1MFCL

High resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
b'QAVVTQESALTTSPGETVTLTCRSSTGTVTSGNHANWVQEKPDHLFTGLIGDTNNRAPGVPARFSGSLIGDKAALTITGAQPEDEAIYFCALWCNNHWIFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN)
publication title Recognition of a carbohydrate antigenic determinant of Salmonella by an antibody.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1993-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfcL01
4OD1L 3O3DB 3VH8A 3JWNC 3MLVH 3D39B 1DEEA 4JHZA 2F58H 4WI5A 3WS6C 3LS4L 4X9GA 2E8YA 4U1JB 4RX4A 3IXAA 1ZHBB 2K7QA 3DO7B 1F00I 1X5ZA 2VDQH 3INUH 3C2AL 2OYPA 3V5KA 5EU6B 1ZVSA 3FN3A 5HHOB 4XPGL 3QO0A 4C57C 5DEGB 4R8WH 4IRZH 1IAKB 3QUMB 2ZUSA 1ZGLA 3NFPB 4AEIH 1QQDA 2RIKA 1KYOJ 5T33L 1YYML 5C9JA 3EYQC 1TVHB 2XFXB 4EOWH 4F2MB 3LN5B 5ALBH 2AJSL 1H8NA 4NJ9H 3RVVC 4WU5A 5HDOA 4P57B 4RGNB 1OP3K 4G80B 3CCHB 4L29B 3T1FA 4ZG1A 4FFWD 1SYVA 3UYRL 2OL3L 4JB9H 5KSUB 1DP0A 4OCMC 1SJHA 2P5WB 5SWSE 1U58B 4TRPL 1I1AC 3SE4C 4JKMA 3AAZA 1I9JL 1T0PB 5FA3B 4OF0A 5D70H 4MD5B 2P49B 3FO1A 2C7UA 1VSCA 1MHEA 1GVIA 3MLTA 5IK3B 5MHSD 3OF6A 4MNGE 3UTQB 3CSGA 4Y4KD 4JCLA 2YSSA 4U6TA 4WEBL 3RAJL 4HLZH 3IDMB 3WNNA 4XP5H 1AKJB 2AJXH 1DUYA 1I7ZA 3QZWG 5C0BA 4MMZC 3X3GH 1QBLH 1R3HA 4N5EC 5DR5L 3RGVB 3TYGL 3ZKXB 3VWJA 3FAXA 4HKBB 1EAPB 4DEPC 1NCWL 2XTJC 1NCDH 2AK4E 5IF0B 4OZHA 1A6VL 4Y5VA 5IWLA 3G04A 3QFJA 5C6WH 3BSZL 4M6ML 5KVFH 1CFNA 1FN4B 4W6WB 5L7XL 4PJ9D 1J12A 3L3JB 4HS6B 1KXQE 2PTUA 2QSTA 1EPFA 2W65B 4MX7A 4J3VA 4U1GB 3CFJB 4PJDA 1WCBA 2B0SH 3F58L 5GGTA 3S36L 5CWSB 4JLRA 4HUUB 3Q5OA 4CMHB 2H6PA 1KB5L 3RJDA 5IW6A 1JCKA 2E7MA 3VXSD 4OQTH 5HYJD 1VEMA 4BSJA 2V2WB 3FT4B 4APQB 4JDZB 5E08H 1BQHG 1BAFL 2BVQB 1PEWA 1OT2A 4XCEB 1TPXB 3WIFB 2XNAA 4JFXA 4I0PA 2R56L 4GBXA 3TWCH 3UTTD 1CBVH 3MV11 4R4NC 3SDXF 4BK4A 1TFHA 4U2ZA 4YBQC 5FGBA 3CFDA 4JQVC 1BM3L 5IJKC 1P4BH 5E6IA 1KSRA 1OGTB 5KSBA 3U4EB 4OM0L 5DMKA 2V9QA 3JTTB 5J9PA 2WSKA 1DDHA 4LSSL 5FM5O 3TYFA 1UH2A 4TVSa 3VMNA 4MNQD 2AV7B 3ARWA 4BFEA 1B6DA 4BH7B 1ZLUH 5C0NC 4IBLT 2P24A 5FK9A 5FO8B 4O5LH 1I3GH 3GBNL 2H2SD 2R0LL 3UO1H 2B5IC 5I8KH 3E8UH 1FYTA 1HQ4B 2NPLX 1QRKA 1P7QB 4L9LB 3DX9A 3ULUE 5TPWH 1JWUB 3CSBA 2DQUH 4I3RH 4P2RE 1F4HA 1KTDA 4KJPC 1F42A 2AP2A 5LGHH 4X4XB 2FHCA 4CBPA 5C3TA 1JPFA 2ITDA 4YBHA 4HUXA 1T1WA 2HJLB 4Z5RB 3X14A 1S5IH 2BSTB 1FNSL 1SJXA 3O9WC 4KTEL 5FCUL 1QSFD 2GSIA 4KUCD 1D5ZA 3VFUB 5MEQA 4YXLH 3IETA 3QUYA 5FHAL 5CEYB 3VXMD 3P77B 1M7IA 2AXJA 4HHAA 2CDFB 3HG1B 2GTWA 3HKFA 4GW1B 4UQ3B 4WV1C 4MQ7B 4W4OA 1T80A 3K4ZA 4ZFOB 1T04A 5ISZB 4G43A 1YPZF 3V6OE 3WFDH 3WHXB 2BNQB 4NM8H 5D7IA 5L88L 3DUHA 2V2TB 3TV3H 2FBOJ 3CK0H 5B21A 1BQLL 4M62H 1EFXA 2QKIA 2X70A 3FB8B 1FAIH 4FQQB 3T4AA 1G7QB 3E3QE 4LAQH 4Q6IB 2QR0B 5TE6L 1QFWI 4WFEE 5I8EB 4U3XA 2CK0H 3V8CA 4PJGB 3V79C 1VFAA 3FMGH 3DMMA 3E0GA 4ZTPH 3ROOB 1DQMH 2R23B 1VEPA 3QG6B 4BM7A 4AEEA 1KPRA 1EHNA 4RGNC 4FFZH 5KZCB 1AE6H 4F3FA 5IJVB 4JO3L 1OP9A 4JG0L 1T7XA 2DQEL 1DEEB 3UPRA 4FHBD 1A6WL 5F6HI 3IXAB 1QACA 1QFWL 4HGKC 2FBJH 3MCLL 5EO1B 4DQOH 1N64L 3UZVB 4RMTA 3WFBH 1J87A 3QO0B 2DJSA 2NY3D 2HWZH 1UT9A 3TJEH 3QI9C 3BJ91 3O6LH 3OXRB 3BZ4B 2C3VB 4Z95L 4I13B 3EJYD 4GG6F 2V17H 4KAQL 2H32H 5DQ9A 4RRPG 2OZ4A 1ZGLB 3QG7H 5HDBF 3GHEL 5EPMA 2C1PA 5C9JB 2A73A 2QV2A 4HXAH 3V5HA 2J8UA 1WK0A 4X7TB 1QHPA 4WU5B 4D2NA 4NKOA 4D9RE 1KLUA 3RL2A 3RKDD 1TMCB 2XZAL 3RGVC 3C60D 1LK2A 3MRQA 1SYVB 4KJQD 4DKDC 5IKCB 3N06B 1SJHB 5GRVL 2H9GA 4ELKA 3DV4A 1LO3L 5HVWA 5J8OA 5I71B 1LDSA 4KRPD 4WEMB 4KDTA 3FO1B 2C7UB 4ELME 1UENA 1MHEB 4KQ4L 4S1RL 3UBXI 3MLTB 3N1FC 4U1GC 3PWNA 3EO1A 1DR9A 4MCZA 3QNZB 2YSSB 4G6AC 4JRYD 4CVXA 1BIIB 3ARSA 1CICD 5EOQL 1DUYB 4ODTH 1YJDL 1I7ZB 1JWSA 4K23H 1N2RB 2IC2A 3W11D 4APQC 1R3HB 4WUKL 4XAKD 4G7YL 5BRZA 4P2CG 1GAFH 3R1GH 1LK3L 5CUSH 3VWJB 4PRID 4GMTH 4F37K 1KJMB 2NY5H 1KIRA 4HBQA 1GXEA 1GGIL 1EGJH 4RBPH 4OZHB 2DLEA 3QFJB 3WFCL 4X6FA 1CFNB 2LABA 3EDEA 4LLVA 3WIIL 4UT6H 1QSED 3NIDF 4YZFF 1GPOL 3IYLW 4MX7B 5DJ0A 5GS0D 4OLWL 4O58L 4PJDB 1FNGB 2F15A 4PGZA 5DYOA 4LU5H 5ILTL 3L95B 3MPCA 2IALA 4LCUB 3QCVL 5IW6B 4LPTA 3RI5K 1RIHH 3U7WH 4WTZA 2G5RA 2P44B 2ZOLA 2EXWD 4QT5A 1FORH 4XPHL 1EHLL 3WDJA 1PJ9A 2XNAB 5KW9H 2Q1EA 1JV5A 4OQ1A 3U82B 3UX9B 2DQDH 1D5IL 2EH7L 2Y9RT 5DK0A 2VERN 4ZS7H 1CDYA 2EH8L 3TIDA 1EHXA 2ZUQC 3BESR 4JR9L 5IB2B 2WQ8A 4TTGA 4WY7H 4U6XA 5E6IB 5CHNA 4LSTL 5E0QA 5KSBB 3HNTH 4N0UA 5DO2C 1A9BB 1MHCA 5DMKB 5C0CB 4MJ4A 4NC2B 5J9PB 4BH8A 1JTTA 2NZ9D 1X5HA 5EORL 2CLRB 3MNVB 1J8KA 2OJEA 1FDLH 5I75B 1F02I 1MHPL 4Y1AE 1QHOA 4OFVA 2P24B 5EDXA 4Z7WE 3IFOA 2DM7A 4M6NL 1QO3A 1YC8A 2X42A 1FYTB 3QNXA 1M4KA 3BKCH 4NQDD 3DX9B 3VWKB 5FDYA 4UUJA 4OFYD 4KXZH 3KGRA 1KTDB 5CAYB 4DGYL 4WGVB 2W9LA 4L4JA 5GS0H 2ITDB 2F53D 3RU8L 1T1WB 5C0IA 1N4XH 2IPUG 1T83C 2CDGA 2Q20A 4Y4KA 1D5ZB 1HKFA 4H1LA 4ZNEA 4X6DA 3GSNB 3IETB 3QUYB 4G9FE 2GK2A 1DFBL 3ZHLA 1M7IB 1KC5L 1VADB 3PGFH 4HHAB 4JGJA 4DN3H 2GTWB 4OGAC 1KN2L 1AXIB 2IBBA 3O3BA 1JK8B 3TIEA 4Z7OE 4WDIA 3TCLA 4D9LH 1T04B 1JRHI 2EIZA 4G8GD 4ZO8A 4LEOB 4G43B 3CMOL 2QSCH 1KEGH 5MEPA 3PNWA 4Z7NE 3G9VA 