1MFWA

Structure of n-terminal doublecortin domain from dclk: selenomethionine labeled protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
b'TLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSMDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOUBLECORTIN-LIKE KINASE (N-TERMINAL DOMAIN)
publication title The DCX-domain Tandems of Doublecortin and Doublecortin-like Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 25
structure length 106
sequence length 106
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 1mfwA00
5IO9A 5IP4D 1UF0A 1MG4A 5IN7A 2BQQA 5IOIA 5IKCM 1MFWA 1MJDA 2DNFA
chains in the Genus database with same CATH superfamily
1FCCC 2CR5A 1JWUD 2V4LA 4FLHA 1QOAA 3Q3FA 3M3JA 1FEHA 3MJWA 2FUG1 2GB1A 5HHDG 1UH6A 5KHQA 3QWZB 3P63A 2JRHA 2FCSA 3ETRA 5JHAA 1ET6A 1SE2A 3VUXA 3H8HA 2D07B 3NS1A 5D3DA 4HRSA 2V3NA 2KFKA 4XZ4A 4BFRA 1L6UA 4URKA 1PGBA 1IBXA 2MWSB 4MT5A 5DCNA 2BYTA 1ZGUB 1ROEA 5E6OA 4S0RA 5DPSA 2MX2A 1NYQA 2Y5CA 1J19A 3TSSA 2Y5PA 2MLBA 3VVWB 3ZNGC 5BMGA 4WAAA 3RULA 1WXAA 3DOWA 2XN9C 2K6QA 2RDHA 1DOXA 2Z59B 4BAXA 2E3TA 1E7UA 3NZSA 3AULA 4HROA 1Q0WB 1ZKHA 4A3PA 5CX3A 1R4NI 2HJ1A 4CYEA 1TBEA 2V1YA 3AEDB 2FCNA 3QHTA 4ARIA 4C80A 3IXSA 1JCKB 2Z8LA 4WH4A 1FRRA 1ZUD2 1CQVA 2AQ2B 1V6EA 4ZHOA 1V81A 2KT7A 2WQYB 1SXTA 1E8WA 2K39A 2L0FA 3VRBB 1XEEA 2BB5A 2D2QA 3Q69A 2C7NB 4KGSA 5G5HA 3VQIA 1FO4A 1DOIA 3D32A 2M8SA 4LNFA 4NAMA 3AE8B 4IW0A 1FCLA 1YQ4B 2XNAC 2PEAA 2MBQA 2BGFA 3K9OB 2KDBA 2MP2A 2KMMA 1RM6C 2UU7A 3NVZA 2MA9B 4US8A 1MVKA 5D2MB 4EEWA 4G11A 1NI2A 3N32A 1ET9A 3RCZA 4B6WA 2REXA 2LWPA 3RNFC 2MH7A 5BMIA 2CHWA 5BYRA 2HDEA 2JQRB 1C1YB 2N1VA 3ZJUA 2WDQB 3Q14C 2WU5B 2K1FA 3Q3OC 1LO5D 3IFWB 4MDKE 3M62B 2D3AA 2DLBA 2QILA 5FKAC 2JXXA 3ONSA 4RGTA 2RDGA 1N61A 2N7DA 2LGYA 1KF6B 1YD8U 1QOGA 1TS2A 2RMMA 1SGHA 3AEEB 3I57A 2ON8A 3QX1A 1HQRD 3MHSD 3P4PB 1G6JA 4B0MA 2DENB 1V1PA 2WX0A 3W1YA 3C8YA 1VCBA 1HTQA 2KC1A 2BTEA 3Q8BA 1YN5A 4GIVA 4ANWA 3Q8CA 4DDGD 2NPTB 2INPE 2ZPYA 2LRUA 1UBQA 4ZRIA 5CHWA 4W9JA 1RYJA 3KUZA 4GDKA 5FK9C 3BVGA 3VHTC 3DBHB 3PZ7A 4RM9A 2KAJA 4W9EA 2XK5A 2KVRA 1GB4A 3TEXA 3QIJA 3WA0A 2G4DB 2ZVNA 3R2IA 3U30A 3VH4B 2J42A 1NVID 1I4QA 1K8RB 3IT4B 4XWWA 1MJDA 2M0XA 2LXAA 4ZDVA 3AU5A 4W9KA 1E90A 1V97A 4ZRPA 4GDLA 3DWGC 1WF9A 2DZKA 4YSYB 1WRIA 1PDXA 2KDEB 3FILB 3P2BA 2K8CA 1IP9A 2W82A 1WIAA 3PVLA 4ZYSA 1FNUA 3APFA 4XYCA 3ZJVA 2IBIB 1F9JA 1RFAA 3AECB 1ESFA 1I35A 4TUUA 3Q3NC 2W3SA 1CZPA 1E10A 3PO0A 4HJGE 2KJ6A 3O13A 2EMSA 4YTMB 2KTRA 2IO1B 4HCNB 1DYQA 4I6LB 3EGRA 4BOSC 3X0WA 1RLFA 2KNBA 2DZMA 4LDTD 4BBNF 5L83A 1ZXHA 3P4RB 1KTKA 5AUIA 4EFOA 3IVFA 4F8CB 3NOBA 1N5XA 1P7FA 2WXLA 4NJ7A 3RMKC 2LJ5A 4OHJA 1I4HA 3W1SA 4FA6A 2DBYA 1VD2A 4RGNA 3PHWB 2ZJDA 3KUDB 1KH0A 4PYZA 2L52A 2ZZPB 2KLCA 2H89B 3DVGX 1I4GA 2CU1A 1E9MA 2TSSA 2DWQA 2IY0B 2WGSA 3BVZA 1C4PA 4K7SA 2VH2A 4BKTA 4W9HA 3PPAA 4W9GA 5EE3A 2SAKA 2N9KA 1D6EC 2BYEA 3LXFA 4WIPA 2KC2A 4JE3B 3UI3A 3B1LX 3KYCD 1VZ6A 3H9DA 3L08A 4FADA 4C7YA 4C4VA 2WXKA 4MGIE 2JZPA 1XLQA 5IOIA 2L0TA 1E7PB 4RFBA 3WAOA 4FHKA 3WALA 3N1YC 3DVNU 3T8MA 2VZKB 4KV2A 2N4FA 4MH0E 4L2YA 1EM7A 4KGTA 3EUB2 4KZ0A 3EC8A 2DNFA 4W9CA 2IYDB 4BKGA 2PW9A 4BZAA 3PTFC 1BT0A 4P7IA 1P7EA 3VAWA 3WANA 1WYGA 4IDIA 3E9SA 1BUIC 1SE9A 3JSVA 1WXQA 2J7QB 2K8BA 1HA5A 1HEZE 1JWAD 4MGZE 3ZXVA 5TR5A 1VDVA 3Q3JA 5CTRC 1WGHA 4HKZE 4NJ6A 2JPHA 4XDDA 4HDOA 1OEYJ 1RWSA 3HM3A 2WWZA 4RCOA 4AUQC 4A3OA 1SE3A 3VUYA 1EWCA 3NZ3A 2J0KA 3U8ZA 3VH3B 1YOVB 3AH7A 2IJ0A 3MP9A 3QAQA 2PVGC 2JF5A 4RM8A 4C00A 4YT0B 2LXCA 2ZCBA 3IT6B 3A9KB 4KZCA 1M4VA 2BPSA 1L4DB 5JH5C 3QARA 5G55A 2M17A 4FHJA 3ZQ4A 