1MG2D

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
147
structure length
147
Chain Sequence
APQFFNIIDGSPLNFDDAMEEGRDTEAVKHFLETGENVYNEDPEILPEAEELYAGMCSGCHGHYAEGKIGPGLNDAYWTYPGNETDVGLFSTLYGGATGQMGPMWGSLTLDEMLRTMAWVRHLYTGDPKDASWLTDEQKAGFTPFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase, heavy chain
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 41
structure length 147
sequence length 147
chains with identical sequence H, L, P
ec nomenclature
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1mg2D00
2GIWA 1CO6A 2JQRA 4L3HA 3H1KD 5EXQA 1FCDC 4XXLA 1R0QA 2D0SA 1L9JC 3O5CA 3VYMA 4AALA 2OZ1B 1AOFA 1CRGA 1CTYA 1GKSA 5CIFB 1SQPD 1IRWA 3PXSA 1C2RA 3HQ8A 4FA1A 2GC7D 4RSZA 3SXTA 1S6VB 1W5CT 1IZL0 2C1DA 1A2SA 1FHBA 3SLEA 1YNRA 3MK7B 4EICA 2AI5A 3DMIA 1H9YA 1CEDA 3OA8B 3L74D 4Y5RA 3NBTA 2BPBB 4FA9A 1M60A 2YCCA 1HH7A 1EB7A 1HZUA 3TYIA 4EIFA 4WQBA 1RAPA 1DIIC 1QL4A 5DJQB 2MHMA 1YCCA 1YICA 1N50A 1DVVA 1LS9A 1OCDA 5IY51 1MZ4A 1CHHA 1I54A 1CXAA 4AX3A 1L0LD 1HRCA 5DF5A 1I8PA 1CYJA 1IRVA 2AXTV 3MK7C 1NMIA 3ZOOA 1HZVA 1SQVD 1GJQA 4PW9B 4P4QB 1CIGA 1NMLA 3HQ6A 1CRIA 4MU8A 1HROA 1EZVD 2YQBA 1I6DA 1LC2A 2BGVX 1YIQA 3L75D 1W2LA 3HQ7A 2XTSB 4H0JA 2BLFB 5DJQC 4H0KA 1H32B 1K3GA 1C6RA 1QYZA 3BCCD 4JCGA 1CYIA 1KB9D 5CIGB 3O20A 1H32A 3WFDC 1P84D 5KLIB 5KAIV 1DIQC 1CSUA 2B10B 3CX5W 1CRJA 2HV4A 4GYDA 5TISV 1H9XA 1K3HA 1RZ6A 4K3IA 4J20A 1HJ5A 1WEJF 4Q5PA 4L1QA 2ZONG 3C2CA 3RN1A 1YEBA 4O1WA 2QJYB 1M6ZA 1BL9A 3H1LD 1YEAA 1CIFA 1I8OA 2N3BA 1GQ1A 2VHDA 1DVHA 4PD4D 4QAOA 1BGYD 1KYOW 1CORA 1E8EA 1CHIA 2OZ1A 3H1JD 2YK3A 1QKSA 5KLVD 1YFCA 2C8SA 1C7MA 2CE0A 1I5TA 2ZBOA 2PACA 1OAEA 4AAMA 1FI3A 2JTIB 3VNWA 4U3FD 3OCDB 3PXWA 1BCCD 2FWLA 2A06D 4PWAA 4GEDB 1QL3A 3M97X 3DR0A 1YTCA 1ZZHA 3CX5D 1N15A 4UB8V 1COTA 1I55A 4YE1A 2GC4D 