3QIUD 3LEYH 5D7JD 4Z6AT 1OT1A 1DQDH 2WIMA 3IJYA 1P84K 3MJ8A 4Z7UA 3MLWH 1PKOA 3ALXA 4XPTL 1EFXB 5GGRY 2X70B 4PJ9A 3ARYA 3H9SB 5HHMD 5I1KH 1KXVC 3T4AB 3PHQA 5IROA 3P30H 4OZGE 1DSFL 1RMFH 4QTIH 5DHVH 1JRHL 3WS3B 1DBJL 4PJAE 3PWLA 3MROA 3ZKND 4KZEH 1Q9OA 3DMMB 3ZKQD 2AJ3A 3BP7A 3VXSA 4JAMA 4X7DC 5HYJA 1KPRB 2VAJA 4OJFH 3G5VA 5FB8A 2YBRA 4XP6H 5IW1A 1RZ7L 4XNMA 2VLMD 4LMQI 2DQGH 4P9ML 1OM3H 1INEL 4LPWA 1A7OH 3LKRA 2W9DL 2GIYA 4UAOB 1DANT 3K4AA 5D2NE 1DL7H 4LSDA 1KB9J 5DQ9B 1WBZB 4G3YL 3L9RA 3QPXL 1K2DA 3K8LA 5EPMB 2WWKO 2C1PB 4MNQA 5E1HB 3BYTA 3MRMA 1DLFH 4WHDA 2CJUH 3I3DA 5KVEH 3V5HB 2YN5A 2J8UB 1P4IL 2EZ0D 3B5GA 4KJYA 5GRZA 2ZNXA 3UROR 3MCG1 4NKOB 4MYWB 3TBVB 3GJFA 4X4ZA 3FQTA 1KLUB 3RL2B 5F93C 1LK2B 3VWJC 1EDQA 3MRQB 4ODUA 3ZTNL 4XPBL 4YR6A 2H9GB 4ELKB 2WUBL 4Y5VC 1D7FA 5IWLC 2J4WL 4QNPE 4XNXL 4XTRD 3SDAD 2ED7A 4KH2A 5IHUL 4KKCC 1C8PA 2WBJD 1MCCA 3GSQB 4AMKL 1QSFA 2ICWA 3PWNB 3EO1B 1I3RA 2HG5B 2IF7A 3VXMA 4CVXB 2H32A 1MCPL 2GTZA 3NIFE 5A3IC 1FVEA 1HE7A 1B4JL 4LPXA 1FBIH 4P2QD 4NZTL 4D3CL 1RFDH 3O4OB 3MBEB 3PP3K 5IB1A 4I0PC 4IHOA 4GBXC 2XN9B 1KIRB 2HA1A 1UA6H 4MJID 3T0EE 4AEHH 1F4XH 1OCWH 3NAAL 4LNRA 4Y8AA 5ERWA 1NC2D 5FGBC 2EXYC 4YHKL 4PRPD 5E6IC 4LLVB 4F80A 1MUJB 2XTLA 2IBZX 5DJ0B 3L5WB 3R06A 4X7EC 4PJBF 5DYOB 4AENA 4DGVL 3FT2A 3LKQA 3MJ9H 4PJ5E 3OG6B 1QNZL 2IALB 3P0GB 1XGQA 4Y8DC 3SCMD 1IGFH 1EX0A 1KIUA 2HVJA 2ZOLB 2Y72A 1FH5H 3SKJH 3VWKC 4PGCA 1JV5B 1JGVL 3FAWA 2EDNA 1JNNH 3MYJA 1IL1B 4OGZA 3ZDZF 1JJUA 3E2HB 1HHKA 1JZ6A 1MJJA 3NCFB 3I3EA 5E8OA 1FO0L 4JREB 2Q8BH 3IS0X 3BT2H 5CHNB 3D9AL 1MHCB 3FN0H 1OARL 1WWWX 4AY0A 5AWNH 4BH8B 3QUYC 3CXDL 2AV1B 4GXUN 4KJWD 5DHYA 4HIIA 1IKNA 1F90L 3GO1H 4W4OC 3G6AB 1YA5A 1KFAH 1PQZB 3QNXB 1LP9A 4OKVA 1BD2E 4JFQA 4GRLB 3VXUD 4QXGH 4UUJB 1T66D 4M1CC 2OQJA 3OKYA 4R3SA 1HXYA 5J11C 4KK5C 3M45A 2D31A 4FFYL 5CINH 2MCPL 2ICEA 1G0XA 5SX5K 2OR8A 2VXVH 5C0IB 4W70A 2R8SH 5DRWB 2J1KA 4NO5A 5I18L 2CDGB 5D8JH 1ZLUK 5JOEA 4Y4KB 1X4ZA 5FYLE 4H1LB 1RZKL 3GM0A 4XGZB 4X6DB 4JRYA 1CQYA 2B1AL 4HK0A 3DX8A 2QQLL 1CICA 3DMMC 2B39A 3FHQA 1CYGA 3DUSA 1FE8L 4XP9L 1YY8B 1CG9B 3O3BB 2XZCH 5JZ7D 3CDYA 1NGZA 4WDIB 5DJ8A 2VZTA 4LHJB 3PL6D 1EH9A 1KLGA 4WHCA 1KCUH 4PJXE 3WEXA 5C1MB 4JJHA 4PRIA 4WFFE 5D7KE 1ZWIB 4D9QE 3PNWB 4ERSH 3V4UH 4QRUA 4LLUA 4WNQA 2DBLH 2C26A 4U7KA 3IJYB 3MJ8B 4Z7UB 4IRJD 4I0KA 4M8VA 5HYSB 4UAOC 4PJ9B 4ZUVA 3X12B 5HBBA 5LXGL 2N7AA 3PHQB 1QSEA 1VENA 4YDVA 2R4RH 4Z7VB 3KR3L 1WISA 3K8MA 3MLUH 4PJDF 1CF8H 3RY5A 3OAYH 4J3SA 1J88A 2OJZL 4B53A 3OPZH 3I2CL 5DVOA 5IT2H 3PWLB 5EUOE 2A6IA 1Q9OB 2B2XL 2AJ3B 1URLA 2R69L 4JAMB 3PXHA 1RIVL 2AJZB 5E8PB 2ZG1A 3G5VB 4QOKE 3WCYA 1J8HE 5FOBA 5FB8B 1C7SA 3FRUB 5E9DD 2XPGA 5IW1B 4HG4K 1MY7A 2AQ3A 2P42B 3NIGF 3UTTB 5CEZL 3TNNA 1MFCH 3PF2A 4RMVA 3LKRB 4RWYL 4KDTC 1CGTA 1WTGT 2CO6B 4LLMA 1N0XL 5KSBF 2J7LA 4K94C 3WN5A 4MAUH 3GJFK 1KCRL 2HFEA 1LHZA 2AEWA 4MJ6A 5DQJB 3L9RB 1K2DB 2VC2L 3UJTH 3UPCA 1AQKL 1NSNH 3MRMB 3VXRD 5D71L 2ATKA 5DHVA 5I2IA 3U9PH 4KJYB 4ZOBA 2Z8WC 4LBEA 1S3KL 1NC4A 1K3IA 1NFDB 5IG7A 3GJFB 4NQDA 3FQTB 3VA2C 1NKRA 4QRTA 4QRQA 35C8H 1S9YA 3UPAA 1YECL 4OFYA 5LG1A 4ODUB 1ZEAH 4MDIA 4AG4H 4POZD 4XCYB 4XVUD 4NFBA 4NOFA 3IJHA 2NNAA 5DRXA 5JNYA 4YX2H 4WWID 3UBXB 1NGPH 2DMBA 1RVFH 1K4CB 3V5DA 2F53A 2W59A 4IOFC 5B22A 3V4VL 1XGRA 4U7SA 4KUZL 4J1UA 4QHLB 1QSFB 2EO1A 2VZ1A 3OWEA 4H8WL 5C07E 2XWBA 3VI3F 1IAIM 4OLYL 4NCDA 4LK4A 3MV01 2P48B 5KSVB 1ZLSH 5C7XH 4JCMA 1A1OA 3N1QC 5T5FL 4HUVB 5BOPA 1FVEB 3IFPB 4HJJH 2JIXB 3HNVL 3SGKA 3PDGA 4S2SA 3GMLB 2Z31D 4G8GA 4EDXA 3NCJL 1CL7I 1IQWH 1GHFH 1X3DA 5KN5A 3QIUA 3GSUA 2ZPKL 3K0WA 5D7IF 4NN7B 5D7JA 4DWHA 4LVNB 3E2HC 4LNRB 5ERWB 1MREH 3O0RL 4BK5A 5C6TL 3EHBD 1J0IA 5JR1L 1FL6A 1FNEB 2HFGH 4HPYH 4ZFZA 4HUWB 2X4NB 2LE9A 5EOCJ 3ARGD 1EVTC 1KNOA 2HLAA 3R06B 4L3ED 2CLVA 2CXGA 4BSVB 1BEYH 1MCLA 1LEKA 4M7ZB 1FO0A 4AENB 4OCWH 1CL7L 3LKQB 4HLJA 4OCSH 1ZT1A 1JYNA 1XGQB 1RI8A 4N8VA 3MNWA 3QDJD 4R90L 4M48L 4ZXBD 1IC4L 4NNYB 1MFEH 4R26L 4FP8L 2XWTA 4GAGH 4GAFB 3NCYP 4FFWC 1F3DJ 2F5AH 4M1DH 1EERB 2QHRL 2UV3A 2I60L 2JF1A 3MYJB 4YHYB 3R0MA 1BLNA 2VL5B 3OGOE 1HHKB 1I4FA 1MJJB 4YHLH 1LEIA 3SDDD 1WFOA 5FM4A 3OXSA 4Y4KC 2BJMH 4KI5E 3UJJL 5KVDL 5CS7A 4TQEL 4LKXA 1OGAE 4HC1L 2J8UF 4HIIB 3UEZA 1U92A 5L8KB 1R3JA 1CLOL 3PGDB 4EN3A 3KVQA 3V2AR 2SEBA 1LP9B 2VUYA 2JCCA 3C60B 5FYJD 4JFQB 4XCFL 4NO2B 1AP2A 1IQDA 6FABL 2XRAL 4TUJB 2OQJB 2QQNL 1A7QH 2P45B 4R3SB 3PP4L 1HXYB 4LHUD 5IV2A 4NKMA 3MOAH 5DLML 2D31B 2OS7A 3SDAA 1IT9H 2ORBH 4O2CB 4LFHD 3REWA 4OFDA 4KRPB 4PJ9C 4HWEL 2BVEA 5F7HA 1U8NA 5IROC 1ERNA 2WBJA 4U6HA 1NCCL 4U6YA 1YEJL 4OD1H 1I7RA 4UT7L 3MRJA 1GGTA 3CDFA 1JNHB 4JRYB 4HK0B 1GGUA 3DX8B 4MXWH 1MFDH 5FCSH 2YEZA 4F7TA 1INQA 3LS4H 1GCFA 3DUSB 2BVTA 4FQ1L 1WF5A 3E1F1 5J06A 1DLHA 4OB5L 1JGEA 4P2QA 4JO4L 1NGZB 5DJ8B 1KLGB 2P8LB 3WEXB 5FUZH 4S1SL 4XX1G 5DI8B 3X17A 3HRZB 1BJ1J 5DC9B 2VRAA 1MCJA 1MCOL 4MJIA 4QRUB 3I75A 4WNQB 1RIUH 1CWVA 1ES0A 4FQXB 1NC2A 2AEQL 1YEIL 5F71A 5T33H 4EI6B 2YXMA 3HCVA 4PGDA 4ONHA 1OF2A 3K1KC 4ZUVB 5B4MD 1QSEB 4YDVB 1WZKA 4MJ2A 