77L 4XCEA 1AR1C 2VDOL 5A2LH 1ZV5A 5SWZE 5I2IB 4WJ5B 4CBPA 5IJVB 1A1NB 4NPYB 4FMFA 4JE4B 3HE7D 1EO5A 1TMCB 3U36B 1GXEA 2BFVH 4M93C 4HUVB 3W5MA 5KJRL 4I1NB 5H2BA 4PGDA 5F71A 1DL7L 2F8VA 2GUOA 5LGHH 3ETBF 4JJ5A 1OD9A 5HGAA 1KN2L 3BZFA 4C83B 3K4DA 5J8OA 3O6FA 1HYSC 1LE5B 1CZ8H 5M94B 1PYWA 1FZOB 5EZJB 4PG2C 1GGTA 3WHE1 1JNLL 4F7CA 1ZWIB 4UV7L 4FQIL 1LWRA 5IK3B 1P9MA 2DQHH 4GXVH 1Z5LB 3BEWA 4EZMA 5GGVY 2NY1B 5SWZB 2YD8A 1RIVH 2D7TH 4Z7UE 1P5VA 3CFBB 1LK2A 5C1MB 3IRZA 4Y5XC 3C60B 3NMEA 3TBSB 4LDOB 5CJBA 1J1OL 5DHXB 2AK4E 4LSRH 2GKIA 1UB6B 5E8PA 1QRNE 2VXVL 4EOWH 1H5BC 3QDGD 4XGZB 4Z0XA 2EDHA 2GJZA 3MA9L 1NGYA 1E6OL 1QFOA 3ARFA 3IFLH 1AY1L 2HKFH 3V5KA 1D6EB 5D70H 1RZFH 2DQIH 4MQSB 4U33A 1BIIA 4WV1A 2H26B 3T2OA 3PP3K 1KXTB 1MPAL 1K8DA 4L8BA 3QCVL 4M5ZH 5DFVD 5JOEA 4XNQA 5DHVB 1G9NH 4R4FH 1OGTB 5BOZG 3FQTA 5IFJB 1ZA6A 2XZAH 4WO4D 3L5XL 4HK3J 3H42H 2FX7H 4P2QD 5ITFA 2AEQL 4Z7UB 3RWDA 5DJYA 2YBRA 3CH1A 4ZFOB 1NCBH 4YEEA 5ITBH 1B88A 3IFOB 4HQQH 4C57C 5D7IB 3PWNA 2OTUA 2G2RA 3LS5L 1A64A 2C3XA 2YEZB 2VISA 5I1HH 2AK4B 5AZ2L 1QFWM 1QRNB 3BP7A 2OZ4H 4S1QH 2NY0C 3O3DB 4ZUTB 3KPSD 2EE6A 3T0EC 2NNAB 1KC5H 2R0WH 4JPWL 1C5DA 5L2JB 2X7LA 4LKXA 4JVWA 3ISWA 4TQEL 5IV2B 3DBXA 4MNGB 2NXZD 4AEIH 1XR9A 1J87A 3HC0A 3V52H 1M1SA 3PHSA 3VGHA 2G5BA 3QUZB 2Y5TA 4KUCF 1FLTX 3DYOA 3N1MC 3HE7A 4AM0B 4OCLC 4Y19D 5IB1A 3VRIB 2NY4D 4JRYB 2KKQA 3C6LD 4LK4A 1U8KB 4EN3D 4HJJH 1TCMA 4OF7A 3EYOB 2J4WL 4ODWB 1ETZA 4NC1E 1HSBA 2GK0A 1A7QH 5E6ZA 1CFNB 2ATKB 3C5JB 2D3VA 3WKNA 4MSWB 5EU6D 5IB5A 3OF6A 1JGDB 5DMIL 4PJCE 4OM1H 1X7QB 2RHEA 4XXDB 4PPTA 4RIRA 5HGHB 1I8IA 3GO1H 5DURB 4N0UA 3NZHL 4ELKB 3TNNA 3W9DA 5DD1L 1J0ZA 1ZXQA 4JFEE 4LRNH 5DR5H 3WCYA 3RWHA 1CDUA 3UPRA 2YRPA 4OI8A 2ZKHL 2CIKA 1KEGH 1KCKA 4JG0H 5E8EA 2QSQA 1FIGH 1MY5A 2V5MA 3ZL4L 4U2ZA 3L5WA 4ODUB 3S7GA 4UUJB 5FHAH 3BKYH 3D18B 4JQVA 3LEVL 5TGBA 4LBEA 1U6AH 4K8RH 4BJLA 5HHPB 1MEXL 1JZ7A 4MAUH 3BZDA 2AV1A 2JIXB 4TVPL 4UDUB 4R96B 3UZQA 2MQ3A 4QCIB 4PJCB 4RQQA 2YUVA 5LBSH 4YJZL 3P4MA 4PJAA 3PWVA 5GS1B 1R24B 4GXUN 1A3RH 1RIHL 2RBLA 5KOVC 5MERB 4HDIB 2M26A 5AYUL 2CD0A 1GGUA 3W39A 4C4KT 2R2EA 4UINL 3KPMA 4IRZL 2HH0L 4PRAB 1RIUL 3VDCA 5L6YH 4WO4A 5IHBA 3O3BB 4JFEB 2HA1A 3QUML 5FYJU 4PYHA 3T77A 1KTDB 2XFXB 3CLFL 1VEMA 1Y0LA 4LCCC 2OJZL 3OGCB 3LD8C 4P3DA 4LARL 4PJ9B 4QOKA 1K85A 4J23A 1G7PB 4PJGF 3QRGH 4KK5C 1NEZA 2ADFL 1H3GA 4XX1E 4YIQA 4ZOEA 2EIDA 5EB9A 5L0QC 5DQ9B 1M7DA 1XIWB 3KPSA 4KVNH 1N0XH 1S8DA 1EGJL 4HS3B 4EIZC 5EA0H 4HV8A 1GYAA 4AQOA 3MBEC 1NCAH 5LAXA 4QRTA 2LQRA 2YMXL 1MFBH 3W0WE 4LSDA 1OWWA 4HAFA 4BFIB 4OCRL 2J7LA 4Y19A 4XNXH 3FQNA 4OZHF 3EGSA 5E08L 4NCC1 3C6LA 1INQA 4FN0A 5CP3H 3TYFB 1KJ2H 4AIZA 3MA7B 3NCFB 1KGCD 2C3VB 1D9KC 3BKCH 3FB8A 3MNVA 4ODXB 1A8JH 1YMMD 4MDIA 2NY6B 1T83C 1V7NL 1WSST 4DTGH 3OKMB 5EBWA 3VFSA 4IRJB 4L3CA 1LEGA 2YKLL 4MXQC 3RTQD 1AHWC 5I1KH 5CILL 5LQBH 2DLFH 3GSQA 3VD9A 3C87A 1DBKH 2CLZA 5DJXB 3T8XB 1JPTH 4OIAA 3WDHA 2DF3A 3RBSA 5DHYA 4PJIF 4PD4J 3LKQA 2F74B 2C1OA 4YDJB 3F6IA 4QF1B 3HG1D 3GM8A 4KV5F 2DJSA 1YYML 5J1TC 5HPMB 2ZJSL 1R5IA 2EECA 5C0BD 3QUKA 2HRPL 4MAYB 4AH2A 4GAFB 3PABB 3DROB 2QQNL 4EI5B 4DGYL 1ACYL 4CW1B 1NPUA 5TFSL 1HINL 5LCVH 1K2DB 4NN6B 4MCYA 4OCMC 4NKQB 2RGSA 4QRSB 2VQUA 4PS4H 4HXAL 4V1DA 3MO1B 1JNNL 1QSZA 1K4CA 5IROC 2VC2L 4JZJB 2EC8A 3MMEB 5AD0B 5FFLA 1NLDH 1JYNA 1YPZA 3WHXA 1M05A 1SY6H 2DI7A 2ZOLB 3HR6A 2HFFA 5IVNA 4ZUVA 3MV9A 4MX7B 5EC1A 1KIQA 4NN5B 2WIIA 3KNBB 4BH7B 1H15A 4UQ2B 1OL0A 4PTTA 2ZUSA 1I8MB 1B0GB 1T1WA 4JQXA 3RY6A 2EXYC 4G6FD 4PRPD 3QBTB 4TSBL 3CDCA 3WNOA 3WMSA 3KJ6L 4TOYH 4KQ3H 4UBDD 1FFOB 3BUYB 2HT2D 4Q97A 2V5TA 2R69H 5FOJA 1XF2A 5L8KB 1FE8H 5HHMD 1FNSH 3EIFA 5DK3A 5FUCE 4MLSA 2XI9A 5EPMA 3H0TB 3QJFA 1FO0H 3L1OL 3IJHB 4JKPH 3RQ3A 1FZMA 2H3NA 3LH2L 1QLRB 1DVFD 1EVUA 3HNSL 3TJHC 2GSGA 4PBWD 3CK0L 4DUXA 3EJJX 5L2KA 4ZS6C 2X4RA 4HS8H 3CFEB 4MD4A 1KPRB 3GJEB 3VRLF 2NR6C 1T5XA 1YMMA 4HT1L 4L3EB 2FYYA 3W2DL 2AJUH 4S0TD 1ORSB 1KTLB 5HHNA 5FCUH 5D93B 1NFDF 1CE6B 4HHAA 5KVGH 5D1QC 4UMGA 3RI5F 1QYGH 4JRXD 1JPFA 4WWKB 3I6GA 2X05A 3DYMA 4A6YL 5C08A 3G6JA 5BRZB 3ZDXF 4NYLA 3MSPA 4O2FB 3TO4C 3TH4T 1CN4A 1YA5A 2ZCHH 2AJYL 1JVKA 3UJIH 3CLEL 3QH3B 3JVGA 1C16B 3AMLA 1C08A 4HFUL 3OKNA 4H1LH 3LRGA 4GW1A 1I7UA 5C0BA 4JO4L 4R97C 4FP8H 3EDDA 1JF1B 4IM8A 4PRNA 2O61A 1R5WA 2BHZA 3UAJD 4N8VG 2DJ4A 1KIRB 4M93B 5F96L 5F1KC 4ZFGL 1S3KH 3D39E 3BE1L 3KWWB 2YD3A 1L7TL 4J3SA 1MAMH 4OIIL 4LLMA 4I4WB 4P5TD 1TVDA 3D0VB 1HHHB 3CSGA 4AMKL 3HAEG 2Z35B 2W0LA 5JOFA 1BZ9A 