1MG2A

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHAAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase, heavy chain
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 94
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1mg2A00
3I7LA 3FRXA 3EMHA 3MXXA 4BH6A 4FB1D 3IJ1A 4CY3A 3I7KA 5FXYA 3DSMA 2BBKH 4O1QD 1Q47A 3I2NA 4PBZA 4O9DA 4ERZA 3IJCA 4A09B 4CI8A 3SVWD 4JXMA 2J57G 2PBIB 2QC5A 4R7AB 3ZWLB 2W18A 2Z2NA 4BL0A 4CI2A 5GSAA 5IT9g 5K19A 1XIPA 2O9KA 4NSXA 4GM9A 1L0QA 1VYHC 1PGUA 4D0KA 4XEIC 4ESGA 5IJ7E 4J86A 4A7JA 1K8KC 2OJYA 3OL2A 2AGXA 2YB8B 5TEEA 5SXMA 1NEXB 2AGZA 4E54B 1PEVA 5EAPA 4A0BA 3EU7A 3EI2B 4A08A 1TYQC 3V5WB 3ORVD 4N14A 2TRCB 3UVKA 5FLXg 2IUVA 2I3SA 3KRWB 4X60B 3AL8A 5I5IA 4PNKB 4U1EI 4E5ZA 3EG6A 1N6DA 5JWZA 4JSPC 3IJ0A 4ZN4A 3UVLA 3EI3B 3N0EA 2H68A 5TF2A 3RRMC 3PSCB 3GREA 2H13A 3NVNA 1GOTB 3SHFA 2GNQA 2H9LA 3C5MA 3CFSB 2J55H 5EAMA 3K27A 4A11B 4D6VA 4PSXB 3I8EA 2CNXA 2PM6B 4G56B 4K3ID 4AOWA 4BUJC 4CZYA 4LG9A 4A0AB 2Z2PA 3RLMD 4J81A 3N0DA 3U4YA 3SXTD 3FM0A 1MDAH 2P9SC 3VH0A 3EI1B 5CXBA 5GXHA 5FKSA 2YMUA 4H5IA 5C9ZB 4Y5RD 2OIZA 4ERYA 2G99A 4ERQA 3V9FA 3FGBA 4X3EA 4A09A 2OK6A 3CFVA 1MG3A 4IA9A 4J8BA 4GGDA 2H6NA 4J84A 3C99A 4UI9R 3I89A 4L3HD 2PM7B 2I0SA 1JOFA 4L3GD 4A2MA 3SLED 5IGQA 3RN1D 5EMKB 4ZOYA 3SBPA 5TDHB 3L4MD 2HJBA 5B4WA 3MZLA 2YNPA 3PVUB 3I8CA 3JAMg 3I7HA 2PM9B 3KRXB 4J79A 2YBAA 3W15A 2OVPB 2CE8A 5C2VB 1N6FA 3OKYB 4JD2C 2HESX 2XL3A 2P9NC 2CN3A 3PXWD 4JT5C 5I5JA 3MKSB 3EI3A 5AFU3 3NVXA 1QNIA 3OW8A 3I7OA 4A11A 1OLZA 5CYKB 4QL1A 5EM2B 2AH0A 2CE9A 2HKRA 1YFQA 3K26A 3DM0A 3JRPA 5H14A 3UR4A 4XYIA 1FWXA 5AJAA 4A0AA 1A0RB 4FAND 5HYNB 4GGAA 3PXTD 4CY1A 4FWWA 3EI1A 3DXKC 4H5JA 3SBRA 2H6QA 2H6KA 3SMRA 4CZXA 4CI3A 3BG0A 3SWSD 5IC7A 5EALA 5C2WB 5FKRA 4X61B 1ERJA 4MK0B 2P9KC 1RI6A 2IWFA 2P9PC 1TBGA 3C75H 3RSEC 3JB9L 3BWSA 4FA5D 4CY5A 3VGZA 2P9LC 5A2Qg 5FA5B 1JJUB 2OK4A 2PM9A 3PSLA 2AGWA 2AGYA 4PC0A 4QRJA 2Z2OA 4PXWA 4ZOZA 1B9YA 4GM8A 2H14A 3OKYA 1GXRA 4GGCA 4CI1A 3DWLC 4FA1D 3DXMC 1OMWB 3IIYA 3OTTA 4Z8LA 4JSNC 3AL8B 4X63B 4CC9A 5THAA 3IKOA 2AH1A 4JT6C 4J0XA 3HFQA 5HE1B 3SN6B 4FA4D 2G9AA 1U4CA 1SQ9A 4J77A 2H9NA 3UVOA 5AMSA 5FQDA 2GC7A 3EI4B 3SCYA 3UKRC 3RFHA 4Y7RA 2P9IC 4CY2A 4E54A 1U2VC 1PBYB 4J87A 4JSXC 2AQ5A 2B5LA 5CYKA 5EM2A 3OKTA 3EI2A 2UZYB 1GP2B 4O3TB 1R5MA 2CN2A 4GQ2P 4ZOXA 5FKQA 5HE3B 3UKUC 5FKTA 2H3XA 2J56H 4GQBB 4GM3A 5HE2B 3NVQA 4PBYA 3SBQA 2H9PA 4J73A 1SHYB 5EMJB 4L9OA 3B7FA 3E0CA 5EMLB 3UVNA 2I0RA 3L4OD 3OKWA 5GXIA 3JZNA 4FHLA 2B4EA 1XKSA 4J82A 3CIKB 2AGLA 5CXCB 3AH8B 3PE7A 3SJLD 3RN0D 3I7NA 3UVMA 1MG2A 1JMZB 3BG1A 2OVQB 3JROA 3PVWB 4L1QD 2HYEA 5K1CC 3J80g 2HJ4A 3EWEA 4O45A 3F3PA 3MKQA 4TZ4A 3V7DB 3A0FA 3P4FA 4GMBA 1XHMA 2BCJB 2XL2A 3JZGA 4K3JB 1P22A 2IUPA 2UZXB 4ES0A 2H47A 4QT8A 4J0WA 3VA6A 4OZUA 3RFGA 2B5NA 4PSWB 3OL2B 2I0TA 4GZ8A 3EI4A 1GG2B 1NR0A 2P9UC 3GFCA 2IURA 4A0BB 4EWRA 3SFZA 4LGNA 4KFMB 2YNOA 4A08B 2I3TA 3AL9A 5IGOA 5H17A 5TEFA 2HKMA 4HDJA 2GC4A 4QQEA 3AFCA 3F3FA 3JPXA 3MZKA 2MTAH 3ULEC 4CZVA 5I5MA 3ODTA 4J8GA 3C9CA 3MMYA 4E5ZB 4OWRA 2XYIA 1K32A 4O3UB 1B9XA 2B5MA 4YVDA 4XYHA 3PXSD 1N6EA 1S4UX 5HQGA 2CO0C 2Q7QA 5GMKn 2HXCA 4GQ1A 4J78A 3F3GA 5EARA 5HE0B 2H9MA 2IUQA 2OVRB 4ZOVA 1JMXB 4U7AA 3IIWA 3I7PA 4FA9D 4FAVD 2YNNA 5CXCA 1SQJA 4IMMA 2XU7A 2IWKA 3RMZD 3JZHA 5EMMB 3J81g 2QXVA 5H1MA 5KDOB 2CO0A 4I79A 4JSVC 1PI6A 4A2LA 2EBSA 2IAAA 5IJ8E 4AEZA 4LG8A 5CXBB