4S11A 5JOFB 3L3HA 4N8CL 4WI9A 3FQXA 4B7LA 4FNLL 4H26A 2J8HA 4U2YA 4ETQA 4FQLL 1ZXQA 2OL3H 3SCMA 4OZFA 4GW5A 2FX7L 4PUBL 2H2SC 4TRPH 4YHNB 5B8CA 1G0DA 2Q86A 3GMRA 4YPGA 2AKRA 3GMQA 1T2JA 1UZ6F 2X09A 1I9JH 1Q94A 4HGWA 1V7NH 3OMZA 4JFDD 2FIKB 2OP4H 2XPGB 4I4WA 1YQVL 3GGWA 1UH3A 4NJAL 1A14H 3TNNB 2VUOA 1G84A 4QRRE 2NLJB 4CMMB 1JN6A 4FXKA 5DURB 1MQKH 5FFLA 2YRZA 4LLMB 2I5YL 5TDOA 3VDCA 4J23A 3BDYL 1I8MA 4PJHF 3WN5B 2HFEB 3OJDB 1XT5A 1A7BA 3B9EA 1XGYH 2WINA 4HQQL 5TQ0L 3SN6N 2DQCL 2N7BA 3VMOA 5C86A 1FGNL 2HFTA 3BZDA 3U0PA 1A7RL 4M43H 1KENH 4X8XA 1NCWH 1TZHB 5I2IB 1DBKL 4PRBB 1CLCA 1UYWH 4HV8B 4LBEB 5IG7B 5ICYA 1A6VH 4Y16A 4NQDB 1N5AA 5I1AA 4Y2DB 4QRTB 4M6MH 4QRQB 1QTYT 1S9YB 3VXUA 5CP7A 5HXMA 2AQ2A 4LSUL 1MELA 3EOYG 4NN7C 4LVNC 3SKOA 4X6EA 1X7QA 3O41B 3F58H 5DRXB 5JHDD 4Y19E 3V5DB 2F53B 4P5TD 3S34L 4N9GA 1KB5H 5F7EH 1XGRB 5JPMA 1SBBA 4UNTA 3FL7A 3LVEA 4J1UB 5A40E 1T21A 1U9KA 4POYA 2XWBB 4JKKA 4M7ZC 1BAFH 4X6DF 5JHLH 3AVEA 5LKNA 3PIQB 3PDOB 1DQQB 4LPUA 5SWSD 3C8DA 5FYJL 2R56H 1A1OB 1RV6X 4LGSB 4F58L 5HD8D 1ZV5A 3IU4H 5I15H 3VGGA 5B39A 1DBMH 2DRUA 1UWGL 3PL6A 1FL5A 4S2SB 4TSCL 2IJ0C 4G8GB 3IDYB 1B88A 4WRLA 3QIUB 3GSUB 4O9HL 3GK8L 5D7JB 2X1PA 4YHYC 1RY7B 1SMOA 2NY5C 4Z7UF 2NY3C 2EICA 2MWCA 2VSCA 1Z9SA 2Q3AA 5HHMB 3EJYC 1FL6B 4ZFZB 4D0BB 2R0LH 2HLAB 3CH8A 3LKPA 3RPKA 4ONGL 1FO0B 1T1XA 2E8ZA 3HR5A 3BRGC 2VLRE 3UTOA 1UACH 1TQBC 5ESAB 1IKNC 4N8VB 3MNWB 4QWWD 3QB7C 5BW7A 1D6VL 4GUPB 5I76A 3HR6A 5KS9B 7FABL 5C0EA 3QR2A 4KJQC 4NC1C 2YHGA 3VFSA 2FATL 5E9DA 3FFCE 1FNSH 3DROA 4KTEH 5FCUH 3S7GA 3ELAT 1BLNB 4OD3L 1I4FB 4KRPC 2Y5EA 3GMOA 1KF9B 1MF2L 4IDLA 5I8CA 5C0JA 3VFPA 4P3DA 3OXSB 3C5ZD 1LEGA 2YPLE 3MV8E 1YMHB 4LKXB 3VXRA 2YK1L 2EEBA 3SPVA 4DOHB 1P69B 4JZOA 1CICC 1UZ8A 3BH8A 5LAXA 1CD9B 1MCFA 5EOCL 1H15B 1T1ZA 3VFGL 3W11C 4HH8A 5L88H 1VPOH 1MLCB 1Q9KB 2ZCLL 2FH8A 4H20L 2VDKH 4XCCL 2PTVA 2SEBB 3FQUB 4CJ0A 2WWMC 1BQLH 1A1MB 1PZUB 2JCCB 1KV3A 5DRZA 3UTSE 3P9WB 2V9TA 1H3PL 2B8OT 5IV2B 3W9DA 4TOYL 3SDAB 4XMPL 3REWB 4KK9D 3DVNB 1HH9B 5T1DL 3DIFB 4PB9L 3SKNB 5CBEB 5FIEA 5IBTL 4XVTL 2WBJB 5GS0C 4U6HB 1BPVA 3QIBD 4KUCF 4U6YB 3P2TA 4NQTA 5C2BH 3HNSH 4JO3H 5IHBA 1BBDL 2R0KL 3MRJB 1KELL 3ULUD 1FVCA 4CADA 1ZGLM 4P2RD 2DQEH 2YEZB 3D3VE 2B4CC 1A6WH 4W4NA 3I9GH 5HYEA 2DWDB 2EXWC 2JJSA 1DLHB 3F12A 1JGEB 5I1LB 4YNYB 5FXCH 2Z31A 4OLVH 3ES6B 1HDMA 2AXGA 5FF6A 3IFLL 5T1KD 4Z95H 4G8EA 3MO1B 4MJIB 5EZJB 3I75B 3BIBX 3GHEH 5FKAB 5HGGS 5E2UH 5K33A 4H5SB 2WWKT 3HCVB 4PGDB 4ONHB 1OF2B 4PRPB 1O0VA 3V6FA 5KAQG 5JW5A 4N0RA 3WN5C 3ARGA 3L3HB 4L3EA 2NZ9C 3FQXB 1G7LA 4JRWA 4OI7A 1OP5K 4LQ1A 2XZAH 3G5XA 3O11A 3HLAA 4GKZA 3IDNB 4JDTL 1OPGH 2FCBA 3SCMB 3QDJA 4OZFB 5EFIA 3V52L 4ZXBA 4GW5B 4JM4H 5B8CB 4YPGB 2AKRB 5IVOA 3GMQB 4XNUL 4GRWB 4K3DL 3VW3L 1A7PL 1HILA 5BZWB 1Q94B 4HGWB 4KQ4H 1ZS8B 4S1RH 1RU9L 3O3EB 1G1CA 1U8LA 3BUTA 4I4WB 5I74B 5TFSL 4WFED 2BHZA 1J1PL 1S9WA 5ICXB 3MGOA 3D18A 1LO2L 4UOJA 1A4KA 1CZ8H 1JN6B 5EUKA 4A2MA 3LIZL 5TDOB 3SDDA 1WEJL 5EOQH 1YJDH 3CUPA 1I8MB 1G1YA 1VFBA 2FIRT 4WFHD 5H35A 4WUKH 1LDPL 1KT2B 3U0PB 1LK3H 1AR1D 5E4IA 2R2CA 2Z8SA 1GGIH 4LSRL 5C0BE 3G6DH 5BV7H 5EZOL 3W2DL 5GGVY 3SGKC 3W0WB 1LP9F 5I1AB 1YN7A 3WFCH 3IDYC 4JN1L 4NQSA 3KXFE 3OX8A 3VXUB 3VG9B 4G8FA 3WIIH 3QIUC 4YLQT 1ZLWH 3X3FH 2QQKL 2VLLA 5T3ZE 5D7JC 1N7MH 2MQCA 1GPOH 1RSFA 1ZTXL 4U1NA 4LHUA 4OZ4B 3SKOB 3LN9A 1X7QB 4O58H 2P8MA 4WI8A 3V0WL 1S7VA 4CU8A 4N9GB 5JPMB 2EYTA 2Z91A 3ORJA 3F7YB 5EA0L 1ACYL 1G7MA 1S7TA 4NC0B 1M7XA 1I9IL 1EHLH 1GYAA 3RUGE 3ZKNC 3NN8A 2CKBA 1AI1L 1I1FA 3DVGA 3FQWB 5EU3B 3GSXA 4K9EC 4WWKB 4ZUWB 2VQ1B 1T7ZA 2EH8H 4YBLB 5B39B 3VRIA 2DYPD 3PL6B 4KROB 1FL5B 2KQMA 3SGJA 4LSTH 4XVJL 4HK3N 2JK5A 3T77B 4PTUA 5E2TL 4LEXL 4NUJB 3D0VA 3D87B 5F9OL 3RZCD 1GGBH 3U79A 1TJIL 5BJTB 1E27A 2JB6A 4HFWA 1N5YL 3BI9X 5EORH 1KJ2L 2PYFA 3S3JA 4IRJB 5ETUA 5HPMA 1BECA 1GOGA 3BP4A 4HT1L 3B9VA 3L7EA 1ACZA 1XGUB 4D0DA 1XEDA 3WUZA 3GNMH 5I1IL 3LKPB 1X5AA 4TUKH 1T1XB 3N85L 3HR5B 1OQXA 4KC3B 2NY2D 4Q97A 2EZ0C 2ARJA 5DHXB 1UXSA 2FHBA 5F7YC 1EMTL 4EN3C 4PRHE 2G5BB 3KYNA 5AZEL 1RHFA 1SVZA 3O6FD 5C0EB 1CS6A 2GSGB 4QXUL 2HTLD 5E9DB 3JV0A 3DROB 3PWPA 4R7NA 4XTRC 3SDAC 1CGWA 2VXSL 3DARA 1LO0L 5T3XE 5HDQL 4HKXA 1DFBH 4S0SD 3GMOB 3F7PC 1HNFA 5E95B 2PO6D 3T08A 5I8CB 2WBJC 1OHQA 3VFPB 1LQSR 4P3DB 2DIBA 1KN2H 1EVUA 4J8RA 1MRDL 1QFPA 1G9MH 2QJDA 4QHNB 3VI3E 1JF5A 5K9JL 5ADPL 3PXJA 2FJGA 3MUJA 1TTUA 2W9EH 2PXYD 5LAXB 1T1ZB 1G7HA 3FB6A 4OLXL 3QXTA 2HMID 1CGVA 2ICCA 4AYFA 1E4KA 2NY1D 3QQNA 1RZJL 1J0JA 4WW2A 4YHPA 5D7IE 4X98B 1QBAA 1IGCH 2ITCB 3W9DB 1JRHH 5JHDA 2FSEA 4PLJD 4FQJL 3PWJA 1XMWA 3HMWL 4P5TA 5BO1L 3IAQA 3S35L 5CZKA 4QGTA 3LQAC 4YHML 1XCTA 5DFTA 2Q7YB 1KOAA 3VFRA 4HEPG 1WUNT 3GRWL 4CADB 4BKLA 1IGIL 4MVBD 5HPOA 3IGAB 5SWSA 5IIEA 3SCMC 5CJOL 2DTMH 2ZJSL 4KV5F 3WFHA 4Q7DA 5B8CC 1JYVA 2PTTB 4JM2B 3F12B 1T6VN 2HH0H 2WMPA 3BAEL 3ESVF 2Z31B 1YEEL 5I1GH 1HDMB 4MNGA 1OSZA 5I74C 1YN6A 3LY6A 4G8EB 3OSKA 3NBNA 1FJ1A 4G9FD 3LRSA 4G3YH 1R5WA 1T5XB 3QPXH 5FA4A 3NABL 4NN5C 3BVNA 4HF5L 4UTAH 5JW5B 5C92A 5LBSH 3ARGB 1RUKH 