1MG2A

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHAAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
molecule keywords Methylamine dehydrogenase, heavy chain
total genus 94
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1mg2A00
3PXWD 5SXMA 4CI8A 3I8EA 4JSVC 2XYIA 1FWXA 3C9CA 2OK4A 4GM9A 4A09B 4J84A 2G99A 3I2NA 4JSPC 3RMZD 2CO0A 3UVNA 2QC5A 4Y7RA 4GGAA 3SMRA 3A0FA 3BG1A 2P9SC 4N14A 3SVWD 4L3HD 4O9DA 1SQ9A 4D0KA 4U7AA 3IJ1A 1B9YA 1TBGA 5EAPA 5EARA 2YNPA 4HDJA 2CO0C 3K26A 3PE7A 1NEXB 1JOFA 2CE9A 1R5MA 2CN2A 3FGBA 3C5MA 4J79A 3F3FA 2UZXB 4GM8A 3IKOA 3SLED 3AL9A 1TYQC 1XHMA 3PSCB 4FAVD 4J8GA 3EWEA 5FKRA 4G56B 1U4CA 3NVXA 2AGXA 2IAAA 2H9LA 3GFCA 3C99A 3UVMA 4BL0A 2GC7A 2H6NA 4X63B 3OKTA 2CE8A 3I7LA 3V9FA 3K27A 4J82A 4LG9A 3I7PA 4A0BA 2B4EA 2H14A 4L3GD 5HYNB 1P22A 3DM0A 5EM2A 3FRXA 1SQJA 1VYHC 5IJ7E 2H6QA 1GXRA 5H14A 2YNOA 5TEEA 4ERYA 2H3XA 3EI1A 3NVNA 4GQBB 5JWZA 2AGWA 4A11A 3JZGA 3UVKA 3J80g 3MKQA 5GSAA 5CYKA 3U4YA 1MG2A 4A0AB 4JT6C 4J86A 3KRWB 5HE0B 3SBPA 2TRCB 1XIPA 3UVOA 1SHYB 2OVPB 4JT5C 4XYHA 4Z8LA 5IC7A 5THAA 4A0BB 2CNXA 1JJUB 1S4UX 2OK6A 4QQEA 3PXSD 5EM2B 4ZOVA 3SN6B 1A0RB 4CY3A 2HXCA 1MG3A 4L9OA 1OMWB 3L4MD 4O3TB 4ZOYA 2I0SA 5TDHB 4YVDA 3EI1B 5IJ8E 4A7JA 2OVQB 3EI2B 5EAMA 4A0AA 5H17A 5I5IA 4JXMA 1Q47A 3KRXB 4ERQA 3EI4B 4A11B 4H5JA 2HESX 2G9AA 2J56H 4GZ8A 5IGOA 4GMBA 3V7DB 4ES0A 3SHFA 2GNQA 2B5MA 2HJBA 3OKYA 4H5IA 2GC4A 4CI2A 4QT8A 2Q7QA 3JPXA 3SXTD 5B4WA 4LG8A 4CY5A 1N6DA 4K3JB 4E5ZB 1QNIA 3I7KA 2BBKH 3AFCA 5I5MA 5HQGA 4PC0A 3DXMC 3P4FA 1U2VC 4AEZA 4ZN4A 5FKTA 1XKSA 2HJ4A 2OJYA 3OL2B 2AH1A 4K3ID 2P9IC 1NR0A 4LGNA 3RN0D 3JRPA 4J78A 5HE2B 4J0WA 2QXVA 1K8KC 4X61B 4IMMA 4O45A 4J87A 4I79A 1PBYB 5A2Qg 2PM9A 3EI4A 3MXXA 2YB8B 3PVUB 4GGCA 4QL1A 3OTTA 2H9PA 3SBQA 3I7HA 2H13A 3E0CA 3SBRA 2MTAH 4PBZA 4X60B 3DXKC 5HE3B 1GOTB 3OKYB 3OL2A 3BG0A 4FWWA 1N6FA 2UZYB 2CN3A 5FKSA 2PM6B 5FXYA 3UKUC 3AL8B 3J81g 3IJCA 3CFVA 2P9LC 2HKRA 4NSXA 3MMYA 1RI6A 3PVWB 2XU7A 1JMXB 4MK0B 3F3GA 3CFSB 3ULEC 2AGZA 2H68A 4JD2C 3ORVD 4J0XA 2XL3A 2PM7B 4A08B 3FM0A 3ODTA 4Y5RD 5AFU3 5GMKn 4X3EA 5TF2A 4TZ4A 5C2WB 3B7FA 2O9KA 3HFQA 5C9ZB 5FA5B 4EWRA 3I7OA 4QRJA 3NVQA 4E54B 4PSXB 3EI3B 2PM9B 2XL2A 3SWSD 3EG6A 5EMJB 4KFMB 4ZOXA 4OWRA 2AGYA 5HE1B 2OVRB 3DSMA 5CXCB 3I89A 2EBSA 2YBAA 4PNKB 3MZLA 4R7AB 3RSEC 1GP2B 4CY2A 3MKSB 4O1QD 3RN1D 3SFZA 1JMZB 4OZUA 5H1MA 4CI3A 5IT9g 4CY1A 2B5NA 4ERZA 5EMLB 2Z2OA 1ERJA 2IWKA 4PBYA 2IWFA 5K1CC 1OLZA 4A08A 2AQ5A 4D6VA 2J55H 4GQ1A 3VA6A 4BUJC 5EALA 5CXCA 4FA9D 5K19A 3SJLD 3EI3A 5FLXg 4E5ZA 3I7NA 5TEFA 4IA9A 4L1QD 3C75H 5AJAA 4CI1A 1PI6A 3IJ0A 4JSXC 3OW8A 4CC9A 2H9NA 4E54A 2I3TA 1GG2B 3RRMC 4A2LA 2YMUA 3IIYA 2P9KC 3JROA 3EMHA 4O3UB 3N0EA 5EMKB 4GGDA 1PGUA 3F3PA 2IUQA 5EMMB 5AMSA 3VGZA 3BWSA 4U1EI 3DWLC 3UVLA 4GQ2P 4FA4D 4CZXA 4FA5D 3V5WB 1B9XA 1N6EA 1K32A 4ZOZA 2AGLA 4FB1D 4FAND 2P9NC 2BCJB 1PEVA 2IURA 4ESGA 1MDAH 3PSLA 3EU7A 3N0DA 3UR4A 5C2VB 4AOWA 3VH0A 4J77A 4A2MA 2IUVA 3IIWA 3JB9L 4J8BA 4BH6A 5CXBB 3AL8A 2W18A 5KDOB 1L0QA 4FA1D 5IGQA 4J81A 2IUPA 3AH8B 5CYKB 2H9MA 3UKRC 3RLMD 2H47A 2Z2PA 3JZNA 3RFHA 4XYIA 3I8CA 2AH0A 2OIZA 2I3SA 4A09A 3GREA 4PSWB 3JAMg 4XEIC 2B5LA 5GXHA 5FQDA 3ZWLB 2P9PC 2I0RA 2HKMA 2YNNA 5CXBA 3SCYA 4UI9R 4CZYA 2PBIB 3MZKA 3PXTD 2I0TA 4GM3A 2H6KA 3EI2A 2J57G 1YFQA 3W15A 5FKQA 4JSNC 3OKWA 5I5JA 3RFGA 5GXIA 2HYEA 3L4OD 2P9UC 4J73A 3JZHA 4CZVA 3CIKB 4FHLA 4PXWA 2Z2NA