chains in the Genus database with same CATH superfamily
3I7LA 4Z7NA 1A12A 3EMHA 3FRXA 3MXXA 4BH6A 1C9LA 4FB1D 3IJ1A 4CY3A 3I7KA 5FXYA 3DSMA 2BBKH 4O1QD 1Q47A 3I2NA 4PBZA 4O9DA 4ERZA 3IJCA 4A09B 4CI8A 1L5GA 3SVWD 4JXMA 4MMXA 2J57G 2PBIB 2QC5A 4AMYA 4R7AB 3ZWLB 2W18A 2Z2NA 4BL0A 4CI2A 5GSAA 5IT9g 5K19A 3DDUA 1XIPA 2O9KA 4NSXA 5FFGA 4GM9A 3NIFA 1L0QA 1VYHC 1PGUA 4D0KA 5C92A 4XEIC 4ESGA 5IJ7E 4J86A 4A7JA 1K8KC 2OJYA 3OL2A 2AGXA 2YB8B 5TEEA 5SXMA 1NEXB 2AGZA 4E54B 1PEVA 5EAPA 4A0BA 1VE7A 3NIDA 2WQ8A 3EU7A 3EI2B 4A08A 1TYQC 1BPOA 1UTCA 3V5WB 3ORVD 3ZE0A 4N14A 2TRCB 3IURA 3UVKA 4BCBA 5FLXg 5M5UA 5C86A 2IUVA 4UM8A 2I3SA 3KRWB 4X60B 3AL8A 5I5IA 4PNKB 4U1EI 4E5ZA 3EG6A 1N6DA 5JWZA 4JSPC 3IJ0A 4ZN4A 4NC4A 3UVLA 3EI3B 3N0EA 4DNWA 2H68A 5TF2A 3RRMC 3IUMA 3PSCB 3O4GA 2XE4A 2VZ3A 3GREA 2H13A 3NVNA 1GOTB 3SHFA 2GNQA 2H9LA 3IUJA 3C5MA 2VDOA 2J55H 3CFSB 3K27A 5EAMA 5E6UA 1QFSA 4PSXB 3ZDYA 4A11B 3GC3B 3O4IA 3I8EA 3NIGA 2CNXA 2PM6B 4G56B 4K3ID 4AOWA 4BUJC 4CZYA 4LG9A 4A0AB 2Z2PA 3RLMD 4J81A 3N0DA 4WK2A 3U4YA 3SXTD 3FM0A 3IULA 1M1XA 1MDAH 2P9SC 4AN1A 3VH0A 2HU8A 3EI1B 5CXBA 5GXHA 3O4JA 5FKSA 2YMUA 4H5IA 4NENA 5C9ZB 1VZ3A 2OIZA 4Y5RD 5M61A 4ERYA 2G99A 5M5TA 4ERQA 3V9FA 3FGBA 4X3EA 2QR5A 1E8MA 2OK6A 3CFVA 4A09A 1MG3A 4IA9A 4J8BA 4GGDA 2H6NA 4J84A 3C99A 4UI9R 3I89A 3QHYB 1O6FA 4L3HD 2PM7B 2I0SA 1JOFA 2VDLA 4L3GD 5E6RA 4A2MA 3SLED 5IGQA 3RN1D 5EMKB 4ZOYA 3SBPA 5TDHB 3L4MD 2HJBA 5B4WA 3MZLA 2YNPA 3PVUB 3I8CA 3FCSA 3JAMg 3I7HA 4L1MA 2PM9B 3KRXB 4J79A 2YBAA 3W15A 2OVPB 2CE8A 3ZE2A 4RE6A 4G55A 5C2VB 1N6FA 3OKYB 1E5TA 4JD2C 2HESX 2VZ1A 2XL3A 1TYEA 2P9NC 2CN3A 4BCCA 3PXWD 4JT5C 1H2ZA 5I5JA 3MKSB 1K3IA 3EI3A 4G1MA 5AFU3 5M5RA 2EIDA 4MMZA 3NVXA 4WK4A 1QNIA 3OW8A 4NAAA 2JKXA 3MVDK 3KCIA 1O6GA 3I7OA 4A11A 1OLZA 4BP9A 1H2YA 5CYKB 4QL1A 5EM2B 2AH0A 2CE9A 3IUNA 2HKRA 3T3MA 1YFQA 3K26A 3DM0A 3JRPA 1UOOA 4QAMA 5H14A 3UR4A 1I2MB 4XYIA 1FWXA 5AJAA 4WK0A 4A0AA 1A0RB 1VE6A 2EIEA 4FAND 5HYNB 4GGAA 3PXTD 4CY1A 3O4HA 4FWWA 3EI1A 3DXKC 4O2WA 4H5JA 3SBRA 2H6QA 2H6KA 3SMRA 4CZXA 4CI3A 3BG0A 3SWSD 5IC7A 5EALA 5C2WB 5FKRA 3EQ7A 4O02A 4X61B 3ZDXA 4WJKA 1ERJA 4MK0B 2P9KC 1RI6A 2IWFA 2P9PC 1TBGA 2VDMA 3C75H 3RSEC 3JB9L 3BWSA 4FA5D 4CY5A 3VGZA 2P9LC 5A2Qg 3IJEA 3K72A 5FA5B 1JJUB 2OK4A 2PM9A 4RE5A 3MUOA 3PSLA 2AGWA 2AGYA 4PC0A 4QRJA 2Z2OA 4BP8A 4PXWA 4ZOZA 1B9YA 4GM8A 1YR2A 2H14A 2VDRA 3IUQA 3OKYA 1GXRA 2HU7A 4GGCA 1QFMA 4CI1A 3DWLC 1UOQA 4FA1D 2QZPA 3DXMC 1OMWB 3IIYA 3OTTA 4Z8LA 4JSNC 3AL8B 4X63B 4CC9A 5THAA 3IKOA 3MUNA 2VDQA 1UOPA 3OF7A 2AH1A 2VC2A 4JT6C 4J0XA 3HFQA 3EQ9A 4IRZA 5HE1B 3SN6B 4FA4D 2G9AA 1U4CA 3K71A 1SQ9A 4J77A 2H9NA 3ZDZA 3UVOA 5AMSA 5FQDA 2GC7A 3EI4B 3SCYA 3UKRC 3RFHA 4Y7RA 2P9IC 4CY2A 4E54A 1U2VC 1PBYB 4J87A 4JSXC 2AQ5A 2B5LA 5CYKA 5EM2A 3FCUA 3OKTA 3EI2A 2UZYB 1GP2B 4O3TB 1R5MA 2CN2A 2VDNA 4GQ2P 4ZOXA 3V4VA 5FKQA 5HE3B 5FFOA 3UKUC 5FKTA 2H3XA 4Z7QA 3EQ8A 2J56H 4GQBB 5HDBA 4GM3A 1GOFA 3NVQA 5HE2B 4PBYA 3SBQA 2H9PA 4J73A 1SHYB 4D9SA 5EMJB 4L9OA 3B7FA 3E0CA 5EMLB 3UVNA 2I0RA 3L4OD 3OKWA 5M5SA 5GXIA 3JZNA 4FHLA 4BCDA 2B4EA 1XKSA 4J82A 2XDWA 3CIKB 2AGLA 5CXCB 3AH8B 3PE7A 3SJLD 3RN0D 3I7NA 3UVMA 1JMZB 1MG2A 3BG1A 2OVQB 3JROA 3PVWB 4L1QD 2HYEA 5K1CC 3J80g 2HJ4A 3EWEA 4O45A 3F3PA 3MKQA 4TZ4A 3V7DB 3A0FA 2XZGA 3P4FA 4GMBA 