1I1RA 5JDSA 2VDLH 4L3EB 1G7LB 3BXNB 3B5TA 2IAMD 1ZANL 1KJ3L 4KJWC 2ZSWB 3JV6B 3FFDB 3G5XB 3O11B 4GKZB 2C3HA 3QDJB 1W8OA 2YA2A 3ZTNH 1HINH 4XPBH 4LGRB 2WUBH 12E8H 2Z93B 3FRPA 4Y16C 5HYFA 2J4WH 4ZO9A 5JDJA 3O2WL 1HILB 3LZFH 5FO9A 4UV7L 3VG9C 1T66C 5MP6L 4Z78A 1UVQB 1JHTA 3MFFA 4NBXB 1U8LB 4YAQA 3OKMA 2M1KA 1S9WB 2E27L 5EN2B 3D18B 2IMMA 2C1OA 3OZ9H 4LLDB 1JNLL 5EUKB 5K9OA 4BQCA 2BRRH 1MCPH 4NRZA 2CH8A 3SDDB 4B5EA 3SE8H 3VXQA 3DXAB 3A0OA 5J12B 1VFBB 3C5ZA 1GSMA 4KPHL 4FMKA 4D3CH 4FRWA 5C0RL 1A6PA 1EUTA 4NCC2 1A3QA 1K9TA 1T89A 5CIPH 1U41A 5E7BA 3U1SL 1CD8A 4YBLC 3L3IA 3WNKA 2DWEA 3NAAH 3PL6C 2W92A 1YN7B 3MJGX 5BRZE 2JCCF 4HIEB 3OX8B 2AEPL 4DN4L 1N6UA 1NUDA 4G8FB 2CIKA 2XXMB 2VLLB 3CD4A 1TETH 4LHUB 3M17B 3LN4B 3EO9L 5TF1L 1HIML 4H25A 4Q58C 5DA4A 1S7VB 4NKQB 1CGUA 4IM8A 4NDMA 2EYTB 4AM0A 2Z91B 1TZIA 4P4KD 4HAGA 3KAAA 4PJFB 4KZDL 1KJ2A 1IGYA 1S7TB 5BS0E 4OZIE 5AG8A 4PV9A 1SY6L 2A9NH 3U36B 2B20A 2CKBB 4I3SH 1JGVH 1EO7A 1F58L 2R1WA 5BW7C 5C3LD 3IS1X 4M4RA 2ERJB 5GS1A 2HT3D 4XCNA 3TCXA 2BHUA 1UZ6E 5LCVL 3VRIB 3P4OB 1M1SA 3ZHKA 2WV3A 1VKXA 2EYRA 5ALCL 5T1KA 5MEOB 2CLZB 4BJLA 4OLEA 2JK5B 2W60A 3D0VB 4HIXH 2A0LD 4FG6D 4G9DA 3QUKB 1E27B 1ZT7A 2JB6B 3CXDH 4HFWB 2PYFB 5IW3A 3VI4E 3BZFB 4BZ1L 2ARJQ 1CLYH 3EJZD 3FOLA 5HYSG 3L7EB 4D0DB 4PJHE 1QYGH 3IVKA 1ITBB 1A5FL 3S97C 4NRXB 4L8CA 3V6OA 2IPTL 4OCXL 5IB3A 3UXFA 3GHBL 4NNPL 3FONA 4MXVF 3QXDB 4PTTA 2ARJB 1AY1L 1OAZL 4RMRA 3T0ED 3HMXL 4AIZA 2HYMA 5F1OB 4RGMB 1FZMA 1X4XA 4FFYH 4GAYB 2Y4SA 2XV6B 1DQLL 4JFDB 3GZKA 4FA8A 4POZC 4XVUC 5IVXE 4J3TA 3CNKA 5FGSA 2LTQB 1JF6A 5FYJU 2X4QB 3NZ8B 1VB9A 2BVOB 4PJ5D 2IBGA 4HKXB 2QQLH 3QEUA 3CGTA 4RNRA 1VHPA 1ETZA 5EBWA 3ZDYF 4J8RB 4ALAL 4ZNEE 1ZHLB 1RJZA 3HA0A 5IFAL 1OTTD 1P1ZA 4POUB 2FJGB 4EDWL 4R2GD 4KMTH 2FX8H 3PDDA 1G7HB 4F57L 2JJSC 3MRRB 3I02A 3KPRE 5I0DA 3QRGL 1ZT4A 2J88L 2VZOA 4Z8FL 4CJ1A 2Z31C 1Q0XL 2O5YL 1CN4A 4S1QL 3BKJL 5LXGH 2VDNH 2HT4D 4YHPB 4OF5A 5BOZG 2X4RA 3PQYD 4YE4L 2JJVA 3H2WA 4I5BA 1KCKA 3JZ7A 2FD6L 2OJZH 2FSEB 4PD4K 5L6YL 5KJRL 4P5TB 1YYLH 3EHBC 3UBXG 1H0DB 3BIAX 3ARGC 3MJ7B 2R69H 4MXQD 1ZGLP 3MMEA 4F7CA 1I8LA 2UVFA 2YD4A 3VFRB 1CVSC 2Y5TB 5KANI 5C08E 1OD7A 5SWSB 5JIPA 3JWDL 4ZXBC 3VXSE 2BY2A 3WFHB 5CEZH 3FB5A 2BNRE 1MI5E 3V7MA 3KLHD 2EO9A 1PKQE 2DYPA 4RIRB 4ELMA 3FO9A 1XGTA 2IMNA 2IWGA 1KLFA 1NAMH 4RAUA 4MNGB 1NLBL 1OSZB 2YKLL 4BZYA 1N0XH 1YN6B 2BC4A 5FYLD 5JW4M 4MWFB 1FJ1B 3RZCA 4OIIH 3WIHA 3LRSB 2VXTL 2VC2H 3B9KD 4R0LB 5GPRA 3LEVL 5E5RB 4GRWH 1ZHNA 3WUWA 5D71H 3SDDC 3BVNB 1ZK9A 3HI1A 1UXWA 4NUGL 2DM4A 5J12C 5JDSB 3LPGA 1S3KH 3VD7A 4N90E 4MNQE 4WFFD 4D9QD 5D7KD 1IM9D 2XZQL 2AJYH 4PBWD 4RFOL 2AK4B 5IFJA 5HSFA 1A6ZB 4ZS6D 2RB8A 2NY4D 3O6FA 5FO9B 2ZSVA 2D0GA 1MH5A 3P4NA 4EIZC 1G6RL 3GEWB 1FIEA 3T0AA 1C5CH 4WO4D 1JHTB 3MFFB 4KUZH 4YAQB 3OKMB 4G7VH 3VXPA 4H8WH 1QBBA 3BN3B 1YDPB 3QUZB 3CXHJ 4OLYH 1DZBA 2Z8VC 2C1OB 2JTDA 2PO6A 1S9KC 1Q0YH 5K9OB 5JOPE 2R15A 3VXQB 1U8KA 4QOKD 1J8HD 5CSZB 5CBAA 3HNVH 1WJ3A 1OAQL 3OKOA 5I1DA 3VXME 2E6QA 4WUUE 1BMGA 3NCJH 5DK2B 5I1CL 4GLRH 2PXYA 1NKOA 2ZPKH 1K4DB 2ERJC 2BY0A 2VLJE 2DWEB 3WD5L 1UM6L 3TT3H 4IRSD 2NY0D 4PGEA 2AAVA 3SGJC 2CIKB 5JR1H 3MRCB 3ZSTA 5DMGD 1HOCA 4WFGE 1EV2E 4PV8B 1SEQL 1E6JL 1FFNA 1UB5A 1UM4L 4Z0BH 4AIXA 1F4WL 2MOVA 5IMOA 3DO3A 1NEZA 3UYOD 1CL7H 4H25B 1WC7A 1ADQL 3LKNA 2EKJA 4NDMB 4Z7WA 5B4MC 3MRKA 4UU9A 4X8JA 4ESKA 1TZIB 3QIBB 4FS0A 1IC4H 2OTWB 1KJ2B 4R26H 5H37H 1IGYB 4PV9B 5F7UA 4P2RB 5JO5A 2FJFA 3C6LB 5C0AE 2I60H 3IRPX 1LMKA 1QVOA 3SQOL 5A2KH 3OB0H 2OI9B 4DVBA 2EYRB 1VDGA 4JHWH 5T1KB 4OUUA 5GRJL 5TGBA 1GGCL 2WBKA 1RQ5A 2LTQC 5C07D 1Z6JT 4X9HA 1HQRB 2W60B 4V2CB 3O8XD 5TF0A 4G9FA 3UJJH 3U46A 4G9DB 4P9HH 4TQEH 4XNZB 3ZKMD 3MLYL 3ALPA 4X0KA 3FOLB 3RP1A 1XF3A 4M7LT 2C9AA 4GKSA 2IAMA 5CCKH 2WNGA 5E03A 4LHQB 3R4DA 1CXEA 3PHOB 3FONB 4PTTB 2XRAH 3WNOA 4AIZB 3KYMA 3P0YH 4WCYH 3B8YA 2VE6A 1E4KC 3WYRA 2ED9A 3GI9H 4WW2C 2R1YA 1FSKC 1JHKL 5DJXA 1U6AH 1AGBB 2ZWLT 4PJAA 4I18A 3IDJA 3P4MB 2X4SA 2E6JA 2X9XA 5DD5L 3MR9A 4P5TC 1BZQK 3BP5A 3QEUB 4NQCE 4X5XB 1KPVB 4NQEE 3OAUL 5GSRB 3U7YL 2WIIA 5EZIL 1ETZB 5EBWB 4FQ1H 2R29H 3U6RA 4YH6A 1I8IA 2AXFB 2QADD 5F9WB 3QULA 1P1ZB 3DECA 3A6CL 1JHLL 3MRLA 4BSWA 1R3KB 5HD8C 4R4ND 4ZQKB 1MCOH 4O4YL 4PJIE 4N0YL 3I02B 4PB0L 1T7YA 2AEQH 1L9MA 5D2NA 4PRIE 3HZKA 4U1KB 5CZXD 2W0PA 3ZE2E 4KI5D 5LWYL 2M8XA 4YHZH 4N8CH 2QTEA 15C8L 5IB4A 4I5BB 4FNLH 3SGEI 1I1YA 3GJEB 1OGAD 4UMGA 1MY5A 4E41E 5I9QB 2YOCA 1MCDA 4P4KA 1BWMA 1HYRC 2BCKA 1F3JA 2FX7H 4DW2H 2FO4A 3MMEB 4F7CB 3LV3A 4OI8A 1B0GA 3RWEA 4PS4H 5D5MF 4A6YH 4MB3A 3Q5TA 5F7DA 3MA7A 3CLEH 2AI0L 4QWWC 1IGML 3TEUA 1YY9D 2GT9B 1YQVH 3VD5A 3FB5B 2KPNA 1KCLA 1DTUA 3EFFA 2DYPB 4ELMB 1AGEA 2VZVA 4HUNB 3FO9B 3WNMA 4OT1H 2I5YH 4YUEH 3SY0A 3S88H 2BC4B 3KYKL 5GJTH 2VITB 3VMPA 2WLYA 3HUJA 2OSLA 5F21B 3AMLA 1J9CT 2DQCH 1FGNH 4HMEA 3DV6A 1A7RH 1ZHNB 4JFFE 4Y4FD 1J10A 3WUWB 4HWZA 3QFDA 3HI1B 1J1XL 1DBKH 2N56A 3C5ZC 1OTSD 4HWBA 2HFFB 2YRPA 5ID1A 4W6XB 1B2WH 5A16A 4YQXL 4HH9A 2XICA 2NY2B 4YDJA 1T89C 5BMFH 3T0EA 1CK0L 5IFJB 1X44A 1XCQA 1PSKL 