1MG2A

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHAAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
molecule keywords Methylamine dehydrogenase, heavy chain
total genus 94
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1mg2A00
4HDJA 2EBSA 3JB9L 3F3FA 3CFSB 5AMSA 4ERZA 2IUQA 1JOFA 4EWRA 1GXRA 3PXSD 4K3JB 4BL0A 4FAVD 3HFQA 1XIPA 4CZXA 4L9OA 3MXXA 4J79A 4FA9D 2G9AA 3IIYA 3EG6A 4O3UB 4IA9A 5TEFA 4ERQA 3N0DA 5GMKn 3UVNA 3E0CA 4L3HD 1R5MA 3I8EA 3OW8A 5I5IA 1N6DA 2GC7A 5CXBA 4CY3A 4TZ4A 4A09B 4A0BB 2CN2A 1SQ9A 2IAAA 1NR0A 2BBKH 4J8BA 3GFCA 4JD2C 2PM9A 3B7FA 4GZ8A 5HE2B 4L1QD 2CN3A 2OVPB 4ZOYA 4J87A 3J80g 3J81g 3SLED 3SWSD 5TF2A 2Q7QA 3PSLA 4E5ZA 2AH1A 4K3ID 4J77A 3FGBA 5IC7A 3RN0D 3IKOA 2J56H 1VYHC 3I7HA 3SFZA 2HJBA 3V7DB 3PVUB 5FLXg 3OL2A 4FA1D 4CY1A 2H9NA 5TEEA 5AJAA 3ORVD 4XEIC 4GQBB 3BWSA 4A09A 4O45A 1MG2A 2B5NA 4PBYA 4E54B 4FWWA 5GSAA 3NVNA 3EI3B 5FKTA 3PXTD 2H3XA 3I8CA 4CI2A 4U1EI 3KRWB 4GGAA 2AH0A 1N6FA 4CY2A 4J0XA 5FKRA 2H9LA 5CXCB 5JWZA 4GM8A 2P9NC 4QL1A 3EI1A 4A11B 3NVQA 3EMHA 4LG9A 1SQJA 4J0WA 3C9CA 3SMRA 5EMKB 1TYQC 2P9KC 4NSXA 4ESGA 3SBQA 3DXKC 4H5IA 1XKSA 2YNNA 4UI9R 4GM3A 4X60B 2HYEA 3I7LA 1PGUA 3U4YA 1XHMA 2HKRA 1L0QA 3K26A 4FAND 3DXMC 2OK4A 3JZNA 3UVMA 3SN6B 4PBZA 4ZOZA 4CI3A 3C75H 1JMZB 3A0FA 3IJ1A 4A11A 4MK0B 5HQGA 5EM2B 3I7KA 4Y5RD 4ZOVA 2OVQB 2I0TA 3RFHA 4GGDA 2PM7B 3EI4B 5EAPA 4OZUA 2CO0C 2QXVA 3PSCB 5C9ZB 4AEZA 3W15A 5CYKA 4FHLA 4E5ZB 1B9YA 2AGWA 4J84A 4GGCA 2I0SA 2OJYA 5C2VB 3AH8B 3N0EA 3VH0A 2I3TA 4JXMA 4A08B 2H13A 3BG0A 4I79A 3I7PA 2HKMA 5TDHB 3ULEC 4A7JA 4J8GA 4JSVC 2H47A 3I7NA 4IMMA 3L4OD 3I2NA 3JZGA 2H9MA 5FQDA 2G99A 4ZOXA 4R7AB 1TBGA 1RI6A 4J81A 1S4UX 3PXWD 3IJCA 5CXBB 4O9DA 2AGZA 2B5MA 4D6VA 5C2WB 4X3EA 3ZWLB 4X63B 4BUJC 5CYKB 4PSWB 2PBIB 5IT9g 4J73A 4J86A 1A0RB 4XYHA 4ERYA 4JT5C 2GNQA 4PSXB 5H14A 4ES0A 4O1QD 4G56B 5EMMB 1OMWB 3MMYA 3OL2B 2P9PC 4XYIA 3RLMD 5GXHA 5FA5B 4PNKB 3SHFA 2CE8A 2HESX 3PE7A 4GQ1A 3SBRA 3V5WB 4N14A 2Z2PA 3EI2B 4X61B 4L3GD 4FA5D 1U4CA 3FRXA 4YVDA 2IURA 2H68A 5IGOA 4QRJA 3RSEC 2TRCB 3C5MA 3DM0A 4FB1D 2UZXB 1FWXA 2OIZA 3JROA 2YNOA 3MZLA 2OK6A 4A2LA 2H6QA 3UVKA 4ZN4A 3I7OA 4CZYA 2H9PA 1K8KC 4CZVA 3OKWA 5H17A 4JT6C 3OKYB 3V9FA 2Z2NA 5SXMA 3NVXA 1U2VC 3JZHA 4J82A 1GOTB 2AGXA 2HJ4A 5EAMA 4E54A 3JRPA 5HYNB 1JJUB 4CI1A 4O3TB 4D0KA 2H6KA 2QC5A 2CO0A 1MG3A 1B9XA 5EARA 4A08A 1SHYB 3BG1A 2AGYA 2AQ5A 4JSNC 2OVRB 5FKQA 1NEXB 4Y7RA 2GC4A 2W18A 4PXWA 5IJ8E 4CC9A 4GM9A 5GXIA 4OWRA 3SBPA 2BCJB 2YMUA 3RRMC 1P22A 2J57G 3UVOA 5A2Qg 2MTAH 2B5LA 2PM6B 2XL2A 4GMBA 4U7AA 5HE1B 5IGQA 3UVLA 5KDOB 3RMZD 3P4FA 2PM9B 3AFCA 2XU7A 3EI4A 2CNXA 3RN1D 4CI8A 4CY5A 3JPXA 3MKSB 2P9IC 4FA4D 4AOWA 1GP2B 2P9UC 2J55H 5EMLB 5K1CC 2I3SA 3SVWD 3C99A 3UKRC 3OKYA 3IJ0A 4GQ2P 2IWFA 3EU7A 2IUPA 1PI6A 1K32A 3AL8B 3PVWB 1ERJA 5IJ7E 2IUVA 5HE0B 3EI1B 3L4MD 3EI2A 4QQEA 2AGLA 5K19A 3OKTA 3AL9A 2O9KA 5THAA 5AFU3 1GG2B 4BH6A 5EALA 3EWEA 2B4EA 3EI3A 5I5MA 4A0AA 4H5JA 5FXYA 1JMXB 3I89A 5I5JA 4J78A 4A2MA 3F3GA 2H14A 4KFMB 2CE9A 2I0RA 1OLZA 5CXCA 2XL3A 3UKUC 3AL8A 3UR4A 2UZYB 2XYIA 4A0BA 3CIKB 5HE3B 3KRXB 3FM0A 4JSPC 2HXCA 4Z8LA 3SJLD 4LG8A 3DWLC 3F3PA 4JSXC 3ODTA 5H1MA 4PC0A 2P9LC 2P9SC 3VA6A 3MKQA 1YFQA 2YBAA 1N6EA 3IIWA 3MZKA 3GREA 3OTTA 3CFVA 5B4WA 5EMJB 1PBYB 5FKSA 4LGNA 4A0AB 3VGZA 3JAMg 1Q47A 3RFGA 2YB8B 5EM2A 2IWKA 4QT8A 1QNIA 2YNPA 3DSMA 2Z2OA 2H6NA 1PEVA 3SXTD 1MDAH 3SCYA 3K27A