1XHMA 2BCJB 4MMYA 2XL2A 4NBMA 4AN0A 3JZGA 4K3JB 4G1EA 1U8CA 2EIBA 1P22A 3IVMA 2IUPA 2UZXB 4ES0A 2H47A 4QT8A 5E6SA 4J0WA 4JHNA 3VA6A 4OZUA 3RFGA 2B5NA 2BKLA 4PSWB 4DNVA 3ZE1A 3OL2B 2I0TA 4GZ8A 2EICA 2HU5A 3EI4A 1GG2B 2VDKA 3V4PA 4JHPC 1NR0A 2P9UC 3GFCA 2IURA 3T3PA 4EWRA 4A0BB 3SFZA 4LGNA 4KFMB 2YNOA 4A08B 2I3TA 3K6SA 3AL9A 5IGOA 5H17A 5TEFA 2HKMA 4HDJA 2GC4A 4QQEA 3AFCA 3F3FA 3JPXA 3MZKA 2MTAH 3ULEC 4CZVA 3VI3A 3ODTA 5I5MA 4J8GA 3C9CA 3MMYA 2VDPA 4AX4A 1JTDB 4D6VA 4E5ZB 4OWRA 2XYIA 1K32A 4O3UB 1B9XA 2B5MA 4YVDA 5M5VA 4XYHA 3PXSD 1N6EA 3GD1I 1S4UX 5HQGA 2CO0C 4UM9A 4Z7OA 2Q7QA 5GMKn 2HXCA 4GQ1A 1H2WA 3F3GA 4J78A 5EARA 5HE0B 2H9MA 2IUQA 2OVRB 4ZOVA 1JMXB 1H2XA 3VI4A 3QI0A 1GOGA 4U7AA 4DNUA 3IIWA 3I7PA 4FA9D 4FAVD 2YNNA 5CXCA 1SQJA 4IMMA 2XU7A 2IWKA 3RMZD 3JZHA 1GOHA 1JV2A 5EMMB 3J81g 2QXVA 5H1MA 5KDOB 2CO0A 4I79A 1C9IA 1PI6A 4JSVC 4A2LA 1E8NA 1T2XA 2EBSA 4AMZA 2IAAA 1VZ2A 5IJ8E 4AEZA 4LG8A 5CXBB
chains in the Genus database with same CATH topology
3I7LA 3FRXA 3EMHA 3MXXA 4BH6A 4FB1D 3IJ1A 4CY3A 3I7KA 5FXYA 3DSMA 2BBKH 4O1QD 1Q47A 3I2NA 4PBZA 4O9DA 4ERZA 3IJCA 4A09B 4CI8A 3SVWD 4JXMA 2J57G 2PBIB 2QC5A 4R7AB 3ZWLB 2W18A 2Z2NA 4BL0A 4CI2A 5GSAA 5IT9g 5K19A 1XIPA 2O9KA 4NSXA 4GM9A 1L0QA 1VYHC 1PGUA 4D0KA 4XEIC 4ESGA 5IJ7E 4J86A 4A7JA 1K8KC 2OJYA 3OL2A 2AGXA 2YB8B 5TEEA 5SXMA 1NEXB 2AGZA 4E54B 1PEVA 5EAPA 4A0BA 3EU7A 3EI2B 4A08A 1TYQC 3V5WB 3ORVD 4N14A 2TRCB 3UVKA 5FLXg 2IUVA 2I3SA 3KRWB 4X60B 3AL8A 5I5IA 4PNKB 4U1EI 4E5ZA 3EG6A 1N6DA 5JWZA 4JSPC 3IJ0A 4ZN4A 3UVLA 3EI3B 3N0EA 2H68A 5TF2A 3RRMC 3PSCB 3GREA 2H13A 3NVNA 1GOTB 3SHFA 2GNQA 2H9LA 3C5MA 3CFSB 2J55H 5EAMA 3K27A 4A11B 4D6VA 4PSXB 3I8EA 2CNXA 2PM6B 4G56B 4K3ID 4AOWA 4BUJC 4CZYA 4LG9A 4A0AB 2Z2PA 3RLMD 4J81A 3N0DA 3U4YA 3SXTD 3FM0A 1MDAH 2P9SC 3VH0A 3EI1B 5CXBA 5GXHA 5FKSA 2YMUA 4H5IA 5C9ZB 4Y5RD 2OIZA 4ERYA 2G99A 4ERQA 3V9FA 3FGBA 4X3EA 4A09A 2OK6A 3CFVA 1MG3A 4IA9A 4J8BA 4GGDA 2H6NA 4J84A 3C99A 4UI9R 3I89A 4L3HD 2PM7B 2I0SA 1JOFA 4L3GD 4A2MA 3SLED 5IGQA 3RN1D 5EMKB 4ZOYA 3SBPA 5TDHB 3L4MD 2HJBA 5B4WA 3MZLA 2YNPA 3PVUB 3I8CA 3JAMg 3I7HA 2PM9B 3KRXB 4J79A 2YBAA 3W15A 2OVPB 2CE8A 5C2VB 1N6FA 3OKYB 4JD2C 2HESX 2XL3A 2P9NC 2CN3A 3PXWD 4JT5C 5I5JA 3MKSB 3EI3A 5AFU3 3NVXA 1QNIA 3OW8A 3I7OA 4A11A 1OLZA 5CYKB 4QL1A 5EM2B 2AH0A 2CE9A 2HKRA 1YFQA 3K26A 3DM0A 3JRPA 5H14A 3UR4A 4XYIA 1FWXA 5AJAA 4A0AA 1A0RB 4FAND 5HYNB 4GGAA 3PXTD 4CY1A 4FWWA 3EI1A 3DXKC 4H5JA 3SBRA 2H6QA 2H6KA 3SMRA 4CZXA 4CI3A 3BG0A 3SWSD 5IC7A 5EALA 5C2WB 5FKRA 4X61B 1ERJA 4MK0B 2P9KC 1RI6A 2IWFA 2P9PC 1TBGA 3C75H 3RSEC 3JB9L 3BWSA 4FA5D 4CY5A 3VGZA 2P9LC 5A2Qg 5FA5B 1JJUB 2OK4A 2PM9A 3PSLA 2AGWA 2AGYA 4PC0A 4QRJA 2Z2OA 4PXWA 4ZOZA 1B9YA 4GM8A 2H14A 3OKYA 1GXRA 4GGCA 4CI1A 3DWLC 4FA1D 3DXMC 1OMWB 3IIYA 3OTTA 4Z8LA 4JSNC 3AL8B 4X63B 4CC9A 5THAA 3IKOA 2AH1A 4JT6C 4J0XA 3HFQA 5HE1B 3SN6B 4FA4D 2G9AA 1U4CA 1SQ9A 4J77A 2H9NA 3UVOA 5AMSA 5FQDA 2GC7A 3EI4B 3SCYA 3UKRC 3RFHA 4Y7RA 2P9IC 4CY2A 4E54A 1U2VC 1PBYB 4J87A 4JSXC 2AQ5A 2B5LA 5CYKA 5EM2A 3OKTA 3EI2A 2UZYB 1GP2B 4O3TB 1R5MA 2CN2A 4GQ2P 4ZOXA 5FKQA 5HE3B 3UKUC 5FKTA 2H3XA 2J56H 4GQBB 4GM3A 5HE2B 3NVQA 4PBYA 3SBQA 2H9PA 4J73A 1SHYB 5EMJB 4L9OA 3B7FA 3E0CA 5EMLB 3UVNA 2I0RA 3L4OD 3OKWA 5GXIA 3JZNA 4FHLA 2B4EA 1XKSA 4J82A 3CIKB 2AGLA 5CXCB 3AH8B 3PE7A 3SJLD 3RN0D 3I7NA 3UVMA 1MG2A 