5DA0B 2GY7B 3MYZA 1KEML 3L6FA 1II4E 3LHPL 2ZKHL 3O6FB 2ZSVB 3SGDI 1Z9LA 1P7KA 2ZUXA 3BYYA 3HFML 3MLSH 1MPAH 2P5EB 1MRCL 3P0VL 3SDYH 3JWOC 1IAII 3P73A 4PJ5A 3VXPB 3LCYA 4KK9C 3VFTA 3C8KB 1WBYB 1W72L 2GJZB 2X1WL 2PO6B 4P59L 3GI8L 1PZ5A 4PGBA 4KKAD 2BNUA 3G5ZB 4LCIL 4X99B 3UTPE 3PGCB 5CBAB 4NCC1 4ODXA 3ULUC 1QPXA 5I8OH 4O00A 3OKOB 5I1DB 4TSCH 2OR9L 2F19H 3MC0A 5EWIH 5IHZA 3MOBH 4M5YL 2PXYB 4RFEA 1KJVB 1RUML 4KV5E 4Q6YA 1IAIL 3GK8H 5GS1C 4FZ8H 4QRRD 5TE7H 1TVBA 3KS0J 2DLFL 4LRNL 4HKJA 2NY1B 3WFZA 3QI9D 2OI9C 1OAYL 1B90A 4WW2F 3PQYA 1HOCB 1CFSA 3P9LA 1FFNB 5CGMA 1A6TA 3BPOC 5IMOB 4AL8H 4ZOAA 4TVPL 5DRNA 1WC7B 4Y1AB 3LKNB 4BZ2H 5GS2H 2ESVE 4Z7WB 1XF4A 4UU9B 4X8JB 2X7LA 5JIKA 3GIVA 1E28A 1D6VH 5DUPH 4N0CD 1RZFL 4FFVD 4ONFL 3PE9A 4NWTL 5F8RC 3V6OC 3VFNA 4Q9RL 2FATH 5JO5B 2FJFB 2YS4A 3GM8A 4PJCA 1TNNA 2X05A 4Y19D 4L8SA 3EYSH 3KJ4B 4OCRL 4OD3H 1LO5B 1MHHA 2UUDH 1MF2H 1GC1H 4O51B 4MLSA 1M05A 4G9FB 1BVLA 4CGTA 2BVPA 3U46B 1QR1A 2YK1H 1HEZA 4HZLB 5HI3C 4WI7A 5E2WL 5D7LE 4X0KB 5EOCH 5ITBH 1BWWA 1XF3B 4PGJA 4MNHA 1NJ9A 3QH3B 4GH7B 4XCCH 4PJXA 2IAMB 4K8RD 2ARWA 2J5LB 1IM9A 3IXTA 3MXWL 4BYHA 4PJ7F 2I26N 2X1XR 3KYMB 1WCQA 4M7LL 2HKFL 2VE6B 3FO0L 1TJHH 3V95A 3GMNB 1F3DH 2D03L 2DS4A 5T1DH 4JVWA 4OLZH 1U8QB 4PB9H 2IQAA 1FZKA 5F1KC 4OZGB 4HJGA 5IBTH 2OMBA 3UAJD 1HKLH 2ZCHL 4P46D 4H88H 4PJAB 3ULVH 3IDJB 2R0KH 2VLRD 3MACL 4OV6F 2RAMA 2KZWA 1NGWA 3MR9B 5EUOA 5I9QC 4N8PA 3BP5B 3EOTL 3EYVA 2AW2A 4QOKA 1J8HA 1I8LC 3U6RB 1I8IB 5DWUL 2W0KA 2O5ZH 3DSFL 3L5IA 3TJHD 2M2DA 1VGKB 4JG1L 2H26A 4XHJD 3QULB 5C0FB 1TTFA 2YPKB 4OV5B 5EC2A 3FFCD 1IM3A 4F33A 1RULL 1G9MC 3ARDD 4BSWB 3QUML 4QXTA 1S7SB 5F97E 2R0ZL 3Q5YA 3GMPA 3B2VL 4P2QE 4GXVH 4C54A 3MUHL 4UDTB 4PBVC 5D2NB 4YO0A 3V6ZB 4XAWL 1ZOXA 3TF7C 3VA6A 4L4VB 4OD2B 5GSVA 2KDGA 3MQIA 3RZCC 2YPLD 5B3JF 3MV8D 3CDCA 4X80L 5J6HB 5HDLA 5IB4B 4Y89A 3VXTA 1I1YB 3WNLA 1F11A 3KPOA 5F3HA 4MSWA 4P4KB 1JYWA 1D6EA 1F3JB 5BQ7A 1CGXA 1IC5L 1WWAX 2FO4B 3LV3B 4DGIL 2DLHA 4XNUH 1B0GB 3ZZ1A 3RWEB 3ULUF 2NY2C 5F7DB 1GZQA 4FTVE 3MA7B 4MXVE 4RISL 3RTQD 2A74B 3ULSB 4MA7L 1J1PH 2MTPA 1CR9H 3F6IA 3O6FC 4GO6B 2V5MA 1RPQA 2HTLC 3S4SA 1ZAGA 1BJ1H 4X9FA 3LIZH 3SY0B 2RJMA 5C07A 3MRBA 3CVHL 3O8XA 3W39A 5MI0C 5F7MC 4KMQA 2OSLB 1G6RB 4WU7A 5DVMA 3D3VD 5ACZB 1LDPH 3H0TA 2PO6C 3DV6B 4HWUA 1KBGL 5D1QD 1YEDA 3QFDB 3ZDYE 4LSRH 3W2DH 5ID1B 3U7AA 2FEEI 3CU1A 2HJKA 5A16B 2W91A 4HH9B 1NBQA 2PXYC 2PR4H 1HZHL 4UDUA 1R24A 5D72L 5E5MA 1OD9A 1P4LB 3T0EB 8FABB 1T4KA 5EH1A 2I24N 3NCMA 3SQBA 4A6YA 1XCQB 1ZTXH 2UZYB 3NFSL 4Q2ZA 1NFIB 3V0WH 2NY1C 4CN4A 3L6FB 5D6CB 1IBGL 1P7KB 5DJZA 5J13B 2VABA 2VB5A 3DYMA 1ACYH 5INCA 1CQKA 3P73B 2FEEL 4NNXA 4PJ5B 4PLJC 1HNGA 3LKOA 3BZEA 3EGSA 1I9IH 2XQYG 3ZE1E 4TNVF 4PGBB 5CLWA 1PFCA 1AI1H 1VGEH 4FXLA 1CGSL 2YUZA 3PUCA 4LASH 2CIIB 5SWQA 4IMLA 5JIHA 4JY4A 4NGHH 4MVBC 3MSPA 4RFEB 4PYGA 5E2TH 4LEXH 5F9OH 3KJ4C 1OTUD 4IOSD 2QLVB 3GDBA 4FQCH 2E7LA 4LRIA 4AH2A 2GCYB 5GHWL 4TN9A 4ZPTA 1CDBA 3S5LA 5GGQL 4XMKL 3P9LB 1P5VA 3FO2A 3TT1L 1OGAA 2DQIL 3BKML 3N85H 3T3PF 4TUOB 3RKPA 3TESA 4QEGA 1XF4B 4LL9A 4MHHI 3EDDA 3GIVB 2G9HB 1E28B 2Y36H 1EMTH 3E6FA 4I1NB 5E70A 3WDHA 2IAMC 1BD2B 3KXFD 5DSCB 1JE6A 3T2NL 3THML 3KYAA 4UQ2B 1ZKAA 4QXUH 5T3ZD 2VXUL 5IESL 1NAKL 1P84J 5I1HH 4K7PY 1JBJA 2G60L 5K93A 1MQ8A 4D94A 4ELMF 2VXSH 3TO4D 1MHHB 2I07A 5HDQH 4ZUUA 3GIZL 5C71A 1KIQB 2K9UA 1M7DA 3MRFB 5IMMA 1M05B 3MV9B 5I73B 5F7FA 1C1EH 4I18C 1U93A 2BVPB 4GRMA 1QR1B 3B9KB 4NHUB 1HEZB 5ADPH 5GS3A 4Y2OA 1NBZA 4Y4FA 2I9TA 4X7SL 3CDGA 5L2JA 5GGSB 4HKZB 5KOMC 2F74B 4KMLB 4MNHB 1NJ9B 2VYRE 4PJXB 4S1DC 2QL1A 1RZJH 5CILH 4M00A 43C9B 2CRZA 3HAEH 2NY4B 3IB4A 2A83B 3DPBA 1FGVH 5D2NC 5K9KA 3HMWH 5J0BA 5FDWA 2ZP0T 5DGQA 5E8DH 1RZIA 2IQAB 5BO1H 4WO4B 3DBXA 3S35H 5I1EL 4HJGB 4JO1L 2EDBA 3T0XA 4KKNA 4YHMH 3EYOA 3AS1A 3CH1B 4Y88A 3PJSA 3L5XL 2JJWA 3VG0L 1TTGA 5AYQA 4X7CC 5EUOB 3KPQB 1Y6MR 2VQUA 2VZSA 4KGLA 4P4KC 1J1OL 3EYVB 1ORSB 2EDHA 4PRHD 3PABB 5ACMA 4QOKB 2ADFL 1J8HB 1NGXB 4FXGA 1NGQH 2H26B 2VZ3A 4YGVA 5EC2B 5IQ7H 3ARQA 4F33B 1CDUA 4QXTB 2YD9A 2HT3C 4RA3A 4TNWK 4QRRA 5T3XD 3GMPB 5E24E 1M71A 4IRSB 1ZE3C 3JBG7 5EULV 5F1IB 1BJ8A 1AGDA 5KTEL 1IRAY 1I9RL 3MBXL 3LD8B 2R4SL 4FG6C 4NSKA 2A77L 2EE2A 3D2UD 3VXTB 4J3WA 4HSQA 3DI2B 1ZANH 4KWUA 1F11B 1N26A 2ZZUT 1XGPA 4BFBD 1XR9A 3CVHA 1BGXH 3EJZC 5DD0L 4Z7WF 4MSWB 3RA7L 3TBYA 4V1DB 1A7NH 5EC1A 1X9QA 5BQ7B 2R0WL 3V8OA 1CFVL 1NLDH 1EUUA 5JW3H 5SX4I 3C8HA 4X5WB 3O2WH 1I85A 4EEEA 1GZQB 3BPCA 3DUUA 5MP6H 3T0EC 5TDPA 1AXTL 1MEXH 4EUPB 2E27H 4R4FH 4Y19A 3UTZB 1HHIA 5EIVA 2UY7A 5T5NG 3H9SE 5J13C 3ARBD 5DJ6B 3NMEA 4LQFH 4ZFGL 5C07B 3MRBB 1MOEA 5ANME 2AJUH 4WGWB 3O8XB 3W39B 4RDQG 1DE4A 4KPHH 4WU7B 5JQ6L 1E4WL 1KTLB 3H0TB 1RUPL 4Y7MA 3LPFA 3IRZA 1TZGL 3P3YA 1H8OA 5H2BA 5T3ZL 1JMZA 2EDEA 5CD5D 3JUYA 4OFKA 3IDIB 3FOMB 4KVNL 3NA9H 1OTTC 1UKSA 4Z7NF 4LDEB 4JDVA 5MERA 1PDKA 2AEPH 4R2GC 1R24B 1JFQH 2L4OA 5E5MB 1T4KB 1BZ9A 3IF1A 2OM5A 3EO9H 5GGTL 5TF1H 5HY9A 1UFUA 1Q9LA 1T2QL 2WANA 5DJZB 1IJ9A 2HT4C 1EIBA 2VABB 3V0VA 4QGYA 4XZUA 1BFVL 3IKCA 4KZDH 2DI7A 