2BVYA 3EYVA 4X98A 4TUOB 1E4WL 1OGAE 1Q0XH 4OFDA 3T3MF 3G5VB 4MYWB 1F6AB 1ZHNA 2E3VA 3EFDH 4HK0A 4XP6H 5GZND 3KS0J 1SYVB 4NT6A 1NGPL 4OD1H 4UIKH 4PRHD 1UZ8B 1ZTXH 4Y4FA 4EOWL 5BMFH 4PRPA 3S98A 2J8UE 4UT7H 3SDXF 3ZKQD 1FNLA 1RJYA 5D70L 4Y5XB 1HDMB 4BH8B 2NTFB 2VUYA 4JFPA 3D39B 3GIZH 4LKCB 1IVLA 2VUOA 2QV2A 3EYQD 4R4FL 3OZ9L 4HSQA 4HC1H 1H5BB 1TZIA 2DL9A 1TPXC 3CSPA 5D2NC 4ZUWB 2D0HA 3DURA 1BLNA 3H42L 4OD2A 1GC1L 1KLFA 1GZQA 5K93A 1DVFA 4MJIE 4RMQA 2OQJA 2FEEL 1JGVH 1OGAB 1YY9C 4FXGA 4C54A 1JWUB 5DRZA 1T2QL 4ZSOE 3WEXB 1RU9L 2JKXA 4XI5D 1J0IA 3PDDA 4S1QL 3BYYA 2J8UB 4OD3L 3OAUL 5CEZD 1Q9LB 4J4PC 4OV5B 3U7YH 3GZKA 3HZMB 1LDPH 2IADB 4OZ4B 5DS8B 3C9NA 5FGBC 3VFMB 1L6ZA 2IAND 2KUTA 4AEIL 2BOBB 3WSQL 2GTWB 5H94B 3RJDA 3V52L 3WIFA 5HDOA 2UV3A 1GZPB 4MDJA 1J0YA 4JFDE 5IVXA 1MUJB 2NY0B 3T0EB 2CKNA 1HXMB 1A0QL 5KS9F 3KPRB 3GKWH 5T3ZL 1R5VB 3MX0A 1UKQA 4PJFA 2AEPH 4KTEH 2R56L 1NC4D 1UM5H 5FDWB 1I1AC 5TH2A 4GBXC 3TBTB 4ZSOB 2R9HC 3GJFA 3G6DH 3UPAA 4M3KB 2XZCH 5FK9A 1G9NC 1RUAH 3BT2H 1KJVA 5ALBL 4NFDA 1J1XL 3GMNA 3HZYA 1FNHA 2QQKH 4ZQKB 2V9QA 3DETD 2YWZA 1A21A 2VDNH 4X6DF 5C8JB 5GZOC 2P48B 4P5TA 4GRMB 3EDKA 1EUTA 4IDJH 1RK1B 1EEYB 3EBAA 4MA7L 2Y7QA 1MJJA 5GGRY 1K4DA 2D7PA 2B5IC 1ZMYA 1EFXD 2YWYA 5J13C 1KJ3H 3OR6B 2OJEB 1HH9B 4JG0L 1XGTB 1ZHLA 1YEEH 4C56B 1T89C 5DEGA 2ICCA 3MRGA 4I8DA 4U1JA 5TPWH 3MRIA 4LASH 4WW1A 5B38G 4M43H 4GKNA 5DEFB 1TVBA 3MACL 4KK6C 1BBDL 3QHZL 2D7QA 4EXKA 3KLAA 5DMJB 4GKZA 4X99A 3MRBA 4TNVF 4ZO6A 1U6AL 3CSYB 4K8RL 2WWMD 2OR9H 3LKNB 5FUOH 2HJKB 5EC2A 1QUNA 2PCPB 4NKMA 3NCJL 3VXME 5LBSL 2V5YA 5DMGC 3QHFH 5C0AD 2NPLX 2XTJC 4D9QE 2BY3A 4LEXH 4DQOH 4FRWA 5C0FA 3C8DA 3VXNB 3S9DB 5C6TL 2XA8H 1FZKB 3CDGB 3LV3A 1A3LH 1WUNT 3OXSB 3P40A 2YC1B 4ZTOH 2XKNB 1SMAA 4Y1AE 1CR9H 2CK2A 1A6ZA 1NC2B 3WNKA 1CWVA 4L4VD 1U3ZA 1S9WB 2ICWA 4GS7B 5EO0B 1WICA 4NM8L 1N4XH 3SE8L 5CSBA 5ICXB 4GW4B 4PY8I 5F9JB 5DC4B 5K9JH 3NGBC 1T20B 4RGNC 1SJHA 3O2VL 2E8ZA 4LCCB 4RMTA 3PL6C 4RMSA 1MCRA 4ODBD 3LD8B 2IANA 4X0KA 1KJMB 3VXMB 4DK3A 1OQOA 3IDIA 5CP7A 1AI1H 1CFBA 3VXQA 2VH5L 3VE0A 4HWEH 3T3PE 2DQUL 4AIOA 5L0QB 2OR8A 3IU3B 4LLWB 2R4RH 4YNYA 3BZ4A 2R15A 2YUXA 3RDTC 1CXEA 3MBEB 2VMFA 1NC4A 4ZFFB 4Y1AB 3MXVH 3QHTC 4KRMB 4ODHH 4BKLA 2YK1H 3ZTNH 5KSBE 4RISL 1FNGA 3GJFH 1KENH 4S1DC 3KPNB 4YK4C 5LQBL 5CAYB 2WP3O 1HIMH 3ARSA 4LSSL 4QXUH 5E00A 1ZHKB 5E5MA 4GUPB 1F6FB 5TE7H 3P4OB 4YBQD 4BA8A 2VO5A 2AK1L 5B4MD 4NWTH 1IQWH 5DJ2B 3QA3A 1S5HA 2I26N 1DBBL 2A83A 1LK3L 5BVPH 2VN7A 3VFTA 1U92B 5GJSL 1EFXA 5DJAA 4YXKH 3FONA 1AHWB 4BZ2L 1MIMH 4FFZH 5EUOE 1MCSA 2EH7H 3WIHA 1QPPA 2XKUA 4O4YH 3SKNA 4PJ5E 4EUPA 3KS0H 2OSLB 4OFYD 3BMVA 1G0YR 1NBZA 5F8RC 5FYJE 2VL4A 3VXRE 5FM4A 1TQBC 5C92A 3BIKA 2XQBL 4ONHB 1EVTC 1X4ZA 4ZTPH 1U3YA 1I85A 3N1PC 2J12B 5F7KC 4OBRA 5KSBB 2PO6D 3WJLC 2Y36L 4WEBL 5D2LB 4K2UH 5DTFA 3CVHH 4M1GH 5D6CB 3LIZL 2VYRE 3F5WA 1PQZA 2P8MB 3B2UC 4PGZA 3KYNB 5C0AA 4F9LA 1MJ7L 2CR3A 3QNZA 5E7BA 3VFUB 4NZTH 4OSUL 1I8KA 1S9VB 4NZUH 2I25N 3TPUB 4MD5A 2DLIA 5MI0C 3HS0B 4M7LT 3KLHC 4IMKC 4K7FB 5DJDA 4YDKH 3HB3D 3QEUA 5EUOB 4OBSA 1K5NB 1XH3B 3BJ91 4RNRA 3LQAL 3T4AA 4ENEC 4XC1L 4QYOB 2WSKA 3PJSA 4PJ5B 5E2VL 1RMFH 2VLME 4JO2H 2JF1A 4ZO7A 5CJOL 3VXRB 2Y07L 5FYLD 3NCYP 1SEQH 1FE8L 5LWYL 4QEGA 1QRKA 1PX4A 2H32B 5TJWK 1NMAH 1F4WH 4MLIA 3EOTH 2HT3C 3GMLA 4QRUB 5I75C 4Q9CA 3LRHA 5CD3A 5I76B 3U7WH 1X5AA 2VZOA 2AXGA 1UWEL 3UYRH 2CR6A 1UM4L 1CBVL 4LLYA 1T0NB 2AQ2A 4Y2DD 5DD5H 2R39A 4WUUE 5DVKA 4JDVB 1U91A 3IJYA 5C0EB 1IKNC 3O9WC 3ILPA 1RUPH 2RIKA 4WFGE 4PREB 1A7NL 2C4XA 4ONGH 3WXVH 1ITBB 1S7WA 1KCRH 4XRCA 3MJ7A 5F7FA 5FCUL 2IBZX 2LAAA 5BJTA 5KVGL 5GGSB 3BXNA 3AREC 3BN3B 1YN6A 5KOMC 2YA2A 5HGBA 2VWEC 5HDLA 1FVEA 3ZT7A 3CPLA 1N0LA 3SKJL 4WU7A 4TSAH 3WS3B 4FZEH 4WHTA 3MRCA 3TZVD 5CZXD 4KMTH 2YZ1A 3D0LB 4G5ZL 1FL6A 1J0KA 3QQ3B 5CEXA 2VLLA 5BV7H 1MRCH 1N6UA 1U95B 4RWYH 3Q0HA 4PY7A 1UACL 5TDOA 2D9QB 4CN4A 1MQKH 1HSAA 2FHCA 5E70A 3ZMRA 2HFEA 4OFYA 4EUPH 1U3JA 1DEEB 3GNML 3TO4B 4UT6H 1MAJA 2NLJB 3S37X 4OZGE 3BUTA 4AIXA 5IOPA 3NIFE 3MZGB 4Y16D 2WBJD 5I1CL 3STLA 2N7BA 3KXFE 3PNWB 4GH7B 4M1CC 4DFIA 2PO6A 4HFWB 1FL3A 2JCCE 3QDMD 4KU1A 3RHWK 3X17A 35C8H 3NPZB 1TXKA 4OZIA 5HSFA 4R97B 2O5YH 4FQHA 5F89A 1YNLH 1KTKE 1IM9B 1N3NA 2VERN 4GAYB 3ARVA 1KPVA 1FGVL 1NEUA 3U0PA 5E8NB 5JXAL 1B6DA 1AGBB 2ERJB 4BZYA 1Q0XL 3HUJF 2A6KA 2A0LC 1H8OA 4HS6B 3EFDL 3UP1A 1IM3A 3CX5K 4G8FA 4JFZH 1UH3A 43CAA 3GB7A 1A6WH 5F7HA 3NCYS 5D2NE 3VG0H 1N6VA 5E2TH 5MEPB 4M6NL 3FTGA 4OD1L 3NFNB 5ENWA 4UT9H 