1MG2A

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
382
structure length
382
Chain Sequence
b'EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHAAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase, heavy chain
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 94
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1mg2A00
3EI2A 4A08A 3RFGA 2OVPB 4QL1A 4LGNA 3A0FA 5CXBA 2XU7A 4J0WA 4TZ4A 1VYHC 2PM9B 5TF2A 1R5MA 3N0EA 3UVMA 3UVOA 4JT6C 4GQBB 2CE8A 4J81A 1P22A 4L1QD 5FA5B 3SLED 3F3FA 4PBZA 5IGQA 2I0SA 4X3EA 2QC5A 2H9NA 4CC9A 2IWFA 4D6VA 3MZKA 3SBRA 4OWRA 4J84A 3JZHA 5HE3B 3SJLD 4E5ZB 3CFVA 3P4FA 1SQ9A 4YVDA 4ERZA 2IURA 2AGXA 3VGZA 2OK6A 2QXVA 4FA1D 4K3ID 3E0CA 4LG8A 4A09B 1RI6A 1XKSA 4PSWB 5CXCB 3RMZD 3CIKB 2W18A 3NVXA 3VA6A 2PM9A 5FLXg 3HFQA 3EG6A 2H9PA 4FA9D 4IMMA 1SQJA 2IUVA 3BG1A 3V9FA 3IJ0A 4E54B 4LG9A 5KDOB 3KRXB 4H5IA 3SCYA 3GFCA 2H6QA 1N6EA 5SXMA 3EI2B 3MZLA 3UVLA 4BH6A 1TBGA 5TEFA 3UVKA 1NR0A 4BUJC 4CZVA 4E5ZA 5HQGA 3V5WB 3PXTD 4JD2C 3W15A 4A0BB 4ESGA 4QRJA 2OIZA 2Z2OA 2B5MA 5EMJB 2BCJB 4A09A 3AL9A 4J0XA 5CXCA 3BWSA 2P9UC 3PXWD 2HKMA 3ORVD 2Q7QA 1MG2A 2IWKA 5AFU3 2GC4A 2XL2A 5FKQA 2OJYA 5GXHA 4PBYA 4CY5A 2IUPA 3ULEC 3C75H 4E54A 3SBPA 4XYIA 2AH1A 4A2LA 4PSXB 3F3GA 4U1EI 3SBQA 2AGZA 3I7HA 4J8GA 2B5NA 2H6NA 4Y7RA 5IJ7E 2H6KA 4O1QD 1FWXA 4X61B 2TRCB 5FKSA 3L4OD 3RN0D 4CZYA 5THAA 4A0BA 5H14A 1JOFA 4GMBA 5IJ8E 4X60B 5I5MA 4EWRA 3L4MD 3J81g 3RSEC 4L3GD 2PM7B 3OTTA 2PM6B 3JAMg 3AL8A 2H13A 1MG3A 3CFSB 4A0AB 5GSAA 3I8EA 4CZXA 1OLZA 3OL2A 5EALA 5EAPA 5B4WA 1JMXB 2YB8B 4QQEA 4A2MA 4J87A 2EBSA 2I3TA 4UI9R 4GM3A 3PXSD 3I7PA 2B5LA 3DM0A 3V7DB 3C9CA 3RFHA 3RN1D 1B9YA 4J79A 2IUQA 3OKTA 2Z2PA 1K8KC 4FAND 2HESX 5GXIA 3ODTA 4JXMA 5H17A 2GNQA 5EMLB 5FXYA 3JB9L 3C5MA 3KRWB 4X63B 1GG2B 3PE7A 3EMHA 4J73A 1XIPA 5HE0B 4ERYA 5JWZA 5H1MA 4HDJA 5EM2B 3MKQA 3PSCB 2XL3A 4L9OA 3K27A 3C99A 2H14A 2UZXB 2CN3A 3UR4A 4QT8A 5I5JA 4A0AA 2YNNA 5HE2B 1JJUB 2AGLA 4XYHA 3EI1B 2H47A 1A0RB 1L0QA 3IJCA 2G99A 3IIYA 2GC7A 4ES0A 5GMKn 4ZOYA 4FAVD 2H9MA 3SMRA 2P9KC 4XEIC 2P9LC 2HXCA 2AGYA 4GZ8A 4JSNC 2H3XA 2CN2A 2P9NC 5AMSA 1JMZB 1GP2B 3AL8B 2CO0C 3MXXA 4R7AB 4Y5RD 5EARA 4GM9A 2H68A 3JROA 4CI2A 3OW8A 2HKRA 4CI3A 3OL2B 1Q47A 3J80g 3RRMC 5TEEA 5C2WB 3N0DA 3EU7A 5EM2A 5AJAA 5EAMA 4N14A 3MMYA 5CYKB 2AGWA 4J77A 3SN6B 3IKOA 1N6FA 2YMUA 3B7FA 3JZNA 4A7JA 1GOTB 2I0RA 3FRXA 2PBIB 3PVUB 4O45A 3MKSB 1K32A 4AOWA 2YNPA 5EMKB 2HJBA 3EI1A 1U4CA 4D0KA 2I3SA 4PC0A 3JZGA 3SWSD 3IJ1A 3OKYB 3SVWD 3DXKC 3RLMD 4ZOXA 1ERJA 2XYIA 4L3HD 2CO0A 3DWLC 5IT9g 4GQ2P 5FQDA 3I2NA 3UKRC 3I7KA 4GGCA 1SHYB 4FB1D 4JT5C 4IA9A 3SHFA 1TYQC 4O9DA 4GGAA 4Z8LA 1MDAH 1QNIA 3NVQA 4KFMB 4OZUA 4ZN4A 3EI3B 4NSXA 5CYKA 2UZYB 2AQ5A 1NEXB 1OMWB 4O3TB 3NVNA 4J8BA 3PVWB 2J55H 2G9AA 3IIWA 4CY2A 2OK4A 2BBKH 4CI1A 4FHLA 2CNXA 5TDHB 2OVRB 4J78A 3JRPA 4JSPC 3JPXA 5FKTA 4AEZA 3EI4B 5HE1B 4GQ1A 3OKYA 3I89A 4GGDA 1U2VC 1B9XA 3BG0A 4MK0B 2MTAH 3I7NA 1PBYB 3VH0A 3FGBA 4U7AA 5HYNB 5FKRA 1S4UX 3U4YA 3DXMC 2HYEA 1YFQA 3AFCA 3I7LA 5C2VB 3I7OA 4A11B 2Z2NA 2P9IC 2OVQB 3EI3A 5I5IA 1GXRA 4J86A 3ZWLB 4PXWA 4GM8A 4JSVC 4ZOVA 5K19A 4J82A 4PNKB 4A08B 1PGUA 5CXBB 5A2Qg 3DSMA 1XHMA 3EWEA 4CY3A 2YNOA 1N6DA 3PSLA 4G56B 3SXTD 4FWWA 2HJ4A 2O9KA 3GREA 1PEVA 4ERQA 3UKUC 3FM0A 3EI4A 3K26A 5IC7A 5EMMB 1PI6A 5C9ZB 4O3UB 2YBAA 4CI8A 5IGOA 2CE9A 3AH8B 3UVNA 2I0TA 3OKWA 2IAAA 5K1CC 3I8CA 2B4EA 2H9LA 4FA5D 2P9PC 4JSXC 4I79A 2J56H 2J57G 4A11A 3SFZA 4K3JB 2AH0A 4BL0A 2P9SC 4FA4D 4CY1A 4ZOZA 3F3PA 4H5JA