chains in the Genus database with same CATH superfamily
3PXWD 5SXMA 4CI8A 3I8EA 4JSVC 2XYIA 1FWXA 3C9CA 2OK4A 4GM9A 4A09B 4J84A 2XZGA 2G99A 4L1MA 3I2NA 4JSPC 4MMYA 3RMZD 2CO0A 3UVNA 2QC5A 4Y7RA 4GGAA 3SMRA 3A0FA 3BG1A 2P9SC 4N14A 4WK4A 3SVWD 4L3HD 4O9DA 1SQ9A 4D0KA 4U7AA 3IJ1A 1B9YA 1TBGA 1C9LA 3O4JA 1VE7A 5EAPA 5EARA 2YNPA 4HDJA 2CO0C 3K26A 3PE7A 1NEXB 4AMYA 1JOFA 1M1XA 2CE9A 1R5MA 2CN2A 3FGBA 2VDNA 3C5MA 4J79A 2BKLA 4MMZA 3ZE2A 3F3FA 2UZXB 5M5UA 4GM8A 3IKOA 2QR5A 3SLED 3AL9A 1TYQC 1XHMA 3PSCB 4FAVD 4J8GA 3EWEA 5FKRA 4G56B 1U4CA 3NVXA 2AGXA 2IAAA 2H9LA 3GFCA 3C99A 4G55A 3UVMA 4BL0A 2GC7A 2H6NA 4WJKA 3K6SA 3IULA 4X63B 3OKTA 2CE8A 3I7LA 3V9FA 3K27A 4J82A 4LG9A 3I7PA 4A0BA 2B4EA 2H14A 4L3GD 3QHYB 1P22A 3DM0A 5EM2A 3FRXA 3VI3A 1SQJA 5HYNB 1VYHC 5IJ7E 2H6QA 1GXRA 5H14A 3V4VA 2YNOA 2EIDA 4NAAA 5TEEA 2H3XA 4ERYA 3NVNA 1GOGA 1UTCA 4GQBB 3EI1A 5JWZA 2AGWA 4A11A 3JZGA 3IUMA 2QZPA 1VZ3A 3UVKA 1QFSA 4UM8A 3J80g 3MKQA 4PXWA 5GSAA 5CYKA 3U4YA 1MG2A 3IUNA 4A0AB 4JT6C 4J86A 3ZDYA 3KRWB 5HE0B 3SBPA 2TRCB 1XIPA 3UVOA 1SHYB 2OVPB 4JT5C 4XYHA 4Z8LA 5IC7A 5THAA 4A0BB 2CNXA 1JJUB 1S4UX 2HU7A 2OK6A 5M5RA 3PXSD 4QQEA 5EM2B 4ZOVA 5E6SA 3SN6B 1A0RB 4CY3A 2EIEA 2HXCA 1MG3A 4L9OA 1OMWB 3L4MD 1BPOA 2VZ3A 3IUJA 4O3TB 4ZOYA 5E6UA 3OF7A 2I0SA 4AN0A 5TDHB 4YVDA 3EI1B 5IJ8E 4A7JA 2OVQB 3EI2B 5EAMA 4A0AA 4AN1A 5H17A 3NIGA 5I5IA 4JXMA 3ZE0A 1Q47A 3KRXB 3T3PA 4ERQA 4D9SA 1GOHA 2VDOA 3EI4B 4A11B 4H5JA 2HESX 3NIDA 2G9AA 2HU5A 2J56H 3ZDXA 4BCCA 4GZ8A 5IGOA 4GMBA 3V7DB 4BP8A 1A12A 4ES0A 3ZDZA 3SHFA 2GNQA 2B5MA 2HJBA 3OKYA 4H5IA 2GC4A 2VDPA 4CI2A 4QT8A 2Q7QA 5M61A 3JPXA 4AX4A 3SXTD 5B4WA 4LG8A 4CY5A 1N6DA 4K3JB 4E5ZB 1QNIA 3I7KA 2BBKH 3AFCA 5I5MA 5HQGA 4PC0A 3DXMC 3P4FA 1U2VC 4AEZA 4ZN4A 5FKTA 1XKSA 3T3MA 1O6GA 3O4HA 2HJ4A 1H2XA 2OJYA 3OL2B 4Z7QA 4K3ID 1E8NA 1UOQA 2P9IC 1NR0A 5M5SA 4LGNA 3RN0D 3JRPA 4J78A 2EICA 5HE2B 4J0WA 1TYEA 2QXVA 4WK2A 1K8KC 4WK0A 4X61B 1UOOA 4IMMA 4O45A 4J87A 4I79A 1PBYB 5A2Qg 2PM9A 3EI4A 1K3IA 3MXXA 5FFOA 2YB8B 3PVUB 4GGCA 4QL1A 3OTTA 2H9PA 3SBQA 3I7HA 2H13A 4BP9A 3E0CA 3SBRA 2MTAH 4PBZA 4X60B 3DXKC 4DNWA 5HE3B 1I2MB 3MVDK 3VI4A 1GOTB 3OKYB 3OL2A 3BG0A 4FWWA 1N6FA 2UZYB 3O4GA 4JHNA 2CN3A 5FKSA 4JHPC 2PM6B 5FXYA 1C9IA 4G1MA 3UKUC 3AL8B 3J81g 1T2XA 3IJCA 3CFVA 3K71A 1U8CA 1QFMA 2P9LC 2HKRA 4NSXA 3MMYA 1RI6A 3PVWB 2XU7A 1JMXB 4MK0B 3F3GA 3CFSB 3ULEC 4MMXA 2AGZA 2H68A 4JD2C 3ORVD 4J0XA 2XL3A 2PM7B 3FCUA 3FM0A 3ODTA 4Y5RD 5AFU3 5GMKn 4A08B 3EQ9A 4X3EA 1JTDB 5TF2A 4UM9A 1JV2A 4TZ4A 5C2WB 3B7FA 2O9KA 2HU8A 3MUOA 3HFQA 4QAMA 5C9ZB 3IJEA 2EIBA 5FA5B 3I7OA 4QRJA 4EWRA 3IVMA 3NVQA 4E54B 2VDLA 3EI3B 4PSXB 2PM9B 2XL2A 3SWSD 3EG6A 3ZE1A 5EMJB 4KFMB 4ZOXA 4OWRA 2AGYA 5HE1B 2OVRB 3DSMA 5CXCB 4AMZA 3I89A 2EBSA 2YBAA 4PNKB 3MZLA 5C86A 4R7AB 3RSEC 1GP2B 4CY2A 3MKSB 4O1QD 2VZ1A 3RN1D 3SFZA 1O6FA 1JMZB 4OZUA 5H1MA 4CI3A 3GC3B 5IT9g 4CY1A 2B5NA 3IURA 4ERZA 5EMLB 2Z2OA 4Z7OA 1ERJA 2IWKA 4PBYA 2IWFA 1H2WA 3GD1I 5K1CC 1OLZA 4A08A 3NIFA 2AQ5A 1VE6A 4D6VA 2J55H 4GQ1A 3VA6A 4BUJC 5EALA 5CXCA 4FA9D 5K19A 3IUQA 3SJLD 3EI3A 5FLXg 4E5ZA 3I7NA 5TEFA 4IA9A 4L1QD 1H2YA 1E8MA 2VC2A 3C75H 5AJAA 4CI1A 1PI6A 3IJ0A 1GOFA 3OW8A 4JSXC 4CC9A 1VZ2A 2H9NA 4E54A 2I3TA 1GG2B 3RRMC 4A2LA 2YMUA 3IIYA 3K72A 2P9KC 3JROA 3EMHA 4O3UB 3N0EA 5EMKB 