4KDWA 3RNQA 3KYKH 3FCTB 3GBNH 2YRZA 3HNVH 5GSRB 3DMMC 2Z8RA 3RUGF 1H3WM 3FQWB 1FG9C 3MREB 5H35A 3REWA 1EXUB 3KXFB 3OKLB 3R0MA 1V05A 3MV8D 3WD5H 3RIAK 3CFKB 5DK2A 4IIQC 2JCCB 4H8WH 4YPJA 1KBGH 2QQQA 3RWFA 1JWMA 2CDGA 5JO5A 1HNGA 3GIVA 1NKRA 1P1ZA 4LQFL 3QRFM 5I8KH 4I9WD 3T2NH 4BELD 3BP4A 3MRFB 2E9WA 5IHUH 2Z8VC 2FGWL 1MFEL 5C0CB 1NGWB 3M17B 3QPQC 1OAZH 5SWSD 5FOBB 1DN0B 1BD2E 1Q38A 3ARDD 4H26B 5D2NB 3EAKA 1LEIA 4UB0L 4YH6A 15C8H 4YPGA 3VXSE 1T5WA 4MJ6B 2DIJA 5C6WH 5EZIH 1V7MH 3AB0C 1BQHB 3EOAB 3RPIB 1LDPL 1WZ1L 5J7CC 1AGCA 4CDHA 4LLVA 3LQMA 3K8LA 4NOBA 3ARGC 1F4AA 5KZCB 5DJ6B 1FPTL 2UYLB 2A38A 5FYKH 2FJHB 4PJEF 1WFUA 4G8IB 3FO0L 3TZVA 4JVPA 5TE6L 4P0DA 3HI6L 4ZYKA 2D9CA 4QTHB 5IJKA 3W81A 3OKYA 3FB6B 2V2XA 4LLUB 4GRWH 1HQ4A 1F42A 5IWLA 2AJSH 5FB8A 1I8LC 1R6VA 1A14H 3C8HA 3B9KD 4XBGA 1JYWA 1NGQH 3A6BH 4OZFA 4G6AC 1FJ1A 4LAJH 5LJYH 1S7QA 2A1WL 3G6DL 1AXTH 2WUCL 3SDAC 3I50H 1KV3A 2NX5B 1BD2B 4P2YA 3M1BB 1OAXH 4U2YA 3L7EB 4O00A 3VXSB 4K3JH 3QDMA 4JR9H 2DQGL 2DL2A 5EU7E 1FORL 3DVNB 1MFDH 3EOBA 4K23L 2YN5A 1I1AB 4HGWA 4J7RA 3SJVD 3N1GC 4LSPH 4EDXA 5J3HC 5HYJA 2GCYB 1AGFB 4RAVA 5M95B 2VTFA 1E4XI 3BGFC 1WFNA 4PRBB 4GQ9H 4X6FA 4GAGH 1INEL 4P4KA 4JY6A 4Z95H 5F7DA 4YHPA 2PN5A 2NY5H 4FQ2H 1JZ2A 2YN3A 4O51B 5CBEB 4LCYB 4HX1A 1OPGH 5TPWL 2XTJE 2ZP0T 4LASL 4PJBA 4CMMB 3ECBB 4M7LL 5C0IA 4KI5D 1P2CA 2F19L 2AS5M 2EDFA 2VLKA 4RZCB 2FD6L 4BUGA 2X4QB 2CDEA 2Y9RT 1P4IL 3E6HA 4R4ND 4NFBA 5J13B 3RWJB 3DVFA 4UILL 5H37G 4KGLA 1ZLSL 4R6UA 2ZZUT 4BFGA 4M7KL 3MGTB 4MA3A 3I3EA 5B38A 2DD8L 5IBLC 1FFNB 1EERB 1VFUA 4Q2ZA 3MV8A 1FZJB 4N5ED 1LQSR 3ARBC 3BDBA 3VFNA 3FOMB 3STZB 2MPAL 3WN5A 1NUDA 5E2WH 5IFAH 1UCBL 4MA8H 2OXGA 2VLJE 2G9HA 3TVMC 3QJHA 4Q9RL 5GGVL 2NW2A 4WI7A 1SBSL 3BW9A 5GRVK 5C2UB 1WZKA 4LCWA 5D9SB 2VXSH 4XPTH 1I1FA 2FX8H 4G9FE 1JK8B 1H3TA 3WO4C 4KAQH 4Y8DC 4TRPL 3MLWL 2XTJB 1IGJA 5FAAA 1CXFA 1QBLL 3ARDA 4LOUD 4PGDB 5DA0B 5CSGA 4ACPA 5K9JL 3HCVA 4MXVE 5HGAB 1YEGH 3BZFB 4X9BA 3IDYC 3U0TA 3O45B 1AXSB 4HEPG 4Z7QE 1BFSA 2FLRT 4LLQA 5KSAD 1RHHA 2DLGA 4UTAL 2FIRT 1AI1L 4MWFB 3DX7A 5T5NG 4P9ML 4HWEL 3NABH 1X5YA 2NCMA 3TBWA 2W07A 1ZEAH 5DEZA 2C3WA 3QFDA 4N0YL 3MRHB 2MNUA 2UUDH 3NZ8A 2K7PA 4K9EH 4PGCA 2VLJB 2CLVB 2ADGA 5IEKB 3PL6B 3FFDA 3ZZ1A 1DDHA 3UTTA 5HYQA 2WNGA 1LK2B 4NOFA 3S88L 2W65B 4G9FB 4AG4L 4O02L 4X7TB 3ZTNL 4JHAH 4QHKJ 4NWUL 4U4BA 4DVRH 3OQ3B 4LL9A 2QR0A 5BQ7A 3U4AA 4M7ZC 5HI3D 3RIFF 5E8PB 2NYYD 3RDTB 2IPKB 3IGAB 2D03H 1WQVT 1QEWA 4KKAD 4HIEB 4QHKI 1SYSB 1HOCA 3H9SB 1G7LB 5E2JA 4WV1B 3QNYB 1O7SA 2VSDA 5K59F 4FFVC 3RVTD 1K8DB 4CL7A 2AABL 5EO1B 2PYEB 3V8OA 4YK4B 2HAZA 2GSIA 5AYQA 3LS4H 4NGHL 1G7QA 4RSVA 4OV6F 5IHZB 5I1DA 1A7RH 4TPRL 1ZA6B 5F3BA 3HI5L 4XMLH 5ITFB 5TF1H 4XPAL 1AJ7L 2FL5A 2CH8A 3CH1B 3S96B 1ZT7A 4RDQG 3RY5A 1D5ZA 4ZTPL 3OHXA 1ZA3B 4ZO8A 1GGCH 3O8XA 3QQ4B 1XEDA 3BGAA 1C5CL 4HZAA 4K2UL 1GVIA 2ILLA 2L7JA 4M1GL 4UNTA 2DQEL 3TA3C 2EE9A 1FL5A 2R1XA 3NACL 1PEWA 1TQBB 1WTGT 4BSJA 5GHWL 4N0UE 3DBXB 4HEME 1PKQA 4NUGL 3O4LA 4PJ7F 3HC0B 3KPPB 3LN9A 5EDXA 4NO5A 3IDXH 1C5BH 4KK9C 2Y5TB 1UM6L 3HMXA 4YDKL 4DUVA 3HR5B 2BSRB 3GK8L 1K9TA 1T2JA 3UZEA 4ZD3H 4HGKC 1F13A 3HE6C 3EYFB 1BWWA 3P0VH 4N9GA 5MI0B 4EIGB 2H2PC 1SHMA 2V5SA 1AD9B 3E1F1 3RWIB 3RRQA 2VDML 5IB5B 3C2AH 5DJZA 1F4WL 4H25B 4UV4H 1AE6H 4J6RH 3NCCB 3FT3A 2R2BA 1B3JA 2ED8A 2AAVA 3TBVA 1VFAA 3ALPA 4RIRB 3U7WL 1R3IH 3Q3GA 5CGMA 4N0UB 5JORA 1NUGA 2EDOA 3TNNB 3W9DB 5DRXA 5E8DH 2UY6A 4CAGA 2DM4A 1JHKH 3UPRB 4G8GD 3QUXA 5HDBF 5I75B 3CFDA 1RUPL 4QOKE 4Y2OA 3L5WB 3VI3F 1KB5A 1E4XH 5IIEA 3RU8H 4LPCA 2A6JA 3U9PH 2BSTA 1KLGA 1ZT1B 2I27N 3GSNA 3KPSE 5B3JE 4U7MA 1RULL 4XHJD 4FZEL 5I0ZA 4RQQB 4KMTL 2R0ZH 2IPUK 2NY3D 2D0FA 3PWVB 4MGXA 3QDHA 1KXVC 4RWYL 1DLFH 4NQCD 4ZOAA 2R2EB 4Q7DA 4KKBD 3BEVB 3WIHL 1IBGH 1DR9A 2YPKB 2XKSA 3MNZB 2I60L 4AEHH 4ODTL 1JGUH 4KUZL 4Z7VA 4W6YB 3T77B 1FYHB 4YR6A 4XT1C 5D5MA 2DYPD 3SGKA 2PTUA 4QOKB 1X6LA 4F2MA 1DE4A 5HHOD 2NW3A 4K7PX 4I0KA 1NEZB 3ZTJG 4PLOB 4KZEH 2O5YL 1NBVH 4YIQB 1OP9A 4F58L 3ARZA 2RR3A 3VGDA 2V7HA 1D5BB 4LQ1A 5FECB 2QHRL 3QIWC 4HIXL 1I3GH 1XF4B 1F4YH 1FHGA 3TIDA 4Z7WF 4QRQA 4UTBH 2JJSC 2YRLA 1GOFA 3NH7L 3QFJE 4W70A 1CGSL 5DYOA 4JFZL 3S37H 4FQPA 4O2EA 2X4UA 2X4PA 3SKMA 2BX5A 1CI5A 3FQNB 4HUUA 3O41B 3C5ZD 3JTSB 3KYKL 3K81A 4XX1G 4XWOD 1N6QL 4M48H 3GBNL 2QADC 3HNVL 5I6XC 3X11A 2BVPB 2HTLC 4FTVD 3SDDC 4P2RD 3LDBC 3MRLB 4MDIB 5ADPH 4JY4A 1LDSA 5FYKU 2M2DA 1Q9WA 3V6FA 3WD5L 5EBWB 4JM2A 4MXWH 1LEGB 3RGVC 3MV7A 5BV7C 1KBGL 1XR8A 5T1DH 4U6HB 4V1DE 