chains in the Genus database with same CATH superfamily
3EI2A 4A08A 2VZ3A 3RFGA 5M5VA 3ZDXA 2OVPB 4QL1A 4LGNA 3A0FA 5CXBA 2XU7A 3QHYB 4J0WA 4TZ4A 1VYHC 2PM9B 1M1XA 4WK0A 5TF2A 1R5MA 3N0EA 3UVMA 4BCBA 3UVOA 4JT6C 4GQBB 4MMXA 4MMZA 2CE8A 4AX4A 4J81A 1P22A 4L1QD 5FA5B 3SLED 3F3FA 4PBZA 5IGQA 2I0SA 2EIBA 4X3EA 2QC5A 1L5GA 2H9NA 4CC9A 2IWFA 2VDLA 4D6VA 3IULA 3MZKA 3SBRA 4OWRA 4J84A 1H2YA 5C92A 2VC2A 3JZHA 5HE3B 3SJLD 3ZDYA 4E5ZB 4WK4A 4BP8A 4DNVA 3CFVA 1UTCA 3P4FA 1SQ9A 4YVDA 4ERZA 2IURA 2AGXA 3VI4A 4JHNA 3ZE1A 3VGZA 4G1EA 2OK6A 2QXVA 4FA1D 4K3ID 3E0CA 4LG8A 4A09B 1RI6A 1XKSA 3IVMA 4PSWB 5CXCB 3RMZD 3CIKB 4MMYA 2W18A 3NVXA 3VA6A 5FFGA 2PM9A 5FLXg 3IJEA 3HFQA 3EG6A 1C9IA 2H9PA 4FA9D 4IMMA 4BCDA 1I2MB 1SQJA 2IUVA 3BG1A 4RE6A 3IJ0A 4O2WA 3V9FA 4E54B 3V4VA 4LG9A 5KDOB 1K3IA 3KRXB 4H5IA 2VDPA 4Z7OA 3SCYA 4WK2A 3GFCA 2H6QA 1N6EA 1E8MA 5SXMA 3EI2B 3MZLA 3UVLA 1E5TA 4BCCA 4BH6A 1TBGA 5TEFA 3UVKA 1NR0A 4BUJC 4CZVA 4E5ZA 5HQGA 3V5WB 3PXTD 4JD2C 3W15A 4A0BB 4ESGA 4QRJA 2OIZA 2Z2OA 2B5MA 2VDNA 5EMJB 2BCJB 3DDUA 4A09A 3AL9A 5C86A 5M5TA 3MUOA 4J0XA 5CXCA 3BWSA 2P9UC 3PXWD 2HKMA 3ORVD 3QI0A 1YR2A 3MUNA 2Q7QA 1MG2A 2IWKA 3V4PA 5AFU3 3EQ7A 2GC4A 2XL2A 5FKQA 2OJYA 5GXHA 4PBYA 4CY5A 2IUPA 3ULEC 2XDWA 5M61A 3C75H 3O4HA 4E54A 3SBPA 4XYIA 3IUJA 3K71A 2AH1A 2HU5A 4A2LA 4PSXB 3F3GA 4U1EI 3SBQA 1JTDB 2AGZA 3I7HA 4J8GA 4WJKA 2B5NA 4AN0A 2H6NA 4O02A 4Y7RA 3O4IA 5IJ7E 2H6KA 4O1QD 1FWXA 4X61B 2TRCB 5FKSA 3L4OD 3RN0D 3IUQA 4CZYA 5THAA 4A0BA 5H14A 1JOFA 4GMBA 5IJ8E 1U8CA 4X60B 4EWRA 5I5MA 3L4MD 3J81g 3RSEC 4L3GD 2PM7B 3OTTA 2PM6B 3JAMg 3AL8A 1E8NA 2H13A 4IRZA 1MG3A 4AMYA 3EQ8A 3CFSB 4A0AB 5GSAA 3KCIA 2EIDA 3I8EA 2HU7A 2VZ1A 4CZXA 1OLZA 3OL2A 5EALA 5EAPA 5B4WA 1JMXB 2YB8B 4QQEA 4A2MA 1BPOA 4J87A 2EBSA 2I3TA 4UI9R 4GM3A 3PXSD 3I7PA 1GOGA 2B5LA 3T3PA 3DM0A 3V7DB 2EICA 3C9CA 3RFHA 3RN1D 1B9YA 4J79A 2IUQA 3OKTA 2Z2PA 1K8KC 4FAND 2HESX 5GXIA 3ODTA 4JXMA 5H17A 4NC4A 2GNQA 5EMLB 5FXYA 3JB9L 3C5MA 1UOPA 3KRWB 1GG2B 4X63B 3PE7A 3T3MA 3EMHA 4J73A 1XIPA 4JHPC 5HE0B 3VI3A 4ERYA 5JWZA 1GOHA 5H1MA 4HDJA 5EM2B 3MKQA 3PSCB 2XL3A 4L9OA 3K27A 4AMZA 3C99A 2H14A 2UZXB 3ZE2A 2CN3A 3UR4A 4QT8A 5I5JA 4A0AA 2YNNA 5HE2B 3O4GA 1JJUB 2AGLA 4XYHA 1A12A 1O6FA 3EI1B 5E6RA 2H47A 1A0RB 1GOFA 1L0QA 3GD1I 3IJCA 2G99A 3IIYA 2HU8A 2GC7A 4ES0A 5GMKn 4ZOYA 4FAVD 2H9MA 3OF7A 3K6SA 3SMRA 2P9KC 4XEIC 5M5RA 2P9LC 2HXCA 2AGYA 4GZ8A 4JSNC 2H3XA 2CN2A 2P9NC 5AMSA 1JMZB 1GP2B 3AL8B 3IUNA 5FFOA 4DNUA 2CO0C 3MXXA 4NENA 4R7AB 4Y5RD 5EARA 4BP9A 4Z7QA 1C9LA 4GM9A 2H68A 3JROA 4CI2A 3OW8A 2HKRA 4CI3A 3OL2B 5HDBA 1Q47A 3J80g 3RRMC 5E6UA 5TEEA 5C2WB 3MVDK 3N0DA 3EU7A 5EM2A 5AJAA 5EAMA 4N14A 3MMYA 4DNWA 5CYKB 2AGWA 2QZPA 2XZGA 4J77A 2VDOA 3FCUA 3SN6B 3IKOA 1N6FA 2YMUA 3B7FA 3JZNA 4NBMA 4A7JA 1H2WA 1GOTB 2I0RA 3FRXA 2PBIB 3PVUB 4O45A 3MKSB 1K32A 4RE5A 4AOWA 2YNPA 5EMKB 2HJBA 3EI1A 1U4CA 4D0KA 2I3SA 1UOOA 4PC0A 3JZGA 3SWSD 3IJ1A 3OKYB 3IURA 3DXKC 3RLMD 3SVWD 4ZOXA 1ERJA 2XYIA 4L3HD 2CO0A 3DWLC 5IT9g 4GQ2P 4G1MA 5FQDA 3GC3B 3I2NA 3UKRC 5E6SA 3I7KA 4GGCA 1SHYB 4FB1D 4JT5C 4IA9A 3SHFA 1TYQC 4O9DA 2JKXA 4GGAA 1QFSA 4Z8LA 1MDAH 1QNIA 2VDRA 3NVQA 4KFMB 4OZUA 4ZN4A 3EI3B 2BKLA 4NSXA 2WQ8A 3FCSA 2UZYB 5CYKA 