4GGDA 1PGUA 2VDRA 2IUQA 3F3PA 5AMSA 3VGZA 5EMMB 3BWSA 4U1EI 3DWLC 3UVLA 4GQ2P 4FA4D 4CZXA 4FA5D 3V5WB 1B9XA 1N6EA 1K32A 3FCSA 4ZOZA 2AGLA 4FB1D 1UOPA 4FAND 2P9NC 2BCJB 1PEVA 2IURA 4ESGA 1MDAH 3PSLA 3EU7A 3N0DA 2JKXA 3DDUA 5M5TA 4G1EA 3UR4A 2XE4A 5C2VB 4AOWA 5C92A 3VH0A 4J77A 4A2MA 2IUVA 3IIWA 5E6RA 3JB9L 4J8BA 4BH6A 5CXBB 3AL8A 2W18A 4NBMA 5KDOB 5HDBA 1L0QA 4FA1D 5IGQA 4J81A 2IUPA 3AH8B 5M5VA 5CYKB 4O02A 3EQ8A 4DNVA 4BCBA 2H9MA 3MUNA 3UKRC 2XDWA 3RLMD 3KCIA 2H47A 2Z2PA 4DNUA 3JZNA 4RE5A 3RFHA 4XYIA 3I8CA 3QI0A 2AH0A 3EQ7A 5FFGA 2OIZA 2I3SA 4A09A 3GREA 4PSWB 3V4PA 3JAMg 4XEIC 2B5LA 2VDMA 5GXHA 3O4IA 5FQDA 4IRZA 3ZWLB 2P9PC 2I0RA 2HKMA 2YNNA 5CXBA 3SCYA 4UI9R 4CZYA 1L5GA 2PBIB 4BCDA 2WQ8A 3MZKA 3PXTD 4NENA 2I0TA 4GM3A 4NC4A 2H6KA 3EI2A 2J57G 1YFQA 1YR2A 3W15A 5FKQA 4RE6A 4JSNC 3OKWA 5I5JA 1H2ZA 4Z7NA 3RFGA 2VDKA 2VDQA 2HYEA 5GXIA 3L4OD 2P9UC 4O2WA 4J73A 1E5TA 3JZHA 3CIKB 4FHLA 4CZVA 2AH1A 2Z2NA
chains in the Genus database with same CATH topology
3PXWD 5SXMA 4CI8A 3I8EA 4JSVC 2XYIA 1FWXA 3C9CA 2OK4A 4GM9A 4A09B 4J84A 2G99A 3I2NA 4JSPC 3RMZD 2CO0A 3UVNA 2QC5A 4Y7RA 4GGAA 3SMRA 3A0FA 3BG1A 2P9SC 4N14A 3SVWD 4L3HD 4O9DA 1SQ9A 4D0KA 4U7AA 3IJ1A 1B9YA 1TBGA 5EAPA 5EARA 2YNPA 4HDJA 2CO0C 3K26A 3PE7A 1NEXB 1JOFA 2CE9A 1R5MA 2CN2A 3FGBA 3C5MA 4J79A 3F3FA 2UZXB 4GM8A 3IKOA 3SLED 3AL9A 1TYQC 1XHMA 3PSCB 4FAVD 4J8GA 3EWEA 5FKRA 4G56B 1U4CA 3NVXA 2AGXA 2IAAA 2H9LA 3GFCA 3C99A 3UVMA 4BL0A 2GC7A 2H6NA 4X63B 3OKTA 2CE8A 3I7LA 3V9FA 3K27A 4J82A 4LG9A 3I7PA 4A0BA 2B4EA 2H14A 4L3GD 5HYNB 1P22A 3DM0A 5EM2A 3FRXA 1SQJA 1VYHC 5IJ7E 2H6QA 1GXRA 5H14A 2YNOA 5TEEA 4ERYA 2H3XA 3EI1A 3NVNA 4GQBB 5JWZA 2AGWA 4A11A 3JZGA 3UVKA 3J80g 3MKQA 5GSAA 5CYKA 3U4YA 1MG2A 4A0AB 4JT6C 4J86A 3KRWB 5HE0B 3SBPA 2TRCB 1XIPA 3UVOA 1SHYB 2OVPB 4JT5C 4XYHA 4Z8LA 5IC7A 5THAA 4A0BB 2CNXA 1JJUB 1S4UX 2OK6A 4QQEA 3PXSD 5EM2B 4ZOVA 3SN6B 1A0RB 4CY3A 2HXCA 1MG3A 4L9OA 1OMWB 3L4MD 4O3TB 4ZOYA 2I0SA 5TDHB 4YVDA 3EI1B 5IJ8E 4A7JA 2OVQB 3EI2B 5EAMA 4A0AA 5H17A 5I5IA 4JXMA 1Q47A 3KRXB 4ERQA 3EI4B 4A11B 4H5JA 2HESX 2G9AA 2J56H 4GZ8A 5IGOA 4GMBA 3V7DB 4ES0A 3SHFA 2GNQA 2B5MA 2HJBA 3OKYA 4H5IA 2GC4A 4CI2A 4QT8A 2Q7QA 3JPXA 3SXTD 5B4WA 4LG8A 4CY5A 1N6DA 4K3JB 4E5ZB 1QNIA 3I7KA 2BBKH 3AFCA 5I5MA 5HQGA 4PC0A 3DXMC 3P4FA 1U2VC 4AEZA 4ZN4A 5FKTA 1XKSA 2HJ4A 2OJYA 3OL2B 2AH1A 4K3ID 2P9IC 1NR0A 4LGNA 3RN0D 3JRPA 4J78A 5HE2B 4J0WA 2QXVA 1K8KC 4X61B 4IMMA 4O45A 4J87A 4I79A 1PBYB 5A2Qg 2PM9A 3EI4A 3MXXA 2YB8B 3PVUB 4GGCA 4QL1A 3OTTA 2H9PA 3SBQA 3I7HA 2H13A 3E0CA 3SBRA 2MTAH 4PBZA 4X60B 3DXKC 5HE3B 1GOTB 3OKYB 3OL2A 3BG0A 4FWWA 1N6FA 2UZYB 2CN3A 5FKSA 2PM6B 5FXYA 3UKUC 3AL8B 3J81g 3IJCA 3CFVA 2P9LC 2HKRA 4NSXA 3MMYA 1RI6A 3PVWB 2XU7A 1JMXB 4MK0B 3F3GA 3CFSB 3ULEC 2AGZA 2H68A 4JD2C 3ORVD 4J0XA 2XL3A 2PM7B 4A08B 3FM0A 3ODTA 4Y5RD 5AFU3 5GMKn 4X3EA 5TF2A 4TZ4A 5C2WB 3B7FA 2O9KA 3HFQA 5C9ZB 5FA5B 4EWRA 3I7OA 4QRJA 3NVQA 4E54B 4PSXB 3EI3B 2PM9B 2XL2A 3SWSD 3EG6A 5EMJB 4KFMB 4ZOXA 4OWRA 2AGYA 5HE1B 2OVRB 3DSMA 5CXCB 3I89A 2EBSA 2YBAA 4PNKB 3MZLA 4R7AB 3RSEC 1GP2B 4CY2A 3MKSB 4O1QD 3RN1D 3SFZA 1JMZB 4OZUA 5H1MA 4CI3A 5IT9g 4CY1A 2B5NA 4ERZA 5EMLB 2Z2OA 1ERJA 2IWKA 4PBYA 2IWFA 5K1CC 1OLZA 4A08A 2AQ5A 4D6VA 2J55H 4GQ1A 3VA6A 4BUJC 5EALA 5CXCA 4FA9D 5K19A 3SJLD 3EI3A 5FLXg 4E5ZA 3I7NA 5TEFA 4IA9A 4L1QD 3C75H 5AJAA 