1MFQC

Crystal structure analysis of a ternary s-domain complex of human signal recognition particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
108
Chain Sequence
KHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Induced structural changes of 7SL RNA during the assembly of human signal recognition particle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rna
molecule keywords 7S RNA of human SRP
total genus 32
structure length 108
sequence length 116
ec nomenclature
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 1mfqC00
1DULA 2PXTA 2PXLA 3KL4A 5GAHi 2PXBA 2PXVA 2PXKA 2V3CC 2XXAA 3LQXA 2PXPA 1MFQC 1QB2A 3NDBB 1HQ1A 2PXDA 2PXFA 2PXEA 1QZXA 5GAGi 2FFHA 3DM5A 2JQEA 2PXUA 2PXQA
chains in the Genus database with same CATH superfamily
2XXQA 3CLCA 2O38A 1U2ZA 2PXTA 2PXLA 1Y9QA 3KL4A 1LLIA 1ZZBA 1RZSA 2J7UA 1QQAA 3A9XA 1ZAYA 2LYKA 2OFYA 2ODRD 4YARA 2H8RA 3L1PA 4MCTA 5DTQA 2PUEA 2L8NA 3NZLA 4I8TA 4HRAA 1ZZ8A 2HSGA 5DSXA 4DE8A 3UWPA 2LCVA 3TEPA 3QF3A 1PRAA 5GAGi 2VEOA 1WH6A 1B0NA 3QOWA 3KJXA 2IUOA 1GT0C 2BNMA 4OBMA 4X4HA 1UXCA 2HINA 3GZDA 3LISA 2PXPA 3QYXA 2J7WA 3O9XA 4PU7A 1JFTA 5DRTA 2PUFA 3BS3A 4F8DA 2JVLA 3TELA 4EK9A 1WH8A 4EZIA 4IWRA 1QB2A 3UFDA 2KEKA 2LYPA 2FFHA 3OQNA 2GZUA 2WIUB 2LYLA 3QOXA 2IVBA 1BDHA 2XSDC 2D5VA 2PUAA 1ZPQA 1E3OC 3OMTA 1BDIA 1PNRA 2MEZA 2M4HA 4EKIA 4X4EA 2PXFA 5A7LA 4Q2JA 1QZXA 3GN5A 4FN3A 4X4BA 3JXBC 2PXQA 3D1NI 2L1PA 4MCXA 3SX0A 4JCYA 1DULA 2LNMA 2BNNA 3ZHIA 4Z5HA 2KPJA 1VPWA 3S8QA 1JFSA 3NROA 2XXAA 3M9LA 1HQ1A 4I6UA 3ZKCA 1NEQA 2AXUA 1QP0A 1QP7A 2KEIA 2LLWA 3SCHA 2PUCA 1RZRD 2PUBA 1ZZ9A 4YBAA 3GN5B 3RZZA 1IC8A 1S7EA 2PXVA 4GHJA 3PE5A 1PRUA 2EWTA 2BJCA 2GRLA 4I6TA 3OQMA 3EUSA 1X2LA 4JCXA 4Z59A 3A9ZA 4O8BA 2BNOA 2HCSA 3OQOA 1LMB3 4I6RA 1QP4A 4X4CA 4WVLA 3QQ6A 1LCCA 2R63A 2CSFA 4GQMA 5DT2A 2XXPA 2IVGA 2XCJA 4J1WA 2L49A 4EKGA 1WIZA 3DM5A 2HFZA 4Y42A 5DTMA 5DTRA 3GZCA 4X4GA 1JWLA 1O4XA 5GAHi 2AXVA 1ZZCA 4IA8A 3LQXA 3VK0A 2FJRA 1R63A 2IVQA 3GBFA 3QWGA 2PXDA 1WETA 1QQBA 4X4DA 1LQCA 1R69A 2MQKA 3SCFA 2O49A 4YG7B 2LYQA 3VWSA 2A6CA 1OSLA 3MEJA 4NDWA 3DNVB 3OKZA 1UXDA 4EQZA 3MLFA 1RZRA 1CJGA 4PU3C 1DWKA 3R1FA 2B5AA 4DE9A 2CROA 3FMYA 2ICPA 4YG4A 4Z5DA 2KEJA 1MFQC 3GUUA 2PUGA 2AUWA 2AXZA 4OB4A 2PUDA 1OCTC 4X4IA 2AWIA 2HCNA 2PE5A 2PPXA 1QPZA 1UTXA 3KXAA 3FYMA 3ME5A 2PXBA 1LCDA 3JXCL 3G0TA 1RPEL 4ER3A 1PRVA 2IU7A 2LYJA 3LFPA 3NDBB 2MXDA 3F52A 1DW9A 