1JMZB 3BG1A 2OVQB 3JROA 3PVWB 4L1QD 2HYEA 5K1CC 3J80g 2HJ4A 3EWEA 4O45A 3F3PA 3MKQA 4TZ4A 3V7DB 3A0FA 3P4FA 4GMBA 1XHMA 2BCJB 2XL2A 3JZGA 4K3JB 1P22A 2IUPA 2UZXB 4ES0A 2H47A 4QT8A 4J0WA 3VA6A 4OZUA 3RFGA 2B5NA 4PSWB 3OL2B 2I0TA 4GZ8A 3EI4A 1GG2B 1NR0A 2P9UC 3GFCA 2IURA 4A0BB 4EWRA 3SFZA 4LGNA 4KFMB 2YNOA 4A08B 2I3TA 3AL9A 5IGOA 5H17A 5TEFA 2HKMA 4HDJA 2GC4A 4QQEA 3AFCA 3F3FA 3JPXA 3MZKA 2MTAH 3ULEC 4CZVA 5I5MA 3ODTA 4J8GA 3C9CA 3MMYA 4E5ZB 4OWRA 2XYIA 1K32A 4O3UB 1B9XA 2B5MA 4YVDA 4XYHA 3PXSD 1N6EA 1S4UX 5HQGA 2CO0C 2Q7QA 5GMKn 2HXCA 4GQ1A 4J78A 3F3GA 5EARA 5HE0B 2H9MA 2IUQA 2OVRB 4ZOVA 1JMXB 4U7AA 3IIWA 3I7PA 4FA9D 4FAVD 2YNNA 5CXCA 1SQJA 4IMMA 2XU7A 2IWKA 3RMZD 3JZHA 5EMMB 3J81g 2QXVA 5H1MA 5KDOB 2CO0A 4I79A 4JSVC 1PI6A 4A2LA 2EBSA 2IAAA 5IJ8E 4AEZA 4LG8A 5CXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7L A;  3FRX A;  3EMH A;  3MXX A;  4BH6 A;  4FB1 D;  3IJ1 A;  4CY3 A;  3I7K A;  5FXY A;  3DSM A;  2BBK H;  4O1Q D;  1Q47 A;  3I2N A;  4PBZ A;  4O9D A;  4ERZ A;  3IJC A;  4A09 B;  4CI8 A;  3SVW D;  4JXM A;  2J57 G;  2PBI B;  2QC5 A;  4R7A B;  3ZWL B;  2W18 A;  2Z2N A;  4BL0 A;  4CI2 A;  5GSA A;  5IT9 g;  5K19 A;  1XIP A;  2O9K A;  4NSX A;  4GM9 A;  1L0Q A;  1VYH C;  1PGU A;  4D0K A;  4XEI C;  4ESG A;  5IJ7 E;  4J86 A;  4A7J A;  1K8K C;  2OJY A;  3OL2 A;  2AGX A;  2YB8 B;  5TEE A;  5SXM A;  1NEX B;  2AGZ A;  4E54 B;  1PEV A;  5EAP A;  4A0B A;  3EU7 A;  3EI2 B;  4A08 A;  1TYQ C;  3V5W B;  3ORV D;  4N14 A;  2TRC B;  3UVK A;  5FLX g;  2IUV A;  2I3S A;  3KRW B;  4X60 B;  3AL8 A;  5I5I A;  4PNK B;  4U1E I;  4E5Z A;  3EG6 A;  1N6D A;  5JWZ A;  4JSP C;  3IJ0 A;  4ZN4 A;  3UVL A;  3EI3 B;  3N0E A;  2H68 A;  5TF2 A;  3RRM C;  3PSC B;  3GRE A;  2H13 A;  3NVN A;  1GOT B;  3SHF A;  2GNQ A;  2H9L A;  3C5M A;  3CFS B;  2J55 H;  5EAM A;  3K27 A;  4A11 B;  4D6V A;  4PSX B;  3I8E A;  2CNX A;  2PM6 B;  4G56 B;  4K3I D;  4AOW A;  4BUJ C;  4CZY A;  4LG9 A;  4A0A B;  2Z2P A;  3RLM D;  4J81 A;  3N0D A;  3U4Y A;  3SXT D;  3FM0 A;  1MDA H;  2P9S C;  3VH0 A;  3EI1 B;  5CXB A;  5GXH A;  5FKS A;  2YMU A;  4H5I A;  5C9Z B;  4Y5R D;  2OIZ A;  4ERY A;  2G99 A;  4ERQ A;  3V9F A;  3FGB A;  4X3E A;  4A09 A;  2OK6 A;  3CFV A;  1MG3 A;  4IA9 A;  4J8B A;  4GGD A;  2H6N A;  4J84 A;  3C99 A;  4UI9 R;  3I89 A;  4L3H D;  2PM7 B;  2I0S A;  1JOF A;  4L3G D;  4A2M A;  3SLE D;  5IGQ A;  3RN1 D;  5EMK B;  4ZOY A;  3SBP A;  5TDH B;  3L4M D;  2HJB A;  5B4W A;  3MZL A;  2YNP A;  3PVU B;  3I8C A;  3JAM g;  3I7H A;  2PM9 B;  3KRX B;  4J79 A;  2YBA A;  3W15 A;  2OVP B;  2CE8 A;  5C2V B;  1N6F A;  3OKY B;  4JD2 C;  2HES X;  2XL3 A;  2P9N C;  2CN3 A;  3PXW D;  4JT5 C;  5I5J A;  3MKS B;  3EI3 A;  5AFU 3;  3NVX A;  1QNI A;  3OW8 A;  3I7O A;  4A11 A;  1OLZ A;  5CYK B;  4QL1 A;  5EM2 B;  2AH0 A;  2CE9 A;  2HKR A;  1YFQ A;  3K26 A;  3DM0 A;  3JRP A;  5H14 A;  3UR4 A;  4XYI A;  1FWX A;  5AJA A;  4A0A A;  1A0R B;  4FAN D;  5HYN B;  4GGA A;  3PXT D;  4CY1 A;  4FWW A;  3EI1 A;  3DXK C;  4H5J A;  3SBR A;  2H6Q A;  2H6K A;  3SMR A;  4CZX A;  4CI3 A;  3BG0 A;  3SWS D;  5IC7 A;  5EAL A;  5C2W B;  5FKR A;  4X61 B;  1ERJ A;  4MK0 B;  2P9K C;  1RI6 A;  2IWF A;  2P9P C;  1TBG A;  3C75 H;  3RSE C;  3JB9 L;  3BWS A;  4FA5 D;  4CY5 A;  3VGZ A;  2P9L C;  5A2Q g;  5FA5 B;  1JJU B;  2OK4 A;  2PM9 A;  3PSL A;  