1SBBB 1PQSA 3GOEA 4MGYE 1J8CA 2LHEA 4M8MA 2GMIC 3GE8C 2J0MA 4M02A 2MW5A 4AWJA 1C78A 1UD7A 3ZW3A 1AARA 1VRAB 3ZGZA 1JQ4A 3ZDTA 3PRMB 2EMTA 3DBSA 3JVZX 1E5WA 1TKGA 3TL5A 2K6DB 3SDLC 4N59A 1UWMA 3V61A 2IO3B 1XLOA 3AB5A 3PT2B 4A55A 2L8JA 4DHZE 2RDBC 1EU3A 3T3OA 3TUOA 1MFWA 2PVOD 1FFVA 4PT5A 4ZRJA 2C60A 2VRRB 4DK5A 1F2RC 1PUTA 4P1CC 3AEGB 2KVZA 2CS4A 1YN3A 2WDRB 4JQWC 2AQ3B 2NTTA 2RD0A 5BYSA 4P6VF 1WZ0A 4PS3A 4NQKE 3EECA 1I7HA 2LVOA 3SEBA 4PYUA 1P3QU 1YJIA 3NY5A 2RPVA 3FILA 2AL3A 1FM0D 4II2B 1TIFA 4ICVA 2C9WB 2G1EA 1TKEA 1HE8A 5IKCM 5KHOA 3KH0A 3AE3B 3OJ3A 1AWDA 4ZHPA 2AX5A 2MBHA 2NBVB 1TYGB 2LUEA 4BKSD 1Q10A 1V5OA 2D10A 3IG3A 5HG2A 2RSUA 3N30A 3SD5A 3NHEB 5H8YE 4RF1A 3Q8EA 2DYOA 1P0RA 4BKSA 2LMCA 2PLPA 2CJNA 2YEPB 1WXVA 1NENB 4HWIB 4P16A 1WJUA 3EHVA 2G45B 4L23A 5C3JB 2BVCA 1V80A 1L6VA 2BS2B 3KUCB 1Y56A 3DHGC 2I38A 4NAWA 2N7JA 4HPLB 1ZP0B 2C7HA 3QK0A 2LGXA 1CK1A 3ZXRA 2KQ4X 1N60A 2IGDA 2IZVB 5IA7A 2MJ3A 2L83A 3LJ3A 4E3CA 3WCQA 2JRIB 1ZXIA 3AEBB 3GS2A 3HRDD 3RUIB 2KANA 3RNBC 4ACFA 4HKQA 3A9JA 3W2DA 4IWPA 3GP7A 2KO3A 2NS5A 5J2RA 2KOXA 3AE7B 3RZWC 2GI9A 3AN1A 3I63C 3APDA 3JW0X 1T0YA 4M0WA 1Z5SB 1WX8A 1WMHA 2BWFA 1R4MB 2MHJA 1GNUA 4O1NA 4J6IA 3RNCC 3DBRB 2VZKD 2BYFA 1UBIA 4AJWA 4YXDB 2M19A 1D4BA 3BK1A 4IC7B 2O6VD 2RPQA 3TBLD 1TTNA 2XEWA 2QSDA 5LXHA 2CU3A 4EE2A 4DWFA 2VH1A 3ZNID 2O6VA 3KQ4A 1GC7A 3X23A 2N9PC 3BZDB 4J3OD 3U52E 3C19A 4S17A 3S2AA 4PK1A 5L95C 3BYTB 3ZO5B 1T5XD 2KYWA 2GRIA 4NNJB 1KLGD 2LD9A 3BVMA 3C0RB 4AOFA 2QHOA 3ECIA 3DBLB 4KDLB 2LVPA 2OHFA 2AYOB 1MG8A 2KD0A 3HVZA 3OG5A 3ZYYX 4C7ZA 3RNEC 3DCGA 4IG7B 1ZDVA 1YMHE 2W55A 5C2TB 4GU2A 1ENFA 2ZVOA 4CHKA 5T8IA 2KJRA 2L32A 3GZNB 2V9HA 1JW9D 3HVDA 2WXPA 4KX6B 2C7MB 3IAS1 1FMAD 3Q8AA 1XO3A 2L1AA 1LM8B 2KDMA 2IGGA 5BMHA 3L0WB 5LNK1 1F2RI 1GJZA 5G5GA 2WXRA 4LNKA 2JY6A 2D3CA 2INNE 4CQNA 2QMTA 1BMLC 3QA8A 3URYA 4JGHB 1T0SC 3SFDB 1TY2A 1SJHD 3NVVA 3UQAA 3DQVA 2AWTA 2JT4B 3AE9B 3R66C 4DXFA 1JALA 2N7EA 1V49A 1QKZA 1E8ZA 2GBKA 1LQBA 2ICIA 4IKGA 4N6EB 1VR9A 1XD3B 3CMMB 1I4XA 3AE6B 1N63A 4MH8A 1NEKB 4N58A 4RNAA 2JXTA 2KWUB 3U2SC 2WXOA 2UYZB 2G4SA 2JYEA 1L7YA 1CJEA 3W5VB 1WYWB 2Q5WD 1GC6A 3PRPB 4GGQA 1XLNA 2WX1A 4I6NB 4EKUA 2KX3A 2W9NA 2N1WA 3RD2A 4BBNC 2O2VB 1VJKA 3I9V1 4DHJB 4KIKB 1YJJA 3R7RA 2PE9A 1UWXA 2PE6B 4KSKC 3VXWA 1BXTA 4LK0M 3N20C 5EE1A 1S1QB 2V4IB 4OVVA 4IM0A 3I5JC 3ZRCA 1D5ZC 5HI1A 1LXDA 4ARCA 1OQRA 1PGXA 3CF6E 3NS8A 4JWSC 1WJNA 4OVZA 2ZEQA 1TS4A 3B08A 2CKHB 2C5LC 2KKCA 1Q1OA 4FXCA 2FCMA 5JXVA 4MELA 1NI3A 2GLSA 2LEKA 2B76B 4OZAA 1Y8RC 4TQ1A 3OLMD 5C1ZA 4ZRKA 1V86A 3H1UA 3RFZB 3FC4A 4YSXB 3RNGC 1J7AA 2KFKB 1WE6A 4USAA 3W9CB 4BVUC 2V3PA 1E8YA 4GOCA 3A4RA 4A8XC 3A1QB 2IY1B 5JZEB 2N9LA 5E6PA 2KN4A 2WXQA 3ZVVA 3ZDMC 1JROA 2KWCA 2QC8A 3N3KB 2FBWB 5C23A 4YTNB 1WH3A 4EZKA 1IGCA 3M95A 2KX0A 3KW5B 3LDZE 1V8CA 2EELA 1WXMA 2OJWA 4WQMA 3P1MA 5IN7A 3QQ8B 2KMAA 1GAQB 1L0YB 2D3GA 4MJSB 3AE5B 2G9HD 2I1KA 3KYDD 3RNAC 1QT9A 1SEBD 1J7CA 3WAMA 1C79A 4NZLB 1DGJA 3SR6A 1WXSA 2DAFA 4KKJA 4FBJB 1ZOYB 3PS6A 4OW0A 2J0JA 1P9DU 4G3XB 4RMAA 1HXYD 2JUOA 4WJOA 3BIID 2MBEA 4A90A 1ACCA 2MP2B 3PLVA 4RGMA 4IWOA 4B9KA 3VDZA 3ZRFA 3HM6X 4IWQA 1HZ6A 2HE7A 1TZ1A 1YQ3B 5TSSA 3ZTDA 1EF1A 5AZFA 2E6XA 1UGMA 4LNOA 2J53A 4GB9A 2BKFA 3W5UB 2PIAA 5AZGA 3AI5A 3H7PB 4H2AA 4LNIA 2BWES 3MFGA 2NBUA 1WJ4A 1HTOA 2L05A 1E8XA 4HK2A 5D6JB 1TJEA 2OJRA 4LNNA 4FJZA 3R2TA 1N6ZA 4WJPA 1I4RA 4Q2JA 2YLMA 2BB6A 3PLUA 1NDDA 3RYTA 4F1SA 3JYUA 1E6EB 2WXGA 4ANXA 3HIZA 3WIMA 4AQ7A 2ZW1A 1I42A 4K3CA 1ZE3D 1LGRA 5DPRA 1YX6B 1V1PB 4D2KA 2ZNVC 5FR6A 1C4AA 2INDC 3W1SC 4XGAB 4KKIA 4WJQA 5IP4D 3PSEB 