4P46A 4OGYL 4NNXB 2VLRA 1CXLA 3BZEB 2AXHA 3EGSB 1SY6H 4JO2H 2IQ9L 3BP6A 2NYYD 2W07A 4HIHA 3AB0B 4MXQC 3NVQA 1XF1A 2EECA 1D5BB 5ITFA 4MB4A 5F9AC 4IMLB 5D5ME 4JY4B 4OKDA 3FFCA 2N4IA 2PUQT 1SM3H 3ARDA 4ORGB 1PG7W 5E5UB 4C56E 3QSKB 3KLHC 1IILE 4XH2A 2A1WL 4L8SC 4F9LA 3K3QA 1LD9B 1W0WB 3V4PL 2DKSA 4YEEA 2PYEB 5FOJA 4AH2B 2APFA 1N3NA 1D5MB 4JHAL 1HH6A 3OV6A 3S5LB 3BWAA 2YPLA 3KPLA 3KYOA 2PNDA 3MV8A 4M7KL 4JFEE 5FHBH 3U30C 2IFFL 5KVMC 2NW2B 2EDFA 3B9KC 4U3CA 3RVWC 1OGAB 1JPSH 2IPTH 2NY6D 1ZSDB 3GHBH 5IBLD 4NNPH 1OAZH 3AM8A 3B5HA 5DD6A 3HMXH 4NKIL 5D7SH 3CLFH 4KY1H 3TH2T 3WFEL 4HBCL 1B9ZA 4GG8A 2DF3A 3ILPA 3LQZA 2FX9L 3IDGA 3RTQA 4HWNA 4UI2A 3BRFA 1JGUL 1OSPL 3O6ML 3SE9L 2FB4H 2NY4C 1H8SA 4IOFD 5F1NA 4M5ZL 1QLFA 2I07B 2XYCA 3VD3A 4ZUUB 1CE1H 1NEUA 4WO4C 5E99L 3QP3A 5JXAL 5IMMB 4NQUA 4KRMB 3PWPE 5BS0D 1AD9A 2Y07H 1T5WA 5E56A 3U2SA 1CLZL 3HUJF 1FFOA 4TYUA 3D3VA 2ZUUA 4XNYL 3NIFF 1NBZB 3MV7E 4Y4FB 3DVFA 4WV1B 5D1QA 4EDWH 2I9TB 1RUQL 3CDGB 5L2JB 4N9OB 4P9HC 4NZRL 3RIAK 4F57H 1OAXL 1FNLA 3TBSA 3QRGH 2J88H 4O2EA 4HG4J 2DQFA 2OK0L 5EBLB 3Q6GH 1B3JA 2VDRL 5EG6C 1MIMH 4U1LA 3Q3GB 2GY5A 1EZVY 5KVGL 4ODSH 2UUDK 5GGRA 5D1XD 4CL7A 4P49A 2ZOKA 4IRSC 1FFPB 2FD6H 2NY0C 3B9AA 1N6VA 4OF6A 1PY4A 3BO8A 4HXBL 4RAVA 3OR6A 5K9KB 5INDB 1BQHA 3AC0A 2HRPH 1DUZA 3MODL 3DBXB 5DMGC 4E0RA 3LD8C 1U8OA 3EYOB 3RVTD 1UADC 1INDL 5JHDE 2CR6A 1D5XA 1MVUA 2A6DA 3JWDH 1QLRB 5GJSL 4WI3A 1OW0A 4FXGB 1DVFD 5ESVA 4ZYKA 4Y4HD 4YGVB 4F7MA 4G6JH 3BEWA 1NLBH 1QSVA 2CKNA 4BUHA 4WEUD 3AU1A 2OZ4L 4QRRB 4EBQL 1OWRM 3QI9B 3CX5K 3LEVH 2GFBB 3WL9B 3JSSA 4Q9CA 2EDTA 5F6IB 1KIPA 4L8DB 3O8XC 2VISA 4R4BA 4KHXL 1YNKL 3IFNH 3O2DH 3ZKMC 1XGPB 3NCEB 1XR9B 3CVHB 2XZQH 2F54D 4RFOH 4XXDA 3KPRD 3TBYB 3MLVL 1KCSH 4XVSL 2IAND 1ED3A 1BP3B 4RZCA 3KXFA 1T22B 2EDOA 1K8IB 1EEYA 4PJ7E 3BPCB 3D85D 3DOSA 3DUUB 4U05A 5B38G 2VDQL 1L6ZA 2CMRH 1EO8L 4PJCF 5TDPB 3QEQE 2NXZD 4K94L 3BGFB 2I9LA 4Y19B 3I85A 4IRZL 1A8JH 2EIBA 3TO4A 1TCRB 2ADJA 1T1YB 2O61A 4YFLF 4QO1A 3G08A 3WMSA 1HSAA 25C8H 1DE4B 3RUGA 1OAQH 3MRPA 5C08D 4N5UA 3VCLA 1Q38A 3AB0C 2BNRD 1MI5D 4JN2A 2QADC 4DKFL 1MCHA 1AC0A 1RJLA 4PJXF 3WD5H 4JB9L 3A6BL 2WBWB 5AUMA 4JDVB 2PCPB 5MERB 1UQSB 1PG7L 3LDBC 4ZDHA 3U9UB 5D70L 1BZ9B 4JPKH 1MWAA 4X4YA 4G42B 1IGJB 4QYOA 2E7LC 1Q9LB 4LRIC 4ZUTA 3QDMA 3NFNA 1ADQH 5CZXC 1MAMH 4J4PD 1EHAA 3V0VB 1KN4L 3O4LE 4KI5C 4R97C 4XZUB 4N90D 1J05A 2LFGA 5B3JE 4P46B 1W0YT 4OSUH 2VLRB 4XP5L 2AJXL 5EUOF 5LJYH 3Q0HA 4ODWA 2OXGA 4F7PA 3BP6B 4R9HA 5K59F 4PRHA 1OQOA 2ADIA 1G9NC 1QBLL 3X3GL 1EK3A 2AS5M 3HAEG 5EBMB 4UINL 3DX7A 1AR2A 1AJ7L 4FQIH 2V2XA 1NCDL 3CU7A 3FFCB 4NP4L 3U48A 1WAAF 1JI2A 1YY9C 5GISH 5GRJH 1FPTL 5KVFL 4FOMA 4QF1A 1YC7A 5MENE 1WITA 4XH2B 3QISA 2YD7A 3DTXA 4DZBA 2ZUQB 3CJJA 3IDXH 3ZO0A 3OR7A 5JOPD 4V2BA 3X11A 1N3NB 4BA8A 3BWAB 1BFSA 4U7MA 2YPLB 5CJXA 3KPLB 3KYOB 3MV8B 3VFMB 3D2UA 5SWZE 4WUUD 4TNWF 4M1GL 3FT3A 3I84A 4OLUL 4Y4FC 1NCTA 2VLJD 2BP3A 2FWOA 5E08L 1X5XA 5DD6B 1OTSC 2E9IA 3MNZA 2Z35A 3C9NA 2I25N 3H6JA 3ILPB 3UTSB 3LQZB 4JKLA 1CBVL 1A3RL 4BFGA 4WFGD 3RTQB 1JHKH 1WZLA 3VFOA 4PLKD 3WLBA 1P4BL 4JPIA 2WW8A 3ARZA 4UNVA 5F1NB 5DD5H 1QLFB 2D7MA 5E94A 4HULB 3ARBA 4JY5L 5ESQA 1AQDA 1RK1B 5JXED 1WZ1H 3OAUH 5EZIH 4PJBB 5F96H 5E8EA 5CLTA 4WTXA 4I0CC 3U2SB 4P99A 4JRXE 1E6OH 1GC1C 1FFOB 3D3VB 1T0MA 4IS6A 1CDIA 1NCAH 5C0AD 5DDHA 2WLZA 4KKAC 5D1QB 3E8UL 3A6CH 3VH8B 4N0YH 3TBSB 4PB0H 5TPWL 2WP3T 4I3RL 4WFHE 2DQFB 2LU7A 1GIGL 5F72S 1QUNA 4U1LB 5LGHL 3LMJL 2DQTH 5LWYH 3V5KB 1U8HA 1ZVSB 15C8H 2ZOKB 1S9VA 3V7AE 5C70A 3FKUS 3OR6B 2OLDA 4Q0XL 4AK1A 2YWYA 4BQBA 5F6IC 1DUZB 2DMCA 3IAPA 2ILLA 1ZA6A 1QQDB 4YXLL 3VDBA 1U8OB 4OF3A 4NRYA 2GAZA 3L1OL 3O3AA 1AO7E 1D5XB 5EZLA 3T3PE 1MVUB 3STZA 4OBRA 3EW3B 4YXKH 1FP5A 3UDWA 4C55A 1QZ1A 1IGMH 1KTRL 3BQUA 4N0CC 4FFVC 3SGEH 3T1FB 3G6JE 5ESVB 4GMSH 1DJSA 3WFDL 4ZYKB 1I85C 4NM8L 4LP4A 3BEWB 5HHVL 2L0DA 3TV3L 4LGPB 1JWMA 3CK0L 3AAZB 3BGFC 3AU1B 1LVEA 4NZJA 2A6JA 4IEFB 4GW4A 2NX5E 4NQCD 4YDLB 4LAQL 4NQED 4GOSA 3C5SA 4KI5F 3CX2A 4NM4H 1KIPB 2GQHA 2VISB 2FR4A 2ICWI 3BWUC 4YFEA 4DFIA 4JJ5A 4FFZL 4XXDB 4D0CA 4UILL 3ZT7A 1T2XA 5C0BB 1CK0H 3CVIL 1NMAH 3WXVH 1PSKH 1ED3B 4MCYA 2WWMD 3KXFB 4RZCB 4K8RC 1KEMH 3LHPH 1J86A 2VKXA 1EEYB 2BRQA 3HFMH 1I8KA 4PG2A 3QEHA 1MRCH 4DQOL 3H3PL 4Y5VB 1LILA 4U0RB 3G04B 2Y6SD 3WFBL 5A2IH 5BVPH 1J5OL 2XACC 5F9JA 3O6LL 4PIRF 4E41D 3TO4B 3QO1A 1W72H 2V17L 1OY3B 2O61B 1W0VA 4P59H 3G08B 3UAJC 3WHE0 1U8JA 1WCBB 4LCIH 5BS0A 4OZIA 4P46C 4JLRB 3FZUD 2H6PB 3RUGB 4C4KO 4QY8A 3MRPB 5IOPA 3ARUA 2VDOH 3QXUA 4B0MM 1R0AL 1IZJA 3BIKA 4M5YH 3VCLB 3LSOA 4RFNC 3O2DA 4M7JL 4X7FC 3QT2A 4JN2B 1N8ZA 1RJLB 3OAZK 3TJHC 3EYUH 2ENYA 4JFXB 4LRNH 4XHJC 4MQSB 4L8BA 4I0PB 3U4BH 4GBXB 3ARDC 2EDXA 4ZDHB 5D1XA 3S3PA 4BQ6A 3RIAF 2HJFA 4KKLD 4F9LC 1MWAB 3BISA 1S7QA 3CFDB 4X4YB 2X10A 2FHFA 4UNUA 4JFFD 4ZUTB 2Z4QA 2KL6A 5IUSA 4PJHA 3RBGA 3NZHL 2BSSA 4ACPA 2YRLA 4YFDB 1J05B 1DDHB 3TYFB 1X5JA 1RZFH 1FRGL 4ONFH 3WKML 3VRJA 3SKMA 4LSQL 4ODTL 5HHXL 4ODWB 3FN9A 4K23L 5FK9B 1IARB 3AM8C 4PRHB 1NC4D 2ADIB 5EIQA 5EO0A 1QBML 