1MG2A

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
382
structure length
382
Chain Sequence
b'EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHAAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase, heavy chain
molecule tags Oxidoreductase
source organism Paracoccus denitrificans
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
total genus 94
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1mg2A00
4ESGA 2IWFA 4CZXA 5B4WA 3I7PA 4AEZA 2EBSA 5CYKA 4GM9A 2B5NA 4K3ID 3UKRC 5AJAA 3CFVA 2HESX 1TYQC 4IMMA 3PSCB 5EMJB 2IUQA 5FA5B 3KRXB 4J8BA 4J0XA 3EI2A 4AOWA 1VYHC 3IIYA 3N0EA 2H68A 3FM0A 4PXWA 4FB1D 4FAND 5A2Qg 3K27A 3U4YA 3AFCA 3C9CA 5EARA 4GZ8A 2HXCA 3SCYA 3RSEC 3OKTA 3NVNA 5H17A 2B5LA 5CXCA 2AGLA 3J80g 4X63B 3FRXA 3IKOA 5C9ZB 2J55H 2I0RA 4U7AA 3AL8B 2PM9B 1MG3A 3OL2A 3I2NA 3DSMA 1A0RB 3OKYA 1N6FA 1Q47A 2GC4A 3CIKB 5AMSA 3N0DA 3DM0A 3I7OA 4JT5C 4L9OA 5TEEA 4GQ1A 3JZGA 5IJ7E 4A0AA 2PM9A 3I89A 1FWXA 3EMHA 2CE9A 3FGBA 4OZUA 2I3TA 5CXBB 3SBPA 3GREA 3JROA 4D0KA 5FKTA 4Z8LA 4PSXB 3KRWB 2OK6A 3C99A 5GSAA 2OVPB 2AH0A 5CXBA 2H3XA 3L4MD 5CXCB 4A2LA 4ERYA 4CZYA 5GXIA 1SQ9A 3C5MA 1JMXB 4J87A 5K19A 4XYHA 5EALA 3PXSD 4PNKB 4CY1A 3AL8A 4L1QD 2YMUA 3I7KA 2G99A 4J78A 2IWKA 3V9FA 5GMKn 5IT9g 4CI2A 4O45A 4FHLA 2H13A 3MZLA 1GG2B 4CY2A 3JPXA 4JSXC 4ZOYA 3SFZA 3NVXA 3OKYB 2I0TA 2CO0A 3UVOA 2PM7B 3F3GA 2XU7A 3OTTA 2HKRA 1P22A 5HYNB 2AGWA 2I3SA 3B7FA 2P9PC 1XIPA 4O1QD 5TF2A 1JMZB 4TZ4A 2MTAH 4CI1A 1SHYB 2AQ5A 3J81g 2CN3A 4LGNA 3RFGA 4X61B 1XHMA 2QXVA 3F3FA 2CE8A 2H9LA 2YNNA 4A7JA 4KFMB 3BG1A 1YFQA 4H5JA 2B5MA 5AFU3 2OK4A 3W15A 5HE2B 2Z2NA 4GMBA 3PXWD 5FQDA 3SMRA 3EG6A 4L3GD 5GXHA 4HDJA 2CNXA 5I5IA 3EU7A 3HFQA 2IUPA 2BBKH 3OL2B 1XKSA 3I7NA 4GM8A 3SBQA 5TDHB 4N14A 4BH6A 1N6DA 3NVQA 2J57G 1MG2A 4FAVD 4A08B 2P9NC 4FA4D 4O9DA 2XL2A 3PVUB 3UVNA 5TEFA 4FWWA 4A2MA 3JRPA 4J77A 1L0QA 1PI6A 2XYIA 5IGOA 5FKSA 3SLED 5HE1B 2UZXB 5FLXg 1GP2B 4MK0B 2I0SA 3BWSA 3AL9A 3EI4B 3DXKC 2Q7QA 3V5WB 1R5MA 4A11A 2YNPA 4GQ2P 4D6VA 3ORVD 4BUJC 3PSLA 4CZVA 4A11B 2CN2A 2YNOA 1GXRA 5I5JA 2IURA 2YB8B 3DXMC 4LG8A 2H6NA 5K1CC 5I5MA 2IAAA 3SWSD 2AGZA 4CI3A 4XEIC 3OKWA 4A08A 1NEXB 3EI3A 3PXTD 1GOTB 1K8KC 4A09A 2GC7A 2P9KC 2OIZA 2H9PA 3F3PA 3ODTA 2P9UC 4E5ZA 5HE3B 3BG0A 2OVRB 1SQJA 2P9LC 3RN1D 3K26A 3VH0A 3I7LA 3JZNA 4E5ZB 1TBGA 3JZHA 4O3TB 2HJ4A 3RFHA 3VA6A 4I79A 3EI4A 4ERZA 2H47A 2YBAA 5EAPA 3UVMA 2TRCB 4BL0A 3MMYA 3PE7A 4GM3A 4Y7RA 5SXMA 4G56B 3IIWA 4GGDA 4GGAA 4U1EI 4QT8A 4JSNC 5IGQA 2PBIB 5EMLB 3ULEC 3RLMD 2Z2OA 3EI3B 4EWRA 5C2WB 3E0CA 3PVWB 3IJCA 5HQGA 2OVQB 2XL3A 4JD2C 1JOFA 1RI6A 4IA9A 3SBRA 4FA5D 5EM2B 4K3JB 4H5IA 2OJYA 4QRJA 5FXYA 2B4EA 3GFCA 3OW8A 4O3UB 4JSPC 4XYIA 2HYEA 4JSVC 5H1MA 5HE0B 3ZWLB 4PBZA 1NR0A 4A0BB 4ES0A 1PEVA 4UI9R 1B9XA 4QL1A 3UR4A 4GQBB 3V7DB 4X60B 1U4CA 3SN6B 2W18A 2CO0C 3AH8B 3SJLD 2J56H 3CFSB 3UVKA 4J73A 4CI8A 4QQEA 2H6QA 2HJBA 5EMKB 3UKUC 4A09B 5IC7A 4R7AB 2HKMA 5EAMA 4A0AB 4E54A 1PBYB 2UZYB 3RMZD 3IJ1A 4PSWB 5IJ8E 1N6EA 3RRMC 4A0BA 4CY5A 1JJUB 3A0FA 4PBYA 2H6KA 1QNIA 3SXTD 1S4UX 5FKQA 4J82A 3EI1B 3MKSB 2PM6B 5KDOB 2AGXA 2IUVA 3I8CA 3L4OD 3VGZA 4FA9D 4YVDA 2BCJB 5THAA 4X3EA 4L3HD 3UVLA 5FKRA 4ERQA 4J0WA 1B9YA 3I8EA 4E54B 3IJ0A 2H14A 1K32A 3EI1A 4OWRA 3P4FA 4JT6C 4J84A 2P9SC 3MXXA 5H14A 4GGCA 4LG9A 4JXMA 1PGUA 4J8GA 2H9MA 4J86A 2G9AA 3JAMg 4FA1D 3SHFA 4CY3A 4ZOXA 4Y5RD 2QC5A 3MKQA 5JWZA 3RN0D 4NSXA 2GNQA 3JB9L 3I7HA 5C2VB 1ERJA 2P9IC 2AGYA 5EM2A 3MZKA 2Z2PA 5CYKB 3DWLC 1OLZA 2AH1A 4ZOZA 4J81A 4CC9A 4ZOVA 5EMMB 4J79A 3EI2B 4ZN4A 1U2VC 3EWEA 1OMWB 3C75H 1MDAH 2O9KA 3SVWD 2H9NA 4PC0A