4ER0A 1L1MA 3F51A 2ICTA 2AW6A 4X4FA 1PERL 2OR1L 2R1JL 1EFAA 1ZUGA 1CQTA 4YG1A 2YBDA 3OP9A 2O4AA 4ER5A 1Y7YA 4Z5CA 1HF0A 2PXEA 3TFLA 2PXUA 1ZS4A 2KZ8A 1ZVVA 4PU8A 3HZIB 3G7DA 1NW3A 4ER7A 3B7HA 2PXKA 3NXHA 1X57A 2V3CC 5K98B 3CROL 3BDNA 2IV1A 3BD1A 3OWQA 1SQ8A 1AU7A 3ZHMA 2JQEA 1YSEA 3FYAA 1NERA 3KZ3A 4IVZA 2LYRA 5JUWA 2GRMA 4JQDA 2EBYA 3SCGA 3SR4A 2PIJA 3A9YA 1JH9A 3JXDL 3G5GA 1RIOA 1POUA 2JCGA 2XJ3A 2XIUA 4FBIA 4PU4C 3U3WA 3H5TA 1XWRA 1ZZ7A 2LYSA 5DRYA 3QFIA 3ZPXA 1ADRA 4ER6A 3CECA 3PXPA 2EF8A 2XI8A 1ZZ6A 4Z58A 3TRBA 3R09A 4J1XA 3IVPA 3F6WA 2LLVA 3GZDC 2WUSR
chains in the Genus database with same CATH topology
1DULA 2PXTA 2PXLA 3KL4A 5GAHi 2PXBA 2PXVA 2PXKA 2V3CC 2XXAA 3LQXA 2PXPA 1MFQC 1QB2A 3NDBB 1HQ1A 2PXDA 2PXFA 2PXEA 1QZXA 5GAGi 2FFHA 3DM5A 2JQEA 2PXUA 2PXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DUL A;  2PXT A;  2PXL A;  3KL4 A;  5GAH i;  2PXB A;  2PXV A;  2PXK A;  2V3C C;  2XXA A;  3LQX A;  2PXP A;  1MFQ C;  1QB2 A;  3NDB B;  1HQ1 A;  2PXD A;  2PXF A;  2PXE A;  1QZX A;  5GAG i;  2FFH A;  3DM5 A;  2JQE A;  2PXU A;  2PXQ A; 
#chains in the Genus database with same CATH topology
 2XXQ A;  3CLC A;  2O38 A;  1U2Z A;  2PXT A;  2PXL A;  1Y9Q A;  3KL4 A;  1LLI A;  1ZZB A;  1RZS A;  2J7U A;  1QQA A;  3A9X A;  1ZAY A;  2LYK A;  2OFY A;  2ODR D;  4YAR A;  2H8R A;  3L1P A;  4MCT A;  5DTQ A;  2PUE A;  2L8N A;  3NZL A;  4I8T A;  4HRA A;  1ZZ8 A;  2HSG A;  5DSX A;  4DE8 A;  3UWP A;  2LCV A;  3TEP A;  3QF3 A;  1PRA A;  5GAG i;  2VEO A;  1WH6 A;  1B0N A;  3QOW A;  3KJX A;  2IUO A;  1GT0 C;  2BNM A;  4OBM A;  4X4H A;  1UXC A;  2HIN A;  3GZD A;  3LIS A;  2PXP A;  3QYX A;  2J7W A;  3O9X A;  4PU7 A;  1JFT A;  5DRT A;  2PUF A;  3BS3 A;  4F8D A;  2JVL A;  3TEL A;  4EK9 A;  1WH8 A;  4EZI A;  4IWR A;  1QB2 A;  3UFD A;  2KEK A;  2LYP A;  2FFH A;  3OQN A;  2GZU A;  2WIU B;  2LYL A;  3QOX A;  2IVB A;  1BDH A;  2XSD C;  2D5V A;  2PUA A;  1ZPQ A;  1E3O C;  3OMT A;  1BDI A;  1PNR A;  2MEZ A;  2M4H A;  4EKI A;  4X4E A;  2PXF A;  5A7L A;  4Q2J A;  1QZX A;  3GN5 A;  4FN3 A;  4X4B A;  3JXB C;  2PXQ A;  3D1N I;  2L1P A;  4MCX A;  3SX0 A;  4JCY A;  1DUL A;  2LNM A;  2BNN A;  3ZHI A;  4Z5H A;  2KPJ A;  1VPW A;  3S8Q A;  1JFS A;  3NRO A;  2XXA A;  3M9L A;  1HQ1 A;  4I6U A;  3ZKC A;  1NEQ A;  2AXU A;  1QP0 A;  1QP7 A;  2KEI A;  2LLW A;  3SCH A;  2PUC A;  1RZR D;  2PUB A;  1ZZ9 A;  4YBA A;  3GN5 