2AQ5A 1NEXB 1O6GA 1OMWB 1H2XA 4O3TB 3NVNA 4J8BA 3NIDA 3PVWB 4QAMA 2J55H 2G9AA 3IIWA 3NIGA 4CY2A 2OK4A 2BBKH 4CI1A 1VE7A 4FHLA 2VDQA 2CNXA 5TDHB 2OVRB 4J78A 3JRPA 4G55A 4JSPC 3JPXA 5FKTA 4AEZA 3EI4B 4UM9A 5HE1B 4GQ1A 3OKYA 3I89A 4GGDA 1U2VC 1B9XA 3BG0A 4MK0B 3EQ9A 2MTAH 3I7NA 3ZE0A 4NAAA 1PBYB 4UM8A 3VH0A 3IUMA 3FGBA 4U7AA 5HYNB 5FKRA 1JV2A 1S4UX 2QR5A 3U4YA 3DXMC 2HYEA 5M5UA 1YFQA 3AFCA 3I7LA 5C2VB 3I7OA 4A11B 1UOQA 2Z2NA 2P9IC 2OVQB 3EI3A 5I5IA 1GXRA 4J86A 3ZWLB 4PXWA 4GM8A 4JSVC 4ZOVA 5K19A 3K72A 4J82A 4PNKB 4A08B 1PGUA 5CXBB 5A2Qg 3DSMA 1XHMA 1QFMA 2VDKA 3EWEA 4AN1A 4CY3A 2YNOA 1N6DA 3PSLA 4G56B 3SXTD 4FWWA 2HJ4A 2O9KA 3GREA 4D9SA 1PEVA 4ERQA 3UKUC 3FM0A 3EI4A 3O4JA 4Z7NA 3K26A 5IC7A 5EMMB 1PI6A 2VDMA 1H2ZA 3NIFA 5C9ZB 4O3UB 2EIEA 1VE6A 2YBAA 4CI8A 4L1MA 1VZ3A 5IGOA 2CE9A 3AH8B 3UVNA 2I0TA 3OKWA 2IAAA 5K1CC 3I8CA 5M5SA 2B4EA 2H9LA 3ZDZA 4FA5D 2P9PC 4JSXC 1TYEA 1VZ2A 4I79A 2XE4A 2J56H 2J57G 4A11A 3SFZA 4K3JB 2AH0A 4BL0A 2P9SC 4FA4D 4CY1A 4ZOZA 1T2XA 3F3PA 4H5JA
chains in the Genus database with same CATH topology
3EI2A 4A08A 3RFGA 2OVPB 4QL1A 4LGNA 3A0FA 5CXBA 2XU7A 4J0WA 4TZ4A 1VYHC 2PM9B 5TF2A 1R5MA 3N0EA 3UVMA 3UVOA 4JT6C 4GQBB 2CE8A 4J81A 1P22A 4L1QD 5FA5B 3SLED 3F3FA 4PBZA 5IGQA 2I0SA 4X3EA 2QC5A 2H9NA 4CC9A 2IWFA 4D6VA 3MZKA 3SBRA 4OWRA 4J84A 3JZHA 5HE3B 3SJLD 4E5ZB 3CFVA 3P4FA 1SQ9A 4YVDA 4ERZA 2IURA 2AGXA 3VGZA 2OK6A 2QXVA 4FA1D 4K3ID 3E0CA 4LG8A 4A09B 1RI6A 1XKSA 4PSWB 5CXCB 3RMZD 3CIKB 2W18A 3NVXA 3VA6A 2PM9A 5FLXg 3HFQA 3EG6A 2H9PA 4FA9D 4IMMA 1SQJA 2IUVA 3BG1A 3V9FA 3IJ0A 4E54B 4LG9A 5KDOB 3KRXB 4H5IA 3SCYA 3GFCA 2H6QA 1N6EA 5SXMA 3EI2B 3MZLA 3UVLA 4BH6A 1TBGA 5TEFA 3UVKA 1NR0A 4BUJC 4CZVA 4E5ZA 5HQGA 3V5WB 3PXTD 4JD2C 3W15A 4A0BB 4ESGA 4QRJA 2OIZA 2Z2OA 2B5MA 5EMJB 2BCJB 4A09A 3AL9A 4J0XA 5CXCA 3BWSA 2P9UC 3PXWD 2HKMA 3ORVD 2Q7QA 1MG2A 2IWKA 5AFU3 2GC4A 2XL2A 5FKQA 2OJYA 5GXHA 4PBYA 4CY5A 2IUPA 3ULEC 3C75H 4E54A 3SBPA 4XYIA 2AH1A 4A2LA 4PSXB 3F3GA 4U1EI 3SBQA 2AGZA 3I7HA 4J8GA 2B5NA 2H6NA 4Y7RA 5IJ7E 2H6KA 4O1QD 1FWXA 4X61B 2TRCB 5FKSA 3L4OD 3RN0D 4CZYA 5THAA 4A0BA 5H14A 1JOFA 4GMBA 5IJ8E 4X60B 5I5MA 4EWRA 3L4MD 3J81g 3RSEC 4L3GD 2PM7B 3OTTA 2PM6B 3JAMg 3AL8A 2H13A 1MG3A 3CFSB 4A0AB 5GSAA 3I8EA 4CZXA 1OLZA 3OL2A 5EALA 5EAPA 5B4WA 1JMXB 2YB8B 4QQEA 4A2MA 4J87A 2EBSA 2I3TA 4UI9R 4GM3A 3PXSD 3I7PA 2B5LA 3DM0A 3V7DB 3C9CA 3RFHA 3RN1D 1B9YA 4J79A 2IUQA 3OKTA 2Z2PA 1K8KC 4FAND 2HESX 5GXIA 3ODTA 4JXMA 5H17A 2GNQA 5EMLB 5FXYA 3JB9L 3C5MA 3KRWB 4X63B 1GG2B 3PE7A 3EMHA 4J73A 1XIPA 5HE0B 4ERYA 5JWZA 5H1MA 4HDJA 5EM2B 3MKQA 3PSCB 2XL3A 4L9OA 3K27A 3C99A 2H14A 2UZXB 2CN3A 3UR4A 4QT8A 5I5JA 4A0AA 2YNNA 5HE2B 1JJUB 2AGLA 4XYHA 3EI1B 2H47A 1A0RB 1L0QA 3IJCA 2G99A 3IIYA 2GC7A 4ES0A 5GMKn 4ZOYA 4FAVD 2H9MA 3SMRA 2P9KC 4XEIC 2P9LC 2HXCA 2AGYA 4GZ8A 4JSNC 2H3XA 2CN2A 2P9NC 5AMSA 1JMZB 1GP2B 3AL8B 2CO0C 3MXXA 4R7AB 4Y5RD 5EARA 4GM9A 2H68A 3JROA 4CI2A 3OW8A 2HKRA 4CI3A 3OL2B 1Q47A 3J80g 3RRMC 5TEEA 5C2WB 3N0DA 3EU7A 5EM2A 5AJAA 5EAMA 4N14A 3MMYA 5CYKB 2AGWA 4J77A 3SN6B 3IKOA 1N6FA 2YMUA 3B7FA 3JZNA 4A7JA 1GOTB 2I0RA 3FRXA 2PBIB 3PVUB 4O45A 3MKSB 1K32A 4AOWA 2YNPA 5EMKB 2HJBA 3EI1A 1U4CA 4D0KA 2I3SA 4PC0A 3JZGA 3SWSD 3IJ1A 3OKYB 3SVWD 3DXKC 3RLMD 4ZOXA 1ERJA 2XYIA 4L3HD 2CO0A 3DWLC 5IT9g 4GQ2P 5FQDA 3I2NA 3UKRC 3I7KA 4GGCA 1SHYB 4FB1D 4JT5C 4IA9A 3SHFA 