4P99A 4LLAA 4RGOH 2CLZB 3CD4A 5E99H 3DMMB 1YPZE 5DZLA 1EMTH 2EEAA 1EDQA 1EX0A 3WV0A 1R0AH 3MV9E 1OSPH 2R2HA 3LKQB 1MJUH 4JCMA 1X5HA 3QFJB 2XXMB 5IW6A 2XWBA 3O2DH 3TT3H 3DVIA 1F90H 1K3IA 1OAZL 4G8GA 2XICA 1BOGB 4H1LB 4JKWA 2WV3A 4LRIA 4YFLI 2EDRA 2H6PA 3D9AH 3UO1H 4XPBL 3IJSA 2QKIA 3BHBA 1V7ML 3IXTB 1QFUH 2V9RA 5JR1H 3ULVD 4AY0A 3V5DA 1VACA 3JV6A 3VFRB 2AXFA 1ERNA 4S11A 4NCC2 3X13A 3SE3A 5FA3B 1W0YT 3T1FB 3TP4A 1ZKAA 1IGTB 1R3HB 1UJ3C 3ZHLA 4XVSL 1IAIM 2WINA 4V1DB 1CFQB 2NY1D 5SWZD 4PGEA 3VCLB 3GMMB 5CGTA 1OAUH 4PV8B 3WHXB 3IS1X 2BXZA 5DJ0A 3B83A 2ATPA 2UWEA 4KGJA 2P5EA 3C60D 3MV9B 4L3AA 5L2KE 4NRZB 3BDXA 4LNVA 4D0DA 2P24A 2WIIB 4U1SB 5B21A 5IMKB 1H15B 3BN9D 1A6UL 1OTSD 2BVOB 3HKFA 5ETUA 4H8WC 1G7HA 5AG8A 2Q86A 1OAXL 1L6XA 2JJUA 4M62H 1A3QA 2DYPA 4I13B 3DTXA 5HHOA 4WW2F 4Q6IC 3NCMA 3STBA 1S78C 3EYSH 4HJ0C 5I17B 3CXDH 1MF2H 2ORBL 3FAXA 1AGEB 3BMWA 4LSPL 1XF2B 1J11A 1IAKB 2IH3B 1IL1B 4WY7L 3I75B 3TYGH 2VAAB 5C08E 3SDAB 5FM5O 3G6JE 1TLKA 3IKKA 4HWNA 3HN3A 1HE7A 4FZ8H 3QJFB 4FQ2L 2DIAA 3F12B 2W0FA 2Z8WC 4LNRB 4DKFH 1CIDA 2XG5A 1EJOH 1D5IL 1OPGL 2VSCA 1LO3L 4WU5A 2JB6B 2H3NB 5INDA 2VDQL 4W4OA 3ZKXC 1G6RH 4L1HA 2NY7H 4JG1L 4U1MB 1I9JH 2DM2A 3BGFB 4DEPC 4L4JA 3FB5A 3C5ZA 5L2KB 5E03A 2X4RB 3QEGL 2ADIB 1KCVL 4HZLA 2AK4D 4FTVA 1SM3L 4P2RA 1QRND 3P9LB 2FYYB 5CZVL 3FN0H 2JB5L 2ENYA 5HHNB 1OAYH 4U1HB 4R90H 4JPVL 1DQLH 1RSFA 1TJIH 1YEIH 3L5IA 4AEFA 1GCFA 4PJHF 5A2KH 5E2WL 5IFAL 5BVJB 4MA8L 5I2IA 3VW3L 4GKSB 3QUZD 2HVJA 2DKUA 1A1NA 3NA9L 3M8OH 3U46A 3G6JB 3G5YB 5DLMH 1PVHA 2VXSL 4XPTL 3AY4C 3U36A 2FX8L 2VIRB 2WM0A 4NKDA 4HUVA 4KAQL 3ARBB 1ZGLM 2ARJB 1GHFH 1PLGH 2FJFB 4TN9A 1VERA 3OKNB 3HPJB 2WWKO 4C83A 4OQTH 2BDNH 1LE5A 1XZ0A 3NCBB 4LPYA 4YO0B 5EZJA 3S3SA 3TBYA 4P23C 4U0QB 1R5WB 3INUL 4JGJA 2NY5C 1XGRB 3MLUH 4FQCL 1ZWIA 3WJJA 2VXUH 1ZEAL 1CGTA 5DURD 1BX2B 3CCHB 2CKBA 4OLXH 1J1PL 1NBQA 1A9BB 1Z5LA 2VDRL 3IDYB 5CJXA 4CVXA 1GL4B 1Y6MR 3Q2CA 5SWZA 2YPLE 3CFBA 3OB8A 4QT5A 3QQ9D 3GGWB 2GK2A 1RUQH 4PTUB 3C60A 2BCKB 4HMEA 3U4BL 1DP0A 4ZXBC 5C0RH 3MOBL 1ZHNB 4U05A 1UB6A 5IBUB 4MJ4A 2LABA 4XGZA 4Y4FB 1GPOH 2FH6A 2JIXD 1LP9F 4KKNA 5CINH 2WLYA 2H26A 3CMOL 2E7LA 3RVUD 1S7UA 3NFPB 4OGYL 2CUHA 4PLKD 4JFPB 3NIGE 1DFBL 1OGTA 3U1SH 4G8EA 1QFWI 3ARQA 4AENA 5IVXE 5IFJA 4OFKA 1P4LB 1TZIB 1IEHA 1A7RL 1MCBA 3S36X 1CLOH 4JFED 1IZKA 2YPLB 4Z7UA 1F5WA 1L7IH 4XMLL 4ZFOA 4DN4H 4PJFE 5FUZH 4NSKB 5K9KB 1ED3A 1G9ML 3IFOA 5FM5M 5D7IA 3DX8B 4KRNA 4FXGB 4PJ9D 1CXHA 3OG4B 3GHBH 4KQ4H 3I85A 3KDMB 2DLHA 1MVUA 5ICYA 2AK4A 3VI4F 1DQDL 5HI4D 5I8CB 2KPNA 2CPCA 3BDYH 3O3DA 3WDJA 4ZUTA 3WNNA 2QLVB 1HWGB 3WNMA 2NNAA 4G3YH 4K9EC 5L2JA 2EO9A 3L95A 5IV2A 2VZSA 4JB9H 4MNGA 1EA9C 3K8KA 5E1HB 5E6IC 3C9NB 4MVBC 4IOIA 4D3CH 1IC7H 4FXKB 1YZZA 1X5GA 5TQ0H 4LVOC 4R8WH 5IW1B 3VGEA 4AM0A 4TUKH 3JWOH 3TA3B 3VRIA 5IVXB 1D6VL 1MCKA 4JRYA 3MCKB 3BOVA 1U8KA 3TT1H 1SMOA 3B8YA 3EYOA 3FQXA 3C5SB 4PJFB 3P0VL 2NY6D 1VKXB 5I15H 1ZOXA 1CFNA 2ATKA 4IRJD 1PX3A 4M6OH 4MSWA 4L8CA 1TJGL 5I0DA 1JGDA 2OK0L 4JPKH 3GJFB 3OKDB 1M6OB 4DAGH 4HKZB 2EXWC 1X7QA 1AE6L 5FK9B 1H3PL 2R1YB 3OR7A 4J6RL 4HWBA 4XXDA 4W6XB 4U6XB 1B4JL 5ID0B 4NKOB 3GMNB 3HZYB 2HG5A 1Q9OB 4ELKA 4DGVH 4WCYH 4OZHE 1R3IL 4ZAKC 5KW9L 3PG2A 4K3DL 1ADQA 2IPTH 4PGBB 1OTTD 3CFCH 3VFWA 6CGTA 1MJJB 1T7YA 1K4DB 1JHKL 2VLRE 1A5FH 1ZHLB 3QDJE 4MAYD 4ERSH 5ACLA 2VXTH 3VDBA 3LRSB 4EI5D 3A0OA 1PGRB 1CGUA 3MRIB 5CIPA 5SX4I 3X3GL 3NIDF 4UUJA 1CD1B 3RU8L 4GKNB 4I0PD 1TVBB 1JTOA 3D18A 3U9PL 3LEYH 5HHPA 3D2UB 1R3KB 2W91A 4I2XE 2JIXA 3G04B 4PJIE 4UDUA 4R96A 2DQCL 2EDQA 4QCIA 5IGXL 1IKFL 4HUMB 5KG9B 2IANE 3CVHB 3QULA 1R24A 4KV5E 2R0ZL 4NP4L 4RBPH 5MERA 5I8OH 3F7PC 4KFZC 1RVFH 3VMPA 4OZHB 1NAKL 4PRAA 1C1EH 2ZSWA 5I19L 3O3BA 4JFEA 4OB5L 1H0DA 4OF5A 1JGUL 4R9HA 2VLRB 3LV3B 4XZUB 1MCIA 2XFXA 3SGJC 3ZSTA 3OGCA 5JPNB 3QDJB 4PJ9A 4JDZB 4YDIL 3ULUD 3NAAH 4DKDC 5DFTA 5DT1H 4KZEL 1QR4A 3RBGA 5DQ9A 1XIWA 4NO0B 3LSOB 4I2XB 4HS3A 1SJHB 3N50A 4GQPH 4P3CL 4PJIB 3ZT6A 4QKXB 3QXDB 2CJUL 4QHMA 1TJHL 4OLVH 4U1IB 4NHUA 1IGCH 4Y5YA 4Z7NF 4M6MH 4X0KB 4XP5L 5JUEL 4J3XA 2PW1B 4JAMB 3EDFA 3IDIB 4ELMF 3VE0B 1OW0A 3MGOB 4W68A 4ZPTB 2V5RA 4U1GC 3S37L 3HMXL 1LILA 1I4FA 3OL2A 2BSSA 3TYFA 1GH7A 3ELAT 4M48L 2P45B 3MA7A 2C3VA 1PBYA 4ODXA 4K7PH 1T80A 3RWCA 4L3ED 1F4XL 5FF6B 3UROR 1KPUA 2FEDD 2F5BL 5ADPL 4QHUA 3OKMA 4BQBA 5GRJH 4QY8B 1T0MB 1BECA 3JWDH 4NIKB 4BKLB 1C8PA 4DZ8B 3FN9A 3RZCC 1PY4A 4LPUA 3QZWA 2C7UA 5J12B 3NTCH 2QADB 4LSQH 3X3FH 5DJCB 3QXVA 5IBTH 5I6XB 2HMIC 1A7PL 5BRZD 