2AGW A;  2AGY A;  4PC0 A;  4QRJ A;  2Z2O A;  4PXW A;  4ZOZ A;  1B9Y A;  4GM8 A;  2H14 A;  3OKY A;  1GXR A;  4GGC A;  4CI1 A;  3DWL C;  4FA1 D;  3DXM C;  1OMW B;  3IIY A;  3OTT A;  4Z8L A;  4JSN C;  3AL8 B;  4X63 B;  4CC9 A;  5THA A;  3IKO A;  2AH1 A;  4JT6 C;  4J0X A;  3HFQ A;  5HE1 B;  3SN6 B;  4FA4 D;  2G9A A;  1U4C A;  1SQ9 A;  4J77 A;  2H9N A;  3UVO A;  5AMS A;  5FQD A;  2GC7 A;  3EI4 B;  3SCY A;  3UKR C;  3RFH A;  4Y7R A;  2P9I C;  4CY2 A;  4E54 A;  1U2V C;  1PBY B;  4J87 A;  4JSX C;  2AQ5 A;  2B5L A;  5CYK A;  5EM2 A;  3OKT A;  3EI2 A;  2UZY B;  1GP2 B;  4O3T B;  1R5M A;  2CN2 A;  4GQ2 P;  4ZOX A;  5FKQ A;  5HE3 B;  3UKU C;  5FKT A;  2H3X A;  2J56 H;  4GQB B;  4GM3 A;  5HE2 B;  3NVQ A;  4PBY A;  3SBQ A;  2H9P A;  4J73 A;  1SHY B;  5EMJ B;  4L9O A;  3B7F A;  3E0C A;  5EML B;  3UVN A;  2I0R A;  3L4O D;  3OKW A;  5GXI A;  3JZN A;  4FHL A;  2B4E A;  1XKS A;  4J82 A;  3CIK B;  2AGL A;  5CXC B;  3AH8 B;  3PE7 A;  3SJL D;  3RN0 D;  3I7N A;  3UVM A;  1MG2 A;  1JMZ B;  3BG1 A;  2OVQ B;  3JRO A;  3PVW B;  4L1Q D;  2HYE A;  5K1C C;  3J80 g;  2HJ4 A;  3EWE A;  4O45 A;  3F3P A;  3MKQ A;  4TZ4 A;  3V7D B;  3A0F A;  3P4F A;  4GMB A;  1XHM A;  2BCJ B;  2XL2 A;  3JZG A;  4K3J B;  1P22 A;  2IUP A;  2UZX B;  4ES0 A;  2H47 A;  4QT8 A;  4J0W A;  3VA6 A;  4OZU A;  3RFG A;  2B5N A;  4PSW B;  3OL2 B;  2I0T A;  4GZ8 A;  3EI4 A;  1GG2 B;  1NR0 A;  2P9U C;  3GFC A;  2IUR A;  4A0B B;  4EWR A;  3SFZ A;  4LGN A;  4KFM B;  2YNO A;  4A08 B;  2I3T A;  3AL9 A;  5IGO A;  5H17 A;  5TEF A;  2HKM A;  4HDJ A;  2GC4 A;  4QQE A;  3AFC A;  3F3F A;  3JPX A;  3MZK A;  2MTA H;  3ULE C;  4CZV A;  5I5M A;  3ODT A;  4J8G A;  3C9C A;  3MMY A;  4E5Z B;  4OWR A;  2XYI A;  1K32 A;  4O3U B;  1B9X A;  2B5M A;  4YVD A;  4XYH A;  3PXS D;  1N6E A;  1S4U X;  5HQG A;  2CO0 C;  2Q7Q A;  5GMK n;  2HXC A;  4GQ1 A;  4J78 A;  3F3G A;  5EAR A;  5HE0 B;  2H9M A;  2IUQ A;  2OVR B;  4ZOV A;  1JMX B;  4U7A A;  3IIW A;  3I7P A;  4FA9 D;  4FAV D;  2YNN A;  5CXC A;  1SQJ A;  4IMM A;  2XU7 A;  2IWK A;  3RMZ D;  3JZH A;  5EMM B;  3J81 g;  2QXV A;  5H1M A;  5KDO B;  2CO0 A;  4I79 A;  4JSV C;  1PI6 A;  4A2L A;  2EBS A;  2IAA A;  5IJ8 E;  4AEZ A;  4LG8 A;  5CXB B; 
#chains in the Genus database with same CATH topology
 3I7L A;  4Z7N A;  1A12 A;  3EMH A;  3FRX A;  3MXX A;  4BH6 A;  1C9L A;  4FB1 D;  3IJ1 A;  4CY3 A;  3I7K A;  5FXY A;  3DSM A;  2BBK H;  4O1Q D;  1Q47 A;  3I2N A;  4PBZ A;  4O9D A;  4ERZ A;  3IJC A;  4A09 B;  4CI8 A;  1L5G A;  3SVW D;  4JXM A;  4MMX A;  2J57 G;  2PBI B;  2QC5 A;  4AMY A;  4R7A B;  3ZWL B;  2W18 A;  2Z2N A;  4BL0 A;  4CI2 A;  5GSA A;  5IT9 g;  5K19 A;  3DDU A;  1XIP A;  2O9K A;  4NSX A;  5FFG A;  4GM9 A;  3NIF A;  1L0Q A;  1VYH C;  1PGU A;  4D0K A;  5C92 A;  4XEI C;  4ESG A;  5IJ7 E;  4J86 A;  4A7J A;  1K8K C;  2OJY A;  3OL2 A;  2AGX A;  2YB8 B;  5TEE A;  5SXM A;  1NEX B;  2AGZ A;  4E54 B;  1PEV A;  5EAP A;  4A0B A;  1VE7 A;  3NID A;  2WQ8 A;  3EU7 A;  3EI2 B;  4A08 A;  1TYQ C;  1BPO A;  1UTC A;  3V5W B;  3ORV D;  3ZE0 A;  4N14 A;  2TRC B;  3IUR A;  3UVK A;  4BCB A;  5FLX g;  5M5U A;  5C86 A;  2IUV A;  4UM8 A;  2I3S A;  3KRW B;  4X60 B;  3AL8 A;  5I5I A;  4PNK B;  4U1E I;  4E5Z A;  3EG6 A;  1N6D A;  5JWZ A;  4JSP C;  3IJ0 A;  4ZN4 A;  4NC4 A;  3UVL A;  3EI3 B;  3N0E A;  4DNW