chains in the Genus database with same CATH superfamily
4HDJA 2BKLA 2EBSA 3T3PA 3F3FA 3JB9L 2QR5A 3CFSB 5AMSA 4ERZA 1JV2A 2IUQA 1JOFA 3NIDA 1GXRA 4EWRA 3PXSD 4K3JB 5E6UA 4BL0A 4FAVD 2EIBA 1GOHA 3HFQA 3IUNA 1XIPA 4CZXA 4L9OA 3MXXA 4J79A 4FA9D 3VI3A 2G9AA 3IIYA 3EG6A 4O3UB 5FFGA 4IA9A 5TEFA 4ERQA 3N0DA 3O4GA 4UM9A 3UVNA 5GMKn 3E0CA 1VZ3A 4L3HD 1R5MA 4NAAA 3I8EA 3OW8A 5I5IA 1N6DA 2GC7A 4MMYA 5CXBA 1E8NA 4CY3A 4TZ4A 4WK0A 4A09B 4A0BB 2CN2A 1SQ9A 2IAAA 1NR0A 4JHPC 2BBKH 4J8BA 3GFCA 4JD2C 2PM9A 3B7FA 1C9LA 4GZ8A 5HE2B 4L1QD 2CN3A 2OVPB 4ZOYA 1O6FA 4J87A 3J80g 1L5GA 3J81g 3SLED 2VZ1A 3SWSD 5TF2A 2Q7QA 3PSLA 4E5ZA 2AH1A 4K3ID 4J77A 3FGBA 5IC7A 3RN0D 4BP8A 3IKOA 2J56H 2XE4A 1VYHC 3I7HA 3SFZA 1QFSA 2HJBA 4MMXA 3V7DB 3PVUB 5FLXg 3OL2A 4FA1D 4CY1A 2H9NA 5TEEA 5AJAA 3ORVD 4XEIC 4GQBB 3BWSA 4A09A 2VDLA 4O02A 4O45A 1MG2A 2B5NA 2WQ8A 4PBYA 4E54B 4FWWA 5GSAA 3NVNA 3EI3B 5FKTA 3PXTD 2H3XA 3I8CA 4CI2A 1T2XA 1M1XA 4Z7NA 1VZ2A 3IUMA 4DNVA 1H2WA 1UOPA 4U1EI 3KRWB 4GGAA 2AH0A 1N6FA 4CY2A 4J0XA 5FKRA 2H9LA 5CXCB 5JWZA 1U8CA 4GM8A 3ZDXA 2P9NC 4QL1A 3EI1A 4A11B 4NBMA 3EQ8A 3NVQA 1VE6A 3EMHA 4LG9A 4WK4A 1SQJA 4J0WA 3C9CA 3SMRA 2HU7A 5EMKB 1TYQC 2P9KC 4NSXA 5E6RA 5C86A 1JTDB 4ESGA 4WK2A 4BCCA 1UTCA 3SBQA 3DXKC 4H5IA 1XKSA 2YNNA 4UI9R 4GM3A 4JHNA 4X60B 2HYEA 3I7LA 1PGUA 3U4YA 1XHMA 2HKRA 1L0QA 3K26A 4FAND 3DXMC 2OK4A 3JZNA 3NIFA 1QFMA 3UVMA 4WJKA 3SN6B 4PBZA 4ZOZA 2VC2A 4CI3A 3C75H 1JMZB 3A0FA 3IJ1A 4A11A 4MK0B 5HQGA 5EM2B 3I7KA 4Y5RD 2VDNA 4ZOVA 2OVQB 2I0TA 3RFHA 4GGDA 2PM7B 3EI4B 5EAPA 4OZUA 2CO0C 2HU5A 2QXVA 3PSCB 5C9ZB 4AEZA 3W15A 3O4JA 5CYKA 4FHLA 4E5ZB 1B9YA 4MMZA 2AGWA 4J84A 4GGCA 3MUOA 2I0SA 2OJYA 5C2VB 4QAMA 3AH8B 3N0EA 3EQ9A 3VH0A 2I3TA 4JXMA 4A08B 2H13A 3BG0A 4I79A 3I7PA 2HKMA 5TDHB 3ULEC 4A7JA 4J8GA 4JSVC 2H47A 4L1MA 3L4OD 3I7NA 4IMMA 2XDWA 3I2NA 3JZGA 2H9MA 3IULA 4NENA 5FQDA 2G99A 4ZOXA 4BCDA 4R7AB 1TBGA 1RI6A 4J81A 1S4UX 3PXWD 4Z7QA 3IJCA 5CXBB 3IJEA 4O9DA 2AGZA 2B5MA 4D6VA 5C2WB 4X3EA 3ZWLB 4X63B 4BUJC 5CYKB 2EIEA 4PSWB 5HDBA 2PBIB 5IT9g 4J73A 4J86A 4O2WA 1A0RB 3V4PA 4XYHA 4ERYA 4JT5C 2GNQA 3FCSA 4G55A 4PSXB 4O1QD 5H14A 4ES0A 4G56B 5EMMB 1OMWB 3MMYA 3ZDZA 3K71A 3OL2B 4BP9A 2P9PC 4XYIA 3RLMD 1H2XA 2HU8A 5GXHA 5FA5B 2VZ3A 4PNKB 4RE5A 3SHFA 2CE8A 2HESX 3PE7A 4GQ1A 3SBRA 3V5WB 4N14A 2Z2PA 3EI2B 4DNUA 1H2YA 4X61B 4L3GD 4FA5D 1U4CA 3FRXA 4YVDA 2IURA 2H68A 5IGOA 4QRJA 3IUQA 3RSEC 1E5TA 2TRCB 2VDKA 3C5MA 2JKXA 3DM0A 4FB1D 3K6SA 2UZXB 1FWXA 2OIZA 3JROA 2YNOA 3MZLA 4AMYA 2OK6A 4A2LA 2H6QA 3UVKA 4AMZA 4ZN4A 3I7OA 4CZYA 2H9PA 1K8KC 4CZVA 3OKWA 5H17A 4JT6C 3ZE0A 3OKYB 3V9FA 2Z2NA 5SXMA 3NVXA 3NIGA 2XZGA 3O4HA 1U2VC 3JZHA 4J82A 1GOTB 2AGXA 2HJ4A 5EAMA 4E54A 3JRPA 5HYNB 1JJUB 4CI1A 3VI4A 4O3TB 5M5RA 4D0KA 3IVMA 2H6KA 2QC5A 4AN1A 5E6SA 5M61A 2CO0A 1MG3A 1B9XA 5EARA 3GC3B 4A08A 1SHYB 3BG1A 2AGYA 2AQ5A 4JSNC 3O4IA 2OVRB 5FKQA 1NEXB 3MUNA 4Y7RA 4G1EA 1GOFA 2GC4A 2W18A 4NC4A 4PXWA 5IJ8E 4CC9A 4GM9A 5GXIA 4D9SA 4Z7OA 4OWRA 2VDPA 2VDRA 2BCJB 2YMUA 3RRMC 1P22A 2J57G 3SBPA 3UVOA 2MTAH 5A2Qg 2B5LA 2PM6B 2XL2A 4DNWA 1BPOA 3K72A 4GMBA 4U7AA 5HE1B 5IGQA 3KCIA 5C92A 1TYEA 2EICA 3UVLA 5KDOB 3RMZD 3P4FA 2PM9B 3AFCA 1UOQA 2EIDA 2XU7A 2CNXA 3DDUA 3EI4A 3RN1D 4CI8A 4CY5A 5FFOA 3JPXA 3MKSB 2P9IC 4FA4D 4AOWA 1H2ZA 1GP2B 3ZE2A 