4CI1A 1PI6A 3IJ0A 4JSXC 3OW8A 4CC9A 2H9NA 4E54A 2I3TA 1GG2B 3RRMC 4A2LA 2YMUA 3IIYA 2P9KC 3JROA 3EMHA 4O3UB 3N0EA 5EMKB 4GGDA 1PGUA 3F3PA 2IUQA 5EMMB 5AMSA 3VGZA 3BWSA 4U1EI 3DWLC 3UVLA 4GQ2P 4FA4D 4CZXA 4FA5D 3V5WB 1B9XA 1N6EA 1K32A 4ZOZA 2AGLA 4FB1D 4FAND 2P9NC 2BCJB 1PEVA 2IURA 4ESGA 1MDAH 3PSLA 3EU7A 3N0DA 3UR4A 5C2VB 4AOWA 3VH0A 4J77A 4A2MA 2IUVA 3IIWA 3JB9L 4J8BA 4BH6A 5CXBB 3AL8A 2W18A 5KDOB 1L0QA 4FA1D 5IGQA 4J81A 2IUPA 3AH8B 5CYKB 2H9MA 3UKRC 3RLMD 2H47A 2Z2PA 3JZNA 3RFHA 4XYIA 3I8CA 2AH0A 2OIZA 2I3SA 4A09A 3GREA 4PSWB 3JAMg 4XEIC 2B5LA 5GXHA 5FQDA 3ZWLB 2P9PC 2I0RA 2HKMA 2YNNA 5CXBA 3SCYA 4UI9R 4CZYA 2PBIB 3MZKA 3PXTD 2I0TA 4GM3A 2H6KA 3EI2A 2J57G 1YFQA 3W15A 5FKQA 4JSNC 3OKWA 5I5JA 3RFGA 5GXIA 2HYEA 3L4OD 2P9UC 4J73A 3JZHA 4CZVA 3CIKB 4FHLA 4PXWA 2Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXW D;  5SXM A;  4CI8 A;  3I8E A;  4JSV C;  2XYI A;  1FWX A;  3C9C A;  2OK4 A;  4GM9 A;  4A09 B;  4J84 A;  2G99 A;  3I2N A;  4JSP C;  3RMZ D;  2CO0 A;  3UVN A;  2QC5 A;  4Y7R A;  4GGA A;  3SMR A;  3A0F A;  3BG1 A;  2P9S C;  4N14 A;  3SVW D;  4L3H D;  4O9D A;  1SQ9 A;  4D0K A;  4U7A A;  3IJ1 A;  1B9Y A;  1TBG A;  5EAP A;  5EAR A;  2YNP A;  4HDJ A;  2CO0 C;  3K26 A;  3PE7 A;  1NEX B;  1JOF A;  2CE9 A;  1R5M A;  2CN2 A;  3FGB A;  3C5M A;  4J79 A;  3F3F A;  2UZX B;  4GM8 A;  3IKO A;  3SLE D;  3AL9 A;  1TYQ C;  1XHM A;  3PSC B;  4FAV D;  4J8G A;  3EWE A;  5FKR A;  4G56 B;  1U4C A;  3NVX A;  2AGX A;  2IAA A;  2H9L A;  3GFC A;  3C99 A;  3UVM A;  4BL0 A;  2GC7 A;  2H6N A;  4X63 B;  3OKT A;  2CE8 A;  3I7L A;  3V9F A;  3K27 A;  4J82 A;  4LG9 A;  3I7P A;  4A0B A;  2B4E A;  2H14 A;  4L3G D;  5HYN B;  1P22 A;  3DM0 A;  5EM2 A;  3FRX A;  1SQJ A;  1VYH C;  5IJ7 E;  2H6Q A;  1GXR A;  5H14 A;  2YNO A;  5TEE A;  4ERY A;  2H3X A;  3EI1 A;  3NVN A;  4GQB B;  5JWZ A;  2AGW A;  4A11 A;  3JZG A;  3UVK A;  3J80 g;  3MKQ A;  5GSA A;  5CYK A;  3U4Y A;  1MG2 A;  4A0A B;  4JT6 C;  4J86 A;  3KRW B;  5HE0 B;  3SBP A;  2TRC B;  1XIP A;  3UVO A;  1SHY B;  2OVP B;  4JT5 C;  4XYH A;  4Z8L A;  5IC7 A;  5THA A;  4A0B B;  2CNX A;  1JJU B;  1S4U X;  2OK6 A;  4QQE A;  3PXS D;  5EM2 B;  4ZOV A;  3SN6 B;  1A0R B;  4CY3 A;  2HXC A;  1MG3 A;  4L9O A;  1OMW B;  3L4M D;  4O3T B;  4ZOY A;  2I0S A;  5TDH B;  4YVD A;  3EI1 B;  5IJ8 E;  4A7J A;  2OVQ B;  3EI2 B;  5EAM A;  4A0A A;  5H17 A;  5I5I A;  4JXM A;  1Q47 A;  3KRX B;  4ERQ A;  3EI4 B;  4A11 B;  4H5J A;  2HES X;  2G9A A;  2J56 H;  4GZ8 A;  5IGO A;  4GMB A;  3V7D B;  4ES0 A;  3SHF A;  2GNQ A;  2B5M A;  2HJB A;  3OKY A;  4H5I A;  2GC4 A;  4CI2 A;  4QT8 A;  2Q7Q A;  3JPX A;  3SXT D;  5B4W A;  4LG8 A;  4CY5 A;  1N6D A;  4K3J B;  4E5Z B;  1QNI A;  3I7K A;  2BBK H;  3AFC A;  5I5M A;  5HQG A;  4PC0 A;  3DXM C;  3P4F A;  1U2V C;  4AEZ A;  4ZN4 A;  5FKT A;  1XKS A;  2HJ4 A;  2OJY A;  3OL2 B;  2AH1 A;  4K3I D;  2P9I C;  1NR0 A;  4LGN A;  3RN0 D;  3JRP A;  4J78 A;  5HE2 B;  4J0W A;  2QXV A;  1K8K C;  4X61 B;  4IMM A;  4O45 A;  4J87 A;  4I79 A;  1PBY B;  5A2Q g;  2PM9 A;  3EI4 A;  3MXX A;  2YB8 B;  3PVU B;  4GGC A;  4QL1 A;  3OTT A;  2H9P A;  3SBQ A;  3I7H A;  2H13 A;  3E0C A;  3SBR A;  2MTA H;  4PBZ A;  4X60 B;  3DXK C;  5HE3 B;  1GOT B;  3OKY B;  3OL2 A;  3BG0 A;  4FWW A;  1N6F A;  2UZY B;  2CN3 A;  5FKS A;  2PM6 B;  5FXY A;  3UKU C;  