chains in the Genus database with same CATH superfamily
4ESGA 2IWFA 4CZXA 3T3PA 5B4WA 3I7PA 4AEZA 4DNVA 2EBSA 2VDQA 1BPOA 5CYKA 2EIDA 4GM9A 2B5NA 4K3ID 3UKRC 3ZDZA 5M5TA 5FFGA 5AJAA 3CFVA 2HESX 1TYQC 4IMMA 3PSCB 5EMJB 2VDPA 2IUQA 3IUNA 5FA5B 3KRXB 4J8BA 4J0XA 3EI2A 4AOWA 1UOQA 1VYHC 1U8CA 3IIYA 3N0EA 2H68A 3FM0A 4PXWA 4FB1D 4FAND 2XDWA 1O6GA 5A2Qg 4O2WA 3K71A 3K27A 3IURA 3U4YA 3AFCA 3C9CA 5EARA 4GZ8A 2HXCA 3SCYA 3RSEC 3OKTA 3NVNA 5H17A 2B5LA 5CXCA 4BP9A 2AGLA 1GOFA 3J80g 4X63B 3FRXA 3IKOA 4MMYA 3EQ7A 5C9ZB 2J55H 2I0RA 4U7AA 3AL8B 2PM9B 1MG3A 3OL2A 3I2NA 3DSMA 1A0RB 3OKYA 1N6FA 1Q47A 2GC4A 3VI4A 3EQ8A 3CIKB 5AMSA 3N0DA 3DM0A 3I7OA 4JT5C 4L9OA 5TEEA 2WQ8A 3JZGA 4GQ1A 4NAAA 5IJ7E 4DNWA 3IUMA 4A0AA 1H2YA 2PM9A 3IVMA 3I89A 1FWXA 3EMHA 4Z7OA 2CE9A 3FGBA 1TYEA 4JHPC 4OZUA 2I3TA 5CXBB 3SBPA 3GREA 3JROA 4D0KA 5FKTA 2EICA 4Z8LA 3KRWB 2OK6A 4PSXB 1C9LA 3C99A 4G1MA 2OVPB 5GSAA 2AH0A 5CXBA 2H3XA 1H2ZA 3L4MD 5CXCB 5HDBA 4A2LA 4CZYA 4ERYA 5GXIA 1SQ9A 3C5MA 1JMXB 4J87A 5K19A 4XYHA 1GOGA 1JTDB 5EALA 4UM8A 3PXSD 4PNKB 4AMZA 4CY1A 3AL8A 4L1QD 2YMUA 3I7KA 2G99A 4J78A 5M5VA 3ZE2A 3V9FA 5IT9g 5GMKn 4CI2A 4O45A 4FHLA 5M5SA 2H13A 1VZ2A 3MZLA 3NIDA 1GG2B 4O02A 4CY2A 3JPXA 4JSXC 4ZOYA 3SFZA 3NVXA 3OKYB 2I0TA 2CO0A 3UVOA 1QFSA 2PM7B 3F3GA 2XU7A 3OTTA 2HKRA 1P22A 5HYNB 2AGWA 2VC2A 2EIEA 2I3SA 3B7FA 3MVDK 1YR2A 2P9PC 1XIPA 4O1QD 5TF2A 1JMZB 4TZ4A 2MTAH 4CI1A 3ZE0A 4AN1A 1SHYB 2AQ5A 3J81g 1A12A 2CN3A 4LGNA 2VDNA 3RFGA 4X61B 1XHMA 2QXVA 3F3FA 2CE8A 2H9LA 2YNNA 4A7JA 4KFMB 3BG1A 1YFQA 3KCIA 4H5JA 2B5MA 5AFU3 2OK4A 3W15A 1UOPA 5HE2B 2Z2NA 3K72A 4GMBA 3PXWD 3O4JA 5FQDA 3SMRA 3EG6A 3MUNA 3QI0A 4L3GD 5GXHA 4HDJA 2CNXA 5I5IA 3EU7A 3HFQA 2IUPA 2BBKH 3OL2B 1XKSA 3I7NA 4GM8A 1I2MB 5E6RA 1VE7A 3SBQA 5TDHB 4N14A 4BH6A 1K3IA 1N6DA 2VDRA 4PC0A 1VZ3A 3NVQA 2J57G 2XZGA 1MG2A 4FAVD 4A08B 2JKXA 2P9NC 4FA4D 4MMXA 3FCSA 4O9DA 2XL2A 3PVUB 3UVNA 5TEFA 5M61A 4FWWA 4Z7QA 4A2MA 3EQ9A 3GC3B 3OF7A 3JRPA 4J77A 1L0QA 1PI6A 2XYIA 3ZE1A 5IGOA 5FKSA 3SLED 5HE1B 2UZXB 5FLXg 4UM9A 4BCBA 1GP2B 4MK0B 1C9IA 2I0SA 4DNUA 3BWSA 3AL9A 3EI4B 3DXKC 2Q7QA 3V5WB 1R5MA 1JV2A 4A11A 2YNPA 4GQ2P 4D6VA 3ORVD 4BUJC 2VZ1A 1M1XA 3PSLA 5C86A 4CZVA 4A11B 2EIBA 2CN2A 2YNOA 1GXRA 5FFOA 2IURA 3DXMC 1T2XA 2YB8B 1UOOA 4LG8A 2H6NA 5K1CC 5I5MA 2IAAA 3SWSD 2AGZA 2BKLA 1GOHA 4CI3A 4XEIC 3OKWA 4A08A 1NEXB 3EI3A 5E6SA 3PXTD 1GOTB 1K8KC 4A09A 2GC7A 3K6SA 2P9KC 2OIZA 2H9PA 1H2XA 3F3PA 3ODTA 2P9UC 4E5ZA 5HE3B 3BG0A 2OVRB 1SQJA 2P9LC 3RN1D 3K26A 4NC4A 3VH0A 3I7LA 3JZNA 4E5ZB 1TBGA 3JZHA 4O3TB 3MUOA 2HJ4A 3RFHA 4MMZA 3VI3A 3VA6A 4I79A 3EI4A 4ERZA 4NENA 1E8MA 2H47A 2YBAA 5EAPA 3O4HA 3UVMA 2TRCB 4BL0A 3MMYA 3PE7A 4GM3A 4Y7RA 5SXMA 4RE6A 3FCUA 5I5JA 4G56B 3IIWA 4GGDA 3T3MA 3V4VA 3NIGA 2VDKA 4GGAA 4U1EI 4IRZA 4BCDA 4QT8A 4JSNC 5IGQA 2PBIB 5EMLB 3ULEC 3RLMD 2Z2OA 3EI3B 4EWRA 5C2WB 3DDUA 3E0CA 3IJCA 2QZPA 3PVWB 3NIFA 5HQGA 2OVQB 2XL3A 4JD2C 1JOFA 1RI6A 4IA9A 3SBRA 4Z7NA 4FA5D 5EM2B 4WJKA 4K3JB 4H5IA 2OJYA 4QRJA 3V4PA 5FXYA 2B4EA 1UTCA 3GFCA 3OW8A 4JSPC 4O3UB 4XYIA 2HYEA 4JSVC 5H1MA 4L1MA 5HE0B 3ZWLB 2HU8A 3IUQA 4PBZA 1NR0A 2XE4A 4A0BB 4ES0A 4RE5A 