2P9UC 4AN0A 2J55H 5EMLB 5K1CC 3ZDYA 1UOOA 3IUJA 2I3SA 3SVWD 3C99A 3T3MA 2QZPA 2VDMA 3IURA 3UKRC 3OKYA 3IJ0A 1VE7A 4GQ2P 2IWFA 3EU7A 2IUPA 3FCUA 1PI6A 1K32A 3AL8B 3PVWB 1ERJA 5IJ7E 2IUVA 5HE0B 3EI1B 3L4MD 3EI2A 4QQEA 2AGLA 5K19A 5M5TA 3OKTA 3AL9A 3OF7A 2O9KA 5THAA 5AFU3 5M5UA 1GG2B 4BH6A 5EALA 4AX4A 3EWEA 2B4EA 3EQ7A 4BCBA 3EI3A 5I5MA 4A0AA 2VDOA 4H5JA 5FXYA 1JMXB 3I89A 5I5JA 4J78A 4A2MA 3F3GA 3MVDK 2H14A 4KFMB 2CE9A 2I0RA 1OLZA 3QI0A 2XL3A 3GD1I 5CXCA 3AL8A 3UKUC 3UR4A 2UZYB 2XYIA 4A0BA 3CIKB 4UM8A 5HE3B 3ZE1A 3KRXB 3FM0A 4JSPC 2HXCA 3QHYB 1I2MB 4Z8LA 3SJLD 4LG8A 3DWLC 3F3PA 4G1MA 4JSXC 1YR2A 3ODTA 5H1MA 4IRZA 1GOGA 4PC0A 2P9LC 2P9SC 3VA6A 3MKQA 1YFQA 3V4VA 2YBAA 1K3IA 1N6EA 3IIWA 3MZKA 3GREA 1E8MA 3CFVA 3OTTA 5B4WA 5EMJB 1O6GA 1PBYB 1A12A 5FKSA 4LGNA 4A0AB 3VGZA 3JAMg 1Q47A 3RFGA 2YB8B 5EM2A 5M5VA 2IWKA 4RE6A 4QT8A 5M5SA 1QNIA 2VDQA 2YNPA 3DSMA 2Z2OA 2H6NA 1PEVA 3SXTD 1MDAH 1C9IA 3SCYA 3K27A
chains in the Genus database with same CATH topology
4HDJA 2EBSA 3JB9L 3F3FA 3CFSB 5AMSA 4ERZA 2IUQA 1JOFA 4EWRA 1GXRA 3PXSD 4K3JB 4BL0A 4FAVD 3HFQA 1XIPA 4CZXA 4L9OA 3MXXA 4J79A 4FA9D 2G9AA 3IIYA 3EG6A 4O3UB 4IA9A 5TEFA 4ERQA 3N0DA 5GMKn 3UVNA 3E0CA 4L3HD 1R5MA 3I8EA 3OW8A 5I5IA 1N6DA 2GC7A 5CXBA 4CY3A 4TZ4A 4A09B 4A0BB 2CN2A 1SQ9A 2IAAA 1NR0A 2BBKH 4J8BA 3GFCA 4JD2C 2PM9A 3B7FA 4GZ8A 5HE2B 4L1QD 2CN3A 2OVPB 4ZOYA 4J87A 3J80g 3J81g 3SLED 3SWSD 5TF2A 2Q7QA 3PSLA 4E5ZA 2AH1A 4K3ID 4J77A 3FGBA 5IC7A 3RN0D 3IKOA 2J56H 1VYHC 3I7HA 3SFZA 2HJBA 3V7DB 3PVUB 5FLXg 3OL2A 4FA1D 4CY1A 2H9NA 5TEEA 5AJAA 3ORVD 4XEIC 4GQBB 3BWSA 4A09A 4O45A 1MG2A 2B5NA 4PBYA 4E54B 4FWWA 5GSAA 3NVNA 3EI3B 5FKTA 3PXTD 2H3XA 3I8CA 4CI2A 4U1EI 3KRWB 4GGAA 2AH0A 1N6FA 4CY2A 4J0XA 5FKRA 2H9LA 5CXCB 5JWZA 4GM8A 2P9NC 4QL1A 3EI1A 4A11B 3NVQA 3EMHA 4LG9A 1SQJA 4J0WA 3C9CA 3SMRA 5EMKB 1TYQC 2P9KC 4NSXA 4ESGA 3SBQA 3DXKC 4H5IA 1XKSA 2YNNA 4UI9R 4GM3A 4X60B 2HYEA 3I7LA 1PGUA 3U4YA 1XHMA 2HKRA 1L0QA 3K26A 4FAND 3DXMC 2OK4A 3JZNA 3UVMA 3SN6B 4PBZA 4ZOZA 4CI3A 3C75H 1JMZB 3A0FA 3IJ1A 4A11A 4MK0B 5HQGA 5EM2B 3I7KA 4Y5RD 4ZOVA 2OVQB 2I0TA 3RFHA 4GGDA 2PM7B 3EI4B 5EAPA 4OZUA 2CO0C 2QXVA 3PSCB 5C9ZB 4AEZA 3W15A 5CYKA 4FHLA 4E5ZB 1B9YA 2AGWA 4J84A 4GGCA 2I0SA 2OJYA 5C2VB 3AH8B 3N0EA 3VH0A 2I3TA 4JXMA 4A08B 2H13A 3BG0A 4I79A 3I7PA 2HKMA 5TDHB 3ULEC 4A7JA 4J8GA 4JSVC 2H47A 3I7NA 4IMMA 3L4OD 3I2NA 3JZGA 2H9MA 5FQDA 2G99A 4ZOXA 4R7AB 1TBGA 1RI6A 4J81A 1S4UX 3PXWD 3IJCA 5CXBB 4O9DA 2AGZA 2B5MA 4D6VA 5C2WB 4X3EA 3ZWLB 4X63B 4BUJC 5CYKB 4PSWB 2PBIB 5IT9g 4J73A 4J86A 1A0RB 4XYHA 4ERYA 4JT5C 2GNQA 4PSXB 5H14A 4ES0A 4O1QD 4G56B 5EMMB 1OMWB 3MMYA 3OL2B 2P9PC 4XYIA 3RLMD 5GXHA 5FA5B 4PNKB 3SHFA 2CE8A 2HESX 3PE7A 4GQ1A 3SBRA 3V5WB 4N14A 2Z2PA 3EI2B 4X61B 4L3GD 4FA5D 1U4CA 3FRXA 4YVDA 2IURA 2H68A 5IGOA 4QRJA 3RSEC 2TRCB 3C5MA 3DM0A 4FB1D 2UZXB 1FWXA 2OIZA 3JROA 2YNOA 3MZLA 2OK6A 4A2LA 2H6QA 3UVKA 4ZN4A 3I7OA 4CZYA 2H9PA 1K8KC 4CZVA 3OKWA 5H17A 4JT6C 3OKYB 3V9FA 2Z2NA 5SXMA 3NVXA 1U2VC 3JZHA 4J82A 1GOTB 2AGXA 2HJ4A 5EAMA 4E54A 3JRPA 5HYNB 1JJUB 4CI1A 4O3TB 4D0KA 2H6KA 2QC5A 2CO0A 1MG3A 1B9XA 5EARA 4A08A 1SHYB 3BG1A 2AGYA 2AQ5A 4JSNC 2OVRB 5FKQA 1NEXB 4Y7RA 2GC4A 2W18A 4PXWA 5IJ8E 4CC9A 4GM9A 5GXIA 4OWRA 3SBPA 2BCJB 2YMUA 3RRMC 1P22A 2J57G 3UVOA 5A2Qg 2MTAH 2B5LA 2PM6B 2XL2A 4GMBA 4U7AA 5HE1B 5IGQA 3UVLA 5KDOB 3RMZD 