1TYQC 4O9DA 4GGAA 4Z8LA 1MDAH 1QNIA 3NVQA 4KFMB 4OZUA 4ZN4A 3EI3B 4NSXA 5CYKA 2UZYB 2AQ5A 1NEXB 1OMWB 4O3TB 3NVNA 4J8BA 3PVWB 2J55H 2G9AA 3IIWA 4CY2A 2OK4A 2BBKH 4CI1A 4FHLA 2CNXA 5TDHB 2OVRB 4J78A 3JRPA 4JSPC 3JPXA 5FKTA 4AEZA 3EI4B 5HE1B 4GQ1A 3OKYA 3I89A 4GGDA 1U2VC 1B9XA 3BG0A 4MK0B 2MTAH 3I7NA 1PBYB 3VH0A 3FGBA 4U7AA 5HYNB 5FKRA 1S4UX 3U4YA 3DXMC 2HYEA 1YFQA 3AFCA 3I7LA 5C2VB 3I7OA 4A11B 2Z2NA 2P9IC 2OVQB 3EI3A 5I5IA 1GXRA 4J86A 3ZWLB 4PXWA 4GM8A 4JSVC 4ZOVA 5K19A 4J82A 4PNKB 4A08B 1PGUA 5CXBB 5A2Qg 3DSMA 1XHMA 3EWEA 4CY3A 2YNOA 1N6DA 3PSLA 4G56B 3SXTD 4FWWA 2HJ4A 2O9KA 3GREA 1PEVA 4ERQA 3UKUC 3FM0A 3EI4A 3K26A 5IC7A 5EMMB 1PI6A 5C9ZB 4O3UB 2YBAA 4CI8A 5IGOA 2CE9A 3AH8B 3UVNA 2I0TA 3OKWA 2IAAA 5K1CC 3I8CA 2B4EA 2H9LA 4FA5D 2P9PC 4JSXC 4I79A 2J56H 2J57G 4A11A 3SFZA 4K3JB 2AH0A 4BL0A 2P9SC 4FA4D 4CY1A 4ZOZA 3F3PA 4H5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI2 A;  4A08 A;  3RFG A;  2OVP B;  4QL1 A;  4LGN A;  3A0F A;  5CXB A;  2XU7 A;  4J0W A;  4TZ4 A;  1VYH C;  2PM9 B;  5TF2 A;  1R5M A;  3N0E A;  3UVM A;  3UVO A;  4JT6 C;  4GQB B;  2CE8 A;  4J81 A;  1P22 A;  4L1Q D;  5FA5 B;  3SLE D;  3F3F A;  4PBZ A;  5IGQ A;  2I0S A;  4X3E A;  2QC5 A;  2H9N A;  4CC9 A;  2IWF A;  4D6V A;  3MZK A;  3SBR A;  4OWR A;  4J84 A;  3JZH A;  5HE3 B;  3SJL D;  4E5Z B;  3CFV A;  3P4F A;  1SQ9 A;  4YVD A;  4ERZ A;  2IUR A;  2AGX A;  3VGZ A;  2OK6 A;  2QXV A;  4FA1 D;  4K3I D;  3E0C A;  4LG8 A;  4A09 B;  1RI6 A;  1XKS A;  4PSW B;  5CXC B;  3RMZ D;  3CIK B;  2W18 A;  3NVX A;  3VA6 A;  2PM9 A;  5FLX g;  3HFQ A;  3EG6 A;  2H9P A;  4FA9 D;  4IMM A;  1SQJ A;  2IUV A;  3BG1 A;  3V9F A;  3IJ0 A;  4E54 B;  4LG9 A;  5KDO B;  3KRX B;  4H5I A;  3SCY A;  3GFC A;  2H6Q A;  1N6E A;  5SXM A;  3EI2 B;  3MZL A;  3UVL A;  4BH6 A;  1TBG A;  5TEF A;  3UVK A;  1NR0 A;  4BUJ C;  4CZV A;  4E5Z A;  5HQG A;  3V5W B;  3PXT D;  4JD2 C;  3W15 A;  4A0B B;  4ESG A;  4QRJ A;  2OIZ A;  2Z2O A;  2B5M A;  5EMJ B;  2BCJ B;  4A09 A;  3AL9 A;  4J0X A;  5CXC A;  3BWS A;  2P9U C;  3PXW D;  2HKM A;  3ORV D;  2Q7Q A;  1MG2 A;  2IWK A;  5AFU 3;  2GC4 A;  2XL2 A;  5FKQ A;  2OJY A;  5GXH A;  4PBY A;  4CY5 A;  2IUP A;  3ULE C;  3C75 H;  4E54 A;  3SBP A;  4XYI A;  2AH1 A;  4A2L A;  4PSX B;  3F3G A;  4U1E I;  3SBQ A;  2AGZ A;  3I7H A;  4J8G A;  2B5N A;  2H6N A;  4Y7R A;  5IJ7 E;  2H6K A;  4O1Q D;  1FWX A;  4X61 B;  2TRC B;  5FKS A;  3L4O D;  3RN0 D;  4CZY A;  5THA A;  4A0B A;  5H14 A;  1JOF A;  4GMB A;  5IJ8 E;  4X60 B;  5I5M A;  4EWR A;  3L4M D;  3J81 g;  3RSE C;  4L3G D;  2PM7 B;  3OTT A;  2PM6 B;  3JAM g;  3AL8 A;  2H13 A;  1MG3 A;  3CFS B;  4A0A B;  5GSA A;  3I8E A;  4CZX A;  1OLZ A;  3OL2 A;  5EAL A;  5EAP A;  5B4W A;  1JMX B;  2YB8 B;  4QQE A;  4A2M A;  4J87 A;  2EBS A;  2I3T A;  4UI9 R;  4GM3 A;  3PXS D;  3I7P A;  2B5L A;  3DM0 A;  3V7D B;  3C9C A;  3RFH A;  3RN1 D;  1B9Y A;  4J79 A;  2IUQ A;  3OKT A;  2Z2P A;  1K8K C;  4FAN D;  2HES X;  5GXI A;  3ODT A;  4JXM A;  5H17 A;  2GNQ A;  5EML B;  5FXY A;  3JB9 L;  3C5M A;  3KRW B;  4X63 B;  1GG2 B;  3PE7 A;  3EMH A;  4J73 A;  1XIP A;  5HE0 B;  4ERY A;  5JWZ A;  5H1M A;  4HDJ A;  5EM2 B;  3MKQ A;  3PSC B;  2XL3 A;  4L9O A;  3K27 A;  3C99 A;  2H14 A;  2UZX B;  2CN3 A;  3UR4 A;  4QT8 A;  5I5J A;  4A0A A;  2YNN A;  5HE2 B;  1JJU B;  2AGL A;  4XYH A;  3EI1 B;  2H47 