1MG3D 2ZZS1 3DP5A 3WFBC 1KV9A 1NNOA 3SJLA 1NU1D 2CA3B 1CC5A 1KB0A 3OA8A 3WFCC 1AOQA 1KX2A 1CXCA 2QJPB 4FA5A 2N9IA 3VRDA 5GTIV 3L71D 3RN0A 2MTAC 3CXHW 1NIRA 4WQ9A 5DFSA 1H33B 2CXBA 1KYOD 3L4OA 5B66V 1MG2D 4WQCA 3ORVA 1DT1A 1DW0A 1VYDA 1CTZA 1CCHA 1RZ5A 1PP9D 3ZOYA 3CU4A 2DGEA 3WC8A 1DW3A 2QJKB 1C52A 1N9CA 1I6EA 1A8CA 1DW1A 1ZRTD 1FJ0A 2FYUD 4DY9A 1CSWA 3O0RC 1F1FA 5CIBB 3ZIYA 1IQCA 1CYCA 3SVWA 1LMSA 3CWBD 1CHJA 1GU2A 3A0HV 3CXHD 2EXVA 3PH2B 1HJ3A 3JBTB 4KMGA 3WFEC 1LC1A 3A0BV 1NTKD 2IBZD 1S5LV 1WVEC 2AIUA 4FAVA 2C1VA 4O1QA 5CIHB 2I8FA 1U75B 1CIHA 351CA 1IO3A 4PJ0V 3SWSA 1CRHA 5B6QA 2ZOOA 3O1YA 4NFGB 2N18B 2N3YA 4L3GA 3HQ9A 2CA4B 3ZOXA 4LJIA 2BCCD 3L70D 3CYTI 3ZOWA 2C1DB 4WQ7A 4WQDA 4FANA 1CSVA 1C75A 2B11B 1CNOA 155CA 4V2KA 2FYNB 4WQ8A 1NTMD 2PCCB 1CRYA 4AANA 3OCDA 4WQAA 3RMZA 1LFMA 2N9JA 1KIBA 1HCMA 5C0ZA 5CICB 3KZIV 4IL6V 1C6SA 2DVHA 3L4MA 3WUIA 2C1UA 4FB1A 3L72D 2N18C 2V08A 4FA4A 2PCBB 1GIWA 3WU2V 1GDVA 2L4DA 1HJ4A 1H1OA 1J3SA 5CIEB 5KAFV 1ETPA 1FI9A 2V07A 4AAOA 1CSXA 1SQQD 2C2CA 2FRCA 5KKZB 1F1CA 1H33A 1DW2A 4EIDA 1B7VA 2B4ZA 3H1HD 1BE3D 4WQEA 1QN2A 3H1ID 5C9MA 1KX7A 2ZXYA 3CP5A 1H31B 5B5EV 1PPJD 4XYDB 2YIUB 5AURA 2BCNB 1SQBD 3RLMA 3NWVA 1H31A 1E29A 5H2FV 2D0WA 1SQXD 1C6OA 1FOCA 4D6TD 3TGUD 1U74B 2B12B 2CE1A 5CYTR 1A56A 1L9BC 2C9XB 3NBSA 2ORLA 2LIRA 3X39A 451CA 3L73D 1NTZD 1E2RA 5CIDB 2B0ZB 1N90A 1JDLA 2BH4X 4EIEA 1CIEA 5GTHV 1AKKA 2LITA 3PXTA 3ZBMA 1FI7A 3ZCFA 1AYGA 2GB8B 4UB6V 5E79V 1CCRA 1RAQA 1CRCA 4N0KA 1L0ND 1M70A 2BH5X 3A9FA 1CTJA 1C2NA
chains in the Genus database with same CATH superfamily