3P4FA 2PM9B 3AFCA 2XU7A 3EI4A 2CNXA 3RN1D 4CI8A 4CY5A 3JPXA 3MKSB 2P9IC 4FA4D 4AOWA 1GP2B 2P9UC 2J55H 5EMLB 5K1CC 2I3SA 3SVWD 3C99A 3UKRC 3OKYA 3IJ0A 4GQ2P 2IWFA 3EU7A 2IUPA 1PI6A 1K32A 3AL8B 3PVWB 1ERJA 5IJ7E 2IUVA 5HE0B 3EI1B 3L4MD 3EI2A 4QQEA 2AGLA 5K19A 3OKTA 3AL9A 2O9KA 5THAA 5AFU3 1GG2B 4BH6A 5EALA 3EWEA 2B4EA 3EI3A 5I5MA 4A0AA 4H5JA 5FXYA 1JMXB 3I89A 5I5JA 4J78A 4A2MA 3F3GA 2H14A 4KFMB 2CE9A 2I0RA 1OLZA 5CXCA 2XL3A 3UKUC 3AL8A 3UR4A 2UZYB 2XYIA 4A0BA 3CIKB 5HE3B 3KRXB 3FM0A 4JSPC 2HXCA 4Z8LA 3SJLD 4LG8A 3DWLC 3F3PA 4JSXC 3ODTA 5H1MA 4PC0A 2P9LC 2P9SC 3VA6A 3MKQA 1YFQA 2YBAA 1N6EA 3IIWA 3MZKA 3GREA 3OTTA 3CFVA 5B4WA 5EMJB 1PBYB 5FKSA 4LGNA 4A0AB 3VGZA 3JAMg 1Q47A 3RFGA 2YB8B 5EM2A 2IWKA 4QT8A 1QNIA 2YNPA 3DSMA 2Z2OA 2H6NA 1PEVA 3SXTD 1MDAH 3SCYA 3K27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDJ A;  2EBS A;  3JB9 L;  3F3F A;  3CFS B;  5AMS A;  4ERZ A;  2IUQ A;  1JOF A;  4EWR A;  1GXR A;  3PXS D;  4K3J B;  4BL0 A;  4FAV D;  3HFQ A;  1XIP A;  4CZX A;  4L9O A;  3MXX A;  4J79 A;  4FA9 D;  2G9A A;  3IIY A;  3EG6 A;  4O3U B;  4IA9 A;  5TEF A;  4ERQ A;  3N0D A;  5GMK n;  3UVN A;  3E0C A;  4L3H D;  1R5M A;  3I8E A;  3OW8 A;  5I5I A;  1N6D A;  2GC7 A;  5CXB A;  4CY3 A;  4TZ4 A;  4A09 B;  4A0B B;  2CN2 A;  1SQ9 A;  2IAA A;  1NR0 A;  2BBK H;  4J8B A;  3GFC A;  4JD2 C;  2PM9 A;  3B7F A;  4GZ8 A;  5HE2 B;  4L1Q D;  2CN3 A;  2OVP B;  4ZOY A;  4J87 A;  3J80 g;  3J81 g;  3SLE D;  3SWS D;  5TF2 A;  2Q7Q A;  3PSL A;  4E5Z A;  2AH1 A;  4K3I D;  4J77 A;  3FGB A;  5IC7 A;  3RN0 D;  3IKO A;  2J56 H;  1VYH C;  3I7H A;  3SFZ A;  2HJB A;  3V7D B;  3PVU B;  5FLX g;  3OL2 A;  4FA1 D;  4CY1 A;  2H9N A;  5TEE A;  5AJA A;  3ORV D;  4XEI C;  4GQB B;  3BWS A;  4A09 A;  4O45 A;  1MG2 A;  2B5N A;  4PBY A;  4E54 B;  4FWW A;  5GSA A;  3NVN A;  3EI3 B;  5FKT A;  3PXT D;  2H3X A;  3I8C A;  4CI2 A;  4U1E I;  3KRW B;  4GGA A;  2AH0 A;  1N6F A;  4CY2 A;  4J0X A;  5FKR A;  2H9L A;  5CXC B;  5JWZ A;  4GM8 A;  2P9N C;  4QL1 A;  3EI1 A;  4A11 B;  3NVQ A;  3EMH A;  4LG9 A;  1SQJ A;  4J0W A;  3C9C A;  3SMR A;  5EMK B;  1TYQ C;  2P9K C;  4NSX A;  4ESG A;  3SBQ A;  3DXK C;  4H5I A;  1XKS A;  2YNN A;  4UI9 R;  4GM3 A;  4X60 B;  2HYE A;  3I7L A;  1PGU A;  3U4Y A;  1XHM A;  2HKR A;  1L0Q A;  3K26 A;  4FAN D;  3DXM C;  2OK4 A;  3JZN A;  3UVM A;  3SN6 B;  4PBZ A;  4ZOZ A;  4CI3 A;  3C75 H;  1JMZ B;  3A0F A;  3IJ1 A;  4A11 A;  4MK0 B;  5HQG A;  5EM2 B;  3I7K A;  4Y5R D;  4ZOV A;  2OVQ B;  2I0T A;  3RFH A;  4GGD A;  2PM7 B;  3EI4 B;  5EAP A;  4OZU A;  2CO0 C;  2QXV A;  3PSC B;  5C9Z B;  4AEZ A;  3W15 A;  5CYK A;  4FHL A;  4E5Z B;  1B9Y A;  2AGW A;  4J84 A;  4GGC A;  2I0S A;  2OJY A;  5C2V B;  3AH8 B;  3N0E A;  3VH0 A;  2I3T A;  4JXM A;  4A08 B;  2H13 A;  3BG0 A;  4I79 A;  3I7P A;  2HKM A;  5TDH B;  3ULE C;  4A7J A;  4J8G A;  4JSV C;  2H47 A;  3I7N A;  4IMM A;  3L4O D;  3I2N A;  3JZG A;  2H9M A;  5FQD A;  2G99 A;  4ZOX A;  4R7A B;  1TBG A;  1RI6 A;  4J81 A;  1S4U X;  3PXW D;  3IJC A;  5CXB B;  4O9D A;  2AGZ A;  2B5M A;  4D6V A;  5C2W B;  4X3E A;  3ZWL B;  4X63 B;  4BUJ C;  5CYK B;  4PSW B;  2PBI B;  5IT9 g;  4J73 A;  4J86 A;  1A0R B;  4XYH A;  4ERY A;  4JT5 C;  2GNQ A;  4PSX B;  5H14 A;  4ES0 A;  4O1Q D;  4G56 B;  5EMM B;  1OMW B;  3MMY A;  3OL2 B;  2P9P C;  4XYI A;  3RLM D;  