A;  1A0R B;  1L0Q A;  3IJC A;  2G99 A;  3IIY A;  2GC7 A;  4ES0 A;  5GMK n;  4ZOY A;  4FAV D;  2H9M A;  3SMR A;  2P9K C;  4XEI C;  2P9L C;  2HXC A;  2AGY A;  4GZ8 A;  4JSN C;  2H3X A;  2CN2 A;  2P9N C;  5AMS A;  1JMZ B;  1GP2 B;  3AL8 B;  2CO0 C;  3MXX A;  4R7A B;  4Y5R D;  5EAR A;  4GM9 A;  2H68 A;  3JRO A;  4CI2 A;  3OW8 A;  2HKR A;  4CI3 A;  3OL2 B;  1Q47 A;  3J80 g;  3RRM C;  5TEE A;  5C2W B;  3N0D A;  3EU7 A;  5EM2 A;  5AJA A;  5EAM A;  4N14 A;  3MMY A;  5CYK B;  2AGW A;  4J77 A;  3SN6 B;  3IKO A;  1N6F A;  2YMU A;  3B7F A;  3JZN A;  4A7J A;  1GOT B;  2I0R A;  3FRX A;  2PBI B;  3PVU B;  4O45 A;  3MKS B;  1K32 A;  4AOW A;  2YNP A;  5EMK B;  2HJB A;  3EI1 A;  1U4C A;  4D0K A;  2I3S A;  4PC0 A;  3JZG A;  3SWS D;  3IJ1 A;  3OKY B;  3SVW D;  3DXK C;  3RLM D;  4ZOX A;  1ERJ A;  2XYI A;  4L3H D;  2CO0 A;  3DWL C;  5IT9 g;  4GQ2 P;  5FQD A;  3I2N A;  3UKR C;  3I7K A;  4GGC A;  1SHY B;  4FB1 D;  4JT5 C;  4IA9 A;  3SHF A;  1TYQ C;  4O9D A;  4GGA A;  4Z8L A;  1MDA H;  1QNI A;  3NVQ A;  4KFM B;  4OZU A;  4ZN4 A;  3EI3 B;  4NSX A;  5CYK A;  2UZY B;  2AQ5 A;  1NEX B;  1OMW B;  4O3T B;  3NVN A;  4J8B A;  3PVW B;  2J55 H;  2G9A A;  3IIW A;  4CY2 A;  2OK4 A;  2BBK H;  4CI1 A;  4FHL A;  2CNX A;  5TDH B;  2OVR B;  4J78 A;  3JRP A;  4JSP C;  3JPX A;  5FKT A;  4AEZ A;  3EI4 B;  5HE1 B;  4GQ1 A;  3OKY A;  3I89 A;  4GGD A;  1U2V C;  1B9X A;  3BG0 A;  4MK0 B;  2MTA H;  3I7N A;  1PBY B;  3VH0 A;  3FGB A;  4U7A A;  5HYN B;  5FKR A;  1S4U X;  3U4Y A;  3DXM C;  2HYE A;  1YFQ A;  3AFC A;  3I7L A;  5C2V B;  3I7O A;  4A11 B;  2Z2N A;  2P9I C;  2OVQ B;  3EI3 A;  5I5I A;  1GXR A;  4J86 A;  3ZWL B;  4PXW A;  4GM8 A;  4JSV C;  4ZOV A;  5K19 A;  4J82 A;  4PNK B;  4A08 B;  1PGU A;  5CXB B;  5A2Q g;  3DSM A;  1XHM A;  3EWE A;  4CY3 A;  2YNO A;  1N6D A;  3PSL A;  4G56 B;  3SXT D;  4FWW A;  2HJ4 A;  2O9K A;  3GRE A;  1PEV A;  4ERQ A;  3UKU C;  3FM0 A;  3EI4 A;  3K26 A;  5IC7 A;  5EMM B;  1PI6 A;  5C9Z B;  4O3U B;  2YBA A;  4CI8 A;  5IGO A;  2CE9 A;  3AH8 B;  3UVN A;  2I0T A;  3OKW A;  2IAA A;  5K1C C;  3I8C A;  2B4E A;  2H9L A;  4FA5 D;  2P9P C;  4JSX C;  4I79 A;  2J56 H;  2J57 G;  4A11 A;  3SFZ A;  4K3J B;  2AH0 A;  4BL0 A;  2P9S C;  4FA4 D;  4CY1 A;  4ZOZ A;  3F3P A;  4H5J A; 
#chains in the Genus database with same CATH topology
 3EI2 A;  4A08 A;  2VZ3 A;  3RFG A;  5M5V A;  3ZDX A;  2OVP B;  4QL1 A;  4LGN A;  3A0F A;  5CXB A;  2XU7 A;  3QHY B;  4J0W A;  4TZ4 A;  1VYH C;  2PM9 B;  1M1X A;  4WK0 A;  5TF2 A;  1R5M A;  3N0E A;  3UVM A;  4BCB A;  3UVO A;  4JT6 C;  4GQB B;  4MMX A;  4MMZ A;  2CE8 A;  4AX4 A;  4J81 A;  1P22 A;  4L1Q D;  5FA5 B;  3SLE D;  3F3F A;  4PBZ A;  5IGQ A;  2I0S A;  2EIB A;  4X3E A;  2QC5 A;  1L5G A;  2H9N A;  4CC9 A;  2IWF A;  2VDL A;  4D6V A;  3IUL A;  3MZK A;  3SBR A;  4OWR A;  4J84 A;  1H2Y A;  5C92 A;  2VC2 A;  3JZH A;  5HE3 B;  3SJL D;  3ZDY A;  4E5Z B;  4WK4 A;  4BP8 A;  4DNV A;  3CFV A;  1UTC A;  3P4F A;  1SQ9 A;  4YVD A;  4ERZ A;  2IUR A;  2AGX A;  3VI4 A;  4JHN A;  3ZE1 A;  3VGZ A;  4G1E A;  2OK6 A;  2QXV A;  4FA1 D;  4K3I D;  3E0C A;  4LG8 A;  4A09 B;  1RI6 A;  1XKS A;  3IVM A;  4PSW B;  5CXC B;  3RMZ D;  3CIK B;  4MMY A;  2W18 A;  3NVX A;  3VA6 A;  5FFG A;  2PM9 A;  5FLX g;  3IJE A;  3HFQ A;  3EG6 A;  1C9I A;  2H9P A;  4FA9 D;  4IMM A;  4BCD A;  1I2M