3CWIA 1C3TA 4HPPA 1QLBB 2KLGA 2KWVB 4GDKB 3E56A 4MSMB 5I4DA 3CSTA 2EKEC 3TEZA 3NG0A 4KVGB 2FNJB 1QF6A 1L5PA 4K7WA 2KK8A 2NPTA 2QDFA 1XLPA 3V6CB 4JIOU 3MTNB 3V3XA 2XK5B 4L1BA 3DVNV 1F1HA 2JVCA 2BT6A 3V62A 2BW2A 1WI0A 4EZLA 1GOZA 3DPDA 3HUIA 4IM3A 1H4RA 3NUHB 4HCPB 4LCDE 2QIEB 4DDID 1WM2A 4AP4C 4GDLB 3AXCA 5CHFA 2KFJA 2DHZA 2YEPF 3AEAB 1C9FA 3I3TB 4ZYNA 5EE9A 3VUWA 1UNSA 4PS8A 1R4NB 2UWQA 1KLUD 4YTPB 4TMAB 1V2YA 3EA6A 4XX5A 4XC2A 1WRDB 1WJ6A 4A20A 4TKNA 1WR1A 1T0RC 4M8NA 4E74A 1WZ3A 3CIRB 4HVBA 3NZUA 3MHZA 1VZ8A 1K51A 4TQ0A 1MHXA 2LHDA 2GBRA 1STEA 3HK0A 1CMXB 4MACA 2LI5A 3TEYA 1TGZB 4AS1A 2Y3AA 2H88B 5CHVC 2OEDA 4JLCA 1TS3A 2AEHA 1RRBA 1XF5L 2IO2B 2G3QB 2M0AA 3NRZA 2K0PA 2A5UA 4W9IA 1FXIA 4QAYA 4WAFA 2KACA 1T3QA 4NY0A 4LDTB 3KVFB 1XCQL 2JYTA 5H92C 3PV1A 3B9JA 4LLGM 1WGRA 2FCQA 2JZZA 3R3MA 1E0ZA 2WNMA 4LJOB 2L00B 2KMCA 3GB1A 2DAJA 3ML8A 2KXJA 3AM9A 3WAPA 1JRUA 4GMVA 3EFCA 3NVYA 3PREA 3LB8C 4K3BA 1N62A 2QJLA 1T0QC 2JSVX 4WJNA 2WXIA 1F77A 2ZW0A 4MM3B 2HTME 3P42A 3TIXA 4ZOHC 1FRDA 1SE4A 2CHXA 1WX9A 4R3DA 1GPXA 3U7ZA 2JX5A 3IAM1 3ZLZA 1B1ZA 4C4VB 1UUPA 3A1QA 2V0GA 3L16A 4DBGA 2AQ1B 4W9LA 2L3ZA 1PFDA 2WP9B 2W3RA 3APCA 1D5XC 2J52A 1AW7A 3KLSX 2LVQA 1U4AA 2KWDA 2W54A 4DXAB 3DVGY 4GLSC 1WE7A 5GMVA 4HJKA 2EKIA 2MJEA 3ENEA 3TJPA 1PYWD 2K25A 3AV8A 2R2QA 3RI7C 2CJOA 2MRPA 3QCAA 3N9YC 3A4SC 3JSVB 1F52A 4FN2A 1T6BX 4WWMA 4MJSA 1KRHA 4IM2A 1WFYA 3L4PA 1JMLA 2IO0B 1WGDA 1EF5A 1C77A 3EFUA 2PKOA 1X1MA 2N9XA 4N9F4 3AE2B 4REZA 1OQYA 3RN9C 3OJ4B 4K7UA 3Q3MC 5HKHA 1L0XB 2D5GA 3UF8A 2BBCA 2X8XX 3NVWA 1PGAA 2WXMA 3FAHA 4HEA1 1KFYB 1YIWA 1IUEA 1NBFC 4FJYA 4GXBA 2RGFA 5DPWA 3SHQA 1A70A 2RR9A 4EOYA 2AL6A 3P4QB 4IOIE 4MGKE 3HHMA 4EUTA 3ZTCA 2JZ3B 4W9DA 5BO4B 1FNVA 1N5WA 2GBMA 1P98A 4TV3A 3ZIMA 3H7PA 2PPHA 2HJ8A 4II3B 5G2NA 5AUKA 2JWZA 2Y5BB 3KWLA 3H6NA 4ANVA 4RGOS 4WWOA 3ZNHB 3Q2AC 2M56B 1GG3A 2WDTB 4G0NB 3A9KA 4EZJA 4WWPA 1SJED 4JX1C 3UIOB 2PJHA 1SB3C 4NJCA 1E7VA 3AE4B 4JWUC 4B95A 3AU4A 1V5TA 5HFYA 2WXFA 3VTWA 3ZKJC 2FIFA 1QILA 4LJPB 2LASA 3VTUA 3TEWA 5DPTA 3L54A 4JL9A 1JWMD 1FXAA 2LJIA 5JHBA 2BS4B 4I6PA 4DQOC 1SF0A 2LFIA 2ZCCA 2WDVB 2D11A 4FULA 4BOZB 4OZCA 2MQJA 1R4MI 2SEBD 2WYQA 1WR6E 2GBJA 2QEJC 1GUAB 2JWUA 3ZJTA 2DYMA 1JWBD 2K8HA 3DBRI 3ML9A 2WXHA 3ZNZB 3PGEA 2KJHB 3A33B 3R7QA 1SSNA 4KSLC 3NJTA 2INCC 4MEMA 3V6EB 4E71A 1SIFA 3SFEB 3ALBA 2NR2A 1R7SA 3J9CA 4RH6A 4M00A 1WGKA 3B0AA 4TSSA 2PMVA 3RT3B 3P4SB 4YSZB 1YQBA 2BS3B 3TMPB 3FKYA 1OTRB 3DWMA 2BF8B 1MHHE 4P1BC 2YVCA 4ANUA 1V1OA 2N0SB 1YJ1A 4HXDA 1YN4A 2IGHA 1EUVB 4B0EA 3U7DA 1OEYA 1Z2MA 1AN8A 1FPYA 4XWTA 3DBLI 3RPFC 2R2OA 2JU6X 3IHPC 1OFFA 4K81A 2KN5A 3PZ8A 2HD5B 2V3SA 3RZFA 2ASQA 2LZ6A 1A5RA 3VR8B 1L0VB 1IGDA 1HZ5A 5BYQA 4A6QA 3Q6BA 2MCNB 4LTUA 2MBBB 3GZNI 3BY4B 1DOYA 1RFKA 1ZW7A 4NAWB 2R61A 4CO7A 2NBWB 1UZXB 1IBXB 4WWNA 5IAAC 2DX5B 1I4PA 3CSFA 1D3ZA 1YX5B 1FXTB 1TS5A 4US9A 4C56C 1IYFA 2DZJA 3MC9A 4W9FA 1FFUA 4X57B 3Q8FA 3UINB 2X38A 1FNWA 1KOTA 4F7ZA 2IPKD 2ZPNA 2L7RA 1UF0A 3DBHI 1M94A 1TZOA 3A9JB 2B3AA 2J4XA 2ACZB 5J18A 4RF0A 4MM3A 1L4ZB 2WS3B 4GN1A 2CHZA 1EU4A 2NMQA 5D3IB 1FD6A 3VR9B 1MG4A 1VZ7A 3BWUD 2K22A 2WHIA 4M0WB 4HLEA 3MJ5A 1ZDXA 5GXGB 2LUMA 1WMHB 1B9RA 3OAWA 3DHHC 5J17A 2MSED 3T9LA 4ICUA 3L17A 1TY0A 4MSQB 3SU8X 1WY8A 4FJVB 2FIDA 3V05A 1J0GA 1XT9B 2FAZA 1J7BA 1YNTE 2WXNA 1LFDA 2KQSA 3M63B 2LGSA 1V9JA 3ZUNA 1RAXA 4NQLB 2MJDA 2WLBA 1NYRA 2KZRA 1OGWA 3VRAB 1IPGA 4NPNA 4IUMB 2WXJA 3UGBB 5LLIA 1D5MC 3H7SA 1WGYA 2M1MA 2O6VB 4XDCA 1K52A 2DYBA 3BYYB 2MBOA 5AZHA 2IDYA 2M4NA 1FIQA 1MPEA 5IO9A 3LYYA 4HPMB 1TT5B 3K9PB 1Q5WB 4YL8A 2Z0DB 4ZRQA 2WU2B 1L2NA 