2GIWA 1CO6A 2JQRA 4L3HA 3H1KD 5EXQA 1FCDC 4XXLA 1R0QA 2D0SA 1L9JC 3O5CA 3VYMA 4AALA 2OZ1B 1AOFA 1CRGA 1CTYA 1GKSA 5CIFB 1SQPD 1IRWA 3PXSA 1C2RA 3HQ8A 4FA1A 2GC7D 4RSZA 3SXTA 1S6VB 1W5CT 1IZL0 2C1DA 1A2SA 1FHBA 3SLEA 1YNRA 3MK7B 4EICA 2AI5A 3DMIA 1H9YA 1CEDA 3OA8B 3L74D 4Y5RA 3NBTA 2BPBB 4FA9A 1M60A 2YCCA 1HH7A 1EB7A 1HZUA 3TYIA 4EIFA 4WQBA 1RAPA 1DIIC 1QL4A 5DJQB 2MHMA 1YCCA 1YICA 1N50A 1DVVA 1LS9A 1OCDA 5IY51 1MZ4A 1CHHA 1I54A 1CXAA 4AX3A 1L0LD 1HRCA 5DF5A 1I8PA 1CYJA 1IRVA 2AXTV 3MK7C 1NMIA 3ZOOA 1HZVA 1SQVD 1GJQA 4PW9B 4P4QB 1CIGA 1NMLA 3HQ6A 1CRIA 4MU8A 1HROA 1EZVD 2YQBA 1I6DA 1LC2A 2BGVX 1YIQA 3L75D 1W2LA 3HQ7A 2XTSB 4H0JA 2BLFB 5DJQC 4H0KA 1H32B 1K3GA 1C6RA 1QYZA 3BCCD 4JCGA 1CYIA 1KB9D 5CIGB 3O20A 1H32A 3WFDC 1P84D 5KLIB 5KAIV 1DIQC 1CSUA 2B10B 3CX5W 1CRJA 2HV4A 4GYDA 5TISV 1H9XA 1K3HA 1RZ6A 4K3IA 4J20A 3D0WA 1HJ5A 1WEJF 4Q5PA 4L1QA 2ZONG 3C2CA 3RN1A 1YEBA 4O1WA 2QJYB 1M6ZA 1BL9A 3H1LD 1YEAA 1CIFA 1I8OA 2N3BA 1GQ1A 2VHDA 1DVHA 4PD4D 4QAOA 1BGYD 1KYOW 1CORA 1E8EA 1CHIA 2OZ1A 3H1JD 2YK3A 1QKSA 5KLVD 1YFCA 2C8SA 1C7MA 2CE0A 1I5TA 2ZBOA 2PACA 1OAEA 4AAMA 1FI3A 2JTIB 3VNWA 4U3FD 3OCDB 3PXWA 1BCCD 2FWLA 2A06D 4PWAA 4GEDB 1QL3A 3M97X 3DR0A 1YTCA 1ZZHA 3CX5D 1N15A 4UB8V 1COTA 1I55A 4YE1A 2GC4D 1MG3D 2ZZS1 3DP5A 3WFBC 1KV9A 1NNOA 3SJLA 1NU1D 2CA3B 1CC5A 1KB0A 3OA8A 3WFCC 1AOQA 1KX2A 1CXCA 2QJPB 4FA5A 2N9IA 3VRDA 5GTIV 3L71D 3RN0A 2MTAC 3CXHW 1NIRA 4WQ9A 5DFSA 1H33B 2CXBA 1KYOD 3L4OA 5B66V 1MG2D 4WQCA 3ORVA 1DT1A 1DW0A 1VYDA 1CTZA 1CCHA 1RZ5A 1PP9D 3ZOYA 3CU4A 2DGEA 3WC8A 1DW3A 2QJKB 1C52A 1N9CA 1I6EA 1A8CA 1DW1A 1ZRTD 1FJ0A 2FYUD 4DY9A 1CSWA 3O0RC 1F1FA 5CIBB 3ZIYA 1IQCA 1CYCA 3SVWA 1LMSA 3CWBD 1CHJA 1GU2A 3A0HV 3CXHD 2EXVA 3PH2B 1HJ3A 3JBTB 4KMGA 3WFEC 1LC1A 3A0BV 1NTKD 2IBZD 1S5LV 1WVEC 2AIUA 4FAVA 2C1VA 4O1QA 5CIHB 2I8FA 1U75B 1CIHA 351CA 1IO3A 4PJ0V 3SWSA 1CRHA 5B6QA 2ZOOA 3O1YA 4NFGB 2N18B 2N3YA 4L3GA 3HQ9A 2CA4B 3ZOXA 4LJIA 2BCCD 3L70D 3CYTI 3ZOWA 2C1DB 4WQ7A 4WQDA 4FANA 1CSVA 1C75A 2B11B 1CNOA 155CA 