A;  2H68 A;  5TF2 A;  3RRM C;  3IUM A;  3PSC B;  3O4G A;  2XE4 A;  2VZ3 A;  3GRE A;  2H13 A;  3NVN A;  1GOT B;  3SHF A;  2GNQ A;  2H9L A;  3IUJ A;  3C5M A;  2VDO A;  2J55 H;  3CFS B;  3K27 A;  5EAM A;  5E6U A;  1QFS A;  4PSX B;  3ZDY A;  4A11 B;  3GC3 B;  3O4I A;  3I8E A;  3NIG A;  2CNX A;  2PM6 B;  4G56 B;  4K3I D;  4AOW A;  4BUJ C;  4CZY A;  4LG9 A;  4A0A B;  2Z2P A;  3RLM D;  4J81 A;  3N0D A;  4WK2 A;  3U4Y A;  3SXT D;  3FM0 A;  3IUL A;  1M1X A;  1MDA H;  2P9S C;  4AN1 A;  3VH0 A;  2HU8 A;  3EI1 B;  5CXB A;  5GXH A;  3O4J A;  5FKS A;  2YMU A;  4H5I A;  4NEN A;  5C9Z B;  1VZ3 A;  2OIZ A;  4Y5R D;  5M61 A;  4ERY A;  2G99 A;  5M5T A;  4ERQ A;  3V9F A;  3FGB A;  4X3E A;  2QR5 A;  1E8M A;  2OK6 A;  3CFV A;  4A09 A;  1MG3 A;  4IA9 A;  4J8B A;  4GGD A;  2H6N A;  4J84 A;  3C99 A;  4UI9 R;  3I89 A;  3QHY B;  1O6F A;  4L3H D;  2PM7 B;  2I0S A;  1JOF A;  2VDL A;  4L3G D;  5E6R A;  4A2M A;  3SLE D;  5IGQ A;  3RN1 D;  5EMK B;  4ZOY A;  3SBP A;  5TDH B;  3L4M D;  2HJB A;  5B4W A;  3MZL A;  2YNP A;  3PVU B;  3I8C A;  3FCS A;  3JAM g;  3I7H A;  4L1M A;  2PM9 B;  3KRX B;  4J79 A;  2YBA A;  3W15 A;  2OVP B;  2CE8 A;  3ZE2 A;  4RE6 A;  4G55 A;  5C2V B;  1N6F A;  3OKY B;  1E5T A;  4JD2 C;  2HES X;  2VZ1 A;  2XL3 A;  1TYE A;  2P9N C;  2CN3 A;  4BCC A;  3PXW D;  4JT5 C;  1H2Z A;  5I5J A;  3MKS B;  1K3I A;  3EI3 A;  4G1M A;  5AFU 3;  5M5R A;  2EID A;  4MMZ A;  3NVX A;  4WK4 A;  1QNI A;  3OW8 A;  4NAA A;  2JKX A;  3MVD K;  3KCI A;  1O6G A;  3I7O A;  4A11 A;  1OLZ A;  4BP9 A;  1H2Y A;  5CYK B;  4QL1 A;  5EM2 B;  2AH0 A;  2CE9 A;  3IUN A;  2HKR A;  3T3M A;  1YFQ A;  3K26 A;  3DM0 A;  3JRP A;  1UOO A;  4QAM A;  5H14 A;  3UR4 A;  1I2M B;  4XYI A;  1FWX A;  5AJA A;  4WK0 A;  4A0A A;  1A0R B;  1VE6 A;  2EIE A;  4FAN D;  5HYN B;  4GGA A;  3PXT D;  4CY1 A;  3O4H A;  4FWW A;  3EI1 A;  3DXK C;  4O2W A;  4H5J A;  3SBR A;  2H6Q A;  2H6K A;  3SMR A;  4CZX A;  4CI3 A;  3BG0 A;  3SWS D;  5IC7 A;  5EAL A;  5C2W B;  5FKR A;  3EQ7 A;  4O02 A;  4X61 B;  3ZDX A;  4WJK A;  1ERJ A;  4MK0 B;  2P9K C;  1RI6 A;  2IWF A;  2P9P C;  1TBG A;  2VDM A;  3C75 H;  3RSE C;  3JB9 L;  3BWS A;  4FA5 D;  4CY5 A;  3VGZ A;  2P9L C;  5A2Q g;  3IJE A;  3K72 A;  5FA5 B;  1JJU B;  2OK4 A;  2PM9 A;  4RE5 A;  3MUO A;  3PSL A;  2AGW A;  2AGY A;  4PC0 A;  4QRJ A;  2Z2O A;  4BP8 A;  4PXW A;  4ZOZ A;  1B9Y A;  4GM8 A;  1YR2 A;  2H14 A;  2VDR A;  3IUQ A;  3OKY A;  1GXR A;  2HU7 A;  4GGC A;  1QFM A;  4CI1 A;  3DWL C;  1UOQ A;  4FA1 D;  2QZP A;  3DXM C;  1OMW B;  3IIY A;  3OTT A;  4Z8L A;  4JSN C;  3AL8 B;  4X63 B;  4CC9 A;  5THA A;  3IKO A;  3MUN A;  2VDQ A;  1UOP A;  3OF7 A;  2AH1 A;  2VC2 A;  4JT6 C;  4J0X A;  3HFQ A;  3EQ9 A;  4IRZ A;  5HE1 B;  3SN6 B;  4FA4 D;  2G9A A;  1U4C A;  3K71 A;  1SQ9 A;  4J77 A;  2H9N A;  3ZDZ A;  3UVO A;  5AMS A;  5FQD A;  2GC7 A;  3EI4 B;  3SCY A;  3UKR C;  3RFH A;  4Y7R A;  2P9I C;  4CY2 A;  4E54 A;  1U2V C;  1PBY B;  4J87 A;  4JSX C;  2AQ5 A;  2B5L A;  5CYK A;  5EM2 A;  3FCU A;  3OKT A;  3EI2 A;  2UZY B;  1GP2 B;  4O3T B;  1R5M A;  2CN2 A;  2VDN A;  4GQ2 P;  4ZOX A;  3V4V A;  5FKQ A;  5HE3 B;  5FFO A;  3UKU C;  5FKT A;  2H3X A;  4Z7Q A;  3EQ8 A;  2J56 H;  4GQB B;  5HDB A;  4GM3 A;  1GOF A;  3NVQ A;  5HE2 B;  4PBY A;  3SBQ A;  2H9P A;  4J73 A;  1SHY B;  4D9S A;  5EMJ B;  4L9O