3AL8 B;  3J81 g;  3IJC A;  3CFV A;  2P9L C;  2HKR A;  4NSX A;  3MMY A;  1RI6 A;  3PVW B;  2XU7 A;  1JMX B;  4MK0 B;  3F3G A;  3CFS B;  3ULE C;  2AGZ A;  2H68 A;  4JD2 C;  3ORV D;  4J0X A;  2XL3 A;  2PM7 B;  4A08 B;  3FM0 A;  3ODT A;  4Y5R D;  5AFU 3;  5GMK n;  4X3E A;  5TF2 A;  4TZ4 A;  5C2W B;  3B7F A;  2O9K A;  3HFQ A;  5C9Z B;  5FA5 B;  4EWR A;  3I7O A;  4QRJ A;  3NVQ A;  4E54 B;  4PSX B;  3EI3 B;  2PM9 B;  2XL2 A;  3SWS D;  3EG6 A;  5EMJ B;  4KFM B;  4ZOX A;  4OWR A;  2AGY A;  5HE1 B;  2OVR B;  3DSM A;  5CXC B;  3I89 A;  2EBS A;  2YBA A;  4PNK B;  3MZL A;  4R7A B;  3RSE C;  1GP2 B;  4CY2 A;  3MKS B;  4O1Q D;  3RN1 D;  3SFZ A;  1JMZ B;  4OZU A;  5H1M A;  4CI3 A;  5IT9 g;  4CY1 A;  2B5N A;  4ERZ A;  5EML B;  2Z2O A;  1ERJ A;  2IWK A;  4PBY A;  2IWF A;  5K1C C;  1OLZ A;  4A08 A;  2AQ5 A;  4D6V A;  2J55 H;  4GQ1 A;  3VA6 A;  4BUJ C;  5EAL A;  5CXC A;  4FA9 D;  5K19 A;  3SJL D;  3EI3 A;  5FLX g;  4E5Z A;  3I7N A;  5TEF A;  4IA9 A;  4L1Q D;  3C75 H;  5AJA A;  4CI1 A;  1PI6 A;  3IJ0 A;  4JSX C;  3OW8 A;  4CC9 A;  2H9N A;  4E54 A;  2I3T A;  1GG2 B;  3RRM C;  4A2L A;  2YMU A;  3IIY A;  2P9K C;  3JRO A;  3EMH A;  4O3U B;  3N0E A;  5EMK B;  4GGD A;  1PGU A;  3F3P A;  2IUQ A;  5EMM B;  5AMS A;  3VGZ A;  3BWS A;  4U1E I;  3DWL C;  3UVL A;  4GQ2 P;  4FA4 D;  4CZX A;  4FA5 D;  3V5W B;  1B9X A;  1N6E A;  1K32 A;  4ZOZ A;  2AGL A;  4FB1 D;  4FAN D;  2P9N C;  2BCJ B;  1PEV A;  2IUR A;  4ESG A;  1MDA H;  3PSL A;  3EU7 A;  3N0D A;  3UR4 A;  5C2V B;  4AOW A;  3VH0 A;  4J77 A;  4A2M A;  2IUV A;  3IIW A;  3JB9 L;  4J8B A;  4BH6 A;  5CXB B;  3AL8 A;  2W18 A;  5KDO B;  1L0Q A;  4FA1 D;  5IGQ A;  4J81 A;  2IUP A;  3AH8 B;  5CYK B;  2H9M A;  3UKR C;  3RLM D;  2H47 A;  2Z2P A;  3JZN A;  3RFH A;  4XYI A;  3I8C A;  2AH0 A;  2OIZ A;  2I3S A;  4A09 A;  3GRE A;  4PSW B;  3JAM g;  4XEI C;  2B5L A;  5GXH A;  5FQD A;  3ZWL B;  2P9P C;  2I0R A;  2HKM A;  2YNN A;  5CXB A;  3SCY A;  4UI9 R;  4CZY A;  2PBI B;  3MZK A;  3PXT D;  2I0T A;  4GM3 A;  2H6K A;  3EI2 A;  2J57 G;  1YFQ A;  3W15 A;  5FKQ A;  4JSN C;  3OKW A;  5I5J A;  3RFG A;  5GXI A;  2HYE A;  3L4O D;  2P9U C;  4J73 A;  3JZH A;  4CZV A;  3CIK B;  4FHL A;  4PXW A;  2Z2N A; 
#chains in the Genus database with same CATH topology
 3PXW D;  5SXM A;  4CI8 A;  3I8E A;  4JSV C;  2XYI A;  1FWX A;  3C9C A;  2OK4 A;  4GM9 A;  4A09 B;  4J84 A;  2XZG A;  2G99 A;  4L1M A;  3I2N A;  4JSP C;  4MMY A;  3RMZ D;  2CO0 A;  3UVN A;  2QC5 A;  4Y7R A;  4GGA A;  3SMR A;  3A0F A;  3BG1 A;  2P9S C;  4N14 A;  4WK4 A;  3SVW D;  4L3H D;  4O9D A;  1SQ9 A;  4D0K A;  4U7A A;  3IJ1 A;  1B9Y A;  1TBG A;  1C9L A;  3O4J A;  1VE7 A;  5EAP A;  5EAR A;  2YNP A;  4HDJ A;  2CO0 C;  3K26 A;  3PE7 A;  1NEX B;  4AMY A;  1JOF A;  1M1X A;  2CE9 A;  1R5M A;  2CN2 A;  3FGB A;  2VDN A;  3C5M A;  4J79 A;  2BKL A;  4MMZ A;  3ZE2 A;  3F3F A;  2UZX B;  5M5U A;  4GM8 A;  3IKO A;  2QR5 A;  3SLE D;  3AL9 A;  1TYQ C;  1XHM A;  3PSC B;  4FAV D;  4J8G A;  3EWE A;  5FKR A;  4G56 B;  1U4C A;  3NVX A;  2AGX A;  2IAA A;  2H9L A;  3GFC A;  3C99 A;  4G55 A;  3UVM A;  4BL0 A;  2GC7 A;  2H6N A;  4WJK A;  3K6S A;  3IUL A;  4X63 B;  3OKT A;  2CE8 A;  3I7L A;  3V9F A;  3K27 A;  4J82 A;  4LG9 A;  3I7P A;  4A0B A;  2B4E A;  2H14 A;  4L3G D;  3QHY B;  1P22 A;  3DM0 A;  5EM2 A;  3FRX