1PEVA 4UI9R 1B9XA 4QL1A 4BCCA 3UR4A 4GQBB 3V7DB 4X60B 1U4CA 3SN6B 2W18A 5M5RA 2CO0C 3AH8B 3SJLD 3ZDXA 2J56H 3O4GA 3CFSB 4AN0A 3UVKA 4J73A 4CI8A 4QQEA 2H6QA 2HJBA 4D9SA 1VE6A 5EMKB 5C92A 3UKUC 4A09B 5IC7A 4R7AB 4WK2A 2HKMA 5EAMA 4A0AB 4E54A 1PBYB 2UZYB 2VDOA 3RMZD 3IJ1A 4PSWB 5IJ8E 1N6EA 3RRMC 4A0BA 4CY5A 1JJUB 3A0FA 3IUJA 4PBYA 4WK0A 2H6KA 4AMYA 1QNIA 3SXTD 1S4UX 2HU5A 5FKQA 4J82A 3EI1B 3MKSB 1L5GA 2PM6B 5KDOB 2AGXA 2IUVA 3I8CA 4BP8A 3L4OD 3VGZA 4FA9D 4YVDA 2BCJB 5THAA 4X3EA 4L3HD 4JHNA 5FKRA 3UVLA 4J0WA 1B9YA 4ERQA 3I8EA 4E54B 4NBMA 3IJ0A 2H14A 1K32A 3EI1A 3IJEA 4QAMA 5E6UA 4OWRA 3P4FA 4JT6C 4J84A 2P9SC 2QR5A 3MXXA 5H14A 4GGCA 4LG9A 4JXMA 1PGUA 3QHYB 2VDMA 2VDLA 4J8GA 2H9MA 4AX4A 4J86A 2G9AA 3JAMg 3O4IA 1E8NA 3ZDYA 4FA1D 1O6FA 3SHFA 4CY3A 4ZOXA 2VZ3A 5M5UA 4Y5RD 2QC5A 3MKQA 4G55A 5JWZA 3RN0D 4NSXA 2GNQA 3JB9L 3I7HA 4G1EA 5C2VB 1ERJA 2P9IC 2AGYA 5EM2A 3MZKA 2Z2PA 5CYKB 3DWLC 1OLZA 2AH1A 3IULA 4ZOZA 1E5TA 4J81A 1H2WA 2HU7A 4ZOVA 4WK4A 1QFMA 3GD1I 4J79A 4CC9A 4ZN4A 5EMMB 3EI2B 1U2VC 3EWEA 1OMWB 3C75H 1MDAH 2O9KA 3SVWD 2H9NA 2IWKA
chains in the Genus database with same CATH topology
4ESGA 2IWFA 4CZXA 5B4WA 3I7PA 4AEZA 2EBSA 5CYKA 4GM9A 2B5NA 4K3ID 3UKRC 5AJAA 3CFVA 2HESX 1TYQC 4IMMA 3PSCB 5EMJB 2IUQA 5FA5B 3KRXB 4J8BA 4J0XA 3EI2A 4AOWA 1VYHC 3IIYA 3N0EA 2H68A 3FM0A 4PXWA 4FB1D 4FAND 5A2Qg 3K27A 3U4YA 3AFCA 3C9CA 5EARA 4GZ8A 2HXCA 3SCYA 3RSEC 3OKTA 3NVNA 5H17A 2B5LA 5CXCA 2AGLA 3J80g 4X63B 3FRXA 3IKOA 5C9ZB 2J55H 2I0RA 4U7AA 3AL8B 2PM9B 1MG3A 3OL2A 3I2NA 3DSMA 1A0RB 3OKYA 1N6FA 1Q47A 2GC4A 3CIKB 5AMSA 3N0DA 3DM0A 3I7OA 4JT5C 4L9OA 5TEEA 4GQ1A 3JZGA 5IJ7E 4A0AA 2PM9A 3I89A 1FWXA 3EMHA 2CE9A 3FGBA 4OZUA 2I3TA 5CXBB 3SBPA 3GREA 3JROA 4D0KA 5FKTA 4Z8LA 4PSXB 3KRWB 2OK6A 3C99A 5GSAA 2OVPB 2AH0A 5CXBA 2H3XA 3L4MD 5CXCB 4A2LA 4ERYA 4CZYA 5GXIA 1SQ9A 3C5MA 1JMXB 4J87A 5K19A 4XYHA 5EALA 3PXSD 4PNKB 4CY1A 3AL8A 4L1QD 2YMUA 3I7KA 2G99A 4J78A 2IWKA 3V9FA 5GMKn 5IT9g 4CI2A 4O45A 4FHLA 2H13A 3MZLA 1GG2B 4CY2A 3JPXA 4JSXC 4ZOYA 3SFZA 3NVXA 3OKYB 2I0TA 2CO0A 3UVOA 2PM7B 3F3GA 2XU7A 3OTTA 2HKRA 1P22A 5HYNB 2AGWA 2I3SA 3B7FA 2P9PC 1XIPA 4O1QD 5TF2A 1JMZB 4TZ4A 2MTAH 4CI1A 1SHYB 2AQ5A 3J81g 2CN3A 4LGNA 3RFGA 4X61B 1XHMA 2QXVA 3F3FA 2CE8A 2H9LA 2YNNA 4A7JA 4KFMB 3BG1A 1YFQA 4H5JA 2B5MA 5AFU3 2OK4A 3W15A 5HE2B 2Z2NA 4GMBA 3PXWD 5FQDA 3SMRA 3EG6A 4L3GD 5GXHA 4HDJA 2CNXA 5I5IA 3EU7A 3HFQA 2IUPA 2BBKH 3OL2B 1XKSA 3I7NA 4GM8A 3SBQA 5TDHB 4N14A 4BH6A 1N6DA 3NVQA 2J57G 1MG2A 4FAVD 4A08B 2P9NC 4FA4D 4O9DA 2XL2A 3PVUB 3UVNA 5TEFA 4FWWA 4A2MA 3JRPA 4J77A 1L0QA 1PI6A 2XYIA 5IGOA 5FKSA 3SLED 5HE1B 2UZXB 5FLXg 1GP2B 4MK0B 2I0SA 3BWSA 3AL9A 3EI4B 3DXKC 2Q7QA 3V5WB 1R5MA 4A11A 2YNPA 4GQ2P 4D6VA 3ORVD 4BUJC 3PSLA 4CZVA 4A11B 2CN2A 2YNOA 1GXRA 5I5JA 2IURA 2YB8B 3DXMC 4LG8A 2H6NA 5K1CC 5I5MA 2IAAA 3SWSD 2AGZA 4CI3A 4XEIC 3OKWA 4A08A 1NEXB 3EI3A 3PXTD 1GOTB 1K8KC 4A09A 2GC7A 2P9KC 2OIZA 2H9PA 3F3PA 3ODTA 2P9UC 4E5ZA 5HE3B 3BG0A 2OVRB 1SQJA 2P9LC 3RN1D 3K26A 3VH0A 3I7LA 3JZNA 4E5ZB 1TBGA 3JZHA 4O3TB 2HJ4A 3RFHA 3VA6A 4I79A 3EI4A 4ERZA 2H47A 2YBAA 5EAPA 3UVMA 2TRCB 4BL0A 3MMYA 3PE7A 4GM3A 4Y7RA 5SXMA 4G56B 3IIWA 4GGDA 4GGAA 4U1EI 4QT8A 4JSNC 5IGQA 2PBIB 5EMLB 3ULEC 3RLMD 2Z2OA 3EI3B 4EWRA 5C2WB 3E0CA 3PVWB 3IJCA 5HQGA 2OVQB 2XL3A 4JD2C 1JOFA 1RI6A 4IA9A 3SBRA 4FA5D 5EM2B 4K3JB 4H5IA 2OJYA 4QRJA 5FXYA 2B4EA 