A;  3B7F A;  3E0C A;  5EML B;  3UVN A;  2I0R A;  3L4O D;  3OKW A;  5M5S A;  5GXI A;  3JZN A;  4FHL A;  4BCD A;  2B4E A;  1XKS A;  4J82 A;  2XDW A;  3CIK B;  2AGL A;  5CXC B;  3AH8 B;  3PE7 A;  3SJL D;  3RN0 D;  3I7N A;  3UVM A;  1JMZ B;  1MG2 A;  3BG1 A;  2OVQ B;  3JRO A;  3PVW B;  4L1Q D;  2HYE A;  5K1C C;  3J80 g;  2HJ4 A;  3EWE A;  4O45 A;  3F3P A;  3MKQ A;  4TZ4 A;  3V7D B;  3A0F A;  2XZG A;  3P4F A;  4GMB A;  1XHM A;  2BCJ B;  4MMY A;  2XL2 A;  4NBM A;  4AN0 A;  3JZG A;  4K3J B;  4G1E A;  1U8C A;  2EIB A;  1P22 A;  3IVM A;  2IUP A;  2UZX B;  4ES0 A;  2H47 A;  4QT8 A;  5E6S A;  4J0W A;  4JHN A;  3VA6 A;  4OZU A;  3RFG A;  2B5N A;  2BKL A;  4PSW B;  4DNV A;  3ZE1 A;  3OL2 B;  2I0T A;  4GZ8 A;  2EIC A;  2HU5 A;  3EI4 A;  1GG2 B;  2VDK A;  3V4P A;  4JHP C;  1NR0 A;  2P9U C;  3GFC A;  2IUR A;  3T3P A;  4EWR A;  4A0B B;  3SFZ A;  4LGN A;  4KFM B;  2YNO A;  4A08 B;  2I3T A;  3K6S A;  3AL9 A;  5IGO A;  5H17 A;  5TEF A;  2HKM A;  4HDJ A;  2GC4 A;  4QQE A;  3AFC A;  3F3F A;  3JPX A;  3MZK A;  2MTA H;  3ULE C;  4CZV A;  3VI3 A;  3ODT A;  5I5M A;  4J8G A;  3C9C A;  3MMY A;  2VDP A;  4AX4 A;  1JTD B;  4D6V A;  4E5Z B;  4OWR A;  2XYI A;  1K32 A;  4O3U B;  1B9X A;  2B5M A;  4YVD A;  5M5V A;  4XYH A;  3PXS D;  1N6E A;  3GD1 I;  1S4U X;  5HQG A;  2CO0 C;  4UM9 A;  4Z7O A;  2Q7Q A;  5GMK n;  2HXC A;  4GQ1 A;  1H2W A;  3F3G A;  4J78 A;  5EAR A;  5HE0 B;  2H9M A;  2IUQ A;  2OVR B;  4ZOV A;  1JMX B;  1H2X A;  3VI4 A;  3QI0 A;  1GOG A;  4U7A A;  4DNU A;  3IIW A;  3I7P A;  4FA9 D;  4FAV D;  2YNN A;  5CXC A;  1SQJ A;  4IMM A;  2XU7 A;  2IWK A;  3RMZ D;  3JZH A;  1GOH A;  1JV2 A;  5EMM B;  3J81 g;  2QXV A;  5H1M A;  5KDO B;  2CO0 A;  4I79 A;  1C9I A;  1PI6 A;  4JSV C;  4A2L A;  1E8N A;  1T2X A;  2EBS A;  4AMZ A;  2IAA A;  1VZ2 A;  5IJ8 E;  4AEZ A;  4LG8 A;  5CXB B; 
#chains in the Genus database with same CATH homology
 3I7L A;  3FRX A;  3EMH A;  3MXX A;  4BH6 A;  4FB1 D;  3IJ1 A;  4CY3 A;  3I7K A;  5FXY A;  3DSM A;  2BBK H;  4O1Q D;  1Q47 A;  3I2N A;  4PBZ A;  4O9D A;  4ERZ A;  3IJC A;  4A09 B;  4CI8 A;  3SVW D;  4JXM A;  2J57 G;  2PBI B;  2QC5 A;  4R7A B;  3ZWL B;  2W18 A;  2Z2N A;  4BL0 A;  4CI2 A;  5GSA A;  5IT9 g;  5K19 A;  1XIP A;  2O9K A;  4NSX A;  4GM9 A;  1L0Q A;  1VYH C;  1PGU A;  4D0K A;  4XEI C;  4ESG A;  5IJ7 E;  4J86 A;  4A7J A;  1K8K C;  2OJY A;  3OL2 A;  2AGX A;  2YB8 B;  5TEE A;  5SXM A;  1NEX B;  2AGZ A;  4E54 B;  1PEV A;  5EAP A;  4A0B A;  3EU7 A;  3EI2 B;  4A08 A;  1TYQ C;  3V5W B;  3ORV D;  4N14 A;  2TRC B;  3UVK A;  5FLX g;  2IUV A;  2I3S A;  3KRW B;  4X60 B;  3AL8 A;  5I5I A;  4PNK B;  4U1E I;  4E5Z A;  3EG6 A;  1N6D A;  5JWZ A;  4JSP C;  3IJ0 A;  4ZN4 A;  3UVL A;  3EI3 B;  3N0E A;  2H68 A;  5TF2 A;  3RRM C;  3PSC B;  3GRE A;  2H13 A;  3NVN A;  1GOT B;  3SHF A;  2GNQ A;  2H9L A;  3C5M A;  3CFS B;  2J55 H;  5EAM A;  3K27 A;  4A11 B;  4D6V A;  4PSX B;  3I8E A;  2CNX A;  2PM6 B;  4G56 B;  4K3I D;  4AOW A;  4BUJ C;  4CZY A;  4LG9 A;  4A0A B;  2Z2P A;  3RLM D;  4J81 A;  3N0D A;  3U4Y A;  3SXT D;  3FM0 A;  1MDA H;  2P9S C;  3VH0 A;  3EI1 B;  5CXB A;  5GXH A;  5FKS A;  2YMU A;  4H5I A;  5C9Z B;  4Y5R D;  2OIZ A;  4ERY A;  2G99 A;  4ERQ A;  3V9F A;  3FGB A;  4X3E A;  4A09 A;  2OK6 A;  3CFV A;  1MG3 A;  4IA9 A;  4J8B A;  4GGD A;  2H6N A;  4J84 