5E00B 4AJ0A 3SDDB 3DSFH 5KVEH 3HFML 4P5MB 4G6KH 2F74A 2A83B 4QF1A 5BV7B 4HPYH 1E6JL 4CADB 1TTGA 5DJAB 3TT3L 4GAJH 1F90L 3H7BB 3KR3L 4IHOA 4KI5F 1QA9B 1JRHL 2ENSA 2V7NB 3SKNB 3PABA 3DROA 4EI5A 4EUPB 2FZ3B 4CW1A 5CEZH 1GRWA 4WEMB 5CIPH 2C1PA 1KB5L 1YYLH 1S9XA 1QFWH 1BMGA 5ESVB 3GSNL 3WS6A 2IFFH 2EDNA 1RZJH 4M61A 1HYSD 5DTFB 2A9NH 4PBVC 4GSDH 4JZJA 3MMEA 5AD0A 5J6HB 4X4XA 4I3RH 1KOAA 1JTTA 5IKCB 2ZOLA 2EKJA 4MX7A 1E0OB 1I8KB 1IFHL 3KNBA 4BH7A 4UQ2A 5TQ2H 5DJDB 1I8MA 1B0GA 1OHQA 4JFYB 4ZS7L 4I48B 4TTDD 3T4AB 3BQUA 4U1LA 1A7OL 5EOQL 1DBJH 1NCCH 1RZGA 1NFDB 4QHNB 2XTLA 1FFOA 3EYSL 3UDWA 3GI8L 1MF2L 1SVCP 2XZZA 4WVRA 4P4RA 3D39D 3S34H 4JO3H 2DJUA 3QIBA 1FP5A 1EJ6A 3H0TA 2Y23A 3LB6D 4NHCH 5FYKE 3T3ME 3THML 1S7TB 2WW8A 3IJHA 2J5LC 4N0CD 2P5WA 1XCQB 4FA8A 1EJOL 2X1QA 3V6OC 4Q6IB 1N5YH 1QLRA 1PFCA 1MCOH 5CD3B 4GRWE 1ZLWH 2X1WL 1OM3H 2AXGB 1OGAD 3WIIH 4OUUB 1FCGA 2QL1A 1ZK9A 3SDXE 3OPZL 1AO7B 2NXZC 4IS6B 4FOMA 1CK0L 1FNAA 1KPRA 3GJEA 3F7YB 3L7FB 4L3EA 4WTZG 1GAFH 1HYRC 1MRFH 2Q3AA 1KTLA 3ZKXB 3FN0L 4IRSC 4R90L 5HVHC 3BKML 4EN3C 4DEPB 4OZIE 3V6ZB 5BJTB 4WWKA 4OTXH 1YN6B 5DD3H 5BRZA 4P3WA 1P4BH 4O2FA 1NCDH 3X14B 4L4TE 3R1GH 5SX4H 1FVEB 2NY0D 1GIGL 4PRDB 1F02I 4WU7B 4U1KA 3F7VA 4WHTB 5MP6L 3QH3A 1VFBB 4NQDA 1FL6B 5SV3A 1GHFL 3HC3L 43C9A 4BQ8A 4Z7VF 4GRWB 3LEXB 5C7XH 1YNKL 5TDOB 2OL3A 4XH2A 3SDXB 3KAAA 5EORH 5HY9B 2HVKA 2E7CA 1ITCA 5JW5B 2DQJH 5IOPB 3VMOA 3MLUL 3KWWA 5CGYD 3HMWH 3PGDA 3STLB 2VXUL 1OAQH 3RWEB 4Y7MA 4X6CF 1HHHA 1Z0NA 3RI5K 2R0LL 4OZIB 2X89D 2EC9T 4FQHB 4W4NA 1NDMB 2Z35A 1QBBA 1JV5B 3NVQA 5JIIA 4PG2A 1WAAF 3V4VH 4CDGC 4HUWB 4L4TB 4TUOA 2DQTL 4C56D 1F6AA 1RUQL 1YEKH 4LPTA 3P2TA 4PJ8C 4JO1H 3WHE0 2A6KB 1Q72H 5D8JH 2DTSA 1UJTA 5MENE 4NJ9H 4XHQA 3ARPA 2Z4QB 5JIHA 3O0RH 3UC0H 3UJTL 1UZ8A 2QQLL 4EQ2A 5ENWB 4NQUA 1GPOL 2FIKB 3WKML 2ED9A 3CU1A 4Y5XA 5CINL 1HDMA 5HHVL 5JW4Q 4DZBB 1T21A 4ZXBB 2NTFA 5F97E 3WFZA 3H3KA 1VADA 4N0FB 5IESL 3D39A 4LKCA 3REVB 3WXWL 1XGYL 4NNYB 2R29H 2Z31C 1VSCA 1FRGL 2CRZA 4U7KA 4X83A 5EIIA 1H5BA 1W0VB 4OCYL 2CDGB 1N5AB 4PLJC 4ZUWA 1JF5A 1L7IL 4LLDB 1E28B 1MI5A 5FUZL 1PD6A 1ZLVH 2N56A 5HDQH 2X4OA 2H8PA 5ADOL 1JWUA 1NAMH 1BBJB 1NC2D 3WEXA 5AZEL 5MENB 5A2FA 3Q6GH 4OGZA 4O9HH 1JHLL 3PWPA 3AM8C 4POZD 1G7MB 1T7VA 5TDPB 5DO2D 2FWOB 2J8UA 1CL7L 4JHZA 1Q9LA 1T5WB 5C09A 4OV5A 2XACC 3HZMA 2IADA 4JB9L 3VFMA 1ZGLP 1KEML 1MJ8L 3VXMD 4LU5L 2BOBA 1AGCB 1Q1JH 5KVFH 2GTWA 5H94A 5K9QI 3TV3L 5HYJE 4JHWH 3S36H 4UDTA 3ZE0F 1GZPA 1H8SA 2N4IA 1WBYA 4HH8A 4XPHL 1ND0B 4BZ1L 4D9QD 4TUKL 3HAEH 3T0EA 3RTQC 5EZLB 1HXMA 5D1ZC 5D71H 1N59B 3KPRA 3QIUC 1CXKA 4KPHL 3T04D 2JLLA 3DO7A 1R5VA 1NMBH 3M45A 2WUBH 5E6IB 2VLKE 2FH8A 1DUZB 2V2XB 5FYLH 2D31A 1BF8A 5JW3L 5L9DL 4JEGB 4Y1AD 3LN4B 3SE9H 3WFEH 5DC9B 2OL3H 3TBTA 4LIQH 4S1RL 4M6OL 1FJ1B 2PXYC 5DD0H 1JUFB 5J1SC 3LHPL 1BF2A 1QSEE 4V2CB 4ZQKA 1WEJH 1U58B 4GLRI 3MV8E 3TNMA 1T1YA 4GRMA 1RURH 4WCYL 1RK1A 3EOBB 4HKXB 2MQCA 1FN4B 2CKBL 2IQ9L 5AG9A 2AJXH 3CFCL 4EDXB 1S7VB 3OR6A 2OJEA 4M6AA 1HH9A 1A5FL 3ZYJA 4P4KB 4F7PB 4LCWE 4C56A 5GGUA 1CXLA 3FQRA 2UZIL 4XMPL 4ERSL 2AI0L 3WBDA 3GRWA 3DX9B 4ZAKB 1UWGH 5DEFA 1A6TB 2W0PA 3Q6FB 4X7DC 2VLKB 2ZCLH 5BCAA 3RVXC 4J12A 5T1KB 1UKSA 1RHFA 4JFFB 3E6HB 3QEHB 3LKNA 2HJKA 3FZUC 4LVNC 3D1MC 2O5XL 2GT9A 4DJMA 1MNUH 3JWOC 4X5LA 1QSEB 3V4UL 2ZUYA 4NQXB 2E7HA 4ISVA 4N1CA 1RVFL 4QHLB 4MA1C 3WN5B 1G1CA 1HHIA 1UFUA 1FG2B 3OJMB 3VXNA 1MWAH 4HD9A 5GGRB 4Y0GA 1FZKA 3CDGA 1QQDB 2E6PA 1FDLH 1UVQA 3OXSA 4LCWB 4ZFOL 3UTTE 5B39B 2I9TA 2XKNA 5CMAA 2UUDK 1NC2A 4PJ5D 1I1FB 1S9WA 1QZ1A 4R2GC 1JZ3A 4URTB 5FYJD 4MQ7B 1Z9SA 3VXRD 5DT1L 3QI9C 2DRUA 5F9JA 2FBJL 1JPSH 4TNVK 4GMSH 1T20A 3D85B 4JKKA 4X9IA 3HCVB 5DZNA 3UPCA 3ULVF 4LCCA 4G80B 2V2TA 1DLHA 2D0GA 3MLSH 2EC9U 1KJMA 4YHYC 1QSVA 3K2MC 3ZDYE 1MELA 3V7MA 3HRPA 3OKOB 1VPOL 4UNUA 5F1OB 3T0AA 2A74B 3TBWB 4A2MA 4LLWA 3T0DA 1X44A 1VENA 1DBMH 1I9RH 2EYSB 5T5NF 3C6SB 4NNXB 4R4BB 4X6EB 4YZFE 3MBEA 3CNKA 3ZE2E 4ZFFA 3UTTB 1QFHA 3IDNB 2FRGP 2KBGA 5KANG 3MJ8B 3LMJL 3TF7C 4PJDF 4GOSA 2W1NA 2DQDL 5E95B 2QR0B 4ZS6D 4XCNA 3VH8B 1ZHKA 1MFCL 5IBTL 2NR6D 1BM3L 3P4OA 4HWBL 3DSFL 5KVEL 1KIPB 1T83A 4HUKB 1TVHB 1IT9H 5DJ2A 3MNWB 3G5ZB 2V17H 1HOCB 3A6OA 4G6KL 4OLYL 1WBXA 5CUSH 5JQ6H 1LE9B 2WBKA 1ADQL 1MH5B 1W2KT 3O4LE 1U92A 1AHWA 2X9YA 4OJFH 3UBXI 3RZCB 4YWGH 3A6CL 4F7MB 3RL1B 1BQSA 2DBLH 3E6FB 4PGJA 5I1DB 2OSLA 4EJ1C 5SX5K 3TO4D 5F3BB 2I5YH 4WUUD 4PJXF 2OMNA 4LSVH 3MLYH 2Q76B 1EHLL 1BHGA 1ZT7B 4WFGD 5E94B 3O6KH 5KSBA 4DFHA 5HD8C 3N85H 