A;  3VI3 A;  1SQJ A;  5HYN B;  1VYH C;  5IJ7 E;  2H6Q A;  1GXR A;  5H14 A;  3V4V A;  2YNO A;  2EID A;  4NAA A;  5TEE A;  2H3X A;  4ERY A;  3NVN A;  1GOG A;  1UTC A;  4GQB B;  3EI1 A;  5JWZ A;  2AGW A;  4A11 A;  3JZG A;  3IUM A;  2QZP A;  1VZ3 A;  3UVK A;  1QFS A;  4UM8 A;  3J80 g;  3MKQ A;  4PXW A;  5GSA A;  5CYK A;  3U4Y A;  1MG2 A;  3IUN A;  4A0A B;  4JT6 C;  4J86 A;  3ZDY A;  3KRW B;  5HE0 B;  3SBP A;  2TRC B;  1XIP A;  3UVO A;  1SHY B;  2OVP B;  4JT5 C;  4XYH A;  4Z8L A;  5IC7 A;  5THA A;  4A0B B;  2CNX A;  1JJU B;  1S4U X;  2HU7 A;  2OK6 A;  5M5R A;  3PXS D;  4QQE A;  5EM2 B;  4ZOV A;  5E6S A;  3SN6 B;  1A0R B;  4CY3 A;  2EIE A;  2HXC A;  1MG3 A;  4L9O A;  1OMW B;  3L4M D;  1BPO A;  2VZ3 A;  3IUJ A;  4O3T B;  4ZOY A;  5E6U A;  3OF7 A;  2I0S A;  4AN0 A;  5TDH B;  4YVD A;  3EI1 B;  5IJ8 E;  4A7J A;  2OVQ B;  3EI2 B;  5EAM A;  4A0A A;  4AN1 A;  5H17 A;  3NIG A;  5I5I A;  4JXM A;  3ZE0 A;  1Q47 A;  3KRX B;  3T3P A;  4ERQ A;  4D9S A;  1GOH A;  2VDO A;  3EI4 B;  4A11 B;  4H5J A;  2HES X;  3NID A;  2G9A A;  2HU5 A;  2J56 H;  3ZDX A;  4BCC A;  4GZ8 A;  5IGO A;  4GMB A;  3V7D B;  4BP8 A;  1A12 A;  4ES0 A;  3ZDZ A;  3SHF A;  2GNQ A;  2B5M A;  2HJB A;  3OKY A;  4H5I A;  2GC4 A;  2VDP A;  4CI2 A;  4QT8 A;  2Q7Q A;  5M61 A;  3JPX A;  4AX4 A;  3SXT D;  5B4W A;  4LG8 A;  4CY5 A;  1N6D A;  4K3J B;  4E5Z B;  1QNI A;  3I7K A;  2BBK H;  3AFC A;  5I5M A;  5HQG A;  4PC0 A;  3DXM C;  3P4F A;  1U2V C;  4AEZ A;  4ZN4 A;  5FKT A;  1XKS A;  3T3M A;  1O6G A;  3O4H A;  2HJ4 A;  1H2X A;  2OJY A;  3OL2 B;  4Z7Q A;  4K3I D;  1E8N A;  1UOQ A;  2P9I C;  1NR0 A;  5M5S A;  4LGN A;  3RN0 D;  3JRP A;  4J78 A;  2EIC A;  5HE2 B;  4J0W A;  1TYE A;  2QXV A;  4WK2 A;  1K8K C;  4WK0 A;  4X61 B;  1UOO A;  4IMM A;  4O45 A;  4J87 A;  4I79 A;  1PBY B;  5A2Q g;  2PM9 A;  3EI4 A;  1K3I A;  3MXX A;  5FFO A;  2YB8 B;  3PVU B;  4GGC A;  4QL1 A;  3OTT A;  2H9P A;  3SBQ A;  3I7H A;  2H13 A;  4BP9 A;  3E0C A;  3SBR A;  2MTA H;  4PBZ A;  4X60 B;  3DXK C;  4DNW A;  5HE3 B;  1I2M B;  3MVD K;  3VI4 A;  1GOT B;  3OKY B;  3OL2 A;  3BG0 A;  4FWW A;  1N6F A;  2UZY B;  3O4G A;  4JHN A;  2CN3 A;  5FKS A;  4JHP C;  2PM6 B;  5FXY A;  1C9I A;  4G1M A;  3UKU C;  3AL8 B;  3J81 g;  1T2X A;  3IJC A;  3CFV A;  3K71 A;  1U8C A;  1QFM A;  2P9L C;  2HKR A;  4NSX A;  3MMY A;  1RI6 A;  3PVW B;  2XU7 A;  1JMX B;  4MK0 B;  3F3G A;  3CFS B;  3ULE C;  4MMX A;  2AGZ A;  2H68 A;  4JD2 C;  3ORV D;  4J0X A;  2XL3 A;  2PM7 B;  3FCU A;  3FM0 A;  3ODT A;  4Y5R D;  5AFU 3;  5GMK n;  4A08 B;  3EQ9 A;  4X3E A;  1JTD B;  5TF2 A;  4UM9 A;  1JV2 A;  4TZ4 A;  5C2W B;  3B7F A;  2O9K A;  2HU8 A;  3MUO A;  3HFQ A;  4QAM A;  5C9Z B;  3IJE A;  2EIB A;  5FA5 B;  3I7O A;  4QRJ A;  4EWR A;  3IVM A;  3NVQ A;  4E54 B;  2VDL A;  3EI3 B;  4PSX B;  2PM9 B;  2XL2 A;  3SWS D;  3EG6 A;  3ZE1 A;  5EMJ B;  4KFM B;  4ZOX A;  4OWR A;  2AGY A;  5HE1 B;  2OVR B;  3DSM A;  5CXC B;  4AMZ A;  3I89 A;  2EBS A;  2YBA A;  4PNK B;  3MZL A;  5C86 A;  4R7A B;  3RSE C;  1GP2 B;  4CY2 A;  3MKS B;  4O1Q D;  2VZ1 A;  3RN1 D;  3SFZ A;  1O6F A;  1JMZ B;  4OZU A;  5H1M A;  4CI3 A;  3GC3 B;  5IT9 g;  4CY1 A;  2B5N A;  3IUR A;  4ERZ A;  5EML B;  2Z2O A;  4Z7O A;  1ERJ A;  2IWK A;  4PBY A;  2IWF A;  1H2W A;  3GD1 I;  5K1C C;  1OLZ A;  4A08 A;  3NIF A;  2AQ5 A;  1VE6 