3GFCA 3OW8A 4O3UB 4JSPC 4XYIA 2HYEA 4JSVC 5H1MA 5HE0B 3ZWLB 4PBZA 1NR0A 4A0BB 4ES0A 1PEVA 4UI9R 1B9XA 4QL1A 3UR4A 4GQBB 3V7DB 4X60B 1U4CA 3SN6B 2W18A 2CO0C 3AH8B 3SJLD 2J56H 3CFSB 3UVKA 4J73A 4CI8A 4QQEA 2H6QA 2HJBA 5EMKB 3UKUC 4A09B 5IC7A 4R7AB 2HKMA 5EAMA 4A0AB 4E54A 1PBYB 2UZYB 3RMZD 3IJ1A 4PSWB 5IJ8E 1N6EA 3RRMC 4A0BA 4CY5A 1JJUB 3A0FA 4PBYA 2H6KA 1QNIA 3SXTD 1S4UX 5FKQA 4J82A 3EI1B 3MKSB 2PM6B 5KDOB 2AGXA 2IUVA 3I8CA 3L4OD 3VGZA 4FA9D 4YVDA 2BCJB 5THAA 4X3EA 4L3HD 3UVLA 5FKRA 4ERQA 4J0WA 1B9YA 3I8EA 4E54B 3IJ0A 2H14A 1K32A 3EI1A 4OWRA 3P4FA 4JT6C 4J84A 2P9SC 3MXXA 5H14A 4GGCA 4LG9A 4JXMA 1PGUA 4J8GA 2H9MA 4J86A 2G9AA 3JAMg 4FA1D 3SHFA 4CY3A 4ZOXA 4Y5RD 2QC5A 3MKQA 5JWZA 3RN0D 4NSXA 2GNQA 3JB9L 3I7HA 5C2VB 1ERJA 2P9IC 2AGYA 5EM2A 3MZKA 2Z2PA 5CYKB 3DWLC 1OLZA 2AH1A 4ZOZA 4J81A 4CC9A 4ZOVA 5EMMB 4J79A 3EI2B 4ZN4A 1U2VC 3EWEA 1OMWB 3C75H 1MDAH 2O9KA 3SVWD 2H9NA 4PC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESG A;  2IWF A;  4CZX A;  5B4W A;  3I7P A;  4AEZ A;  2EBS A;  5CYK A;  4GM9 A;  2B5N A;  4K3I D;  3UKR C;  5AJA A;  3CFV A;  2HES X;  1TYQ C;  4IMM A;  3PSC B;  5EMJ B;  2IUQ A;  5FA5 B;  3KRX B;  4J8B A;  4J0X A;  3EI2 A;  4AOW A;  1VYH C;  3IIY A;  3N0E A;  2H68 A;  3FM0 A;  4PXW A;  4FB1 D;  4FAN D;  5A2Q g;  3K27 A;  3U4Y A;  3AFC A;  3C9C A;  5EAR A;  4GZ8 A;  2HXC A;  3SCY A;  3RSE C;  3OKT A;  3NVN A;  5H17 A;  2B5L A;  5CXC A;  2AGL A;  3J80 g;  4X63 B;  3FRX A;  3IKO A;  5C9Z B;  2J55 H;  2I0R A;  4U7A A;  3AL8 B;  2PM9 B;  1MG3 A;  3OL2 A;  3I2N A;  3DSM A;  1A0R B;  3OKY A;  1N6F A;  1Q47 A;  2GC4 A;  3CIK B;  5AMS A;  3N0D A;  3DM0 A;  3I7O A;  4JT5 C;  4L9O A;  5TEE A;  4GQ1 A;  3JZG A;  5IJ7 E;  4A0A A;  2PM9 A;  3I89 A;  1FWX A;  3EMH A;  2CE9 A;  3FGB A;  4OZU A;  2I3T A;  5CXB B;  3SBP A;  3GRE A;  3JRO A;  4D0K A;  5FKT A;  4Z8L A;  4PSX B;  3KRW B;  2OK6 A;  3C99 A;  5GSA A;  2OVP B;  2AH0 A;  5CXB A;  2H3X A;  3L4M D;  5CXC B;  4A2L A;  4ERY A;  4CZY A;  5GXI A;  1SQ9 A;  3C5M A;  1JMX B;  4J87 A;  5K19 A;  4XYH A;  5EAL A;  3PXS D;  4PNK B;  4CY1 A;  3AL8 A;  4L1Q D;  2YMU A;  3I7K A;  2G99 A;  4J78 A;  2IWK A;  3V9F A;  5GMK n;  5IT9 g;  4CI2 A;  4O45 A;  4FHL A;  2H13 A;  3MZL A;  1GG2 B;  4CY2 A;  3JPX A;  4JSX C;  4ZOY A;  3SFZ A;  3NVX A;  3OKY B;  2I0T A;  2CO0 A;  3UVO A;  2PM7 B;  3F3G A;  2XU7 A;  3OTT A;  2HKR A;  1P22 A;  5HYN B;  2AGW A;  2I3S A;  3B7F A;  2P9P C;  1XIP A;  4O1Q D;  5TF2 A;  1JMZ B;  4TZ4 A;  2MTA H;  4CI1 A;  1SHY B;  2AQ5 A;  3J81 g;  2CN3 A;  4LGN A;  3RFG A;  4X61 B;  1XHM A;  2QXV A;  3F3F A;  2CE8 A;  2H9L A;  2YNN A;  4A7J A;  4KFM B;  3BG1 A;  1YFQ A;  4H5J A;  2B5M A;  5AFU 3;  2OK4 A;  3W15 A;  5HE2 B;  2Z2N A;  4GMB A;  3PXW D;  5FQD A;  3SMR A;  3EG6 A;  4L3G D;  5GXH A;  4HDJ A;  2CNX A;  5I5I A;  3EU7 A;  3HFQ A;  2IUP A;  2BBK H;  3OL2 B;  1XKS A;  3I7N A;  4GM8 A;  3SBQ A;  5TDH B;  4N14 A;  4BH6 A;  1N6D A;  3NVQ A;  2J57 G;  1MG2 A;  4FAV D;  4A08 B;  2P9N C;  4FA4 D;  4O9D A;  2XL2 A;  3PVU B;  3UVN A;  5TEF A;  4FWW A;  4A2M A;  3JRP A;  4J77 A;  1L0Q A;  1PI6 A;  2XYI A;  5IGO A;  5FKS A;  3SLE D;  5HE1 B;  2UZX B;  5FLX g;  1GP2 B;  4MK0 B;  2I0S A;  3BWS A;  3AL9 A;  3EI4 B;  3DXK C;  2Q7Q A;  3V5W B;  1R5M A;  4A11 A;  2YNP A;  4GQ2 P;  4D6V A;  3ORV D;  4BUJ C;  3PSL A;  