4V2KA 2FYNB 4WQ8A 1NTMD 2PCCB 1CRYA 4AANA 3OCDA 4WQAA 3RMZA 1LFMA 2N9JA 1KIBA 1HCMA 5C0ZA 5CICB 3KZIV 4IL6V 1C6SA 2DVHA 3L4MA 3WUIA 2C1UA 4FB1A 3L72D 2N18C 2V08A 4FA4A 2PCBB 1GIWA 3WU2V 1GDVA 2L4DA 1HJ4A 1H1OA 1J3SA 5CIEB 5KAFV 1ETPA 1FI9A 2V07A 4AAOA 1CSXA 1SQQD 2C2CA 2FRCA 5KKZB 1F1CA 1H33A 1DW2A 4EIDA 1B7VA 2B4ZA 3H1HD 1BE3D 4WQEA 1QN2A 3H1ID 5C9MA 1KX7A 2ZXYA 3CP5A 1H31B 5B5EV 1PPJD 4XYDB 2YIUB 5AURA 2BCNB 1SQBD 3RLMA 3NWVA 1H31A 1E29A 5H2FV 2D0WA 1SQXD 1C6OA 1FOCA 4D6TD 3TGUD 1U74B 2B12B 2CE1A 5CYTR 1A56A 1L9BC 2C9XB 3NBSA 2ORLA 2LIRA 3X39A 451CA 3L73D 1NTZD 1E2RA 5CIDB 2B0ZB 1N90A 1JDLA 2BH4X 4EIEA 1CIEA 5GTHV 1AKKA 2LITA 3PXTA 3ZBMA 1FI7A 3ZCFA 1AYGA 2GB8B 4UB6V 5E79V 1CCRA 1RAQA 1CRCA 4N0KA 1L0ND 1M70A 2BH5X 3A9FA 1CTJA 1C2NA
chains in the Genus database with same CATH topology
2GIWA 1CO6A 2JQRA 4L3HA 3H1KD 5EXQA 1FCDC 4XXLA 1R0QA 2D0SA 1L9JC 3O5CA 3VYMA 4AALA 2OZ1B 1AOFA 1CRGA 1CTYA 1GKSA 5CIFB 1SQPD 1IRWA 3PXSA 1C2RA 3HQ8A 4FA1A 2GC7D 4RSZA 3SXTA 1S6VB 1W5CT 1IZL0 2C1DA 1A2SA 1FHBA 3SLEA 1YNRA 3MK7B 4EICA 2AI5A 3DMIA 1H9YA 1CEDA 3OA8B 3L74D 4Y5RA 3NBTA 2BPBB 4FA9A 1M60A 2YCCA 1HH7A 1EB7A 1HZUA 3TYIA 4EIFA 4WQBA 1RAPA 1DIIC 1QL4A 5DJQB 2MHMA 1YCCA 1YICA 1N50A 1DVVA 1LS9A 1OCDA 5IY51 1MZ4A 1CHHA 1I54A 1CXAA 4AX3A 1L0LD 1HRCA 5DF5A 1I8PA 1CYJA 1IRVA 2AXTV 3MK7C 1NMIA 3ZOOA 1HZVA 1SQVD 1GJQA 4PW9B 4P4QB 1CIGA 1NMLA 3HQ6A 1CRIA 4MU8A 1HROA 1EZVD 2YQBA 1I6DA 1LC2A 2BGVX 1YIQA 3L75D 1W2LA 3HQ7A 2XTSB 4H0JA 2BLFB 5DJQC 4H0KA 1H32B 1K3GA 1C6RA 1QYZA 3BCCD 4JCGA 1CYIA 1KB9D 5CIGB 3O20A 1H32A 3WFDC 1P84D 5KLIB 5KAIV 1DIQC 1CSUA 2B10B 3CX5W 1CRJA 2HV4A 4GYDA 5TISV 1H9XA 1K3HA 1RZ6A 4K3IA 4J20A 1HJ5A 1WEJF 4Q5PA 4L1QA 2ZONG 3C2CA 3RN1A 1YEBA 4O1WA 2QJYB 1M6ZA 1BL9A 3H1LD 1YEAA 1CIFA 1I8OA 2N3BA 1GQ1A 2VHDA 