5GXH A;  5FA5 B;  4PNK B;  3SHF A;  2CE8 A;  2HES X;  3PE7 A;  4GQ1 A;  3SBR A;  3V5W B;  4N14 A;  2Z2P A;  3EI2 B;  4X61 B;  4L3G D;  4FA5 D;  1U4C A;  3FRX A;  4YVD A;  2IUR A;  2H68 A;  5IGO A;  4QRJ A;  3RSE C;  2TRC B;  3C5M A;  3DM0 A;  4FB1 D;  2UZX B;  1FWX A;  2OIZ A;  3JRO A;  2YNO A;  3MZL A;  2OK6 A;  4A2L A;  2H6Q A;  3UVK A;  4ZN4 A;  3I7O A;  4CZY A;  2H9P A;  1K8K C;  4CZV A;  3OKW A;  5H17 A;  4JT6 C;  3OKY B;  3V9F A;  2Z2N A;  5SXM A;  3NVX A;  1U2V C;  3JZH A;  4J82 A;  1GOT B;  2AGX A;  2HJ4 A;  5EAM A;  4E54 A;  3JRP A;  5HYN B;  1JJU B;  4CI1 A;  4O3T B;  4D0K A;  2H6K A;  2QC5 A;  2CO0 A;  1MG3 A;  1B9X A;  5EAR A;  4A08 A;  1SHY B;  3BG1 A;  2AGY A;  2AQ5 A;  4JSN C;  2OVR B;  5FKQ A;  1NEX B;  4Y7R A;  2GC4 A;  2W18 A;  4PXW A;  5IJ8 E;  4CC9 A;  4GM9 A;  5GXI A;  4OWR A;  3SBP A;  2BCJ B;  2YMU A;  3RRM C;  1P22 A;  2J57 G;  3UVO A;  5A2Q g;  2MTA H;  2B5L A;  2PM6 B;  2XL2 A;  4GMB A;  4U7A A;  5HE1 B;  5IGQ A;  3UVL A;  5KDO B;  3RMZ D;  3P4F A;  2PM9 B;  3AFC A;  2XU7 A;  3EI4 A;  2CNX A;  3RN1 D;  4CI8 A;  4CY5 A;  3JPX A;  3MKS B;  2P9I C;  4FA4 D;  4AOW A;  1GP2 B;  2P9U C;  2J55 H;  5EML B;  5K1C C;  2I3S A;  3SVW D;  3C99 A;  3UKR C;  3OKY A;  3IJ0 A;  4GQ2 P;  2IWF A;  3EU7 A;  2IUP A;  1PI6 A;  1K32 A;  3AL8 B;  3PVW B;  1ERJ A;  5IJ7 E;  2IUV A;  5HE0 B;  3EI1 B;  3L4M D;  3EI2 A;  4QQE A;  2AGL A;  5K19 A;  3OKT A;  3AL9 A;  2O9K A;  5THA A;  5AFU 3;  1GG2 B;  4BH6 A;  5EAL A;  3EWE A;  2B4E A;  3EI3 A;  5I5M A;  4A0A A;  4H5J A;  5FXY A;  1JMX B;  3I89 A;  5I5J A;  4J78 A;  4A2M A;  3F3G A;  2H14 A;  4KFM B;  2CE9 A;  2I0R A;  1OLZ A;  5CXC A;  2XL3 A;  3UKU C;  3AL8 A;  3UR4 A;  2UZY B;  2XYI A;  4A0B A;  3CIK B;  5HE3 B;  3KRX B;  3FM0 A;  4JSP C;  2HXC A;  4Z8L A;  3SJL D;  4LG8 A;  3DWL C;  3F3P A;  4JSX C;  3ODT A;  5H1M A;  4PC0 A;  2P9L C;  2P9S C;  3VA6 A;  3MKQ A;  1YFQ A;  2YBA A;  1N6E A;  3IIW A;  3MZK A;  3GRE A;  3OTT A;  3CFV A;  5B4W A;  5EMJ B;  1PBY B;  5FKS A;  4LGN A;  4A0A B;  3VGZ A;  3JAM g;  1Q47 A;  3RFG A;  2YB8 B;  5EM2 A;  2IWK A;  4QT8 A;  1QNI A;  2YNP A;  3DSM A;  2Z2O A;  2H6N A;  1PEV A;  3SXT D;  1MDA H;  3SCY A;  3K27 A; 
#chains in the Genus database with same CATH topology
 4HDJ A;  2BKL A;  2EBS A;  3T3P A;  3F3F A;  3JB9 L;  2QR5 A;  3CFS B;  5AMS A;  4ERZ A;  1JV2 A;  2IUQ A;  1JOF A;  3NID A;  1GXR A;  4EWR A;  3PXS D;  4K3J B;  5E6U A;  4BL0 A;  4FAV D;  2EIB A;  1GOH A;  3HFQ A;  3IUN A;  1XIP A;  4CZX A;  4L9O A;  3MXX A;  4J79 A;  4FA9 D;  3VI3 A;  2G9A A;  3IIY A;  3EG6 A;  4O3U B;  5FFG A;  4IA9 A;  5TEF A;  4ERQ A;  3N0D A;  3O4G A;  4UM9 A;  3UVN A;  5GMK n;  3E0C A;  1VZ3 A;  4L3H D;  1R5M A;  4NAA A;  3I8E A;  3OW8 A;  5I5I A;  1N6D A;  2GC7 A;  4MMY A;  5CXB A;  1E8N A;  4CY3 A;  4TZ4 A;  4WK0 A;  4A09 B;  4A0B B;  2CN2 A;  1SQ9 A;  2IAA A;  1NR0 A;  4JHP C;  2BBK H;  4J8B A;  3GFC A;  4JD2 C;  2PM9 A;  3B7F A;  1C9L A;  4GZ8 A;  5HE2 B;  4L1Q D;  2CN3 A;  2OVP B;  4ZOY A;  1O6F A;  4J87 A;  3J80 g;  1L5G A;  3J81 g;  3SLE D;  2VZ1 A;  3SWS D;  5TF2 A;  2Q7Q A;  3PSL A;  4E5Z A;  2AH1 A;  4K3I D;  4J77 A;  3FGB A;  5IC7 A;  3RN0 D;  4BP8 A;  3IKO A;  2J56 H;  2XE4 A;  1VYH C;  3I7H A;  3SFZ A;  1QFS A;  2HJB A;  4MMX A;  3V7D B;  3PVU B;  5FLX g;  