A;  4D6V A;  2J55 H;  4GQ1 A;  3VA6 A;  4BUJ C;  5EAL A;  5CXC A;  4FA9 D;  5K19 A;  3IUQ A;  3SJL D;  3EI3 A;  5FLX g;  4E5Z A;  3I7N A;  5TEF A;  4IA9 A;  4L1Q D;  1H2Y A;  1E8M A;  2VC2 A;  3C75 H;  5AJA A;  4CI1 A;  1PI6 A;  3IJ0 A;  1GOF A;  3OW8 A;  4JSX C;  4CC9 A;  1VZ2 A;  2H9N A;  4E54 A;  2I3T A;  1GG2 B;  3RRM C;  4A2L A;  2YMU A;  3IIY A;  3K72 A;  2P9K C;  3JRO A;  3EMH A;  4O3U B;  3N0E A;  5EMK B;  4GGD A;  1PGU A;  2VDR A;  2IUQ A;  3F3P A;  5AMS A;  3VGZ A;  5EMM B;  3BWS A;  4U1E I;  3DWL C;  3UVL A;  4GQ2 P;  4FA4 D;  4CZX A;  4FA5 D;  3V5W B;  1B9X A;  1N6E A;  1K32 A;  3FCS A;  4ZOZ A;  2AGL A;  4FB1 D;  1UOP A;  4FAN D;  2P9N C;  2BCJ B;  1PEV A;  2IUR A;  4ESG A;  1MDA H;  3PSL A;  3EU7 A;  3N0D A;  2JKX A;  3DDU A;  5M5T A;  4G1E A;  3UR4 A;  2XE4 A;  5C2V B;  4AOW A;  5C92 A;  3VH0 A;  4J77 A;  4A2M A;  2IUV A;  3IIW A;  5E6R A;  3JB9 L;  4J8B A;  4BH6 A;  5CXB B;  3AL8 A;  2W18 A;  4NBM A;  5KDO B;  5HDB A;  1L0Q A;  4FA1 D;  5IGQ A;  4J81 A;  2IUP A;  3AH8 B;  5M5V A;  5CYK B;  4O02 A;  3EQ8 A;  4DNV A;  4BCB A;  2H9M A;  3MUN A;  3UKR C;  2XDW A;  3RLM D;  3KCI A;  2H47 A;  2Z2P A;  4DNU A;  3JZN A;  4RE5 A;  3RFH A;  4XYI A;  3I8C A;  3QI0 A;  2AH0 A;  3EQ7 A;  5FFG A;  2OIZ A;  2I3S A;  4A09 A;  3GRE A;  4PSW B;  3V4P A;  3JAM g;  4XEI C;  2B5L A;  2VDM A;  5GXH A;  3O4I A;  5FQD A;  4IRZ A;  3ZWL B;  2P9P C;  2I0R A;  2HKM A;  2YNN A;  5CXB A;  3SCY A;  4UI9 R;  4CZY A;  1L5G A;  2PBI B;  4BCD A;  2WQ8 A;  3MZK A;  3PXT D;  4NEN A;  2I0T A;  4GM3 A;  4NC4 A;  2H6K A;  3EI2 A;  2J57 G;  1YFQ A;  1YR2 A;  3W15 A;  5FKQ A;  4RE6 A;  4JSN C;  3OKW A;  5I5J A;  1H2Z A;  4Z7N A;  3RFG A;  2VDK A;  2VDQ A;  2HYE A;  5GXI A;  3L4O D;  2P9U C;  4O2W A;  4J73 A;  1E5T A;  3JZH A;  3CIK B;  4FHL A;  4CZV A;  2AH1 A;  2Z2N A; 
#chains in the Genus database with same CATH homology
 3PXW D;  5SXM A;  4CI8 A;  3I8E A;  4JSV C;  2XYI A;  1FWX A;  3C9C A;  2OK4 A;  4GM9 A;  4A09 B;  4J84 A;  2G99 A;  3I2N A;  4JSP C;  3RMZ D;  2CO0 A;  3UVN A;  2QC5 A;  4Y7R A;  4GGA A;  3SMR A;  3A0F A;  3BG1 A;  2P9S C;  4N14 A;  3SVW D;  4L3H D;  4O9D A;  1SQ9 A;  4D0K A;  4U7A A;  3IJ1 A;  1B9Y A;  1TBG A;  5EAP A;  5EAR A;  2YNP A;  4HDJ A;  2CO0 C;  3K26 A;  3PE7 A;  1NEX B;  1JOF A;  2CE9 A;  1R5M A;  2CN2 A;  3FGB A;  3C5M A;  4J79 A;  3F3F A;  2UZX B;  4GM8 A;  3IKO A;  3SLE D;  3AL9 A;  1TYQ C;  1XHM A;  3PSC B;  4FAV D;  4J8G A;  3EWE A;  5FKR A;  4G56 B;  1U4C A;  3NVX A;  2AGX A;  2IAA A;  2H9L A;  3GFC A;  3C99 A;  3UVM A;  4BL0 A;  2GC7 A;  2H6N A;  4X63 B;  3OKT A;  2CE8 A;  3I7L A;  3V9F A;  3K27 A;  4J82 A;  4LG9 A;  3I7P A;  4A0B A;  2B4E A;  2H14 A;  4L3G D;  5HYN B;  1P22 A;  3DM0 A;  5EM2 A;  3FRX A;  1SQJ A;  1VYH C;  5IJ7 E;  2H6Q A;  1GXR A;  5H14 A;  2YNO A;  5TEE A;  4ERY A;  2H3X A;  3EI1 A;  3NVN A;  4GQB B;  5JWZ A;  2AGW A;  4A11 A;  3JZG A;  3UVK A;  3J80 g;  3MKQ A;  5GSA A;  5CYK A;  3U4Y A;  1MG2 A;  4A0A B;  4JT6 C;  4J86 A;  3KRW B;  5HE0 B;  3SBP A;  2TRC B;  1XIP A;  3UVO A;  1SHY B;  2OVP B;  4JT5 C;  4XYH A;  4Z8L A;  5IC7 A;  5THA A;  4A0B B;  2CNX A;  1JJU B;  1S4U X;  2OK6 A;  4QQE A;  3PXS D;  5EM2 B;  4ZOV A;  3SN6 B;  1A0R B;  4CY3 A;  2HXC A;  1MG3 A;  4L9O A;  1OMW B;  3L4M D;  4O3T B;  4ZOY