1DVHA 4PD4D 4QAOA 1BGYD 1KYOW 1CORA 1E8EA 1CHIA 2OZ1A 3H1JD 2YK3A 1QKSA 5KLVD 1YFCA 2C8SA 1C7MA 2CE0A 1I5TA 2ZBOA 2PACA 1OAEA 4AAMA 1FI3A 2JTIB 3VNWA 4U3FD 3OCDB 3PXWA 1BCCD 2FWLA 2A06D 4PWAA 4GEDB 1QL3A 3M97X 3DR0A 1YTCA 1ZZHA 3CX5D 1N15A 4UB8V 1COTA 1I55A 4YE1A 2GC4D 1MG3D 2ZZS1 3DP5A 3WFBC 1KV9A 1NNOA 3SJLA 1NU1D 2CA3B 1CC5A 1KB0A 3OA8A 3WFCC 1AOQA 1KX2A 1CXCA 2QJPB 4FA5A 2N9IA 3VRDA 5GTIV 3L71D 3RN0A 2MTAC 3CXHW 1NIRA 4WQ9A 5DFSA 1H33B 2CXBA 1KYOD 3L4OA 5B66V 1MG2D 4WQCA 3ORVA 1DT1A 1DW0A 1VYDA 1CTZA 1CCHA 1RZ5A 1PP9D 3ZOYA 3CU4A 2DGEA 3WC8A 1DW3A 2QJKB 1C52A 1N9CA 1I6EA 1A8CA 1DW1A 1ZRTD 1FJ0A 2FYUD 4DY9A 1CSWA 3O0RC 1F1FA 5CIBB 3ZIYA 1IQCA 1CYCA 3SVWA 1LMSA 3CWBD 1CHJA 1GU2A 3A0HV 3CXHD 2EXVA 3PH2B 1HJ3A 3JBTB 4KMGA 3WFEC 1LC1A 3A0BV 1NTKD 2IBZD 1S5LV 1WVEC 2AIUA 4FAVA 2C1VA 4O1QA 5CIHB 2I8FA 1U75B 1CIHA 351CA 1IO3A 4PJ0V 3SWSA 1CRHA 5B6QA 2ZOOA 3O1YA 4NFGB 2N18B 2N3YA 4L3GA 3HQ9A 2CA4B 3ZOXA 4LJIA 2BCCD 3L70D 3CYTI 3ZOWA 2C1DB 4WQ7A 4WQDA 4FANA 1CSVA 1C75A 2B11B 1CNOA 155CA 4V2KA 2FYNB 4WQ8A 1NTMD 2PCCB 1CRYA 4AANA 3OCDA 4WQAA 3RMZA 1LFMA 2N9JA 1KIBA 1HCMA 5C0ZA 5CICB 3KZIV 4IL6V 1C6SA 2DVHA 3L4MA 3WUIA 2C1UA 4FB1A 3L72D 2N18C 2V08A 4FA4A 2PCBB 1GIWA 3WU2V 1GDVA 2L4DA 1HJ4A 1H1OA 1J3SA 5CIEB 5KAFV 1ETPA 1FI9A 2V07A 4AAOA 1CSXA 1SQQD 2C2CA 2FRCA 5KKZB 1F1CA 1H33A 1DW2A 4EIDA 1B7VA 2B4ZA 3H1HD 1BE3D 4WQEA 1QN2A 3H1ID 5C9MA 1KX7A 2ZXYA 3CP5A 1H31B 5B5EV 1PPJD 4XYDB 2YIUB 5AURA 2BCNB 1SQBD 3RLMA 3NWVA 1H31A 1E29A 5H2FV 2D0WA 1SQXD 1C6OA 1FOCA 4D6TD 3TGUD 1U74B 2B12B 2CE1A 5CYTR 1A56A 1L9BC 2C9XB 3NBSA 2ORLA 2LIRA 3X39A 451CA 3L73D 1NTZD 1E2RA 5CIDB 2B0ZB 1N90A 1JDLA 2BH4X 4EIEA 1CIEA 5GTHV 1AKKA 2LITA 3PXTA 3ZBMA 1FI7A 3ZCFA 1AYGA 2GB8B 4UB6V 5E79V 1CCRA 1RAQA 1CRCA 4N0KA 1L0ND 1M70A 2BH5X 3A9FA 1CTJA 