B;  1SQJ A;  2IUV A;  3BG1 A;  4RE6 A;  3IJ0 A;  4O2W A;  3V9F A;  4E54 B;  3V4V A;  4LG9 A;  5KDO B;  1K3I A;  3KRX B;  4H5I A;  2VDP A;  4Z7O A;  3SCY A;  4WK2 A;  3GFC A;  2H6Q A;  1N6E A;  1E8M A;  5SXM A;  3EI2 B;  3MZL A;  3UVL A;  1E5T A;  4BCC A;  4BH6 A;  1TBG A;  5TEF A;  3UVK A;  1NR0 A;  4BUJ C;  4CZV A;  4E5Z A;  5HQG A;  3V5W B;  3PXT D;  4JD2 C;  3W15 A;  4A0B B;  4ESG A;  4QRJ A;  2OIZ A;  2Z2O A;  2B5M A;  2VDN A;  5EMJ B;  2BCJ B;  3DDU A;  4A09 A;  3AL9 A;  5C86 A;  5M5T A;  3MUO A;  4J0X A;  5CXC A;  3BWS A;  2P9U C;  3PXW D;  2HKM A;  3ORV D;  3QI0 A;  1YR2 A;  3MUN A;  2Q7Q A;  1MG2 A;  2IWK A;  3V4P A;  5AFU 3;  3EQ7 A;  2GC4 A;  2XL2 A;  5FKQ A;  2OJY A;  5GXH A;  4PBY A;  4CY5 A;  2IUP A;  3ULE C;  2XDW A;  5M61 A;  3C75 H;  3O4H A;  4E54 A;  3SBP A;  4XYI A;  3IUJ A;  3K71 A;  2AH1 A;  2HU5 A;  4A2L A;  4PSX B;  3F3G A;  4U1E I;  3SBQ A;  1JTD B;  2AGZ A;  3I7H A;  4J8G A;  4WJK A;  2B5N A;  4AN0 A;  2H6N A;  4O02 A;  4Y7R A;  3O4I A;  5IJ7 E;  2H6K A;  4O1Q D;  1FWX A;  4X61 B;  2TRC B;  5FKS A;  3L4O D;  3RN0 D;  3IUQ A;  4CZY A;  5THA A;  4A0B A;  5H14 A;  1JOF A;  4GMB A;  5IJ8 E;  1U8C A;  4X60 B;  4EWR A;  5I5M A;  3L4M D;  3J81 g;  3RSE C;  4L3G D;  2PM7 B;  3OTT A;  2PM6 B;  3JAM g;  3AL8 A;  1E8N A;  2H13 A;  4IRZ A;  1MG3 A;  4AMY A;  3EQ8 A;  3CFS B;  4A0A B;  5GSA A;  3KCI A;  2EID A;  3I8E A;  2HU7 A;  2VZ1 A;  4CZX A;  1OLZ A;  3OL2 A;  5EAL A;  5EAP A;  5B4W A;  1JMX B;  2YB8 B;  4QQE A;  4A2M A;  1BPO A;  4J87 A;  2EBS A;  2I3T A;  4UI9 R;  4GM3 A;  3PXS D;  3I7P A;  1GOG A;  2B5L A;  3T3P A;  3DM0 A;  3V7D B;  2EIC A;  3C9C A;  3RFH A;  3RN1 D;  1B9Y A;  4J79 A;  2IUQ A;  3OKT A;  2Z2P A;  1K8K C;  4FAN D;  2HES X;  5GXI A;  3ODT A;  4JXM A;  5H17 A;  4NC4 A;  2GNQ A;  5EML B;  5FXY A;  3JB9 L;  3C5M A;  1UOP A;  3KRW B;  1GG2 B;  4X63 B;  3PE7 A;  3T3M A;  3EMH A;  4J73 A;  1XIP A;  4JHP C;  5HE0 B;  3VI3 A;  4ERY A;  5JWZ A;  1GOH A;  5H1M A;  4HDJ A;  5EM2 B;  3MKQ A;  3PSC B;  2XL3 A;  4L9O A;  3K27 A;  4AMZ A;  3C99 A;  2H14 A;  2UZX B;  3ZE2 A;  2CN3 A;  3UR4 A;  4QT8 A;  5I5J A;  4A0A A;  2YNN A;  5HE2 B;  3O4G A;  1JJU B;  2AGL A;  4XYH A;  1A12 A;  1O6F A;  3EI1 B;  5E6R A;  2H47 A;  1A0R B;  1GOF A;  1L0Q A;  3GD1 I;  3IJC A;  2G99 A;  3IIY A;  2HU8 A;  2GC7 A;  4ES0 A;  5GMK n;  4ZOY A;  4FAV D;  2H9M A;  3OF7 A;  3K6S A;  3SMR A;  2P9K C;  4XEI C;  5M5R A;  2P9L C;  2HXC A;  2AGY A;  4GZ8 A;  4JSN C;  2H3X A;  2CN2 A;  2P9N C;  5AMS A;  1JMZ B;  1GP2 B;  3AL8 B;  3IUN A;  5FFO A;  4DNU A;  2CO0 C;  3MXX A;  4NEN A;  4R7A B;  4Y5R D;  5EAR A;  4BP9 A;  4Z7Q A;  1C9L A;  4GM9 A;  2H68 A;  3JRO A;  4CI2 A;  3OW8 A;  2HKR A;  4CI3 A;  3OL2 B;  5HDB A;  1Q47 A;  3J80 g;  3RRM C;  5E6U A;  5TEE A;  5C2W B;  3MVD K;  3N0D A;  3EU7 A;  5EM2 A;  5AJA A;  5EAM A;  4N14 A;  3MMY A;  4DNW A;  5CYK B;  2AGW A;  2QZP A;  2XZG A;  4J77 A;  2VDO A;  3FCU A;  3SN6 B;  3IKO A;  1N6F A;  2YMU A;  3B7F A;  3JZN A;  4NBM A;  4A7J A;  1H2W A;  1GOT B;  2I0R A;  3FRX A;  2PBI B;  3PVU B;  4O45 A;  3MKS B;  1K32 A;  4RE5 A;  4AOW A;  2YNP A;  5EMK B;  2HJB A;  3EI1 A;  1U4C A;  4D0K A;  2I3S A;  1UOO A;  4PC0 A;  3JZG A;  3SWS D;  3IJ1 A;  3OKY B;  3IUR A;  3DXK C;  3RLM D;  3SVW D;  4ZOX A;  1ERJ A;  2XYI A;  4L3H D;  