B;  3RZZ A;  1IC8 A;  1S7E A;  2PXV A;  4GHJ A;  3PE5 A;  1PRU A;  2EWT A;  2BJC A;  2GRL A;  4I6T A;  3OQM A;  3EUS A;  1X2L A;  4JCX A;  4Z59 A;  3A9Z A;  4O8B A;  2BNO A;  2HCS A;  3OQO A;  1LMB 3;  4I6R A;  1QP4 A;  4X4C A;  4WVL A;  3QQ6 A;  1LCC A;  2R63 A;  2CSF A;  4GQM A;  5DT2 A;  2XXP A;  2IVG A;  2XCJ A;  4J1W A;  2L49 A;  4EKG A;  1WIZ A;  3DM5 A;  2HFZ A;  4Y42 A;  5DTM A;  5DTR A;  3GZC A;  4X4G A;  1JWL A;  1O4X A;  5GAH i;  2AXV A;  1ZZC A;  4IA8 A;  3LQX A;  3VK0 A;  2FJR A;  1R63 A;  2IVQ A;  3GBF A;  3QWG A;  2PXD A;  1WET A;  1QQB A;  4X4D A;  1LQC A;  1R69 A;  2MQK A;  3SCF A;  2O49 A;  4YG7 B;  2LYQ A;  3VWS A;  2A6C A;  1OSL A;  3MEJ A;  4NDW A;  3DNV B;  3OKZ A;  1UXD A;  4EQZ A;  3MLF A;  1RZR A;  1CJG A;  4PU3 C;  1DWK A;  3R1F A;  2B5A A;  4DE9 A;  2CRO A;  3FMY A;  2ICP A;  4YG4 A;  4Z5D A;  2KEJ A;  1MFQ C;  3GUU A;  2PUG A;  2AUW A;  2AXZ A;  4OB4 A;  2PUD A;  1OCT C;  4X4I A;  2AWI A;  2HCN A;  2PE5 A;  2PPX A;  1QPZ A;  1UTX A;  3KXA A;  3FYM A;  3ME5 A;  2PXB A;  1LCD A;  3JXC L;  3G0T A;  1RPE L;  4ER3 A;  1PRV A;  2IU7 A;  2LYJ A;  3LFP A;  3NDB B;  2MXD A;  3F52 A;  1DW9 A;  4ER0 A;  1L1M A;  3F51 A;  2ICT A;  2AW6 A;  4X4F A;  1PER L;  2OR1 L;  2R1J L;  1EFA A;  1ZUG A;  1CQT A;  4YG1 A;  2YBD A;  3OP9 A;  2O4A A;  4ER5 A;  1Y7Y A;  4Z5C A;  1HF0 A;  2PXE A;  3TFL A;  2PXU A;  1ZS4 A;  2KZ8 A;  1ZVV A;  4PU8 A;  3HZI B;  3G7D A;  1NW3 A;  4ER7 A;  3B7H A;  2PXK A;  3NXH A;  1X57 A;  2V3C C;  5K98 B;  3CRO L;  3BDN A;  2IV1 A;  3BD1 A;  3OWQ A;  1SQ8 A;  1AU7 A;  3ZHM A;  2JQE A;  1YSE A;  3FYA A;  1NER A;  3KZ3 A;  4IVZ A;  2LYR A;  5JUW A;  2GRM A;  4JQD A;  2EBY A;  3SCG A;  3SR4 A;  2PIJ A;  3A9Y A;  1JH9 A;  3JXD L;  3G5G A;  1RIO A;  1POU A;  2JCG A;  2XJ3 A;  2XIU A;  4FBI A;  4PU4 C;  3U3W A;  3H5T A;  1XWR A;  1ZZ7 A;  2LYS A;  5DRY A;  3QFI A;  3ZPX A;  1ADR A;  4ER6 A;  3CEC A;  3PXP A;  2EF8 A;  2XI8 A;  1ZZ6 A;  4Z58 A;  3TRB A;  3R09 A;  4J1X A;  3IVP A;  3F6W A;  2LLV A;  3GZD C;  2WUS R; 
#chains in the Genus database with same CATH homology
 1DUL A;  2PXT A;  2PXL A;  3KL4 A;  5GAH i;  2PXB A;  2PXV A;  2PXK A;  2V3C C;  2XXA A;  3LQX A;  2PXP A;  1MFQ C;  1QB2 A;  3NDB B;  1HQ1 A;  2PXD A;  2PXF A;  2PXE A;  1QZX A;  5GAG i;  2FFH A;  3DM5 A;  2JQE A;  2PXU A;  2PXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...