1C2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GIW A;  1CO6 A;  2JQR A;  4L3H A;  3H1K D;  5EXQ A;  1FCD C;  4XXL A;  1R0Q A;  2D0S A;  1L9J C;  3O5C A;  3VYM A;  4AAL A;  2OZ1 B;  1AOF A;  1CRG A;  1CTY A;  1GKS A;  5CIF B;  1SQP D;  1IRW A;  3PXS A;  1C2R A;  3HQ8 A;  4FA1 A;  2GC7 D;  4RSZ A;  3SXT A;  1S6V B;  1W5C T;  1IZL 0;  2C1D A;  1A2S A;  1FHB A;  3SLE A;  1YNR A;  3MK7 B;  4EIC A;  2AI5 A;  3DMI A;  1H9Y A;  1CED A;  3OA8 B;  3L74 D;  4Y5R A;  3NBT A;  2BPB B;  4FA9 A;  1M60 A;  2YCC A;  1HH7 A;  1EB7 A;  1HZU A;  3TYI A;  4EIF A;  4WQB A;  1RAP A;  1DII C;  1QL4 A;  5DJQ B;  2MHM A;  1YCC A;  1YIC A;  1N50 A;  1DVV A;  1LS9 A;  1OCD A;  5IY5 1;  1MZ4 A;  1CHH A;  1I54 A;  1CXA A;  4AX3 A;  1L0L D;  1HRC A;  5DF5 A;  1I8P A;  1CYJ A;  1IRV A;  2AXT V;  3MK7 C;  1NMI A;  3ZOO A;  1HZV A;  1SQV D;  1GJQ A;  4PW9 B;  4P4Q B;  1CIG A;  1NML A;  3HQ6 A;  1CRI A;  4MU8 A;  1HRO A;  1EZV D;  2YQB A;  1I6D A;  1LC2 A;  2BGV X;  1YIQ A;  3L75 D;  1W2L A;  3HQ7 A;  2XTS B;  4H0J A;  2BLF B;  5DJQ C;  4H0K A;  1H32 B;  1K3G A;  1C6R A;  1QYZ A;  3BCC D;  4JCG A;  1CYI A;  1KB9 D;  5CIG B;  3O20 A;  1H32 A;  3WFD C;  1P84 D;  5KLI B;  5KAI V;  1DIQ C;  1CSU A;  2B10 B;  3CX5 W;  1CRJ A;  2HV4 A;  4GYD A;  5TIS V;  1H9X A;  1K3H A;  1RZ6 A;  4K3I A;  4J20 A;  1HJ5 A;  1WEJ F;  4Q5P A;  4L1Q A;  2ZON G;  3C2C A;  3RN1 A;  1YEB A;  4O1W A;  2QJY B;  1M6Z A;  1BL9 A;  3H1L D;  1YEA A;  1CIF A;  1I8O A;  2N3B A;  1GQ1 A;  2VHD A;  1DVH A;  4PD4 D;  4QAO A;  1BGY D;  1KYO W;  1COR A;  1E8E A;  1CHI A;  2OZ1 A;  3H1J D;  2YK3 A;  1QKS A;  5KLV D;  1YFC A;  2C8S A;  1C7M A;  2CE0 A;  1I5T A;  2ZBO A;  2PAC A;  1OAE A;  4AAM A;  1FI3 A;  2JTI B;  3VNW A;  4U3F D;  3OCD B;  3PXW A;  1BCC D;  2FWL A;  2A06 