A;  3C99 A;  4UI9 R;  3I89 A;  4L3H D;  2PM7 B;  2I0S A;  1JOF A;  4L3G D;  4A2M A;  3SLE D;  5IGQ A;  3RN1 D;  5EMK B;  4ZOY A;  3SBP A;  5TDH B;  3L4M D;  2HJB A;  5B4W A;  3MZL A;  2YNP A;  3PVU B;  3I8C A;  3JAM g;  3I7H A;  2PM9 B;  3KRX B;  4J79 A;  2YBA A;  3W15 A;  2OVP B;  2CE8 A;  5C2V B;  1N6F A;  3OKY B;  4JD2 C;  2HES X;  2XL3 A;  2P9N C;  2CN3 A;  3PXW D;  4JT5 C;  5I5J A;  3MKS B;  3EI3 A;  5AFU 3;  3NVX A;  1QNI A;  3OW8 A;  3I7O A;  4A11 A;  1OLZ A;  5CYK B;  4QL1 A;  5EM2 B;  2AH0 A;  2CE9 A;  2HKR A;  1YFQ A;  3K26 A;  3DM0 A;  3JRP A;  5H14 A;  3UR4 A;  4XYI A;  1FWX A;  5AJA A;  4A0A A;  1A0R B;  4FAN D;  5HYN B;  4GGA A;  3PXT D;  4CY1 A;  4FWW A;  3EI1 A;  3DXK C;  4H5J A;  3SBR A;  2H6Q A;  2H6K A;  3SMR A;  4CZX A;  4CI3 A;  3BG0 A;  3SWS D;  5IC7 A;  5EAL A;  5C2W B;  5FKR A;  4X61 B;  1ERJ A;  4MK0 B;  2P9K C;  1RI6 A;  2IWF A;  2P9P C;  1TBG A;  3C75 H;  3RSE C;  3JB9 L;  3BWS A;  4FA5 D;  4CY5 A;  3VGZ A;  2P9L C;  5A2Q g;  5FA5 B;  1JJU B;  2OK4 A;  2PM9 A;  3PSL A;  2AGW A;  2AGY A;  4PC0 A;  4QRJ A;  2Z2O A;  4PXW A;  4ZOZ A;  1B9Y A;  4GM8 A;  2H14 A;  3OKY A;  1GXR A;  4GGC A;  4CI1 A;  3DWL C;  4FA1 D;  3DXM C;  1OMW B;  3IIY A;  3OTT A;  4Z8L A;  4JSN C;  3AL8 B;  4X63 B;  4CC9 A;  5THA A;  3IKO A;  2AH1 A;  4JT6 C;  4J0X A;  3HFQ A;  5HE1 B;  3SN6 B;  4FA4 D;  2G9A A;  1U4C A;  1SQ9 A;  4J77 A;  2H9N A;  3UVO A;  5AMS A;  5FQD A;  2GC7 A;  3EI4 B;  3SCY A;  3UKR C;  3RFH A;  4Y7R A;  2P9I C;  4CY2 A;  4E54 A;  1U2V C;  1PBY B;  4J87 A;  4JSX C;  2AQ5 A;  2B5L A;  5CYK A;  5EM2 A;  3OKT A;  3EI2 A;  2UZY B;  1GP2 B;  4O3T B;  1R5M A;  2CN2 A;  4GQ2 P;  4ZOX A;  5FKQ A;  5HE3 B;  3UKU C;  5FKT A;  2H3X A;  2J56 H;  4GQB B;  4GM3 A;  5HE2 B;  3NVQ A;  4PBY A;  3SBQ A;  2H9P A;  4J73 A;  1SHY B;  5EMJ B;  4L9O A;  3B7F A;  3E0C A;  5EML B;  3UVN A;  2I0R A;  3L4O D;  3OKW A;  5GXI A;  3JZN A;  4FHL A;  2B4E A;  1XKS A;  4J82 A;  3CIK B;  2AGL A;  5CXC B;  3AH8 B;  3PE7 A;  3SJL D;  3RN0 D;  3I7N A;  3UVM A;  1MG2 A;  1JMZ B;  3BG1 A;  2OVQ B;  3JRO A;  3PVW B;  4L1Q D;  2HYE A;  5K1C C;  3J80 g;  2HJ4 A;  3EWE A;  4O45 A;  3F3P A;  3MKQ A;  4TZ4 A;  3V7D B;  3A0F A;  3P4F A;  4GMB A;  1XHM A;  2BCJ B;  2XL2 A;  3JZG A;  4K3J B;  1P22 A;  2IUP A;  2UZX B;  4ES0 A;  2H47 A;  4QT8 A;  4J0W A;  3VA6 A;  4OZU A;  3RFG A;  2B5N A;  4PSW B;  3OL2 B;  2I0T A;  4GZ8 A;  3EI4 A;  1GG2 B;  1NR0 A;  2P9U C;  3GFC A;  2IUR A;  4A0B B;  4EWR A;  3SFZ A;  4LGN A;  4KFM B;  2YNO A;  4A08 B;  2I3T A;  3AL9 A;  5IGO A;  5H17 A;  5TEF A;  2HKM A;  4HDJ A;  2GC4 A;  4QQE A;  3AFC A;  3F3F A;  3JPX A;  3MZK A;  2MTA H;  3ULE C;  4CZV A;  5I5M A;  3ODT A;  4J8G A;  3C9C A;  3MMY A;  4E5Z B;  4OWR A;  2XYI A;  1K32 A;  4O3U B;  1B9X A;  2B5M A;  4YVD A;  4XYH A;  3PXS D;  1N6E A;  1S4U X;  5HQG A;  2CO0 C;  2Q7Q A;  5GMK n;  2HXC A;  4GQ1 A;  4J78 A;  3F3G A;  5EAR A;  5HE0 B;  2H9M A;  2IUQ A;  2OVR B;  4ZOV A;  1JMX B;  4U7A A;  3IIW A;  3I7P A;  4FA9 D;  4FAV D;  2YNN A;  5CXC A;  1SQJ A;  4IMM A;  2XU7 A;  2IWK A;  3RMZ D;  3JZH A;  5EMM B;  3J81 g;  2QXV A;  5H1M A;  5KDO B;  2CO0 A;  4I79 A;  4JSV C;  1PI6 A;  4A2L A;  2EBS A;  2IAA A;  5IJ8 E;  4AEZ A;  4LG8 A;  5CXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...