4CZV A;  4A11 B;  2CN2 A;  2YNO A;  1GXR A;  5I5J A;  2IUR A;  2YB8 B;  3DXM C;  4LG8 A;  2H6N A;  5K1C C;  5I5M A;  2IAA A;  3SWS D;  2AGZ A;  4CI3 A;  4XEI C;  3OKW A;  4A08 A;  1NEX B;  3EI3 A;  3PXT D;  1GOT B;  1K8K C;  4A09 A;  2GC7 A;  2P9K C;  2OIZ A;  2H9P A;  3F3P A;  3ODT A;  2P9U C;  4E5Z A;  5HE3 B;  3BG0 A;  2OVR B;  1SQJ A;  2P9L C;  3RN1 D;  3K26 A;  3VH0 A;  3I7L A;  3JZN A;  4E5Z B;  1TBG A;  3JZH A;  4O3T B;  2HJ4 A;  3RFH A;  3VA6 A;  4I79 A;  3EI4 A;  4ERZ A;  2H47 A;  2YBA A;  5EAP A;  3UVM A;  2TRC B;  4BL0 A;  3MMY A;  3PE7 A;  4GM3 A;  4Y7R A;  5SXM A;  4G56 B;  3IIW A;  4GGD A;  4GGA A;  4U1E I;  4QT8 A;  4JSN C;  5IGQ A;  2PBI B;  5EML B;  3ULE C;  3RLM D;  2Z2O A;  3EI3 B;  4EWR A;  5C2W B;  3E0C A;  3PVW B;  3IJC A;  5HQG A;  2OVQ B;  2XL3 A;  4JD2 C;  1JOF A;  1RI6 A;  4IA9 A;  3SBR A;  4FA5 D;  5EM2 B;  4K3J B;  4H5I A;  2OJY A;  4QRJ A;  5FXY A;  2B4E A;  3GFC A;  3OW8 A;  4O3U B;  4JSP C;  4XYI A;  2HYE A;  4JSV C;  5H1M A;  5HE0 B;  3ZWL B;  4PBZ A;  1NR0 A;  4A0B B;  4ES0 A;  1PEV A;  4UI9 R;  1B9X A;  4QL1 A;  3UR4 A;  4GQB B;  3V7D B;  4X60 B;  1U4C A;  3SN6 B;  2W18 A;  2CO0 C;  3AH8 B;  3SJL D;  2J56 H;  3CFS B;  3UVK A;  4J73 A;  4CI8 A;  4QQE A;  2H6Q A;  2HJB A;  5EMK B;  3UKU C;  4A09 B;  5IC7 A;  4R7A B;  2HKM A;  5EAM A;  4A0A B;  4E54 A;  1PBY B;  2UZY B;  3RMZ D;  3IJ1 A;  4PSW B;  5IJ8 E;  1N6E A;  3RRM C;  4A0B A;  4CY5 A;  1JJU B;  3A0F A;  4PBY A;  2H6K A;  1QNI A;  3SXT D;  1S4U X;  5FKQ A;  4J82 A;  3EI1 B;  3MKS B;  2PM6 B;  5KDO B;  2AGX A;  2IUV A;  3I8C A;  3L4O D;  3VGZ A;  4FA9 D;  4YVD A;  2BCJ B;  5THA A;  4X3E A;  4L3H D;  3UVL A;  5FKR A;  4ERQ A;  4J0W A;  1B9Y A;  3I8E A;  4E54 B;  3IJ0 A;  2H14 A;  1K32 A;  3EI1 A;  4OWR A;  3P4F A;  4JT6 C;  4J84 A;  2P9S C;  3MXX A;  5H14 A;  4GGC A;  4LG9 A;  4JXM A;  1PGU A;  4J8G A;  2H9M A;  4J86 A;  2G9A A;  3JAM g;  4FA1 D;  3SHF A;  4CY3 A;  4ZOX A;  4Y5R D;  2QC5 A;  3MKQ A;  5JWZ A;  3RN0 D;  4NSX A;  2GNQ A;  3JB9 L;  3I7H A;  5C2V B;  1ERJ A;  2P9I C;  2AGY A;  5EM2 A;  3MZK A;  2Z2P A;  5CYK B;  3DWL C;  1OLZ A;  2AH1 A;  4ZOZ A;  4J81 A;  4CC9 A;  4ZOV A;  5EMM B;  4J79 A;  3EI2 B;  4ZN4 A;  1U2V C;  3EWE A;  1OMW B;  3C75 H;  1MDA H;  2O9K A;  3SVW D;  2H9N A;  4PC0 A; 
#chains in the Genus database with same CATH topology
 4ESG A;  2IWF A;  4CZX A;  3T3P A;  5B4W A;  3I7P A;  4AEZ A;  4DNV A;  2EBS A;  2VDQ A;  1BPO A;  5CYK A;  2EID A;  4GM9 A;  2B5N A;  4K3I D;  3UKR C;  3ZDZ A;  5M5T A;  5FFG A;  5AJA A;  3CFV A;  2HES X;  1TYQ C;  4IMM A;  3PSC B;  5EMJ B;  2VDP A;  2IUQ A;  3IUN A;  5FA5 B;  3KRX B;  4J8B A;  4J0X A;  3EI2 A;  4AOW A;  1UOQ A;  1VYH C;  1U8C A;  3IIY A;  3N0E A;  2H68 A;  3FM0 A;  4PXW A;  4FB1 D;  4FAN D;  2XDW A;  1O6G A;  5A2Q g;  4O2W A;  3K71 A;  3K27 A;  3IUR A;  3U4Y A;  3AFC A;  3C9C A;  5EAR A;  4GZ8 A;  2HXC A;  3SCY A;  3RSE C;  3OKT A;  3NVN A;  5H17 A;  2B5L A;  5CXC A;  4BP9 A;  2AGL A;  1GOF A;  3J80 g;  4X63 B;  3FRX A;  3IKO A;  4MMY A;  3EQ7 A;  5C9Z B;  2J55 H;  2I0R A;  4U7A A;  3AL8 B;  2PM9 B;  1MG3 A;  3OL2 A;  3I2N A;  3DSM A;  1A0R B;  3OKY A;  1N6F A;  1Q47 A;  2GC4 A;  3VI4 A;  3EQ8 A;  3CIK B;  5AMS A;  3N0D A;  3DM0 A;  3I7O A;  4JT5 C;  4L9O A;  5TEE A;  2WQ8 A;  3JZG A;  4GQ1 A;  4NAA A;  