2CO0 A;  3DWL C;  5IT9 g;  4GQ2 P;  4G1M A;  5FQD A;  3GC3 B;  3I2N A;  3UKR C;  5E6S A;  3I7K A;  4GGC A;  1SHY B;  4FB1 D;  4JT5 C;  4IA9 A;  3SHF A;  1TYQ C;  4O9D A;  2JKX A;  4GGA A;  1QFS A;  4Z8L A;  1MDA H;  1QNI A;  2VDR A;  3NVQ A;  4KFM B;  4OZU A;  4ZN4 A;  3EI3 B;  2BKL A;  4NSX A;  2WQ8 A;  3FCS A;  2UZY B;  5CYK A;  2AQ5 A;  1NEX B;  1O6G A;  1OMW B;  1H2X A;  4O3T B;  3NVN A;  4J8B A;  3NID A;  3PVW B;  4QAM A;  2J55 H;  2G9A A;  3IIW A;  3NIG A;  4CY2 A;  2OK4 A;  2BBK H;  4CI1 A;  1VE7 A;  4FHL A;  2VDQ A;  2CNX A;  5TDH B;  2OVR B;  4J78 A;  3JRP A;  4G55 A;  4JSP C;  3JPX A;  5FKT A;  4AEZ A;  3EI4 B;  4UM9 A;  5HE1 B;  4GQ1 A;  3OKY A;  3I89 A;  4GGD A;  1U2V C;  1B9X A;  3BG0 A;  4MK0 B;  3EQ9 A;  2MTA H;  3I7N A;  3ZE0 A;  4NAA A;  1PBY B;  4UM8 A;  3VH0 A;  3IUM A;  3FGB A;  4U7A A;  5HYN B;  5FKR A;  1JV2 A;  1S4U X;  2QR5 A;  3U4Y A;  3DXM C;  2HYE A;  5M5U A;  1YFQ A;  3AFC A;  3I7L A;  5C2V B;  3I7O A;  4A11 B;  1UOQ A;  2Z2N A;  2P9I C;  2OVQ B;  3EI3 A;  5I5I A;  1GXR A;  4J86 A;  3ZWL B;  4PXW A;  4GM8 A;  4JSV C;  4ZOV A;  5K19 A;  3K72 A;  4J82 A;  4PNK B;  4A08 B;  1PGU A;  5CXB B;  5A2Q g;  3DSM A;  1XHM A;  1QFM A;  2VDK A;  3EWE A;  4AN1 A;  4CY3 A;  2YNO A;  1N6D A;  3PSL A;  4G56 B;  3SXT D;  4FWW A;  2HJ4 A;  2O9K A;  3GRE A;  4D9S A;  1PEV A;  4ERQ A;  3UKU C;  3FM0 A;  3EI4 A;  3O4J A;  4Z7N A;  3K26 A;  5IC7 A;  5EMM B;  1PI6 A;  2VDM A;  1H2Z A;  3NIF A;  5C9Z B;  4O3U B;  2EIE A;  1VE6 A;  2YBA A;  4CI8 A;  4L1M A;  1VZ3 A;  5IGO A;  2CE9 A;  3AH8 B;  3UVN A;  2I0T A;  3OKW A;  2IAA A;  5K1C C;  3I8C A;  5M5S A;  2B4E A;  2H9L A;  3ZDZ A;  4FA5 D;  2P9P C;  4JSX C;  1TYE A;  1VZ2 A;  4I79 A;  2XE4 A;  2J56 H;  2J57 G;  4A11 A;  3SFZ A;  4K3J B;  2AH0 A;  4BL0 A;  2P9S C;  4FA4 D;  4CY1 A;  4ZOZ A;  1T2X A;  3F3P A;  4H5J A; 
#chains in the Genus database with same CATH homology
 3EI2 A;  4A08 A;  3RFG A;  2OVP B;  4QL1 A;  4LGN A;  3A0F A;  5CXB A;  2XU7 A;  4J0W A;  4TZ4 A;  1VYH C;  2PM9 B;  5TF2 A;  1R5M A;  3N0E A;  3UVM A;  3UVO A;  4JT6 C;  4GQB B;  2CE8 A;  4J81 A;  1P22 A;  4L1Q D;  5FA5 B;  3SLE D;  3F3F A;  4PBZ A;  5IGQ A;  2I0S A;  4X3E A;  2QC5 A;  2H9N A;  4CC9 A;  2IWF A;  4D6V A;  3MZK A;  3SBR A;  4OWR A;  4J84 A;  3JZH A;  5HE3 B;  3SJL D;  4E5Z B;  3CFV A;  3P4F A;  1SQ9 A;  4YVD A;  4ERZ A;  2IUR A;  2AGX A;  3VGZ A;  2OK6 A;  2QXV A;  4FA1 D;  4K3I D;  3E0C A;  4LG8 A;  4A09 B;  1RI6 A;  1XKS A;  4PSW B;  5CXC B;  3RMZ D;  3CIK B;  2W18 A;  3NVX A;  3VA6 A;  2PM9 A;  5FLX g;  3HFQ A;  3EG6 A;  2H9P A;  4FA9 D;  4IMM A;  1SQJ A;  2IUV A;  3BG1 A;  3V9F A;  3IJ0 A;  4E54 B;  4LG9 A;  5KDO B;  3KRX B;  4H5I A;  3SCY A;  3GFC A;  2H6Q A;  1N6E A;  5SXM A;  3EI2 B;  3MZL A;  3UVL A;  4BH6 A;  1TBG A;  5TEF A;  3UVK A;  1NR0 A;  4BUJ C;  4CZV A;  4E5Z A;  5HQG A;  3V5W B;  3PXT D;  4JD2 C;  3W15 A;  4A0B B;  4ESG A;  4QRJ A;  2OIZ A;  2Z2O A;  2B5M A;  5EMJ B;  2BCJ B;  4A09 A;  3AL9 A;  4J0X A;  5CXC A;  3BWS A;  2P9U C;  3PXW D;  2HKM A;  3ORV D;  2Q7Q A;  1MG2 A;  2IWK A;  5AFU 3;  2GC4 A;  2XL2 A;  5FKQ A;  2OJY A;  5GXH A;  4PBY A;  4CY5 A;  2IUP A;  3ULE C;  3C75 H;  4E54 A;  3SBP A;  4XYI A;  2AH1 A;  4A2L A;  4PSX B;  3F3G A;  4U1E I;  3SBQ A;  2AGZ A;  3I7H A;  4J8G A;  2B5N A;  