3OL2 A;  4FA1 D;  4CY1 A;  2H9N A;  5TEE A;  5AJA A;  3ORV D;  4XEI C;  4GQB B;  3BWS A;  4A09 A;  2VDL A;  4O02 A;  4O45 A;  1MG2 A;  2B5N A;  2WQ8 A;  4PBY A;  4E54 B;  4FWW A;  5GSA A;  3NVN A;  3EI3 B;  5FKT A;  3PXT D;  2H3X A;  3I8C A;  4CI2 A;  1T2X A;  1M1X A;  4Z7N A;  1VZ2 A;  3IUM A;  4DNV A;  1H2W A;  1UOP A;  4U1E I;  3KRW B;  4GGA A;  2AH0 A;  1N6F A;  4CY2 A;  4J0X A;  5FKR A;  2H9L A;  5CXC B;  5JWZ A;  1U8C A;  4GM8 A;  3ZDX A;  2P9N C;  4QL1 A;  3EI1 A;  4A11 B;  4NBM A;  3EQ8 A;  3NVQ A;  1VE6 A;  3EMH A;  4LG9 A;  4WK4 A;  1SQJ A;  4J0W A;  3C9C A;  3SMR A;  2HU7 A;  5EMK B;  1TYQ C;  2P9K C;  4NSX A;  5E6R A;  5C86 A;  1JTD B;  4ESG A;  4WK2 A;  4BCC A;  1UTC A;  3SBQ A;  3DXK C;  4H5I A;  1XKS A;  2YNN A;  4UI9 R;  4GM3 A;  4JHN A;  4X60 B;  2HYE A;  3I7L A;  1PGU A;  3U4Y A;  1XHM A;  2HKR A;  1L0Q A;  3K26 A;  4FAN D;  3DXM C;  2OK4 A;  3JZN A;  3NIF A;  1QFM A;  3UVM A;  4WJK A;  3SN6 B;  4PBZ A;  4ZOZ A;  2VC2 A;  4CI3 A;  3C75 H;  1JMZ B;  3A0F A;  3IJ1 A;  4A11 A;  4MK0 B;  5HQG A;  5EM2 B;  3I7K A;  4Y5R D;  2VDN A;  4ZOV A;  2OVQ B;  2I0T A;  3RFH A;  4GGD A;  2PM7 B;  3EI4 B;  5EAP A;  4OZU A;  2CO0 C;  2HU5 A;  2QXV A;  3PSC B;  5C9Z B;  4AEZ A;  3W15 A;  3O4J A;  5CYK A;  4FHL A;  4E5Z B;  1B9Y A;  4MMZ A;  2AGW A;  4J84 A;  4GGC A;  3MUO A;  2I0S A;  2OJY A;  5C2V B;  4QAM A;  3AH8 B;  3N0E A;  3EQ9 A;  3VH0 A;  2I3T A;  4JXM A;  4A08 B;  2H13 A;  3BG0 A;  4I79 A;  3I7P A;  2HKM A;  5TDH B;  3ULE C;  4A7J A;  4J8G A;  4JSV C;  2H47 A;  4L1M A;  3L4O D;  3I7N A;  4IMM A;  2XDW A;  3I2N A;  3JZG A;  2H9M A;  3IUL A;  4NEN A;  5FQD A;  2G99 A;  4ZOX A;  4BCD A;  4R7A B;  1TBG A;  1RI6 A;  4J81 A;  1S4U X;  3PXW D;  4Z7Q A;  3IJC A;  5CXB B;  3IJE A;  4O9D A;  2AGZ A;  2B5M A;  4D6V A;  5C2W B;  4X3E A;  3ZWL B;  4X63 B;  4BUJ C;  5CYK B;  2EIE A;  4PSW B;  5HDB A;  2PBI B;  5IT9 g;  4J73 A;  4J86 A;  4O2W A;  1A0R B;  3V4P A;  4XYH A;  4ERY A;  4JT5 C;  2GNQ A;  3FCS A;  4G55 A;  4PSX B;  4O1Q D;  5H14 A;  4ES0 A;  4G56 B;  5EMM B;  1OMW B;  3MMY A;  3ZDZ A;  3K71 A;  3OL2 B;  4BP9 A;  2P9P C;  4XYI A;  3RLM D;  1H2X A;  2HU8 A;  5GXH A;  5FA5 B;  2VZ3 A;  4PNK B;  4RE5 A;  3SHF A;  2CE8 A;  2HES X;  3PE7 A;  4GQ1 A;  3SBR A;  3V5W B;  4N14 A;  2Z2P A;  3EI2 B;  4DNU A;  1H2Y A;  4X61 B;  4L3G D;  4FA5 D;  1U4C A;  3FRX A;  4YVD A;  2IUR A;  2H68 A;  5IGO A;  4QRJ A;  3IUQ A;  3RSE C;  1E5T A;  2TRC B;  2VDK A;  3C5M A;  2JKX A;  3DM0 A;  4FB1 D;  3K6S A;  2UZX B;  1FWX A;  2OIZ A;  3JRO A;  2YNO A;  3MZL A;  4AMY A;  2OK6 A;  4A2L A;  2H6Q A;  3UVK A;  4AMZ A;  4ZN4 A;  3I7O A;  4CZY A;  2H9P A;  1K8K C;  4CZV A;  3OKW A;  5H17 A;  4JT6 C;  3ZE0 A;  3OKY B;  3V9F A;  2Z2N A;  5SXM A;  3NVX A;  3NIG A;  2XZG A;  3O4H A;  1U2V C;  3JZH A;  4J82 A;  1GOT B;  2AGX A;  2HJ4 A;  5EAM A;  4E54 A;  3JRP A;  5HYN B;  1JJU B;  4CI1 A;  3VI4 A;  4O3T B;  5M5R A;  4D0K A;  3IVM A;  2H6K A;  2QC5 A;  4AN1 A;  5E6S A;  5M61 A;  2CO0 A;  1MG3 A;  1B9X A;  5EAR A;  3GC3 B;  4A08 A;  1SHY B;  3BG1 A;  2AGY A;  2AQ5 A;  4JSN C;  3O4I A;  2OVR B;  5FKQ A;  1NEX B;  3MUN A;  4Y7R A;  4G1E A;  1GOF A;  2GC4 A;  2W18 A;  4NC4 A;  4PXW A;  5IJ8 E;  4CC9 A;  4GM9 A;  5GXI A;  4D9S A;  4Z7O A;  4OWR A;  2VDP A;  2VDR A;  2BCJ B;  