2W9DH 3RVVC 1QVOB 5D2LA 3O8XB 4RDQF 1RZJL 5D6CA 2AEWA 1IM9D 1YQ2A 2A9NL 3FKUS 2P8MA 1FL5B 3KYNA 4FQLL 5EG6C 4RFNB 4HGMA 4HKBB 1A1MB 3VFUA 2CLRB 1S9VA 2ZPKH 4YHNB 3HS0A 3O4LB 4K7FA 5EIVA 4NO5B 1UEYA 1RFDL 3HHRB 3EKCA 3JWDC 1K5NA 1XH3A 1FGNH 3EYQC 4E5XB 1CFVL 4PJ5A 3QDGB 4Q9QH 1DBJL 2H1PH 3DRTA 2FECL 4KROD 4OFVA 1ORQB 2B0SL 3Q48A 3KXFD 1GGIH 1FV1A 1LO4H 3QG6B 4NHCL 2H32A 3HUJE 25C8H 3MLVL 1EBAA 5GGQL 3GHEH 5C07B 4XMKL 4L29B 1VEOA 4NM4L 4QRUA 3BIAX 3P73B 2VITA 5I76A 2BK8A 3QDAA 3BD4A 3LAFA 4OLZL 3QWQB 1NSNH 1CGVA 1MAKA 1KUMA 3FMGL 3O3EB 2Z8SA 4JDTH 1RUMH 3L3KA 4KTDH 4X7SH 4Y4HC 4FFWC 3O4OB 5TE4H 2J5LB 4JDVA 5C0EA 4GLRH 3JWNC 5E2UH 5DWUH 1JPST 5EO9B 4HUNB 5D5ME 3MLTA 1F58H 4X6BA 1FFPB 3MBXL 1YY9D 5IIEB 4KK8C 1FAIH 4P59L 3PP4L 4PJCF 1KLGB 2HKHH 3DXAA 5T33H 5KZCD 3I2CL 3ZE1E 5DD3L 4NQEA 2RB8A 1P4BL 3HUJB 5KBNC 3WS3A 2W9EH 4NO3B 3PHQB 5I71C 4IRSB 3D0LA 3FHAA 4K71B 4KVCL 3TWCL 3QQ3A 2A6DB 5ILTH 5LXGH 3B9VA 4EN3B 5HVHB 4LGSB 2CRYA 4JY5H 5D1QA 4OUOA 5C7XL 1OVZA 1NEZG 4LHUB 5EORL 1DEEA 3TO4A 3SKOB 2NLJA 5DSCA 3MLRH 2NX5D 1BD2D 4UZGA 3WYRA 4F57H 1JI1A 1IGFL 3PNWA 2Y06L 3BISA 2IGFH 4BK5A 4LCUA 2E9BA 4LHJB 3VXSD 2XQYG 4LPXA 4HFWA 5ABDE 3QG7H 1YEJH 3SCMD 4FHBD 4GG6F 4F15C 5IM7A 2NW3B 3RZWA 1QKZH 2W92A 1I1AD 3MV7E 4P2OD 2X1XR 4JN1H 4YHOL 1IC1A 1IM9A 2R9HD 2V7HB 5E8NA 2LU7A 5FHBH 1I7ZB 1LO2L 2EDLA 3CX2A 3CFJB 4N9OB 5FO7B 1CGXA 3VJ6B 1WVZA 4HS6A 4L8DB 1YEKL 4XXCC 1G6RB 1VGEH 1REIA 3S4SB 4IOSD 4MZ3A 3QO0A 2D2OA 4F33B 1FLRH 5MEPA 3QO1B 3GMOB 4OGXH 3SKMB 3NCEB 1YQVH 2BNRE 3FCTA 1B6UA 3S3JA 1RZKH 5GSRA 3ULUL 5HJ3B 1KFAH 4XC3H 3FQWA 4PJ8B 2CGRL 3MREA 5F1SA 3KXFA 1TFHA 3OKLA 4JY4B 3CFKA 4XTRD 4KK6D 2JCCA 1A22B 4OKVB 3B2VH 3N0PB 4JM2B 2RFXA 5FV2A 3MV7B 2EDWA 5HTSA 3TM6A 4H1LG 4F3FB 5EULV 3EO9H 3BGMA 1EV2E 4WW2C 3MLZH 3VWJC 1DQMH 2UWEE 2P5EE 3MRFA 3WUWB 4OM0L 1HK6A 1DBAL 1XF5B 4K94H 2Z31B 3OAYH 2R2HB 2XTJD 5C0CA 1NGWA 3M17A 2XWBB 1EK3A 5D2NA 4H26A 1EO8H 1GGBH 3OB0H 5B8CC 5C70A 3MODL 2BNRB 4JFXA 2Q8AH 1NFIB 3OTTA 1BQHA 3IJSB 3MUY1 3RPIA 5KN5B 3F58L 3QWRD 3VFGH 5KVFL 2NMSA 4DW2H 4M7JH 4JHWL 5DJ6A 3S36L 4U49A 3V5DB 2UYLA 2E7BA 1Z6JT 2FJHA 3JV0A 4HJGB 3X13B 4G8IA 4HXBL 1RUKL 1YEHH 2WINB 1UA6H 4J4PA 2VLJD 3PL6D 4QTHA 4Z8FL 5FGBA 4PGEB 5ALCL 1LMKA 2WUBL 3P77B 1MCWM 1WWCA 5B4MC 1BPVA 2UWEB 4G9FD 2YXMA 2P5EB 3WFEL 4U7SA 1TZGH 2OL3L 4AYFA 3E8UH 5F6IB 4AZ8A 1UGNA 3MFGB 1YECH 2NX5A 1BD2A 5D1ZB 5I1IH 3QIUB 1G7HB 3ABZA 1WITA 3RDTD 3L7EA 4K8RD 2VL5B 1WEJL 3VG9C 4KKLD 4MD0B 1PG7X 3DVNA 1BJ1J 1I1AA 3H9SD 4G9DA 5I1GH 1AGFA 2AJXL 2PXYB 1W0WA 4RFOH 6FABL 3D69B 3HG1B 2PYED 4G6ML 3WFBH 3VD4A 3C08H 3QNXB 4IJ3B 1KCSL 1LD9A 5CBEA 2VDPH 4LCYA 2C5DC 3MRQB 4CMMA 1F3JB 2DI8A 2BNUB 3A67L 3ME0A 3Q1SH 2AGJH 4RZCA 4AEEA 1DJSA 2X4QA 3IAGC 2BNQE 4YQXL 2VZUA 1SJXA 1BP3B 3SQOH 1T89A 3CAFA 1J5OH 4WTXA 3MGTA 1T22B 4D94A 3FQUA 1BJMA 1FFNA 3HB3C 2OZ4A 1NCTA 4L9LC 4XCYB 3L3JB 4MB3A 4YUEL 1FZJA 3WLWD 1MHPL 3STZA 5JZ7C 3B3IA 3BSZL 4WWID 3MLXL 2LVCA 1BAFL 1DUYB 3T2PA 5DQJB 3LPFA 4XVTH 5D9SA 5E6YA 2HVJB 1VHPA 3G6AA 2BVQB 3U46B 1P6FA 4RRPA 5AWNL 1JK8A 3B2UD 2L0DA 3HNTH 1JBJA 4I3SH 4QNPE 4NKDB 2Q8BH 3MTRA 2ICES 1J8HA 3JV5A 3ZYZA 1NANI 1AD0B 1JPSL 3LCYA 2BNQB 5DD6A 1TNMA 3O45A 1AXSA 1N26A 4LGPB 2WBWB 3L3OA 3L5HA 1XZ0B 4Y2DC 2R0KH 3OF6D 3MLSL 4Y4KC 3TBYB 4OLUH 1SJEB 2H9GB 3GBMH 3QWRA 4R2GB 2MCPL 5L88L 1F97A 4MWFA 4XP9H 3QI9B 4PRIA 1TETL 1EEZA 1U8NB 1ZT4B 4YC2C 1PW3A 3IU4L 3S3PA 1BGXH 3MRHA 1JE6A 2CKBB 4OT1L 5DUBB 2VLJA 2CLVA 5IEKA 4DWHA 3PL6A 4CVXB 1S7XB 1T2XA 2X1OA 3TH3T 2B2XL 1BFOB 2F53E 4QT5B 1JWSB 2W65A 4G9FA 4YXLH 3DNKA 5D7IE 3S35X 3FFCE 3U6RB 4X7TA 2EDJA 4M9OA 3BKJH 3DO3A 3BAEL 1FYTA 1P7HL 4YHLH 1NGZB 2XNAB 4J3TA 5DK0B 1WF5A 2IPKA 3RDTA 1QLEH 3IGAA 3RA7H 4HIEA 3CSBA 4YHKH 4M5YL 1SYSA 3H9SA 4MNGE 1G7LA 4WRLA 4PJ7B 3QNYA 3IDMB 3TN0B 3MXWH 1S7UB 4J3UA 4KJPD 2WBJC 4Y16C 2A9ML 2PYEA 5EO1A 1TDQA 4DN3L 5CCKH 5HDBE 2J6EH 4U6VH 1OARH 4LSTL 3FOLB 4MJ5B 2FATL 2XZQH 4G8EB 4X9GA 5IHZA 5GRUL 5IUSA 4AENB 2VDLH 5CEYB 2IMMA 4JRYE 3KLSA 4XCFL 3QXUA 3GRWL 3P0GB 1UYWH 1G7IB 2J1KA 3S96A 2VABB 2F53B 3OGOE 1ED3B 2OS7A 4JPIB 2QTEA 4XPGH 4WDIA 1ZA3A 3U82B 3FFCB 4QOKD 3O6KL 1A9EB 3ORJA 2WQ8A 3QQ4A 1MVUB 5ICYB 3RIFK 3OKEA 4Q0XH 5I30H 1CGYA 3KYMA 1Z3GL 4HPOH 4HULB 3IT8D 5KSVB 2OP4H 3L95B 1H8NA 4KHTL 4OFIA 4TYUA 4M1CD 3WJLA 3KPPA 4IOIB 3P3YA 1BOYA 4QRPA 3HR5A 3PGFH 2EYTA 3K74B 2BSRA 1Y6KR 4ETQB 1AQDB 3BP6B 2BSED 1Q9KB 3OJDB 3DUHA 5CP3A 2GW5A 1KJ2A 1X4YA 3LVEA 2H1PL 4QTIH 3EYFA 3DSNA 2QSCH 3FQXB 