D;  4PWA A;  4GED B;  1QL3 A;  3M97 X;  3DR0 A;  1YTC A;  1ZZH A;  3CX5 D;  1N15 A;  4UB8 V;  1COT A;  1I55 A;  4YE1 A;  2GC4 D;  1MG3 D;  2ZZS 1;  3DP5 A;  3WFB C;  1KV9 A;  1NNO A;  3SJL A;  1NU1 D;  2CA3 B;  1CC5 A;  1KB0 A;  3OA8 A;  3WFC C;  1AOQ A;  1KX2 A;  1CXC A;  2QJP B;  4FA5 A;  2N9I A;  3VRD A;  5GTI V;  3L71 D;  3RN0 A;  2MTA C;  3CXH W;  1NIR A;  4WQ9 A;  5DFS A;  1H33 B;  2CXB A;  1KYO D;  3L4O A;  5B66 V;  1MG2 D;  4WQC A;  3ORV A;  1DT1 A;  1DW0 A;  1VYD A;  1CTZ A;  1CCH A;  1RZ5 A;  1PP9 D;  3ZOY A;  3CU4 A;  2DGE A;  3WC8 A;  1DW3 A;  2QJK B;  1C52 A;  1N9C A;  1I6E A;  1A8C A;  1DW1 A;  1ZRT D;  1FJ0 A;  2FYU D;  4DY9 A;  1CSW A;  3O0R C;  1F1F A;  5CIB B;  3ZIY A;  1IQC A;  1CYC A;  3SVW A;  1LMS A;  3CWB D;  1CHJ A;  1GU2 A;  3A0H V;  3CXH D;  2EXV A;  3PH2 B;  1HJ3 A;  3JBT B;  4KMG A;  3WFE C;  1LC1 A;  3A0B V;  1NTK D;  2IBZ D;  1S5L V;  1WVE C;  2AIU A;  4FAV A;  2C1V A;  4O1Q A;  5CIH B;  2I8F A;  1U75 B;  1CIH A;  351C A;  1IO3 A;  4PJ0 V;  3SWS A;  1CRH A;  5B6Q A;  2ZOO A;  3O1Y A;  4NFG B;  2N18 B;  2N3Y A;  4L3G A;  3HQ9 A;  2CA4 B;  3ZOX A;  4LJI A;  2BCC D;  3L70 D;  3CYT I;  3ZOW A;  2C1D B;  4WQ7 A;  4WQD A;  4FAN A;  1CSV A;  1C75 A;  2B11 B;  1CNO A;  155C A;  4V2K A;  2FYN B;  4WQ8 A;  1NTM D;  2PCC B;  1CRY A;  4AAN A;  3OCD A;  4WQA A;  3RMZ A;  1LFM A;  2N9J A;  1KIB A;  1HCM A;  5C0Z A;  5CIC B;  3KZI V;  4IL6 V;  1C6S A;  2DVH A;  3L4M A;  3WUI A;  2C1U A;  4FB1 A;  3L72 D;  2N18 C;  2V08 A;  4FA4 A;  2PCB B;  1GIW A;  3WU2 V;  1GDV A;  2L4D A;  1HJ4 A;  1H1O A;  1J3S A;  5CIE B;  5KAF V;  1ETP A;  1FI9 A;  2V07 A;  4AAO A;  1CSX A;  1SQQ D;  2C2C A;  2FRC A;  5KKZ B;  1F1C A;  1H33 A;  1DW2 A;  4EID A;  1B7V A;  2B4Z A;  3H1H D;  1BE3 D;  4WQE A;  1QN2 A;  