2Z0EB 1XCTL 4KGRA 1P1AA 2K5PA 3B2FA 3L13A 3U4EG 5E6NA 3R8BA 1JRPA 1WGGA 1XQQA 3KWVA 1UELA 1KLVA 2KDFB 3OWEB 2GOWA 5EDSA 2OOBB 1K50A 2NVUI 2GBNA 3PRZA 2D3BA 1QOFA 2PTLA 1MI0A 2K9XA 1WWTA 3DDCB 3AEFB 4DHZB 1WSPA 1C76A 2KHWB 1WM3A 3BINA 3N1XC 1K53A 2BQQA 5LXIB 3BK2A 5EE0A 3TCAA 4YWGG 1OQQA 3GE3C 3PHXB 2FUHB 4JPSA 3UIPB 3MC8A 4K1RB 2N9EB 1S3SG 4PS7A 3AMZA 1H8CA 3IBEA 1KJTA 1AYFA 3N1ZC 1QOBA 2K3UA 4ASWC 2I1JA 2KTFA 4AJYB 4KDIC 3V60A 3ABVB 2HTHA 1F0ZA 2KDIA 4XE0A 3O65B 2BKRB 4G50A 1EWYC 4GSWA 2BYVE 3AE1B 3DHIC 1SIJA 5D94A 1C4CA 4DXGA 3PZDA 2XBBC 1KM7A 5E6JA 4WQOB 1GB1A 1QZEA 4M01A 3UQBA 2I2YA 2LGDA 3VTVA 5MPOA 2ONQA 2MEKA 3QJZA 1EO6A 1ZPSA 3T3NA 4OVUA 2LGIA 4A9AA 4DHJD 1VLBA 1UGJA 2KTRB 2O2VA 4WURA 2KQ7A 4ITKA 4KIKA 1JWSD 4HDQA 1XXGA 3VFKA 3QC8B 1QQRA 1ISNA 4UDUC 5AEKB 2L76A 5FR3A 4OZBA 1TKYA 2ZNVB 3L10B 2FE8A 2LRWA 2A4ZA 1WX7A 2QCZA 2NCNA 3B2GA 2DZIA 5D7GA 2NTSA 3MC0B
chains in the Genus database with same CATH topology
5IO9A 5IP4D 1UF0A 1MG4A 5IN7A 2BQQA 5IOIA 5IKCM 1MFWA 1MJDA 2DNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IO9 A;  5IP4 D;  1UF0 A;  1MG4 A;  5IN7 A;  2BQQ A;  5IOI A;  5IKC M;  1MFW A;  1MJD A;  2DNF A; 
#chains in the Genus database with same CATH topology
 1FCC C;  2CR5 A;  1JWU D;  2V4L A;  4FLH A;  1QOA A;  3Q3F A;  3M3J A;  1FEH A;  3MJW A;  2FUG 1;  2GB1 A;  5HHD G;  1UH6 A;  5KHQ A;  3QWZ B;  3P63 A;  2JRH A;  2FCS A;  3ETR A;  5JHA A;  1ET6 A;  1SE2 A;  3VUX A;  3H8H A;  2D07 B;  3NS1 A;  5D3D A;  4HRS A;  2V3N A;  2KFK A;  4XZ4 A;  4BFR A;  1L6U A;  4URK A;  1PGB A;  1IBX A;  2MWS B;  4MT5 A;  5DCN A;  2BYT A;  1ZGU B;  1ROE A;  5E6O A;  4S0R A;  5DPS A;  2MX2 A;  1NYQ A;  2Y5C A;  1J19 A;  3TSS A;  2Y5P A;  2MLB A;  3VVW B;  3ZNG C;  5BMG A;  4WAA A;  3RUL A;  1WXA A;  3DOW A;  2XN9 C;  2K6Q A;  2RDH A;  1DOX A;  2Z59 B;  4BAX A;  2E3T A;  1E7U A;  3NZS A;  3AUL A;  4HRO A;  1Q0W B;  1ZKH A;  4A3P A;  5CX3 A;  1R4N I;  2HJ1 A;  4CYE A;  1TBE A;  2V1Y A;  3AED B;  2FCN A;  3QHT A;  4ARI A;  4C80 A;  3IXS A;  1JCK B;  2Z8L A;  4WH4 A;  1FRR A;  1ZUD 2;  1CQV A;  2AQ2 B;  1V6E A;  4ZHO A;  1V81 A;  2KT7 A;  2WQY B;  1SXT A;  1E8W A;  2K39 A;  2L0F A;  3VRB B;  1XEE A;  2BB5 A;  2D2Q A;  3Q69 A;  2C7N B;  4KGS A;  5G5H A;  3VQI A;  1FO4 A;  1DOI A;  3D32 A;  2M8S A;  4LNF A;  4NAM A;  3AE8 B;  4IW0 A;  1FCL A;  1YQ4 B;  2XNA C;  2PEA A;  2MBQ A;  2BGF A;  3K9O B;  2KDB A;  2MP2 A;  2KMM A;  1RM6 C;  2UU7 A;  3NVZ A;  2MA9 B;  4US8 A;  1MVK A;  5D2M B;  4EEW A;  4G11 A;  1NI2 A;  3N32 A;  1ET9 A;  3RCZ A;  4B6W A;  2REX A;  2LWP A;  3RNF C;  2MH7 A;  5BMI A;  2CHW A;  5BYR A;  2HDE A;  2JQR B;  1C1Y B;  2N1V A;  3ZJU A;  2WDQ B;  3Q14 C;  2WU5 B;  2K1F A;  3Q3O C;  1LO5 D;  3IFW B;  4MDK E;  3M62 B;  2D3A A;  2DLB A;  2QIL A;  5FKA C;  2JXX A;  3ONS A;  4RGT A;  2RDG A;  1N61 A;  2N7D A;  2LGY A;  1KF6 B;  1YD8 U;  1QOG A;  1TS2 A;  2RMM A;  1SGH A;  3AEE B;  3I57 A;  2ON8 A;  3QX1 A;  1HQR D;  3MHS D;  3P4P B;  1G6J A;  4B0M A;  2DEN B;  1V1P A;  2WX0 A;  3W1Y A;  3C8Y A;  1VCB A;  1HTQ A;  2KC1 A;  2BTE A;  3Q8B A;  1YN5 A;  4GIV A;  4ANW A;  3Q8C A;  4DDG D;  2NPT B;  2INP E;  2ZPY A;  2LRU A;  1UBQ A;  4ZRI A;  5CHW A;  4W9J A;  1RYJ A;  3KUZ A;  4GDK A;  5FK9 C;  3BVG A;  3VHT C;  3DBH B;  3PZ7 A;  4RM9 A;  2KAJ A;  4W9E A;  2XK5 A;  2KVR A;  1GB4 A;  3TEX A;  3QIJ A;  3WA0 A;  2G4D B;  2ZVN A;  3R2I A;  3U30 A;  3VH4 B;  2J42 A;  1NVI D;  1I4Q A;  1K8R B;  3IT4 B;  4XWW A;  1MJD A;  2M0X A;  2LXA A;  4ZDV A;  3AU5 A;  4W9K A;  1E90 A;  1V97 A;  