A;  2I0S A;  5TDH B;  4YVD A;  3EI1 B;  5IJ8 E;  4A7J A;  2OVQ B;  3EI2 B;  5EAM A;  4A0A A;  5H17 A;  5I5I A;  4JXM A;  1Q47 A;  3KRX B;  4ERQ A;  3EI4 B;  4A11 B;  4H5J A;  2HES X;  2G9A A;  2J56 H;  4GZ8 A;  5IGO A;  4GMB A;  3V7D B;  4ES0 A;  3SHF A;  2GNQ A;  2B5M A;  2HJB A;  3OKY A;  4H5I A;  2GC4 A;  4CI2 A;  4QT8 A;  2Q7Q A;  3JPX A;  3SXT D;  5B4W A;  4LG8 A;  4CY5 A;  1N6D A;  4K3J B;  4E5Z B;  1QNI A;  3I7K A;  2BBK H;  3AFC A;  5I5M A;  5HQG A;  4PC0 A;  3DXM C;  3P4F A;  1U2V C;  4AEZ A;  4ZN4 A;  5FKT A;  1XKS A;  2HJ4 A;  2OJY A;  3OL2 B;  2AH1 A;  4K3I D;  2P9I C;  1NR0 A;  4LGN A;  3RN0 D;  3JRP A;  4J78 A;  5HE2 B;  4J0W A;  2QXV A;  1K8K C;  4X61 B;  4IMM A;  4O45 A;  4J87 A;  4I79 A;  1PBY B;  5A2Q g;  2PM9 A;  3EI4 A;  3MXX A;  2YB8 B;  3PVU B;  4GGC A;  4QL1 A;  3OTT A;  2H9P A;  3SBQ A;  3I7H A;  2H13 A;  3E0C A;  3SBR A;  2MTA H;  4PBZ A;  4X60 B;  3DXK C;  5HE3 B;  1GOT B;  3OKY B;  3OL2 A;  3BG0 A;  4FWW A;  1N6F A;  2UZY B;  2CN3 A;  5FKS A;  2PM6 B;  5FXY A;  3UKU C;  3AL8 B;  3J81 g;  3IJC A;  3CFV A;  2P9L C;  2HKR A;  4NSX A;  3MMY A;  1RI6 A;  3PVW B;  2XU7 A;  1JMX B;  4MK0 B;  3F3G A;  3CFS B;  3ULE C;  2AGZ A;  2H68 A;  4JD2 C;  3ORV D;  4J0X A;  2XL3 A;  2PM7 B;  4A08 B;  3FM0 A;  3ODT A;  4Y5R D;  5AFU 3;  5GMK n;  4X3E A;  5TF2 A;  4TZ4 A;  5C2W B;  3B7F A;  2O9K A;  3HFQ A;  5C9Z B;  5FA5 B;  4EWR A;  3I7O A;  4QRJ A;  3NVQ A;  4E54 B;  4PSX B;  3EI3 B;  2PM9 B;  2XL2 A;  3SWS D;  3EG6 A;  5EMJ B;  4KFM B;  4ZOX A;  4OWR A;  2AGY A;  5HE1 B;  2OVR B;  3DSM A;  5CXC B;  3I89 A;  2EBS A;  2YBA A;  4PNK B;  3MZL A;  4R7A B;  3RSE C;  1GP2 B;  4CY2 A;  3MKS B;  4O1Q D;  3RN1 D;  3SFZ A;  1JMZ B;  4OZU A;  5H1M A;  4CI3 A;  5IT9 g;  4CY1 A;  2B5N A;  4ERZ A;  5EML B;  2Z2O A;  1ERJ A;  2IWK A;  4PBY A;  2IWF A;  5K1C C;  1OLZ A;  4A08 A;  2AQ5 A;  4D6V A;  2J55 H;  4GQ1 A;  3VA6 A;  4BUJ C;  5EAL A;  5CXC A;  4FA9 D;  5K19 A;  3SJL D;  3EI3 A;  5FLX g;  4E5Z A;  3I7N A;  5TEF A;  4IA9 A;  4L1Q D;  3C75 H;  5AJA A;  4CI1 A;  1PI6 A;  3IJ0 A;  4JSX C;  3OW8 A;  4CC9 A;  2H9N A;  4E54 A;  2I3T A;  1GG2 B;  3RRM C;  4A2L A;  2YMU A;  3IIY A;  2P9K C;  3JRO A;  3EMH A;  4O3U B;  3N0E A;  5EMK B;  4GGD A;  1PGU A;  3F3P A;  2IUQ A;  5EMM B;  5AMS A;  3VGZ A;  3BWS A;  4U1E I;  3DWL C;  3UVL A;  4GQ2 P;  4FA4 D;  4CZX A;  4FA5 D;  3V5W B;  1B9X A;  1N6E A;  1K32 A;  4ZOZ A;  2AGL A;  4FB1 D;  4FAN D;  2P9N C;  2BCJ B;  1PEV A;  2IUR A;  4ESG A;  1MDA H;  3PSL A;  3EU7 A;  3N0D A;  3UR4 A;  5C2V B;  4AOW A;  3VH0 A;  4J77 A;  4A2M A;  2IUV A;  3IIW A;  3JB9 L;  4J8B A;  4BH6 A;  5CXB B;  3AL8 A;  2W18 A;  5KDO B;  1L0Q A;  4FA1 D;  5IGQ A;  4J81 A;  2IUP A;  3AH8 B;  5CYK B;  2H9M A;  3UKR C;  3RLM D;  2H47 A;  2Z2P A;  3JZN A;  3RFH A;  4XYI A;  3I8C A;  2AH0 A;  2OIZ A;  2I3S A;  4A09 A;  3GRE A;  4PSW B;  3JAM g;  4XEI C;  2B5L A;  5GXH A;  5FQD A;  3ZWL B;  2P9P C;  2I0R A;  2HKM A;  2YNN A;  5CXB A;  3SCY A;  4UI9 R;  4CZY A;  2PBI B;  3MZK A;  3PXT D;  2I0T A;  4GM3 A;  2H6K A;  3EI2 A;  2J57 G;  1YFQ A;  3W15 A;  5FKQ A;  4JSN C;  3OKW A;  5I5J A;  3RFG A;  5GXI A;  2HYE A;  3L4O D;  2P9U C;  4J73 A;  3JZH A;  4CZV A;  3CIK B;  4FHL A;  4PXW A;  2Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...