5IJ7 E;  4DNW A;  3IUM A;  4A0A A;  1H2Y A;  2PM9 A;  3IVM A;  3I89 A;  1FWX A;  3EMH A;  4Z7O A;  2CE9 A;  3FGB A;  1TYE A;  4JHP C;  4OZU A;  2I3T A;  5CXB B;  3SBP A;  3GRE A;  3JRO A;  4D0K A;  5FKT A;  2EIC A;  4Z8L A;  3KRW B;  2OK6 A;  4PSX B;  1C9L A;  3C99 A;  4G1M A;  2OVP B;  5GSA A;  2AH0 A;  5CXB A;  2H3X A;  1H2Z A;  3L4M D;  5CXC B;  5HDB A;  4A2L A;  4CZY A;  4ERY A;  5GXI A;  1SQ9 A;  3C5M A;  1JMX B;  4J87 A;  5K19 A;  4XYH A;  1GOG A;  1JTD B;  5EAL A;  4UM8 A;  3PXS D;  4PNK B;  4AMZ A;  4CY1 A;  3AL8 A;  4L1Q D;  2YMU A;  3I7K A;  2G99 A;  4J78 A;  5M5V A;  3ZE2 A;  3V9F A;  5IT9 g;  5GMK n;  4CI2 A;  4O45 A;  4FHL A;  5M5S A;  2H13 A;  1VZ2 A;  3MZL A;  3NID A;  1GG2 B;  4O02 A;  4CY2 A;  3JPX A;  4JSX C;  4ZOY A;  3SFZ A;  3NVX A;  3OKY B;  2I0T A;  2CO0 A;  3UVO A;  1QFS A;  2PM7 B;  3F3G A;  2XU7 A;  3OTT A;  2HKR A;  1P22 A;  5HYN B;  2AGW A;  2VC2 A;  2EIE A;  2I3S A;  3B7F A;  3MVD K;  1YR2 A;  2P9P C;  1XIP A;  4O1Q D;  5TF2 A;  1JMZ B;  4TZ4 A;  2MTA H;  4CI1 A;  3ZE0 A;  4AN1 A;  1SHY B;  2AQ5 A;  3J81 g;  1A12 A;  2CN3 A;  4LGN A;  2VDN A;  3RFG A;  4X61 B;  1XHM A;  2QXV A;  3F3F A;  2CE8 A;  2H9L A;  2YNN A;  4A7J A;  4KFM B;  3BG1 A;  1YFQ A;  3KCI A;  4H5J A;  2B5M A;  5AFU 3;  2OK4 A;  3W15 A;  1UOP A;  5HE2 B;  2Z2N A;  3K72 A;  4GMB A;  3PXW D;  3O4J A;  5FQD A;  3SMR A;  3EG6 A;  3MUN A;  3QI0 A;  4L3G D;  5GXH A;  4HDJ A;  2CNX A;  5I5I A;  3EU7 A;  3HFQ A;  2IUP A;  2BBK H;  3OL2 B;  1XKS A;  3I7N A;  4GM8 A;  1I2M B;  5E6R A;  1VE7 A;  3SBQ A;  5TDH B;  4N14 A;  4BH6 A;  1K3I A;  1N6D A;  2VDR A;  4PC0 A;  1VZ3 A;  3NVQ A;  2J57 G;  2XZG A;  1MG2 A;  4FAV D;  4A08 B;  2JKX A;  2P9N C;  4FA4 D;  4MMX A;  3FCS A;  4O9D A;  2XL2 A;  3PVU B;  3UVN A;  5TEF A;  5M61 A;  4FWW A;  4Z7Q A;  4A2M A;  3EQ9 A;  3GC3 B;  3OF7 A;  3JRP A;  4J77 A;  1L0Q A;  1PI6 A;  2XYI A;  3ZE1 A;  5IGO A;  5FKS A;  3SLE D;  5HE1 B;  2UZX B;  5FLX g;  4UM9 A;  4BCB A;  1GP2 B;  4MK0 B;  1C9I A;  2I0S A;  4DNU A;  3BWS A;  3AL9 A;  3EI4 B;  3DXK C;  2Q7Q A;  3V5W B;  1R5M A;  1JV2 A;  4A11 A;  2YNP A;  4GQ2 P;  4D6V A;  3ORV D;  4BUJ C;  2VZ1 A;  1M1X A;  3PSL A;  5C86 A;  4CZV A;  4A11 B;  2EIB A;  2CN2 A;  2YNO A;  1GXR A;  5FFO A;  2IUR A;  3DXM C;  1T2X A;  2YB8 B;  1UOO A;  4LG8 A;  2H6N A;  5K1C C;  5I5M A;  2IAA A;  3SWS D;  2AGZ A;  2BKL A;  1GOH A;  4CI3 A;  4XEI C;  3OKW A;  4A08 A;  1NEX B;  3EI3 A;  5E6S A;  3PXT D;  1GOT B;  1K8K C;  4A09 A;  2GC7 A;  3K6S A;  2P9K C;  2OIZ A;  2H9P A;  1H2X A;  3F3P A;  3ODT A;  2P9U C;  4E5Z A;  5HE3 B;  3BG0 A;  2OVR B;  1SQJ A;  2P9L C;  3RN1 D;  3K26 A;  4NC4 A;  3VH0 A;  3I7L A;  3JZN A;  4E5Z B;  1TBG A;  3JZH A;  4O3T B;  3MUO A;  2HJ4 A;  3RFH A;  4MMZ A;  3VI3 A;  3VA6 A;  4I79 A;  3EI4 A;  4ERZ A;  4NEN A;  1E8M A;  2H47 A;  2YBA A;  5EAP A;  3O4H A;  3UVM A;  2TRC B;  4BL0 A;  3MMY A;  3PE7 A;  4GM3 A;  4Y7R A;  5SXM A;  4RE6 A;  3FCU A;  5I5J A;  4G56 B;  3IIW A;  4GGD A;  3T3M A;  3V4V A;  3NIG A;  2VDK A;  4GGA A;  4U1E I;  4IRZ A;  4BCD A;  4QT8 A;  4JSN C;  5IGQ A;  2PBI B;  5EML B;  3ULE C;  3RLM D;  2Z2O A;  3EI3 B;  4EWR A;  5C2W B;  3DDU A;  3E0C A;  3IJC A;  2QZP A;  3PVW B;  3NIF A;  5HQG A;  2OVQ B;  2XL3 A;  4JD2 C;  1JOF A;  1RI6 A;  4IA9 A;  3SBR A;  4Z7N A;  4FA5 D;  5EM2 