4ZRP A;  4GDL A;  3DWG C;  1WF9 A;  2DZK A;  4YSY B;  1WRI A;  1PDX A;  2KDE B;  3FIL B;  3P2B A;  2K8C A;  1IP9 A;  2W82 A;  1WIA A;  3PVL A;  4ZYS A;  1FNU A;  3APF A;  4XYC A;  3ZJV A;  2IBI B;  1F9J A;  1RFA A;  3AEC B;  1ESF A;  1I35 A;  4TUU A;  3Q3N C;  2W3S A;  1CZP A;  1E10 A;  3PO0 A;  4HJG E;  2KJ6 A;  3O13 A;  2EMS A;  4YTM B;  2KTR A;  2IO1 B;  4HCN B;  1DYQ A;  4I6L B;  3EGR A;  4BOS C;  3X0W A;  1RLF A;  2KNB A;  2DZM A;  4LDT D;  4BBN F;  5L83 A;  1ZXH A;  3P4R B;  1KTK A;  5AUI A;  4EFO A;  3IVF A;  4F8C B;  3NOB A;  1N5X A;  1P7F A;  2WXL A;  4NJ7 A;  3RMK C;  2LJ5 A;  4OHJ A;  1I4H A;  3W1S A;  4FA6 A;  2DBY A;  1VD2 A;  4RGN A;  3PHW B;  2ZJD A;  3KUD B;  1KH0 A;  4PYZ A;  2L52 A;  2ZZP B;  2KLC A;  2H89 B;  3DVG X;  1I4G A;  2CU1 A;  1E9M A;  2TSS A;  2DWQ A;  2IY0 B;  2WGS A;  3BVZ A;  1C4P A;  4K7S A;  2VH2 A;  4BKT A;  4W9H A;  3PPA A;  4W9G A;  5EE3 A;  2SAK A;  2N9K A;  1D6E C;  2BYE A;  3LXF A;  4WIP A;  2KC2 A;  4JE3 B;  3UI3 A;  3B1L X;  3KYC D;  1VZ6 A;  3H9D A;  3L08 A;  4FAD A;  4C7Y A;  4C4V A;  2WXK A;  4MGI E;  2JZP A;  1XLQ A;  5IOI A;  2L0T A;  1E7P B;  4RFB A;  3WAO A;  4FHK A;  3WAL A;  3N1Y C;  3DVN U;  3T8M A;  2VZK B;  4KV2 A;  2N4F A;  4MH0 E;  4L2Y A;  1EM7 A;  4KGT A;  3EUB 2;  4KZ0 A;  3EC8 A;  2DNF A;  4W9C A;  2IYD B;  4BKG A;  2PW9 A;  4BZA A;  3PTF C;  1BT0 A;  4P7I A;  1P7E A;  3VAW A;  3WAN A;  1WYG A;  4IDI A;  3E9S A;  1BUI C;  1SE9 A;  3JSV A;  1WXQ A;  2J7Q B;  2K8B A;  1HA5 A;  1HEZ E;  1JWA D;  4MGZ E;  3ZXV A;  5TR5 A;  1VDV A;  3Q3J A;  5CTR C;  1WGH A;  4HKZ E;  4NJ6 A;  2JPH A;  4XDD A;  4HDO A;  1OEY J;  1RWS A;  3HM3 A;  2WWZ A;  4RCO A;  4AUQ C;  4A3O A;  1SE3 A;  3VUY A;  1EWC A;  3NZ3 A;  2J0K A;  3U8Z A;  3VH3 B;  1YOV B;  3AH7 A;  2IJ0 A;  3MP9 A;  3QAQ A;  2PVG C;  2JF5 A;  4RM8 A;  4C00 A;  4YT0 B;  2LXC A;  2ZCB A;  3IT6 B;  3A9K B;  4KZC A;  1M4V A;  2BPS A;  1L4D B;  5JH5 C;  3QAR A;  5G55 A;  2M17 A;  4FHJ A;  3ZQ4 A;  1SBB B;  1PQS A;  3GOE A;  4MGY E;  1J8C A;  2LHE A;  4M8M A;  2GMI C;  3GE8 C;  2J0M A;  4M02 A;  2MW5 A;  4AWJ A;  1C78 A;  1UD7 A;  3ZW3 A;  1AAR A;  1VRA B;  3ZGZ A;  1JQ4 A;  3ZDT A;  3PRM B;  2EMT A;  3DBS A;  3JVZ X;  1E5W A;  1TKG A;  3TL5 A;  2K6D B;  3SDL C;  4N59 A;  1UWM A;  3V61 A;  2IO3 B;  1XLO A;  3AB5 A;  3PT2 B;  4A55 A;  2L8J A;  4DHZ E;  2RDB C;  1EU3 A;  3T3O A;  3TUO A;  1MFW A;  2PVO D;  1FFV A;  4PT5 A;  4ZRJ A;  2C60 A;  2VRR B;  4DK5 A;  1F2R C;  1PUT A;  4P1C C;  3AEG B;  2KVZ A;  2CS4 A;  1YN3 A;  2WDR B;  4JQW C;  2AQ3 B;  2NTT A;  2RD0 A;  5BYS A;  4P6V F;  1WZ0 A;  4PS3 A;  4NQK E;  3EEC A;  1I7H A;  2LVO A;  3SEB A;  4PYU A;  1P3Q U;  1YJI A;  3NY5 A;  2RPV A;  3FIL A;  2AL3 A;  1FM0 D;  4II2 B;  1TIF A;  4ICV A;  2C9W B;  2G1E A;  1TKE A;  1HE8 A;  5IKC M;  5KHO A;  3KH0 A;  3AE3 B;  3OJ3 A;  1AWD A;  4ZHP A;  2AX5 A;  2MBH A;  2NBV B;  1TYG B;  2LUE A;  4BKS D;  1Q10 A;  1V5O A;  2D10 A;  3IG3 A;  5HG2 A;  2RSU A;  3N30 A;  3SD5 A;  3NHE B;  5H8Y E;  4RF1 A;  3Q8E A;  2DYO A;  1P0R A;  4BKS A;  2LMC A;  2PLP A;  2CJN A;  2YEP B;  1WXV A;  1NEN B;  4HWI B;  4P16 A;  1WJU A;  3EHV A;  2G45 B;  4L23 A;  5C3J B;  2BVC A;  1V80 A;  1L6V A;  2BS2 B;  3KUC B;  1Y56 A;  3DHG C;  2I38 A;  4NAW A;  2N7J A;  4HPL B;  1ZP0 B;  2C7H A;  3QK0 A;  2LGX A;  1CK1 A;  3ZXR A;  2KQ4 X;  1N60 A;  2IGD A;  2IZV B;  5IA7 A;  2MJ3 A;  2L83 A;  3LJ3 A;  4E3C A;  3WCQ A;  2JRI B;  1ZXI A;  3AEB B;  3GS2 A;  3HRD D;  3RUI B;  2KAN A;  3RNB C;  4ACF A;  4HKQ A;  3A9J A;  3W2D A;  