2YMU A;  3RRM C;  1P22 A;  2J57 G;  3SBP A;  3UVO A;  2MTA H;  5A2Q g;  2B5L A;  2PM6 B;  2XL2 A;  4DNW A;  1BPO A;  3K72 A;  4GMB A;  4U7A A;  5HE1 B;  5IGQ A;  3KCI A;  5C92 A;  1TYE A;  2EIC A;  3UVL A;  5KDO B;  3RMZ D;  3P4F A;  2PM9 B;  3AFC A;  1UOQ A;  2EID A;  2XU7 A;  2CNX A;  3DDU A;  3EI4 A;  3RN1 D;  4CI8 A;  4CY5 A;  5FFO A;  3JPX A;  3MKS B;  2P9I C;  4FA4 D;  4AOW A;  1H2Z A;  1GP2 B;  3ZE2 A;  2P9U C;  4AN0 A;  2J55 H;  5EML B;  5K1C C;  3ZDY A;  1UOO A;  3IUJ A;  2I3S A;  3SVW D;  3C99 A;  3T3M A;  2QZP A;  2VDM A;  3IUR A;  3UKR C;  3OKY A;  3IJ0 A;  1VE7 A;  4GQ2 P;  2IWF A;  3EU7 A;  2IUP A;  3FCU A;  1PI6 A;  1K32 A;  3AL8 B;  3PVW B;  1ERJ A;  5IJ7 E;  2IUV A;  5HE0 B;  3EI1 B;  3L4M D;  3EI2 A;  4QQE A;  2AGL A;  5K19 A;  5M5T A;  3OKT A;  3AL9 A;  3OF7 A;  2O9K A;  5THA A;  5AFU 3;  5M5U A;  1GG2 B;  4BH6 A;  5EAL A;  4AX4 A;  3EWE A;  2B4E A;  3EQ7 A;  4BCB A;  3EI3 A;  5I5M A;  4A0A A;  2VDO A;  4H5J A;  5FXY A;  1JMX B;  3I89 A;  5I5J A;  4J78 A;  4A2M A;  3F3G A;  3MVD K;  2H14 A;  4KFM B;  2CE9 A;  2I0R A;  1OLZ A;  3QI0 A;  2XL3 A;  3GD1 I;  5CXC A;  3AL8 A;  3UKU C;  3UR4 A;  2UZY B;  2XYI A;  4A0B A;  3CIK B;  4UM8 A;  5HE3 B;  3ZE1 A;  3KRX B;  3FM0 A;  4JSP C;  2HXC A;  3QHY B;  1I2M B;  4Z8L A;  3SJL D;  4LG8 A;  3DWL C;  3F3P A;  4G1M A;  4JSX C;  1YR2 A;  3ODT A;  5H1M A;  4IRZ A;  1GOG A;  4PC0 A;  2P9L C;  2P9S C;  3VA6 A;  3MKQ A;  1YFQ A;  3V4V A;  2YBA A;  1K3I A;  1N6E A;  3IIW A;  3MZK A;  3GRE A;  1E8M A;  3CFV A;  3OTT A;  5B4W A;  5EMJ B;  1O6G A;  1PBY B;  1A12 A;  5FKS A;  4LGN A;  4A0A B;  3VGZ A;  3JAM g;  1Q47 A;  3RFG A;  2YB8 B;  5EM2 A;  5M5V A;  2IWK A;  4RE6 A;  4QT8 A;  5M5S A;  1QNI A;  2VDQ A;  2YNP A;  3DSM A;  2Z2O A;  2H6N A;  1PEV A;  3SXT D;  1MDA H;  1C9I A;  3SCY A;  3K27 A; 
#chains in the Genus database with same CATH homology
 4HDJ A;  2EBS A;  3JB9 L;  3F3F A;  3CFS B;  5AMS A;  4ERZ A;  2IUQ A;  1JOF A;  4EWR A;  1GXR A;  3PXS D;  4K3J B;  4BL0 A;  4FAV D;  3HFQ A;  1XIP A;  4CZX A;  4L9O A;  3MXX A;  4J79 A;  4FA9 D;  2G9A A;  3IIY A;  3EG6 A;  4O3U B;  4IA9 A;  5TEF A;  4ERQ A;  3N0D A;  5GMK n;  3UVN A;  3E0C A;  4L3H D;  1R5M A;  3I8E A;  3OW8 A;  5I5I A;  1N6D A;  2GC7 A;  5CXB A;  4CY3 A;  4TZ4 A;  4A09 B;  4A0B B;  2CN2 A;  1SQ9 A;  2IAA A;  1NR0 A;  2BBK H;  4J8B A;  3GFC A;  4JD2 C;  2PM9 A;  3B7F A;  4GZ8 A;  5HE2 B;  4L1Q D;  2CN3 A;  2OVP B;  4ZOY A;  4J87 A;  3J80 g;  3J81 g;  3SLE D;  3SWS D;  5TF2 A;  2Q7Q A;  3PSL A;  4E5Z A;  2AH1 A;  4K3I D;  4J77 A;  3FGB A;  5IC7 A;  3RN0 D;  3IKO A;  2J56 H;  1VYH C;  3I7H A;  3SFZ A;  2HJB A;  3V7D B;  3PVU B;  5FLX g;  3OL2 A;  4FA1 D;  4CY1 A;  2H9N A;  5TEE A;  5AJA A;  3ORV D;  4XEI C;  4GQB B;  3BWS A;  4A09 A;  4O45 A;  1MG2 A;  2B5N A;  4PBY A;  4E54 B;  4FWW A;  5GSA A;  3NVN A;  3EI3 B;  5FKT A;  3PXT D;  2H3X A;  3I8C A;  4CI2 A;  4U1E I;  3KRW B;  4GGA A;  2AH0 A;  1N6F A;  4CY2 A;  4J0X A;  5FKR A;  2H9L A;  5CXC B;  5JWZ A;  4GM8 A;  2P9N C;  4QL1 A;  3EI1 A;  4A11 B;  3NVQ A;  3EMH A;  4LG9 A;  1SQJ A;  4J0W A;  3C9C A;  3SMR A;  5EMK B;  1TYQ C;  2P9K C;  4NSX A;  4ESG A;  3SBQ A;  3DXK C;  4H5I A;  1XKS A;  2YNN A;  4UI9 R;  4GM3 A;  4X60 B;  2HYE A;  3I7L A;  1PGU A;  3U4Y A;  1XHM A;  2HKR