B;  4WJK A;  4K3J B;  4H5I A;  2OJY A;  4QRJ A;  3V4P A;  5FXY A;  2B4E A;  1UTC A;  3GFC A;  3OW8 A;  4JSP C;  4O3U B;  4XYI A;  2HYE A;  4JSV C;  5H1M A;  4L1M A;  5HE0 B;  3ZWL B;  2HU8 A;  3IUQ A;  4PBZ A;  1NR0 A;  2XE4 A;  4A0B B;  4ES0 A;  4RE5 A;  1PEV A;  4UI9 R;  1B9X A;  4QL1 A;  4BCC A;  3UR4 A;  4GQB B;  3V7D B;  4X60 B;  1U4C A;  3SN6 B;  2W18 A;  5M5R A;  2CO0 C;  3AH8 B;  3SJL D;  3ZDX A;  2J56 H;  3O4G A;  3CFS B;  4AN0 A;  3UVK A;  4J73 A;  4CI8 A;  4QQE A;  2H6Q A;  2HJB A;  4D9S A;  1VE6 A;  5EMK B;  5C92 A;  3UKU C;  4A09 B;  5IC7 A;  4R7A B;  4WK2 A;  2HKM A;  5EAM A;  4A0A B;  4E54 A;  1PBY B;  2UZY B;  2VDO A;  3RMZ D;  3IJ1 A;  4PSW B;  5IJ8 E;  1N6E A;  3RRM C;  4A0B A;  4CY5 A;  1JJU B;  3A0F A;  3IUJ A;  4PBY A;  4WK0 A;  2H6K A;  4AMY A;  1QNI A;  3SXT D;  1S4U X;  2HU5 A;  5FKQ A;  4J82 A;  3EI1 B;  3MKS B;  1L5G A;  2PM6 B;  5KDO B;  2AGX A;  2IUV A;  3I8C A;  4BP8 A;  3L4O D;  3VGZ A;  4FA9 D;  4YVD A;  2BCJ B;  5THA A;  4X3E A;  4L3H D;  4JHN A;  5FKR A;  3UVL A;  4J0W A;  1B9Y A;  4ERQ A;  3I8E A;  4E54 B;  4NBM A;  3IJ0 A;  2H14 A;  1K32 A;  3EI1 A;  3IJE A;  4QAM A;  5E6U A;  4OWR A;  3P4F A;  4JT6 C;  4J84 A;  2P9S C;  2QR5 A;  3MXX A;  5H14 A;  4GGC A;  4LG9 A;  4JXM A;  1PGU A;  3QHY B;  2VDM A;  2VDL A;  4J8G A;  2H9M A;  4AX4 A;  4J86 A;  2G9A A;  3JAM g;  3O4I A;  1E8N A;  3ZDY A;  4FA1 D;  1O6F A;  3SHF A;  4CY3 A;  4ZOX A;  2VZ3 A;  5M5U A;  4Y5R D;  2QC5 A;  3MKQ A;  4G55 A;  5JWZ A;  3RN0 D;  4NSX A;  2GNQ A;  3JB9 L;  3I7H A;  4G1E A;  5C2V B;  1ERJ A;  2P9I C;  2AGY A;  5EM2 A;  3MZK A;  2Z2P A;  5CYK B;  3DWL C;  1OLZ A;  2AH1 A;  3IUL A;  4ZOZ A;  1E5T A;  4J81 A;  1H2W A;  2HU7 A;  4ZOV A;  4WK4 A;  1QFM A;  3GD1 I;  4J79 A;  4CC9 A;  4ZN4 A;  5EMM B;  3EI2 B;  1U2V C;  3EWE A;  1OMW B;  3C75 H;  1MDA H;  2O9K A;  3SVW D;  2H9N A;  2IWK A; 
#chains in the Genus database with same CATH homology
 4ESG A;  2IWF A;  4CZX A;  5B4W A;  3I7P A;  4AEZ A;  2EBS A;  5CYK A;  4GM9 A;  2B5N A;  4K3I D;  3UKR C;  5AJA A;  3CFV A;  2HES X;  1TYQ C;  4IMM A;  3PSC B;  5EMJ B;  2IUQ A;  5FA5 B;  3KRX B;  4J8B A;  4J0X A;  3EI2 A;  4AOW A;  1VYH C;  3IIY A;  3N0E A;  2H68 A;  3FM0 A;  4PXW A;  4FB1 D;  4FAN D;  5A2Q g;  3K27 A;  3U4Y A;  3AFC A;  3C9C A;  5EAR A;  4GZ8 A;  2HXC A;  3SCY A;  3RSE C;  3OKT A;  3NVN A;  5H17 A;  2B5L A;  5CXC A;  2AGL A;  3J80 g;  4X63 B;  3FRX A;  3IKO A;  5C9Z B;  2J55 H;  2I0R A;  4U7A A;  3AL8 B;  2PM9 B;  1MG3 A;  3OL2 A;  3I2N A;  3DSM A;  1A0R B;  3OKY A;  1N6F A;  1Q47 A;  2GC4 A;  3CIK B;  5AMS A;  3N0D A;  3DM0 A;  3I7O A;  4JT5 C;  4L9O A;  5TEE A;  4GQ1 A;  3JZG A;  5IJ7 E;  4A0A A;  2PM9 A;  3I89 A;  1FWX A;  3EMH A;  2CE9 A;  3FGB A;  4OZU A;  2I3T A;  5CXB B;  3SBP A;  3GRE A;  3JRO A;  4D0K A;  5FKT A;  4Z8L A;  4PSX B;  3KRW B;  2OK6 A;  3C99 A;  5GSA A;  2OVP B;  2AH0 A;  5CXB A;  2H3X A;  3L4M D;  5CXC B;  4A2L A;  4ERY A;  4CZY A;  5GXI A;  1SQ9 A;  3C5M A;  1JMX B;  4J87 A;  5K19 A;  4XYH A;  5EAL A;  3PXS D;  4PNK B;  4CY1 A;  3AL8 A;  4L1Q D;  2YMU A;  3I7K A;  2G99 A;  4J78 A;  2IWK A;  3V9F A;  5GMK n;  5IT9 g;  4CI2 A;  4O45 A;  4FHL A;  2H13 A;  3MZL A;  1GG2 B;  4CY2 A;  3JPX A;  4JSX C;  4ZOY A;  3SFZ A;  3NVX A;  3OKY B;  2I0T A;  2CO0 A;  3UVO A;  2PM7 B;  3F3G A;  