4IWP A;  3GP7 A;  2KO3 A;  2NS5 A;  5J2R A;  2KOX A;  3AE7 B;  3RZW C;  2GI9 A;  3AN1 A;  3I63 C;  3APD A;  3JW0 X;  1T0Y A;  4M0W A;  1Z5S B;  1WX8 A;  1WMH A;  2BWF A;  1R4M B;  2MHJ A;  1GNU A;  4O1N A;  4J6I A;  3RNC C;  3DBR B;  2VZK D;  2BYF A;  1UBI A;  4AJW A;  4YXD B;  2M19 A;  1D4B A;  3BK1 A;  4IC7 B;  2O6V D;  2RPQ A;  3TBL D;  1TTN A;  2XEW A;  2QSD A;  5LXH A;  2CU3 A;  4EE2 A;  4DWF A;  2VH1 A;  3ZNI D;  2O6V A;  3KQ4 A;  1GC7 A;  3X23 A;  2N9P C;  3BZD B;  4J3O D;  3U52 E;  3C19 A;  4S17 A;  3S2A A;  4PK1 A;  5L95 C;  3BYT B;  3ZO5 B;  1T5X D;  2KYW A;  2GRI A;  4NNJ B;  1KLG D;  2LD9 A;  3BVM A;  3C0R B;  4AOF A;  2QHO A;  3ECI A;  3DBL B;  4KDL B;  2LVP A;  2OHF A;  2AYO B;  1MG8 A;  2KD0 A;  3HVZ A;  3OG5 A;  3ZYY X;  4C7Z A;  3RNE C;  3DCG A;  4IG7 B;  1ZDV A;  1YMH E;  2W55 A;  5C2T B;  4GU2 A;  1ENF A;  2ZVO A;  4CHK A;  5T8I A;  2KJR A;  2L32 A;  3GZN B;  2V9H A;  1JW9 D;  3HVD A;  2WXP A;  4KX6 B;  2C7M B;  3IAS 1;  1FMA D;  3Q8A A;  1XO3 A;  2L1A A;  1LM8 B;  2KDM A;  2IGG A;  5BMH A;  3L0W B;  5LNK 1;  1F2R I;  1GJZ A;  5G5G A;  2WXR A;  4LNK A;  2JY6 A;  2D3C A;  2INN E;  4CQN A;  2QMT A;  1BML C;  3QA8 A;  3URY A;  4JGH B;  1T0S C;  3SFD B;  1TY2 A;  1SJH D;  3NVV A;  3UQA A;  3DQV A;  2AWT A;  2JT4 B;  3AE9 B;  3R66 C;  4DXF A;  1JAL A;  2N7E A;  1V49 A;  1QKZ A;  1E8Z A;  2GBK A;  1LQB A;  2ICI A;  4IKG A;  4N6E B;  1VR9 A;  1XD3 B;  3CMM B;  1I4X A;  3AE6 B;  1N63 A;  4MH8 A;  1NEK B;  4N58 A;  4RNA A;  2JXT A;  2KWU B;  3U2S C;  2WXO A;  2UYZ B;  2G4S A;  2JYE A;  1L7Y A;  1CJE A;  3W5V B;  1WYW B;  2Q5W D;  1GC6 A;  3PRP B;  4GGQ A;  1XLN A;  2WX1 A;  4I6N B;  4EKU A;  2KX3 A;  2W9N A;  2N1W A;  3RD2 A;  4BBN C;  2O2V B;  1VJK A;  3I9V 1;  4DHJ B;  4KIK B;  1YJJ A;  3R7R A;  2PE9 A;  1UWX A;  2PE6 B;  4KSK C;  3VXW A;  1BXT A;  4LK0 M;  3N20 C;  5EE1 A;  1S1Q B;  2V4I B;  4OVV A;  4IM0 A;  3I5J C;  3ZRC A;  1D5Z C;  5HI1 A;  1LXD A;  4ARC A;  1OQR A;  1PGX A;  3CF6 E;  3NS8 A;  4JWS C;  1WJN A;  4OVZ A;  2ZEQ A;  1TS4 A;  3B08 A;  2CKH B;  2C5L C;  2KKC A;  1Q1O A;  4FXC A;  2FCM A;  5JXV A;  4MEL A;  1NI3 A;  2GLS A;  2LEK A;  2B76 B;  4OZA A;  1Y8R C;  4TQ1 A;  3OLM D;  5C1Z A;  4ZRK A;  1V86 A;  3H1U A;  3RFZ B;  3FC4 A;  4YSX B;  3RNG C;  1J7A A;  2KFK B;  1WE6 A;  4USA A;  3W9C B;  4BVU C;  2V3P A;  1E8Y A;  4GOC A;  3A4R A;  4A8X C;  3A1Q B;  2IY1 B;  5JZE B;  2N9L A;  5E6P A;  2KN4 A;  2WXQ A;  3ZVV A;  3ZDM C;  1JRO A;  2KWC A;  2QC8 A;  3N3K B;  2FBW B;  5C23 A;  4YTN B;  1WH3 A;  4EZK A;  1IGC A;  3M95 A;  2KX0 A;  3KW5 B;  3LDZ E;  1V8C A;  2EEL A;  1WXM A;  2OJW A;  4WQM A;  3P1M A;  5IN7 A;  3QQ8 B;  2KMA A;  1GAQ B;  1L0Y B;  2D3G A;  4MJS B;  3AE5 B;  2G9H D;  2I1K A;  3KYD D;  3RNA C;  1QT9 A;  1SEB D;  1J7C A;  3WAM A;  1C79 A;  4NZL B;  1DGJ A;  3SR6 A;  1WXS A;  2DAF A;  4KKJ A;  4FBJ B;  1ZOY B;  3PS6 A;  4OW0 A;  2J0J A;  1P9D U;  4G3X B;  4RMA A;  1HXY D;  2JUO A;  4WJO A;  3BII D;  2MBE A;  4A90 A;  1ACC A;  2MP2 B;  3PLV A;  4RGM A;  4IWO A;  4B9K A;  3VDZ A;  3ZRF A;  3HM6 X;  4IWQ A;  1HZ6 A;  2HE7 A;  1TZ1 A;  1YQ3 B;  5TSS A;  3ZTD A;  1EF1 A;  5AZF A;  2E6X A;  1UGM A;  4LNO A;  2J53 A;  4GB9 A;  2BKF A;  3W5U B;  2PIA A;  5AZG A;  3AI5 A;  3H7P B;  4H2A A;  4LNI A;  2BWE S;  3MFG A;  2NBU A;  1WJ4 A;  1HTO A;  2L05 A;  1E8X A;  4HK2 A;  5D6J B;  1TJE A;  2OJR A;  4LNN A;  4FJZ A;  3R2T A;  1N6Z A;  4WJP A;  1I4R A;  4Q2J A;  2YLM A;  2BB6 A;  3PLU A;  1NDD A;  3RYT A;  4F1S A;  3JYU A;  1E6E B;  2WXG A;  4ANX A;  