1DVFA 1GAFL 1UJ3A 2JLLA 4OQTA 4Y4HA 3DX7B 2NY5L 4QHKI 2V2XB 1CDGA 5IVXA 4R7DA 1T0NA 3VGHA 2NZIA 3RTQC 1JTOA 4LIQH 4A2LA 3CFIC 1JPFB 2D9QB 4I48A 4DZBB 4HUXB 1FAKT 3MUZ1 4UT6L 2O5XH 3TA3D 3X14B 5FUOH 3DGGA 2MPAH 3X11B 5E2WH 2GSIB 3UTPD 1CDCA 2OTUA 5MEQB 4LU5L 2FEDD 3E6HA 5IGXH 3D2UB 2APVA 5J56B 1TNMA 5JMRA 3U7WL 3UCRA 1L0XA 1NANH 2P5WD 3MXWH 2F54A 5D1QC 3ULVF 2FWOB 3KPRA 1FORL 2WZPD 3V6BR 2IANA 3MNZB 4M7LH 2HKFH 3FO0H 1C7TA 3CC5A 5KANG 2DQDL 3WSQL 3TPUA 5D7IB 1LO4H 3D85A 5FYKH 4ZS7L 4ODVL 3EOAA 5J11B 3C08L 4ZFFA 1J0HA 3VFOB 2XXCB 4W68A 3WLBB 3D48R 4HCRH 2QKIB 1K85A 4NKDA 5ICZA 2ESVD 5JMOC 2E6PA 4KXZI 4P23D 3S96A 3ARBB 1AQDB 3EOTH 3CZJA 3HTLX 3QWRA 1VFAB 5C08A 3CSPA 1S7XA 1L4IA 1V3KA 1J11A 4IS6B 5DDHB 1RULH 4F15B 4PP1D 2BNRA 1MI5A 5ENWA 4F3FB 3QUMH 1PKQA 1OW0C 1V7ML 2R0ZH 1N59A 4M4PA 1ZHKA 2FRGP 3B2VH 1JZ7A 3UPRB 3S6CA 4XAWH 3T09A 4EKXA 1CD1A 2X1OA 5GS0L 3VXNA 1OTUC 2DLGA 4UIKL 3N50A 1N4XL 1WIOA 2PW2A 4YDLC 1AD0A 5D7LD 5TE4H 3BE1H 4J4PA 3KPSE 2B4CL 5IHLB 4TPRH 3QNYA 1YEGH 1IC5H 1K6QL 1X5LA 1WV7T 5GGVH 4UB0H 4DGIH 3PGFL 2A73B 2GAZB 3O3AB 3TBTA 4DN3L 4HK3J 1JGLH 1OP3H 5EZLB 2IGFH 4OF7A 4RISH 4EN3D 4D9LL 4U6VH 1FZJA 1OAUL 3P11L 4MA7H 2IG2H 2QSCL 3F7QA 2EDQA 4ZD3H 3LEYL 3DV4B 2Q8AL 1QFOA 1JWMB 4U0RC 4OGXH 3DETC 3GSOA 2XI9A 4CUCA 3MLWL 4MLIA 2A38A 2VNCA 3D6GA 3TO4C 1PLGH 3P30L 3C5SB 4QTIL 4J6RL 3C2SA 1IC7H 4MCZB 2DBJA 2XY1A 4WUUA 3HUJE 1P5UA 5F8QC 1VA9A 4M8QA 4JJ5B 2NY6B 3MGTA 1JWSB 1HZHH 2VLJA 4P3WA 2G75A 5D72H 4D0CB 2D7QA 2LAAA 4X6BA 2NY7L 5BRZB 4XP6L 5LQBL 5I17A 2APWA 3HC3H 1A6UL 2EE3A 1IBGH 4P5KA 4L4TE 1OM3L 4KHTH 1BOGA 3UZQA 1A7OL 4XC3H 1PD6A 4DTGH 3STLA 2JB5L 4X6FB 5AAMA 5F9JB 5D1ZD 3I6LE 1FG2A 3JVGA 3HB3D 1DL7L 2C5DC 3QO1B 2CGRH 5D2LE 1XR8A 5DC0A 4S10A 5CEZE 5JXEA 5T1MA 1FL3A 4HW6A 1U8JB 3RWJA 2Q3ZA 5BS0B 4OZIB 1P53A 1Y18A 3DNKA 1DLFL 1Z0NA 5HVHC 2CJUL 4LNVA 1BJMA 4QY8B 4X83A 4FTVD 5KSAD 4YXHL 3J8F7 5IOPB 3MREA 5C0AA 2F9BT 4K7PL 4NOBA 3QCTH 4QT5B 4MA3A 1VFUA 1SQ2N 4GRWE 5DQDH 3TVMD 3DWTA 3WXWL 4F8QA 3BMWA 4L8BB 3G9AB 5DK0B 5GHWH 1IEBA 5ADOL 1U95A 3TIDB 5D1XB 3ZTJH 1QKZL 1NCBL 4XMKH 2HJFB 1S7QB 5DFWH 2NW3A 1EGJA 2YWZA 2XKNA 4U6XB 5AYUL 2DQIH 3BKMH 2Z4QB 4N0UB 3GKWL 4TULL 4PJHB 5KZCD 3PQYE 3NPZB 4I8DA 5CJXC 4K9EL 3U4AA 3WE6A 3SKMB 2OJEB 3REVA 3HPLA 4XWGH 3L3OA 4LCCA 3THMH 1JPTH 1I3VA 3IFOB 2VXUH 1FBIL 2J6EH 1QO3B 5IESH 2BFVH 5EO0B 4Y16D 2QSQA 2G60H 1RFDL 1T6WA 1DVFB 3ZSSA 1UJ3B 3LRGA 4YK4B 4G8IA 1UA6L 1F4AA 5IVXB 5JORA 4R7DB 2ZUVA 3GIZH 1MRFL 1T0NB 2UZIL 4AEHL 2V7HA 1F4XL 3BGMA 4PJCE 1N0LA 1ZMYA 4PR5A 3KS0H 1K8DA 1HHGA 5HI4D 4NQCA 3L3KA 3ARBC 4NQEA 1WFTA 2XA3A 3DGGB 3HI6H 4L1HA 2BDNL 3S3SA 2OTUB 4BQ8A 1Y0LA 2CDEA 2E9BA 3E6HB 2A9ML 5C9KA 3M8OH 4X4ME 1IGFL 1JPGA 2FJHA 5L0QB 5M7QA 4F15C 4PJIA 2VWEE 1QRNE 2N1KA 3GBLA 3TIEB 5CD5C 3SKJL 3TCLB 2EIZB 4JPWH 1ONQA 1GOHA 3JUZA 3CC5B 5MEPB 5FUCC 5C0DA 5EOTA 4ZSOE 3BN9D 2FZ3A 5I1EH 2LVEA 2NXZB 4ZFFB 3CFCH 2FECI 3O6KL 3VFVA 2Q8BL 3EDFA 4E41A 4EUPG 5ICZB 1UWEL 2X4OA 3ILQD 4OAWA 5FGCE 5C2UB 4R96A 1OOAA 5AWNL 5FKPA 1CD0A 4MAYD 1L7TL 3H7BA 3RUGF 5GZOD 3MROB 4LARL 3P9MA 2GYSA 1S7XB 2NYYC 3BP7B 3VXSB 3UDWC 5K59E 5HYJB 4JGMA 1NCUA 1A47A 2BNRB 3OKEA 4NFCA 3BQUC 4PJEE 2FECL 1PKQB 2PKDA 1N59B 3QCUL 1ZHKB 4QXGL 2YBRB 1D9KD 4LDLB 4QCIA 3WBDA 3QBTB 2CRMA 4XNMB 1S7UA 4U1IA 1WAAE 5TQ2L 4JZJA 4G5ZH 3MBXH 3LQAL 3TBWA 5SV3A 2BOBA 3WDIA 2XKSA 4JFFA 1AD0B 1U3ZA 5DZOA 5DD0H 4HCRA 3O3DA 3ARRA 4JFHE 1AFVH 3RA7H 4M6OH 4MQXD 2DQHL 4PPTA 3QNYB 1EBAA 2R0WH 1SHMA 5JW4Q 4MNQB 2IH1A 4NQXA 3RFZC 2E9WA 3TBTB 2CRYA 2NY6C 4U1JA 5IBLC 2AGJL 1HWGB 2XWJA 5EU6A 2BHYA 1D3CA 2JELH 4GAJH 1Q72L 4M9OA 4ERSL 4TSBL 3ZE0E 5CFHA 3V4UL 3GMMA 5DZLA 5I6XC 4PG2C 4YR6B 3OGCA 5C0CD 3TZVD 4ZFGH 4QRSA 3GSOB 1TVHA 2XFXA 5SX4H 2H8PA 5JQ6H 3TA3A 1H3VA 2R4RL 5M95B 2AVGA 2ICWB 3Q2CA 3KHQA 3MLUL 4P57A 1CF8L 1I3RB 1TZGH 1JUFA 2F8OA 5IT2L 3S5LG 3VXMB 4FABL 4WUUB 1A0QH 2H32B 1Z3GH 5KSUA 4KVNH 3UJIH 5F7NC 2J12B 2EE6A 1JMXA 2P5WA 1IEAA 2GTZB 3RWCA 1T7WA 2G75B 3O2VL 5JW4N 4HPOH 5FA3A 2Q76A 4MD5A 1MJUH 4GKNA 3SJVE 2RQ8A 4LCWE 5GGTH 5I17B 5IB1B 4IHOB 5IK3A 1NMCB 1T2QH 4P5KB 3UTQA 1XZ0A 1MFCL 5D1XC 4MA1C 4LVOB 1W2KT 1BOGB 2FGWL 2XQBH 3STLB 3EDJA 4MA8H 4OGYH 3MLPA 2ESVA 5KG9A 4P23A 1E0OB 1XR8B 4MAUL 5T1MB 2VH5H 5DUMH 5GRUL 1J18A 3RWJB 3ALWA 1NSNL 3FT2B 3RVTC 5JA8B 5IBUG 2D4FA 4HKBA 3LKSA 3U9PL 1JP5A 3MREB 5IF0A 5C0AB 1WFUA 2HVJB 4X6CE 1MFBH 3RVXD 35C8L 1DVFC 1FN4A 1UJ3C 1X5IA 4RBPK 5GIRA 3VRLF 4Y4HC 3OKNA 4PGCB 3H9SD 4YK4C 5D96B 3I6KA 1ZEAL 3DYOA 4HS6A 5AG9A 2W65A 3QWOA 4OIAA 2VLKE 4LLAA 4WI4A 1ND0A 5CWSA 1U95B 1RVFL 3RGHA 4RSVA 4HMDA 4M7KH 4XP1H 2NY3B 5BZDA 2APTA 4CRPA 1CIDA 2XKNB 3Q48A 5E8OB 5D7LA 1XF5A 2H1PL 4OM1H 4HS8L 5B3NA 2EIEA 1UWXH 4XCEA 2X89D 2ED8A 3WIFA 2HAZA 3WE6B 3WFEH 4FZEL 1TQBB 5DHYB 5L0QC 3L3OB 4LCCB 3MJ9A 2FX9H 2XOTA 1QLEL 4QLRA 4YHIA 2EC9T 4JQXA 1E4JA 1G0YR 1JGUH 3O6MH 1OSPH 3SE9H 1IQWL 4OKVB 3MLZL 3QEGL 1OGTA 5DZNA 3GSNH 4G8IB 3U4EA 5E2VL 5JORB 2V7HB 4PD4J 3Q1SL 3BGMB 1PEZA 2NXZC 4LSPL 1L9NA 4U4BA 4ODHH 2AV7A 4PR5B 1K8DB 1YEFH 