2XU7 A;  3OTT A;  2HKR A;  1P22 A;  5HYN B;  2AGW A;  2I3S A;  3B7F A;  2P9P C;  1XIP A;  4O1Q D;  5TF2 A;  1JMZ B;  4TZ4 A;  2MTA H;  4CI1 A;  1SHY B;  2AQ5 A;  3J81 g;  2CN3 A;  4LGN A;  3RFG A;  4X61 B;  1XHM A;  2QXV A;  3F3F A;  2CE8 A;  2H9L A;  2YNN A;  4A7J A;  4KFM B;  3BG1 A;  1YFQ A;  4H5J A;  2B5M A;  5AFU 3;  2OK4 A;  3W15 A;  5HE2 B;  2Z2N A;  4GMB A;  3PXW D;  5FQD A;  3SMR A;  3EG6 A;  4L3G D;  5GXH A;  4HDJ A;  2CNX A;  5I5I A;  3EU7 A;  3HFQ A;  2IUP A;  2BBK H;  3OL2 B;  1XKS A;  3I7N A;  4GM8 A;  3SBQ A;  5TDH B;  4N14 A;  4BH6 A;  1N6D A;  3NVQ A;  2J57 G;  1MG2 A;  4FAV D;  4A08 B;  2P9N C;  4FA4 D;  4O9D A;  2XL2 A;  3PVU B;  3UVN A;  5TEF A;  4FWW A;  4A2M A;  3JRP A;  4J77 A;  1L0Q A;  1PI6 A;  2XYI A;  5IGO A;  5FKS A;  3SLE D;  5HE1 B;  2UZX B;  5FLX g;  1GP2 B;  4MK0 B;  2I0S A;  3BWS A;  3AL9 A;  3EI4 B;  3DXK C;  2Q7Q A;  3V5W B;  1R5M A;  4A11 A;  2YNP A;  4GQ2 P;  4D6V A;  3ORV D;  4BUJ C;  3PSL A;  4CZV A;  4A11 B;  2CN2 A;  2YNO A;  1GXR A;  5I5J A;  2IUR A;  2YB8 B;  3DXM C;  4LG8 A;  2H6N A;  5K1C C;  5I5M A;  2IAA A;  3SWS D;  2AGZ A;  4CI3 A;  4XEI C;  3OKW A;  4A08 A;  1NEX B;  3EI3 A;  3PXT D;  1GOT B;  1K8K C;  4A09 A;  2GC7 A;  2P9K C;  2OIZ A;  2H9P A;  3F3P A;  3ODT A;  2P9U C;  4E5Z A;  5HE3 B;  3BG0 A;  2OVR B;  1SQJ A;  2P9L C;  3RN1 D;  3K26 A;  3VH0 A;  3I7L A;  3JZN A;  4E5Z B;  1TBG A;  3JZH A;  4O3T B;  2HJ4 A;  3RFH A;  3VA6 A;  4I79 A;  3EI4 A;  4ERZ A;  2H47 A;  2YBA A;  5EAP A;  3UVM A;  2TRC B;  4BL0 A;  3MMY A;  3PE7 A;  4GM3 A;  4Y7R A;  5SXM A;  4G56 B;  3IIW A;  4GGD A;  4GGA A;  4U1E I;  4QT8 A;  4JSN C;  5IGQ A;  2PBI B;  5EML B;  3ULE C;  3RLM D;  2Z2O A;  3EI3 B;  4EWR A;  5C2W B;  3E0C A;  3PVW B;  3IJC A;  5HQG A;  2OVQ B;  2XL3 A;  4JD2 C;  1JOF A;  1RI6 A;  4IA9 A;  3SBR A;  4FA5 D;  5EM2 B;  4K3J B;  4H5I A;  2OJY A;  4QRJ A;  5FXY A;  2B4E A;  3GFC A;  3OW8 A;  4O3U B;  4JSP C;  4XYI A;  2HYE A;  4JSV C;  5H1M A;  5HE0 B;  3ZWL B;  4PBZ A;  1NR0 A;  4A0B B;  4ES0 A;  1PEV A;  4UI9 R;  1B9X A;  4QL1 A;  3UR4 A;  4GQB B;  3V7D B;  4X60 B;  1U4C A;  3SN6 B;  2W18 A;  2CO0 C;  3AH8 B;  3SJL D;  2J56 H;  3CFS B;  3UVK A;  4J73 A;  4CI8 A;  4QQE A;  2H6Q A;  2HJB A;  5EMK B;  3UKU C;  4A09 B;  5IC7 A;  4R7A B;  2HKM A;  5EAM A;  4A0A B;  4E54 A;  1PBY B;  2UZY B;  3RMZ D;  3IJ1 A;  4PSW B;  5IJ8 E;  1N6E A;  3RRM C;  4A0B A;  4CY5 A;  1JJU B;  3A0F A;  4PBY A;  2H6K A;  1QNI A;  3SXT D;  1S4U X;  5FKQ A;  4J82 A;  3EI1 B;  3MKS B;  2PM6 B;  5KDO B;  2AGX A;  2IUV A;  3I8C A;  3L4O D;  3VGZ A;  4FA9 D;  4YVD A;  2BCJ B;  5THA A;  4X3E A;  4L3H D;  3UVL A;  5FKR A;  4ERQ A;  4J0W A;  1B9Y A;  3I8E A;  4E54 B;  3IJ0 A;  2H14 A;  1K32 A;  3EI1 A;  4OWR A;  3P4F A;  4JT6 C;  4J84 A;  2P9S C;  3MXX A;  5H14 A;  4GGC A;  4LG9 A;  4JXM A;  1PGU A;  4J8G A;  2H9M A;  4J86 A;  2G9A A;  3JAM g;  4FA1 D;  3SHF A;  4CY3 A;  4ZOX A;  4Y5R D;  2QC5 A;  3MKQ A;  5JWZ A;  3RN0 D;  4NSX A;  2GNQ A;  3JB9 L;  3I7H A;  5C2V B;  1ERJ A;  2P9I C;  2AGY A;  5EM2 A;  3MZK A;  2Z2P A;  5CYK B;  3DWL C;  1OLZ A;  2AH1 A;  4ZOZ A;  4J81 A;  4CC9 A;  4ZOV A;  5EMM B;  4J79 A;  3EI2 B;  4ZN4 A;  1U2V C;  3EWE A;  1OMW B;  3C75 H;  1MDA H;  2O9K A;  3SVW D;  2H9N A;  4PC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...