3HIZ A;  3WIM A;  4AQ7 A;  2ZW1 A;  1I42 A;  4K3C A;  1ZE3 D;  1LGR A;  5DPR A;  1YX6 B;  1V1P B;  4D2K A;  2ZNV C;  5FR6 A;  1C4A A;  2IND C;  3W1S C;  4XGA B;  4KKI A;  4WJQ A;  5IP4 D;  3PSE B;  3CWI A;  1C3T A;  4HPP A;  1QLB B;  2KLG A;  2KWV B;  4GDK B;  3E56 A;  4MSM B;  5I4D A;  3CST A;  2EKE C;  3TEZ A;  3NG0 A;  4KVG B;  2FNJ B;  1QF6 A;  1L5P A;  4K7W A;  2KK8 A;  2NPT A;  2QDF A;  1XLP A;  3V6C B;  4JIO U;  3MTN B;  3V3X A;  2XK5 B;  4L1B A;  3DVN V;  1F1H A;  2JVC A;  2BT6 A;  3V62 A;  2BW2 A;  1WI0 A;  4EZL A;  1GOZ A;  3DPD A;  3HUI A;  4IM3 A;  1H4R A;  3NUH B;  4HCP B;  4LCD E;  2QIE B;  4DDI D;  1WM2 A;  4AP4 C;  4GDL B;  3AXC A;  5CHF A;  2KFJ A;  2DHZ A;  2YEP F;  3AEA B;  1C9F A;  3I3T B;  4ZYN A;  5EE9 A;  3VUW A;  1UNS A;  4PS8 A;  1R4N B;  2UWQ A;  1KLU D;  4YTP B;  4TMA B;  1V2Y A;  3EA6 A;  4XX5 A;  4XC2 A;  1WRD B;  1WJ6 A;  4A20 A;  4TKN A;  1WR1 A;  1T0R C;  4M8N A;  4E74 A;  1WZ3 A;  3CIR B;  4HVB A;  3NZU A;  3MHZ A;  1VZ8 A;  1K51 A;  4TQ0 A;  1MHX A;  2LHD A;  2GBR A;  1STE A;  3HK0 A;  1CMX B;  4MAC A;  2LI5 A;  3TEY A;  1TGZ B;  4AS1 A;  2Y3A A;  2H88 B;  5CHV C;  2OED A;  4JLC A;  1TS3 A;  2AEH A;  1RRB A;  1XF5 L;  2IO2 B;  2G3Q B;  2M0A A;  3NRZ A;  2K0P A;  2A5U A;  4W9I A;  1FXI A;  4QAY A;  4WAF A;  2KAC A;  1T3Q A;  4NY0 A;  4LDT B;  3KVF B;  1XCQ L;  2JYT A;  5H92 C;  3PV1 A;  3B9J A;  4LLG M;  1WGR A;  2FCQ A;  2JZZ A;  3R3M A;  1E0Z A;  2WNM A;  4LJO B;  2L00 B;  2KMC A;  3GB1 A;  2DAJ A;  3ML8 A;  2KXJ A;  3AM9 A;  3WAP A;  1JRU A;  4GMV A;  3EFC A;  3NVY A;  3PRE A;  3LB8 C;  4K3B A;  1N62 A;  2QJL A;  1T0Q C;  2JSV X;  4WJN A;  2WXI A;  1F77 A;  2ZW0 A;  4MM3 B;  2HTM E;  3P42 A;  3TIX A;  4ZOH C;  1FRD A;  1SE4 A;  2CHX A;  1WX9 A;  4R3D A;  1GPX A;  3U7Z A;  2JX5 A;  3IAM 1;  3ZLZ A;  1B1Z A;  4C4V B;  1UUP A;  3A1Q A;  2V0G A;  3L16 A;  4DBG A;  2AQ1 B;  4W9L A;  2L3Z A;  1PFD A;  2WP9 B;  2W3R A;  3APC A;  1D5X C;  2J52 A;  1AW7 A;  3KLS X;  2LVQ A;  1U4A A;  2KWD A;  2W54 A;  4DXA B;  3DVG Y;  4GLS C;  1WE7 A;  5GMV A;  4HJK A;  2EKI A;  2MJE A;  3ENE A;  3TJP A;  1PYW D;  2K25 A;  3AV8 A;  2R2Q A;  3RI7 C;  2CJO A;  2MRP A;  3QCA A;  3N9Y C;  3A4S C;  3JSV B;  1F52 A;  4FN2 A;  1T6B X;  4WWM A;  4MJS A;  1KRH A;  4IM2 A;  1WFY A;  3L4P A;  1JML A;  2IO0 B;  1WGD A;  1EF5 A;  1C77 A;  3EFU A;  2PKO A;  1X1M A;  2N9X A;  4N9F 4;  3AE2 B;  4REZ A;  1OQY A;  3RN9 C;  3OJ4 B;  4K7U A;  3Q3M C;  5HKH A;  1L0X B;  2D5G A;  3UF8 A;  2BBC A;  2X8X X;  3NVW A;  1PGA A;  2WXM A;  3FAH A;  4HEA 1;  1KFY B;  1YIW A;  1IUE A;  1NBF C;  4FJY A;  4GXB A;  2RGF A;  5DPW A;  3SHQ A;  1A70 A;  2RR9 A;  4EOY A;  2AL6 A;  3P4Q B;  4IOI E;  4MGK E;  3HHM A;  4EUT A;  3ZTC A;  2JZ3 B;  4W9D A;  5BO4 B;  1FNV A;  1N5W A;  2GBM A;  1P98 A;  4TV3 A;  3ZIM A;  3H7P A;  2PPH A;  2HJ8 A;  4II3 B;  5G2N A;  5AUK A;  2JWZ A;  2Y5B B;  3KWL A;  3H6N A;  4ANV A;  4RGO S;  4WWO A;  3ZNH B;  3Q2A C;  2M56 B;  1GG3 A;  2WDT B;  4G0N B;  3A9K A;  4EZJ A;  4WWP A;  1SJE D;  4JX1 C;  3UIO B;  2PJH A;  1SB3 C;  4NJC A;  1E7V A;  3AE4 B;  4JWU C;  4B95 A;  3AU4 A;  1V5T A;  5HFY A;  2WXF A;  3VTW A;  3ZKJ C;  2FIF A;  1QIL A;  4LJP B;  2LAS A;  3VTU A;  3TEW A;  5DPT A;  3L54 A;  4JL9 A;  1JWM D;  1FXA A;  2LJI A;  5JHB A;  2BS4 B;  4I6P A;  4DQO C;  1SF0 A;  2LFI A;  2ZCC A;  2WDV B;  2D11 A;  4FUL A;  4BOZ B;  4OZC A;  2MQJ A;  1R4M I;  2SEB D;  2WYQ A;  1WR6 E;  2GBJ A;  2QEJ C;  1GUA B;  2JWU A;  3ZJT A;  2DYM A;  1JWB D;  2K8H A;  3DBR I;  3ML9 A;  2WXH