A;  1L0Q A;  3K26 A;  4FAN D;  3DXM C;  2OK4 A;  3JZN A;  3UVM A;  3SN6 B;  4PBZ A;  4ZOZ A;  4CI3 A;  3C75 H;  1JMZ B;  3A0F A;  3IJ1 A;  4A11 A;  4MK0 B;  5HQG A;  5EM2 B;  3I7K A;  4Y5R D;  4ZOV A;  2OVQ B;  2I0T A;  3RFH A;  4GGD A;  2PM7 B;  3EI4 B;  5EAP A;  4OZU A;  2CO0 C;  2QXV A;  3PSC B;  5C9Z B;  4AEZ A;  3W15 A;  5CYK A;  4FHL A;  4E5Z B;  1B9Y A;  2AGW A;  4J84 A;  4GGC A;  2I0S A;  2OJY A;  5C2V B;  3AH8 B;  3N0E A;  3VH0 A;  2I3T A;  4JXM A;  4A08 B;  2H13 A;  3BG0 A;  4I79 A;  3I7P A;  2HKM A;  5TDH B;  3ULE C;  4A7J A;  4J8G A;  4JSV C;  2H47 A;  3I7N A;  4IMM A;  3L4O D;  3I2N A;  3JZG A;  2H9M A;  5FQD A;  2G99 A;  4ZOX A;  4R7A B;  1TBG A;  1RI6 A;  4J81 A;  1S4U X;  3PXW D;  3IJC A;  5CXB B;  4O9D A;  2AGZ A;  2B5M A;  4D6V A;  5C2W B;  4X3E A;  3ZWL B;  4X63 B;  4BUJ C;  5CYK B;  4PSW B;  2PBI B;  5IT9 g;  4J73 A;  4J86 A;  1A0R B;  4XYH A;  4ERY A;  4JT5 C;  2GNQ A;  4PSX B;  5H14 A;  4ES0 A;  4O1Q D;  4G56 B;  5EMM B;  1OMW B;  3MMY A;  3OL2 B;  2P9P C;  4XYI A;  3RLM D;  5GXH A;  5FA5 B;  4PNK B;  3SHF A;  2CE8 A;  2HES X;  3PE7 A;  4GQ1 A;  3SBR A;  3V5W B;  4N14 A;  2Z2P A;  3EI2 B;  4X61 B;  4L3G D;  4FA5 D;  1U4C A;  3FRX A;  4YVD A;  2IUR A;  2H68 A;  5IGO A;  4QRJ A;  3RSE C;  2TRC B;  3C5M A;  3DM0 A;  4FB1 D;  2UZX B;  1FWX A;  2OIZ A;  3JRO A;  2YNO A;  3MZL A;  2OK6 A;  4A2L A;  2H6Q A;  3UVK A;  4ZN4 A;  3I7O A;  4CZY A;  2H9P A;  1K8K C;  4CZV A;  3OKW A;  5H17 A;  4JT6 C;  3OKY B;  3V9F A;  2Z2N A;  5SXM A;  3NVX A;  1U2V C;  3JZH A;  4J82 A;  1GOT B;  2AGX A;  2HJ4 A;  5EAM A;  4E54 A;  3JRP A;  5HYN B;  1JJU B;  4CI1 A;  4O3T B;  4D0K A;  2H6K A;  2QC5 A;  2CO0 A;  1MG3 A;  1B9X A;  5EAR A;  4A08 A;  1SHY B;  3BG1 A;  2AGY A;  2AQ5 A;  4JSN C;  2OVR B;  5FKQ A;  1NEX B;  4Y7R A;  2GC4 A;  2W18 A;  4PXW A;  5IJ8 E;  4CC9 A;  4GM9 A;  5GXI A;  4OWR A;  3SBP A;  2BCJ B;  2YMU A;  3RRM C;  1P22 A;  2J57 G;  3UVO A;  5A2Q g;  2MTA H;  2B5L A;  2PM6 B;  2XL2 A;  4GMB A;  4U7A A;  5HE1 B;  5IGQ A;  3UVL A;  5KDO B;  3RMZ D;  3P4F A;  2PM9 B;  3AFC A;  2XU7 A;  3EI4 A;  2CNX A;  3RN1 D;  4CI8 A;  4CY5 A;  3JPX A;  3MKS B;  2P9I C;  4FA4 D;  4AOW A;  1GP2 B;  2P9U C;  2J55 H;  5EML B;  5K1C C;  2I3S A;  3SVW D;  3C99 A;  3UKR C;  3OKY A;  3IJ0 A;  4GQ2 P;  2IWF A;  3EU7 A;  2IUP A;  1PI6 A;  1K32 A;  3AL8 B;  3PVW B;  1ERJ A;  5IJ7 E;  2IUV A;  5HE0 B;  3EI1 B;  3L4M D;  3EI2 A;  4QQE A;  2AGL A;  5K19 A;  3OKT A;  3AL9 A;  2O9K A;  5THA A;  5AFU 3;  1GG2 B;  4BH6 A;  5EAL A;  3EWE A;  2B4E A;  3EI3 A;  5I5M A;  4A0A A;  4H5J A;  5FXY A;  1JMX B;  3I89 A;  5I5J A;  4J78 A;  4A2M A;  3F3G A;  2H14 A;  4KFM B;  2CE9 A;  2I0R A;  1OLZ A;  5CXC A;  2XL3 A;  3UKU C;  3AL8 A;  3UR4 A;  2UZY B;  2XYI A;  4A0B A;  3CIK B;  5HE3 B;  3KRX B;  3FM0 A;  4JSP C;  2HXC A;  4Z8L A;  3SJL D;  4LG8 A;  3DWL C;  3F3P A;  4JSX C;  3ODT A;  5H1M A;  4PC0 A;  2P9L C;  2P9S C;  3VA6 A;  3MKQ A;  1YFQ A;  2YBA A;  1N6E A;  3IIW A;  3MZK A;  3GRE A;  3OTT A;  3CFV A;  5B4W A;  5EMJ B;  1PBY B;  5FKS A;  4LGN A;  4A0A B;  3VGZ A;  3JAM g;  1Q47 A;  3RFG A;  2YB8 B;  5EM2 A;  2IWK A;  4QT8 A;  1QNI A;  2YNP A;  3DSM A;  2Z2O A;  2H6N A;  1PEV A;  3SXT D;  1MDA H;  3SCY A;  3K27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...