4HKJA 4N8CH 2DQFA 1H3VA 5C0DB 4H5SB 1AD9A 4IMKA 4JREC 3RWIA 5EFIB 4L5FL 4YEFA 1BQUA 3V2AR 5DHVH 4Z7WE 4L8CB 5F7EL 25C8L 5IB4B 5CJQL 4H25A 1CFTB 2YD4A 3UJJH 3GI9H 3OR7B 2ZUXA 4NN7B 1AKJB 5C0ND 3DMMD 1AC6A 4F7TB 2HG5B 2WP3T 4P48A 4DGIH 4ETYA 2I9LA 4BM7A 2A77L 5E56A 5EBLA 3QFJD 3VFWB 2YR3A 4JKMA 4KRPD 4JDTL 4RBPK 4PP1D 4X7SL 4KTDL 5DWUL 2B39A 3SE4C 4MZ2A 5IQ7H 1F58L 3K1DA 2FJGB 3BH8A 4S2SB 1FVDA 5CIPB 5IMLB 2BOCB 2Q6WB 1ZT1A 5HHXL 1BJ1H 1IARB 5LVEA 2AXJA 5DMKB 1YJDH 4Y4HB 5E5UB 3B9KC 3L3HA 1IKNA 4Z7WB 3O9WA 4YBHA 2J88L 2X44D 1OWRM 4RA3A 4V1DD 2J8OA 3QAZC 3QULB 4YHZL 3MCLH 4M1DH 4D8PB 2QSTA 1SY6A 1TITA 3AREA 2ITDA 2BRRH 2GJ6E 3H9ZA 1G9EA 3T0WA 1CLZH 2IG2H 3BEVA 4OCWL 2YPKA 3MNZA 3MV9D 2ZSWB 4ODSL 3TO2B 2WZPD 4NKIL 3V8CA 1H0DB 2BMKA 2CUMA 4E0RB 4I18C 3BI9X 1OCWH 3LKOB 4CMHC 3SOBH 1INDL 1UH2A 2VQ1A 3OSKA 5ANMA 3VWKC 1WK0A 1NCWL 4AT6A 4DKEL 1IC4L 3O11B 2VKWA 3ALXA 4J1UB 2GFBA 4KI5C 1QKZL 2OMBA 5FGRA 5GS3A 1MREL 1VESA 1I3UA 4G6AD 1D5BA 1CE1L 5FECA 4R4NC 3SDAD 5J4MA 4XCCH 5D72L 1XF4A 1FO0A 5FHBL 5CBAB 1ONQB 2P46B 4PBXA 4QHMB 4NHUB 4Y5YB 1NANH 1I9IL 1MRDH 3ZKSD 4F15B 4LSUH 3MJ9H 5I1JH 3MV11 5HYIA 1RZIB 3E3QC 2GJ6B 2OYPA 4HCRA 3O41A 2RJMA 5JW4M 1I4FB 1LO5B 1MLBB 3JTSA 3QCUH 4JCLA 4KHXL 2BSSB 5FV1L 5L2KD 1AFVH 2BVPA 2YD6A 5D96C 5FYJL 1ROWA 4Y88A 5F7NC 3RWCB 3MRLA 2HLFC 4FQQB 1JYXA 1KPUB 4QHUB 5ERWA 4NQSB 2MFNA 3FL7A 5F21B 1UB5B 2PR4L 1IGML 1NLBL 2DDQL 4U6HA 5HI5C 3RWGB 2ZNXA 1RAMA 2JELL 1MIEL 4LP5A 1P5UA 3GUTB 1CCZA 3QZWB 2C7UB 1MCEA 2OI9B 2XPGB 5EWIL 5D7LE 3DMMA 4QXGH 5C08D 2EDXA 3MLZL 4EUPG 3C09C 2EIEA 3MUHL 2CRIA 5KSAC 3FRPA 4IIQA 3QFJA 1CLCA 2F5AL 1WIUA 2YXFA 3IYLW 3OWEA 4H1LA 1BOGA 3QEQA 1IAII 1LGVA 4IHOB 5F8QC 4OGAC 4NZRL 4LAQL 4WW2B 1A7BA 1KB9K 2DAVA 3VWJB 3ULUE 2VQTA 5GISL 3GSWA 3IXTA 2C1PB 4OQ1A 4JFQA 5E1AB 2HFGH 1S9XB 2FR4B 1MLCA 3VFRA 2NQCA 4V2BA 5FA3A 3T1FA 3ULSB 1IGTA 1R3HA 5B8CB 2NY2C 2KZWA 2QBWA 2P5WE 1CFQA 4M61B 5HI3C 1UA6L 2DM3A 5EU3B 5MEOB 2NYYC 3VCLA 1OP3H 3GMMA 1LNUB 5D7LB 4X4XB 5IEHA 3OV6A 4PV8A 1RZKC 3ARGA 5IMMB 5EUOF 1QHOA 2AJVH 4NRZA 1U8IA 1TZGL 3KYOB 1FAKT 3I9GL 4U1SA 3RVTC 5IMKA 1ZE3C 2BVOA 2RCSH 1OQXA 1ZLWK 4L3EE 3VXUE 3BD5A 3H9YA 3TH2T 1WV7T 2K1MA 4Y4FD 3O6MH 5D1XC 3BQUB 4U1LB 5DZOA 2Q20A 1RZGB 1I8LA 5I17A 5JTWA 3H3PH 5LGJA 1AGEA 1IAKA 3JUYA 2IH3A 5T5FL 4KUCD 1IL1A 3I75A 2VAAA 4P4RB 3R06B 4P9HH 3SDAA 3WFBL 5BRZE 4K94C 8FABB 3U7AA 4D9LL 1BFVL 3QIBB 4HC1A 2O5ZH 3F12A 3B5HA 4LNRA 5C0GB 1EBPA 2NZ9C 3ROLA 2P5WB 3VG9B 2JB6A 2YPLD 1HZHL 4NQDE 1VGKB 5GXBB 1A4JB 4U1MA 2VDKH 1NAMB 4OF0A 4WFEE 4XNYL 2XRAH 4HCRH 3BZEA 2YPVH 2ADIA 3DECA 1PG7H 5BO1H 3TCXA 4O58H 3VXUB 3P9LA 3P0YL 4XBEL 3LKSA 4N8VB 3UMTA 4FQXB 4E9LA 1A4KA 4U1HA 5IB3B 4YE4L 1U9KA 4PUBL 1ZAGA 2EEDA 3MUGA 4KY1H 5BVJA 4GKSA 3E2HC 3AXLB 4XVTL 3G5YA 5JDSB 2E27H 5F70A 2XWJB 3HC4H 3HAEB 4L9LB 3TA3D 1M7IB 2VIRA 4U1KB 3F7VB 5IP4A 3ARBA 1YUHB 2BFVL 3DVGB 2ARJA 4NQDB 3LPWA 2FJFA 1E27A 43C9B 2UVFA 2ZOKA 2B1HH 3TVMA 3HPJA 5LGHL 2OL3B 2DOCA 4XH2B 3DLQR 2EH8H 1RI8A 1CZ8L 4YO0A 5I18H 3VGAC 2HVKB 4S0SD 4OLUL 3BYTA 3DGCR 1XGRA 1WCQA 3LN5B 1UXSA 2BJMH 4N8PA 1XGPA 4JGUA 3PGDB 5GRVL 1BX2A 3CCHA 1A9BA 2DQHL 2PKDA 4GXVL 4PIRF 2AVGA 4HF5H 5F6HJ 3PUCA 2VXQH 1RIVL 4Y4KB 2D7TL 3GSXB 1CG9A 1MI5E 1IEBB 4HLZG 1A6VH 1BQLH 3GGWA 1J18A 4MNHB 4PTUA 1JPGA 2BCKA 4XHJC 1AR2A 4YXLL 2WANA 3RL2B 3TFKD 1QLFB 3RY4A 1JNJA 1GOGA 5F6HI 3WFCH 3SPVA 2FX9H 4FABH 4LSRL 3PWPE 1ZLVK 5TF0A 4OZGF 5D7KE 3RX5A 4LDEB 1NDGB 3NIFF 3CVIH 1JGEB 4YHKL 3IFLL 4G7VH 2HKFL 4OCSH 4ONFH 5C09E 3PGCB 1RZFL 1J86A 2DQIL 3NFPA 5DFWH 5HVFB 1T21B 5ACMA 1VADB 1T3FB 4M5ZL 4NO2B 1UH4A 2HLAB 3B6SB 4KJYB 1G9NL 1J05A 2HTKD 4U6VL 4XP4H 4WI4A 5EIIB 1P4LA 4EBQH 3T0EE 1MWAB 3S35H 2XZAL 3KPRE 2YPLA 1DANU 2FX7L 2VLRD 3BESR 4Z76B 3I6LE 1FBIH 1VA9A 4NSKA 4PB0H 5K9KA 1MI5B 3P11H 1NCBL 2CMRH 3K8MA 4XWGH 5ITBL 3DX8A 3QDJD 2X4OB 2H8PB 1HKFA 4HQQL 3KDMA 3CDYA 4HBCH 5I8CA 5I1HL 4MQXD 3PWPB 3QWOB 1OF2A 4NO0D 5T3XH 2OZ4L 2JJWA 5SWQA 3JBG7 4NJAH 2R0WL 1KC5L 4K3GA 4KWUA 4XWOC 2OP4L 5C09B 1TCRA 1NUFA 1RY7B 1IAIH 4FXKA 5DDHB 2P8LB 3T09A 4UDTB 5IW1A 2P8PB 5GS0H 1WBYB 3FAWA 2GITB 1RD6A 3TA3A 4C56E 4OZFG 2AJZA 3O3UN 3V0WH 2AV7B 4X8JB 3MCKA 4Z0BH 3AGVA 5EH1A 3DO7B 3C5SA 4HJJL 4Z78B 1VKXA 1KELH 2R8SH 2D31B 3EYUH 4L1DA 1A7QL 4FQJH 5AUMB 3OKDA 1M6OA 2APVA 4HKZA 2R1YA 2VDOH 5BZWA 4OM1L 2IQAA 4ELME 4F80A 3HE6A 2QADD 4U6XA 1JZ5A 2VR5A 5ID0A 4NKOA 3SDDD 1Q9OA 3JV4A 2OTWB 2FO1A 3F65A 3GO1L 1T1YB 3TNMB 2DN7A 4PGBA 4L8SC 4GG8B 4DGIL 5CJ5A 5JOPE 