2H6N A;  4Y7R A;  5IJ7 E;  2H6K A;  4O1Q D;  1FWX A;  4X61 B;  2TRC B;  5FKS A;  3L4O D;  3RN0 D;  4CZY A;  5THA A;  4A0B A;  5H14 A;  1JOF A;  4GMB A;  5IJ8 E;  4X60 B;  5I5M A;  4EWR A;  3L4M D;  3J81 g;  3RSE C;  4L3G D;  2PM7 B;  3OTT A;  2PM6 B;  3JAM g;  3AL8 A;  2H13 A;  1MG3 A;  3CFS B;  4A0A B;  5GSA A;  3I8E A;  4CZX A;  1OLZ A;  3OL2 A;  5EAL A;  5EAP A;  5B4W A;  1JMX B;  2YB8 B;  4QQE A;  4A2M A;  4J87 A;  2EBS A;  2I3T A;  4UI9 R;  4GM3 A;  3PXS D;  3I7P A;  2B5L A;  3DM0 A;  3V7D B;  3C9C A;  3RFH A;  3RN1 D;  1B9Y A;  4J79 A;  2IUQ A;  3OKT A;  2Z2P A;  1K8K C;  4FAN D;  2HES X;  5GXI A;  3ODT A;  4JXM A;  5H17 A;  2GNQ A;  5EML B;  5FXY A;  3JB9 L;  3C5M A;  3KRW B;  4X63 B;  1GG2 B;  3PE7 A;  3EMH A;  4J73 A;  1XIP A;  5HE0 B;  4ERY A;  5JWZ A;  5H1M A;  4HDJ A;  5EM2 B;  3MKQ A;  3PSC B;  2XL3 A;  4L9O A;  3K27 A;  3C99 A;  2H14 A;  2UZX B;  2CN3 A;  3UR4 A;  4QT8 A;  5I5J A;  4A0A A;  2YNN A;  5HE2 B;  1JJU B;  2AGL A;  4XYH A;  3EI1 B;  2H47 A;  1A0R B;  1L0Q A;  3IJC A;  2G99 A;  3IIY A;  2GC7 A;  4ES0 A;  5GMK n;  4ZOY A;  4FAV D;  2H9M A;  3SMR A;  2P9K C;  4XEI C;  2P9L C;  2HXC A;  2AGY A;  4GZ8 A;  4JSN C;  2H3X A;  2CN2 A;  2P9N C;  5AMS A;  1JMZ B;  1GP2 B;  3AL8 B;  2CO0 C;  3MXX A;  4R7A B;  4Y5R D;  5EAR A;  4GM9 A;  2H68 A;  3JRO A;  4CI2 A;  3OW8 A;  2HKR A;  4CI3 A;  3OL2 B;  1Q47 A;  3J80 g;  3RRM C;  5TEE A;  5C2W B;  3N0D A;  3EU7 A;  5EM2 A;  5AJA A;  5EAM A;  4N14 A;  3MMY A;  5CYK B;  2AGW A;  4J77 A;  3SN6 B;  3IKO A;  1N6F A;  2YMU A;  3B7F A;  3JZN A;  4A7J A;  1GOT B;  2I0R A;  3FRX A;  2PBI B;  3PVU B;  4O45 A;  3MKS B;  1K32 A;  4AOW A;  2YNP A;  5EMK B;  2HJB A;  3EI1 A;  1U4C A;  4D0K A;  2I3S A;  4PC0 A;  3JZG A;  3SWS D;  3IJ1 A;  3OKY B;  3SVW D;  3DXK C;  3RLM D;  4ZOX A;  1ERJ A;  2XYI A;  4L3H D;  2CO0 A;  3DWL C;  5IT9 g;  4GQ2 P;  5FQD A;  3I2N A;  3UKR C;  3I7K A;  4GGC A;  1SHY B;  4FB1 D;  4JT5 C;  4IA9 A;  3SHF A;  1TYQ C;  4O9D A;  4GGA A;  4Z8L A;  1MDA H;  1QNI A;  3NVQ A;  4KFM B;  4OZU A;  4ZN4 A;  3EI3 B;  4NSX A;  5CYK A;  2UZY B;  2AQ5 A;  1NEX B;  1OMW B;  4O3T B;  3NVN A;  4J8B A;  3PVW B;  2J55 H;  2G9A A;  3IIW A;  4CY2 A;  2OK4 A;  2BBK H;  4CI1 A;  4FHL A;  2CNX A;  5TDH B;  2OVR B;  4J78 A;  3JRP A;  4JSP C;  3JPX A;  5FKT A;  4AEZ A;  3EI4 B;  5HE1 B;  4GQ1 A;  3OKY A;  3I89 A;  4GGD A;  1U2V C;  1B9X A;  3BG0 A;  4MK0 B;  2MTA H;  3I7N A;  1PBY B;  3VH0 A;  3FGB A;  4U7A A;  5HYN B;  5FKR A;  1S4U X;  3U4Y A;  3DXM C;  2HYE A;  1YFQ A;  3AFC A;  3I7L A;  5C2V B;  3I7O A;  4A11 B;  2Z2N A;  2P9I C;  2OVQ B;  3EI3 A;  5I5I A;  1GXR A;  4J86 A;  3ZWL B;  4PXW A;  4GM8 A;  4JSV C;  4ZOV A;  5K19 A;  4J82 A;  4PNK B;  4A08 B;  1PGU A;  5CXB B;  5A2Q g;  3DSM A;  1XHM A;  3EWE A;  4CY3 A;  2YNO A;  1N6D A;  3PSL A;  4G56 B;  3SXT D;  4FWW A;  2HJ4 A;  2O9K A;  3GRE A;  1PEV A;  4ERQ A;  3UKU C;  3FM0 A;  3EI4 A;  3K26 A;  5IC7 A;  5EMM B;  1PI6 A;  5C9Z B;  4O3U B;  2YBA A;  4CI8 A;  5IGO A;  2CE9 A;  3AH8 B;  3UVN A;  2I0T A;  3OKW A;  2IAA A;  5K1C C;  3I8C A;  2B4E A;  2H9L A;  4FA5 D;  2P9P C;  4JSX C;  4I79 A;  2J56 H;  2J57 G;  4A11 A;  3SFZ A;  4K3J B;  2AH0 A;  4BL0 A;  2P9S C;  4FA4 D;  4CY1 A;  4ZOZ A;  3F3P A;  4H5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...