A;  3ZNZ B;  3PGE A;  2KJH B;  3A33 B;  3R7Q A;  1SSN A;  4KSL C;  3NJT A;  2INC C;  4MEM A;  3V6E B;  4E71 A;  1SIF A;  3SFE B;  3ALB A;  2NR2 A;  1R7S A;  3J9C A;  4RH6 A;  4M00 A;  1WGK A;  3B0A A;  4TSS A;  2PMV A;  3RT3 B;  3P4S B;  4YSZ B;  1YQB A;  2BS3 B;  3TMP B;  3FKY A;  1OTR B;  3DWM A;  2BF8 B;  1MHH E;  4P1B C;  2YVC A;  4ANU A;  1V1O A;  2N0S B;  1YJ1 A;  4HXD A;  1YN4 A;  2IGH A;  1EUV B;  4B0E A;  3U7D A;  1OEY A;  1Z2M A;  1AN8 A;  1FPY A;  4XWT A;  3DBL I;  3RPF C;  2R2O A;  2JU6 X;  3IHP C;  1OFF A;  4K81 A;  2KN5 A;  3PZ8 A;  2HD5 B;  2V3S A;  3RZF A;  2ASQ A;  2LZ6 A;  1A5R A;  3VR8 B;  1L0V B;  1IGD A;  1HZ5 A;  5BYQ A;  4A6Q A;  3Q6B A;  2MCN B;  4LTU A;  2MBB B;  3GZN I;  3BY4 B;  1DOY A;  1RFK A;  1ZW7 A;  4NAW B;  2R61 A;  4CO7 A;  2NBW B;  1UZX B;  1IBX B;  4WWN A;  5IAA C;  2DX5 B;  1I4P A;  3CSF A;  1D3Z A;  1YX5 B;  1FXT B;  1TS5 A;  4US9 A;  4C56 C;  1IYF A;  2DZJ A;  3MC9 A;  4W9F A;  1FFU A;  4X57 B;  3Q8F A;  3UIN B;  2X38 A;  1FNW A;  1KOT A;  4F7Z A;  2IPK D;  2ZPN A;  2L7R A;  1UF0 A;  3DBH I;  1M94 A;  1TZO A;  3A9J B;  2B3A A;  2J4X A;  2ACZ B;  5J18 A;  4RF0 A;  4MM3 A;  1L4Z B;  2WS3 B;  4GN1 A;  2CHZ A;  1EU4 A;  2NMQ A;  5D3I B;  1FD6 A;  3VR9 B;  1MG4 A;  1VZ7 A;  3BWU D;  2K22 A;  2WHI A;  4M0W B;  4HLE A;  3MJ5 A;  1ZDX A;  5GXG B;  2LUM A;  1WMH B;  1B9R A;  3OAW A;  3DHH C;  5J17 A;  2MSE D;  3T9L A;  4ICU A;  3L17 A;  1TY0 A;  4MSQ B;  3SU8 X;  1WY8 A;  4FJV B;  2FID A;  3V05 A;  1J0G A;  1XT9 B;  2FAZ A;  1J7B A;  1YNT E;  2WXN A;  1LFD A;  2KQS A;  3M63 B;  2LGS A;  1V9J A;  3ZUN A;  1RAX A;  4NQL B;  2MJD A;  2WLB A;  1NYR A;  2KZR A;  1OGW A;  3VRA B;  1IPG A;  4NPN A;  4IUM B;  2WXJ A;  3UGB B;  5LLI A;  1D5M C;  3H7S A;  1WGY A;  2M1M A;  2O6V B;  4XDC A;  1K52 A;  2DYB A;  3BYY B;  2MBO A;  5AZH A;  2IDY A;  2M4N A;  1FIQ A;  1MPE A;  5IO9 A;  3LYY A;  4HPM B;  1TT5 B;  3K9P B;  1Q5W B;  4YL8 A;  2Z0D B;  4ZRQ A;  2WU2 B;  1L2N A;  2Z0E B;  1XCT L;  4KGR A;  1P1A A;  2K5P A;  3B2F A;  3L13 A;  3U4E G;  5E6N A;  3R8B A;  1JRP A;  1WGG A;  1XQQ A;  3KWV A;  1UEL A;  1KLV A;  2KDF B;  3OWE B;  2GOW A;  5EDS A;  2OOB B;  1K50 A;  2NVU I;  2GBN A;  3PRZ A;  2D3B A;  1QOF A;  2PTL A;  1MI0 A;  2K9X A;  1WWT A;  3DDC B;  3AEF B;  4DHZ B;  1WSP A;  1C76 A;  2KHW B;  1WM3 A;  3BIN A;  3N1X C;  1K53 A;  2BQQ A;  5LXI B;  3BK2 A;  5EE0 A;  3TCA A;  4YWG G;  1OQQ A;  3GE3 C;  3PHX B;  2FUH B;  4JPS A;  3UIP B;  3MC8 A;  4K1R B;  2N9E B;  1S3S G;  4PS7 A;  3AMZ A;  1H8C A;  3IBE A;  1KJT A;  1AYF A;  3N1Z C;  1QOB A;  2K3U A;  4ASW C;  2I1J A;  2KTF A;  4AJY B;  4KDI C;  3V60 A;  3ABV B;  2HTH A;  1F0Z A;  2KDI A;  4XE0 A;  3O65 B;  2BKR B;  4G50 A;  1EWY C;  4GSW A;  2BYV E;  3AE1 B;  3DHI C;  1SIJ A;  5D94 A;  1C4C A;  4DXG A;  3PZD A;  2XBB C;  1KM7 A;  5E6J A;  4WQO B;  1GB1 A;  1QZE A;  4M01 A;  3UQB A;  2I2Y A;  2LGD A;  3VTV A;  5MPO A;  2ONQ A;  2MEK A;  3QJZ A;  1EO6 A;  1ZPS A;  3T3N A;  4OVU A;  2LGI A;  4A9A A;  4DHJ D;  1VLB A;  1UGJ A;  2KTR B;  2O2V A;  4WUR A;  2KQ7 A;  4ITK A;  4KIK A;  1JWS D;  4HDQ A;  1XXG A;  3VFK A;  3QC8 B;  1QQR A;  1ISN A;  4UDU C;  5AEK B;  2L76 A;  5FR3 A;  4OZB A;  1TKY A;  2ZNV B;  3L10 B;  2FE8 A;  2LRW A;  2A4Z A;  1WX7 A;  2QCZ A;  2NCN A;  3B2G A;  2DZI A;  5D7G A;  2NTS A;  3MC0 B; 
#chains in the Genus database with same CATH homology
 5IO9 A;  5IP4 D;  1UF0 A;  1MG4 A;  5IN7 A;  2BQQ A;  5IOI A;  5IKC M;  1MFW A;  1MJD A;  2DNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...