3BW9A 1HHGB 2ICEB 1CLZH 4NQCB 1F6AA 2HFGL 3DI3B 3L3KB 2P7TA 3LEXA 1P2CA 4G6KH 4NQEB 4XNYH 1T3FA 4NO5B 4AT6A 1HQ4A 1BEYL 4PJFE 4NZRH 1Y0LB 3HE6D 1OAXH 1X5GA 4OCWL 2CDEB 4L9LA 4EIGB 1JWUA 2BZDA 3BPLB 1CICB 2FJHB 4ZAKD 4C56D 4X4XA 4PJIB 4WHYH 2X1QA 5KVGH 3C2AH 4K2UL 3K81A 2VJXA 1ZVYA 1ONQB 4OFIA 4XPGH 2F5AL 5IFHL 4M1DL 3B4NA 4PRIB 2Z0BA 3F7VA 5C0DB 3AXLA 4LLUB 2FZ3B 4JFED 5CEYA 3K8KA 1YYMH 3VFVB 5D1ZA 3RZWA 2PF6A 1W8NA 2WUCL 4E41B 3HG1A 4UQ3A 1NCNA 4J4PC 4MQ7A 3BH9A 4OAWB 5T1LD 2AJSH 5C09E 2WQRA 5GJSH 5GGSY 4OZIF 3M07A 5GRYA 5ISZA 3H7BB 3MBED 5KSAA 4FTVA 1XF2A 3P9MB 3UYRH 2A6IB 2XN9D 4U31A 3K2UL 1Y6NR 3RVUD 3OKEB 4O02L 3TVMA 3L7FA 2YR3A 3FB8A 4ZPVA 2ZUTA 1MCKA 5FOBB 4FQQA 5A2FA 1G7QA 1S5HA 4QCIB 3EFDL 4Q6IA 1S7UB 4U1IB 3PWPD 5I8EA 1IT9L 2ORBL 5C6PB 4JZJB 2NMSA 4ODBD 5F3BA 4WEBH 4HMCA 3RAJH 4PJGA 4P4RA 3VI4F 3RIFK 1YNKH 3MV7D 1C5BL 5IJVA 2O26U 3K74B 3ZT6A 4MJ6B 1IFHL 4XVSH 4MXWL 1MFDL 5DR5H 3IJSA 2AK1L 3TYGH 2IH1B 1BF2A 4NQXB 2ATKB 5DHVB 1U8PA 5CD3A 3SOBL 4WJ5A 2XWJB 3ULVE 1LNUA 3ZTJG 1NC4B 1EO8H 5EO1A 4K94H 5TH2A 3BSZH 5FUZL 3OXRA 5L7XH 3BZ4A 2C3VA 1NMCC 2MKWA 2E9JA 4DK3A 5IVXF 4MDIB 3GMMB 4PLNC 4M9PA 1RIUL 3OGCB 4JKWA 3B2UD 4QRSB 4LVOC 1KACB 2EDLA 3IJHB 1KCVL 1PBYA 2NNAB 4PLKC 5JNYB 3S36H 1K3ZA 2RR3A 2H8PB 4C4KT 3JVGC 4HS3A 2A6KA 1J0KA 3TA3B 5JW4R 4X7TA 5J6GA 5JXEC 3A67L 3MZGB 1DN0A 4NZDA 2GJ6E 1JUFB 1U91A 4AQOA 3QQ3A 3WO4C 4DKFH 4GRLD 5IKCA 3A6BH 3PV6A 3VE0A 1L0QA 1JZ4A 1IEAB 1PX3A 4MHHG 3RWCB 1PG7H 3KLAA 4HIJA 3PP3H 2Q76B 2EDDA 5CMAA 1YMME 4GKNB 4EDXB 1V7NL 5EU4A 5D96C 1BM3H 2UWEE 2OBGA 4XXCA 2OP4L 4YJZL 5KN5B 4OM0H 4NZUL 1KN4H 1A14L 4PLOB 1XZ0B 3QNZA 1VERA 4LSSH 4RMWA 1BIIA 1MQKL 4UV4L 2ESVB 5KG9B 4CAGA 4P23B 1IEHA 2EIDA 1N2RA 2CKBL 1YNTA 5FYKU 3GBNH 1KNOB 1XGYL 1QPPA 2CLVB 4KGJA 4U49A 1LEKB 4GS7C 4MAYA 1DQJA 1ZT1B 4UINH 4M43L 3N1GC 1KENL 3LKSB 1KJMA 3KPMA 1AJ7H 2YD1A 4LCCC 3RWFA 3LQMA 4NP4H 1UYWL 3QEQD 3LS5L 1FPTH 5IVNA 2XWTB 3VH8G 5GIRB 1D9KA 3OKNB 3I6KB 1FNHA 3T2QA 1NQBA 5A43C 1T20A 3RX8A 4O2FA 3QWOB 4Q74A 1FNGA 4X9BA 1ND0B 2YN3A 3L95A 5FHAH 4EQ3A 5F7EL 4LCUA 1U3YA 4HAFA 3D0LA 5BZDB 4M1GH 5D7LB 1XF5B 1LEIB 4OLUH 3OHXA 2BSED 5K9QI 5IEHA 5JHLL 4LVEA 1HSBA 2X4TA 3BPLC 3CMGA 4MB5A 1U92B 1I7UA 5I15L 3IU4L 1R3JB 4YC2B 1A3RH 3VU2A 4EN3B 4YHIB 1PGRB 1DBML 3L5JA 5IB2A 1BHGA 1KPUA 4H1LH 5IP4A 1AP2B 2D9CA 1IQDB 5H8DA 3O4LD 4L9DA 1A9BA 4JY5H 5DUBA 5C0CA 3TZVA 4K3HA 4NKMB 5TE6H 2EKSA 5SX5H 2Y6SC 1WTLA 2CLRA 3MNVA 3BW9B 1IZKA 1F6AB 3LEXB 2P7TB 1U8NB 1P2CB 1T3FB 4AT6B 1TCMA 1I7RB 3IAGC 5HYQA 4JG0H 3FZUC 1UACL 3VWKA 3EDKA 1GIGH 1INQB 1XIWD 4F7TB 5J89A 1V3MA 3K7UA 3L3GA 1QFWH 3LMJH 5MEND 4P2QB 3MCLH 4YHOL 1N64H 2VR9A 1X5KA 1TVDA 4ORZC 4Q0XH 3F7VB 4KAQH 3AXLB 4JZJC 3RWDA 1AHWA 3GSNA 1ES0B 5SWZD 1NC2B 4KKLC 1JF1A 1VADA 5D1ZB 3L1OH 2QQQA 3BH9B 4DKEL 2JIXD 1JK8A 1X5FA 3KJ6L 4J2XA 1GH7A 4H26B 3BMVA 4LEOA 4ETQB 5KSAB 4FTVB 1XF2B 4CDGC 4U0QB 1VPOL 5HHVH 3HZYA 2VDKL 3GMRB 2Q86B 2CO7B 1LO3H 2HRLA 2P47B 3TVMB 3L7FB 4ZPVB 3H9SA 3Q6FA 1S5HB 1X6LA 1AXSA 1F6LL 1N6QL 5ANMA 3GGWB 1JTPA 1MCWM 3WS3A 4JRXD 1SJVA 5F3BB 4EQ2A 2IFGA 2W0FA 4P4RB 5GRXG 3GJFH 3OAYK 4FXKB 4DFHA 2BXZA 5HI3D 3TA3C 4NN5B 4YIQA 3ROLA 5C2BL 3HNSL 3R0NA 4HUKB 4UILH 5F89A 1UM5L 3ZT5A 2FEDC 4CKVX 3CVIH 2WINB 2X89A 4XHQA 1PAMA 4G7YH 3IJSB 4NHCL 3I9GL 1U8PB 5CD3B 2B7DT 3O45A 4WJ5B 4G6ML 4AQ1B 4CVZA 1LNUB 5ICYB 3R8BB 3H3PH 2OL3A 4Y16B 3EZJB 1N5AB 5TH2B 4OLVL 1LE5A 1J5OH 5IEKA 3CZFA 5HYIA 5CP7B 3MA9L 1WBZA 2LAGB 3DYPA 4X6EB 4OLWH 5E2UL 1I75A 5JA9A 5ILTH 1AO7D 1X5YA 3QCVH 4HS3B 4P23C 2A6KB 5J6GB 1CE6A 3K2MC 1R0AH 1DN0B 2PETA 3TBVA 1WT5A 1T21B 3HE6A 2ZCKL 4M7JH 1U91B 3QQ3B 1CXHA 4XPHH 5D5MA 3ZKXC 3TP4A 1OPGL 3PV6B 2LU3A 5TJWK 4ZAKA 3VE0B 2PW1A 4JM4L 4C56A 1H3XA 1D5IH 2EH7H 1SBSL 4PP1C 4E42A 3GSWA 4PJIF 3KLAB 4HIJB 5CMAB 3BD4A 2NX5D 3JWOL 5EU4B 4JR9H 4KKBD 2GJJA 3ZE2F 3GSQA 3S37L 1YNLL 3NZHH 4JFEA 2HG5A 4CMHC 4H0GA 1CZ8L 1FRGH 3WKMH 3KWWA 4RWHA 3ULUL 4LSQH 3QDME 1MHPH 3I50L 5HHXH 5T1LA 1YEKL 1BREA 1YNTB 4WHYG 4M6NH 1JL8A 1KB5A 6CGTA 1TPXC 2BK8A 1QBMH 3HI5L 4MAYB 1DQJB 3MBEA 1F45A 2XN9A 3KPMB 3RWFB 4YC2C 2KUTA 3G6DL 5BV7L 4DGYH 2EDKA 2DJ4A 4JQXC 4FQXD 5I76B 5J4MA 3F62A 1WGOA 1D9KB 4AEFA 3X3FL 3VFSB 1MUJA 3RU8H 4LSVL 4F7EA 5DXWA 1N7ML 1T20B 2L7UA 3D25A 2P5EE 3L5WA 2OXHA 4O2FB 5J57B 5L2KE 5DVNA 1R3IL 2OMNA 5DMIL 5CJBA 3D0LB 2DDQL 1KC5H 3MV7A 5C0JB 2VKWA 3OHXB 1MCQA 1NDGA 5IEHB 1LEGB 4L9LC 4DK6A 1HSBB 2X4TB 3VXRB 3MLRL 3RX7A 3SPVB 4JZOB 1UZ8B 1NUNB 3CMOH 5JUEL 3BH8B 3WSQH 3RIFF 4ZOEA 1I7UB 1DQTA 2V5RA 1IL1A 4ODVH 2X9YA 1J0ZA 3C08H 2QSVA 4XPTH 5DURD 1KPUB 2JJUA 3OJMB 5DRZB 5HHQA 4TTDD 1J7VR 5DUBB 2MNUA 4ZTOL 3TZVB 1DSFH 1GGBL 2EKSB 3HC0A 1DBJH 1AIFA 1B0RA 3T0VA 2AV1A 4IDJL 4XPFL 3OKDA 5D1ZC 1UWXK 3HB3C 3TFKD 4K07A 3G6AA 5DVKA 4ENED 5GXBB 3GNML 1PQZA 4TUKL 2XA8L 2VDML 4Y2DD 1V7MH 1FYHB 5HYQB 1MJ7L 1FVCB 4GRLA 4MMXC 1CTOA 5KSAC 3H9ZA 1RZ7H 3L3GB 4LCYA 3VD4A 4P9MH 5E6ZA 4AIOA 1INEH 2VO5A 3TVMC 2Y23A 2CD0A 2W9DH 3VRLE 2NR6D 4UIKH 5FF6B 2AXGB 4ONOA 5DRWA 4Q6IC 1QSZA 5FUCE 5AAWA 3S9DB 3RWDB 2B4CH