3KHOA 1YEFH 3ZDZF 3MRRB 4K3EH 4GW5B 2VB5A 5KJRH 4LRNL 3ULVC 5DR5L 1VB9A 4CU8A 2V2WB 1KEGL 2EDYA 4HIHB 1DL7H 2B4CC 3FB7B 3W5NA 4PJGA 5GGUB 1KN2H 1FIGL 2DI9A 3FQRB 3FT4B 3LRSA 2W38A 2ZG2A 1CD1A 3RP1A 5DMYA 5KAQG 5FHAL 2EKSB 5C9JB 4K07A 3BKYL 1T1ZB 1D7FA 3D2UA 1JNLH 1R3KA 3ZKNC 4UV7H 3G04A 4FQIH 4MAUL 1KG0B 4RFEA 5KG9A 3CVHA 3T0VA 3BN9C 1KT2A 1MY7A 4ELMB 2GT9B 4WHYG 1V3JA 1JIBA 1A3RL 2P1YA 3EHBC 4OZHA 4ISVB 4CVZB 3TESA 4IOFD 1T1XB 2IG2L 3HPLB 1J10A 2Z93B 1HHIB 5L6YL 1J1OH 4EXPX 1G7JB 2VLRA 3DV4B 4XZUA 1JYVA 4NBZB 1UVQB 4PY8J 1MCLA 2VXVH 3QAZB 5JPNA 3QDJA 2I9TB 4JDZA 5CMAB 3I6KB 3MA9H 1E6OH 3P4LA 3GMRA 3QRGL 4NBXB 1NH6A 4NDMB 3B9AA 4NO0A 3QCVH 3LSOA 4I18B 4I2XA 4CMHB 1B4RA 3GM0A 4KVNL 4PJIA 3KHQA 4XCCL 1N0XL 1AGDB 3QXDA 3VWKB 5EA0L 4U1IA 2V2TB 5F3HB 1DLHB 4U0RC 3X12B 1NCAL 2PW1A 2OR7A 4JAMA 3L5XH 1MRDL 1S78D 4LSUL 4HJ0D 2AEQH 1MFBL 1P84J 3MGOA 4KJWC 1WIOA 3OJ2C 4ZPTA 3DOSA 3AS0A 1FFRA 4DOHB 4YDVB 2ITCB 4WI9A 1LO0H 1KLUB 4XNXL 4JVUA 4RX4A 1AO7D 4KKCC 3QIWA 5DUPH 4KI1A 1AFVL 1YJDC 1KJ2L 2CDFB 3QUZC 1B90A 5AZ2H 5FF6A 3BKCL 4NNPH 2IBZY 2JJSA 5T1LB 1MCQA 4JQIH 4QY8A 1T0MA 4JPWH 4DTGL 2BY0A 4MXVF 3BPLC 5BW7C 2YOCA 4DZ8A 5D2LE 5I1KL 4JM4H 5FKPA 5ISZA 2DLFL 2LVEA 4XCNB 5DJCA 1DBKL 1JPTL 5D96B 4OCXH 3SDDA 1D9KB 2X4SB 4QXGL 5FYKD 4C55A 4R3SB 4P5MA 1WBXB 1FH5H 3RGVA 2HJFA 1ULVA 4CADA 3IB4A 3H7BA 1QA9A 5KSUB 2J4WH 2V7NA 3FT2A 4HG4J 2FZ3A 1UEMA 4RGMC 3TPKA 4DK6A 5DMIH 5CFHA 5JNYB 5LCVL 3QQ9C 5ESVA 3IFPB 1K6QH 3N06B 2B7DT 1MVFA 1BIHA 3NZHH 3VGGA 4PS4L 2B20A 5DD1H 1GJIA 5J6HA 4M9PA 5I1LB 1GSMA 4MCZA 4WENB 3MRKA 5JA8B 1U42A 2ZKHH 5IKCA 4NC1C 1NLDL 4L4TD 5IG7B 1SY6L 5F7WC 1OTUC 4KJQC 3SDCC 4O2CB 5BXFB 4IEFB 3ZL4H 5GS1C 5B22A 1I7RB 4POUB 1UJ3A 2Q7YA 2NY2B 2UZYB 4JFYA 2JE8A 4I48A 4ODVH 3LEVH 3QUYC 1P7QB 1X4XA 1NFDA 4TVPH 4QHNA 2Y4SA 4TOYL 3V7AE 4KQ3L 3DRTB 4WNQB 2YD9A 4ZXBD 3QT2A 4XVJH 2R69L 2EICA 2L7UA 1FNSL 4TSCH 3DXAE 1OOAA 1WZLA 4JZOB 5AYUH 1FV1B 4NQEE 4UINH 1S7TA 4N68A 1FO0L 2HH0H 5D1XB 1RIUH 1XCQA 4FMKA 4JKPL 3BWAA 4JFHD 4HIIB 4Q6IA 3QUMH 3N1FC 2VITB 3CLFH 2VDKL 4OUUA 2OJZH 3KYAA 3WO3B 4EQ3A 2F54A 2IFGA 4LARH 1AO7A 2AJ3B 3OXRB 4IS6A 3AU1B 4HCRL 5MEND 4HS8L 5JMRA 3F7YA 3L7FA 2ADFH 3IAPA 3L3KB 5BO1L 1OW0C 5IB2B 4JANA 2AJUL 4QWWD 4JGMA 2GAZB 1CICC 3MLTB 4X6CB 4X6BB 5HPOA 5D7JC 2IJ0C 3OBAA 3UBXB 2C3HA 3V6ZA 3L3GB 5MEQA 1JN6B 2NY6C 2YMXH 1QYGL 4TNWF 5KVDH 3DXAB 5F88B 4PJAF 2IAMC 3X14A 4NQEB 4IRJC 4LHUG 7FABH 1OLZA 3E0GA 4OCRH 4PRDA 1U93B 2ZCHL 1VFBA 5E08H 3J7HA 3UJIL 1A6PA 5FKAA 5E6ID 3LEXA 5D1QB 2IEPA 3E2HB 4UU9A 3SDXA 4KDTC 3IF1B 4FP8L 1OTTC 2EH8L 4R26H 5HY9A 3U83A 3ZKMC 2FEEI 3SGDI 3AY4A 4P9HC 4NUJA 4M8VA 4EI6A 1ZHBB 5JW5A 5CILH 5DSCB 4FG6D 5F1IB 3D6GA 1S3KL 5IVZB 4MAYC 4LCUB 5JHDE 4B5EA 1MAML 3RWEA 5B3JF 3MYZA 5IM7B 5I74C 4P5KB 5A43C 1NDMA 1WLHA 1X5IA 2XN9A 4I0PC 1OP5H 3JZ7A 5HYJD 1JV5A 4E41A 3VGAB 1XCTB 4HUWA 4L4TA 1V3MA 4P4KD 1KYOK 2BHUA 3VD3A 1ZVYA 2HRPH 4PP2B 5D6DC 4NZJA 2X40A 4DGYH 1ACYH 4JZJC 4ZUUB 2AQ1A 5TFSH 1HINH 5C0CE 2Z4QA 3NA4A 2VLKD 1NL0H 4XP6L 3QO0B 4RWHA 4UIKL 5BMFL 5T1KD 1ZTXL 4JFFD 2FIKA 4DCQB 3CVIL 3OAYK 4UT7L 4HXAH 1MQ8A 2WIMA 5DI8B 4DZBA 4ZXBA 1C7SA 1JNNH 4L9DA 4N0FA 5E4EC 3OB0K 2VC2H 4RMWA 4WIQA 3REVA 3K1KC 1CDGA 1QSED 4CNIA 1QSFE 4NNYA 2XWTA 3GIZL 3WUWG 5JHDB 2D7MA 4Z6AT 4Z77B 1W0VA 1WWBX 2RFXB 4J3VA 5KS9A 1J9CT 1N5AA 4HC1L 1S9YB 4EBQL 1HILB 5GS2H 2ICEA 4LLDA 1E28A 3BGMB 1FBIL 4LCWD 2ZCKH 1JGVL 5DGQA 2ZUTA 1BBJA 3S5LB 4TSBH 5MENA 5HYSA 3RPKA 3KJ6H 1X5ZA 3EO0B 5CD5C 4HBCL 3JTTB 1TPXB 4WTWA 5EU4B 3ARTA 2NX5E 4N90E 1G7MA 3D85D 5TDPA 4WFHE 4X6DA 2FWOA 2FHBA 5EIQA 2WWKT 4JFXB 3U7YL 3L1OH 4XAKD 2PTTB 2BC4B 2DWEA 2A2QT 1TTFA 1JMZA 2FEDC 5KANI 4F7EB 1QSFB 1ND0A 1WFOA 3LH2H 2VZTA 3T4YA 5I1AB 1YC7A 4GMTH 5EZLA 1YPZF 3V0WL 1JMXA 1N59A 4Z0BL 4D0CB 2XIDA 5C9KA 4QGTA 3GKWL 1D5MB 1AC0A 5E6IA 5FUCC 4Y5VC 2AEPL 1DUZA 3L6FB 4KTEL 4K55A 3UTTD 1P53A 4R7DB 3LN4A 1UM5L 3DGGB 4KRLB 3EYUL 4MB4A 1E4KC 5GJTH 4IMLB 1JUFA 3TJEH 2XZCL 1RUAL 3BT2L 4A6YH 3VFVB 5J6GB 3GKZA 32C2B 1U58A 2QQKL 3LZFH 2VDNL 5I9QC 1WC7B 4HKXA 1FN4A 4IDJL 2AJYH 4GBXB 1YEFL 4G9DB 3GFUA 3CLEH 4RAUA 5J06A 1T03H 1MHHB 4K3EL 3UTPE 1S7VA 1W0WB 3RZCD 4F7PA 4HFUH 1KJ3L 4KMQA 4EKXA 1YEEL 1FC2D 1N8ZA 4JO4H 4DVBA 1D3CA 2HMID 1LD9B 4W81A 1U3HC 4PJDE 2OBGA 3DX9A 1IGYB 2QHLA 4ZAKA 2NXYC 1A6TA 3D5OF 4L8SB 4M43L 3Q6FA 1N2RB 1J8HE 1F3RB 5JA9A 5F96H 2B5IB 4ZFGH 4MHHI 5T1KA 3BE1H 4JFFA 3QEHA 1L7TH 4OIIH 2VZVA 5F9OH 2OR9L 2UZXB 5A3IC 5DA4A 5FUOL 4OLWH 3G5XB 3O8XD 5CZKA