3H1I D;  5C9M A;  1KX7 A;  2ZXY A;  3CP5 A;  1H31 B;  5B5E V;  1PPJ D;  4XYD B;  2YIU B;  5AUR A;  2BCN B;  1SQB D;  3RLM A;  3NWV A;  1H31 A;  1E29 A;  5H2F V;  2D0W A;  1SQX D;  1C6O A;  1FOC A;  4D6T D;  3TGU D;  1U74 B;  2B12 B;  2CE1 A;  5CYT R;  1A56 A;  1L9B C;  2C9X B;  3NBS A;  2ORL A;  2LIR A;  3X39 A;  451C A;  3L73 D;  1NTZ D;  1E2R A;  5CID B;  2B0Z B;  1N90 A;  1JDL A;  2BH4 X;  4EIE A;  1CIE A;  5GTH V;  1AKK A;  2LIT A;  3PXT A;  3ZBM A;  1FI7 A;  3ZCF A;  1AYG A;  2GB8 B;  4UB6 V;  5E79 V;  1CCR A;  1RAQ A;  1CRC A;  4N0K A;  1L0N D;  1M70 A;  2BH5 X;  3A9F A;  1CTJ A;  1C2N A; 
#chains in the Genus database with same CATH topology
 2GIW A;  1CO6 A;  2JQR A;  4L3H A;  3H1K D;  5EXQ A;  1FCD C;  4XXL A;  1R0Q A;  2D0S A;  1L9J C;  3O5C A;  3VYM A;  4AAL A;  2OZ1 B;  1AOF A;  1CRG A;  1CTY A;  1GKS A;  5CIF B;  1SQP D;  1IRW A;  3PXS A;  1C2R A;  3HQ8 A;  4FA1 A;  2GC7 D;  4RSZ A;  3SXT A;  1S6V B;  1W5C T;  1IZL 0;  2C1D A;  1A2S A;  1FHB A;  3SLE A;  1YNR A;  3MK7 B;  4EIC A;  2AI5 A;  3DMI A;  1H9Y A;  1CED A;  3OA8 B;  3L74 D;  4Y5R A;  3NBT A;  2BPB B;  4FA9 A;  1M60 A;  2YCC A;  1HH7 A;  1EB7 A;  1HZU A;  3TYI A;  4EIF A;  4WQB A;  1RAP A;  1DII C;  1QL4 A;  5DJQ B;  2MHM A;  1YCC A;  1YIC A;  1N50 A;  1DVV A;  1LS9 A;  1OCD A;  5IY5 1;  1MZ4 A;  1CHH A;  1I54 A;  1CXA A;  4AX3 A;  1L0L D;  1HRC A;  5DF5 A;  1I8P A;  1CYJ A;  1IRV A;  2AXT V;  3MK7 C;  1NMI A;  3ZOO A;  1HZV A;  1SQV D;  1GJQ A;  4PW9 B;  4P4Q B;  1CIG A;  1NML A;  3HQ6 A;  1CRI A;  4MU8 A;  1HRO A;  1EZV D;  2YQB A;  1I6D A;  1LC2 A;  2BGV X;  1YIQ A;  3L75 D;  1W2L A;  3HQ7 A;  2XTS B;  4H0J A;  2BLF B;  5DJQ C;  4H0K A;  1H32 B;  1K3G A;  1C6R A;  1QYZ A;  3BCC D;  4JCG A;  1CYI A;  1KB9 D;  5CIG B;  3O20 A;  1H32 A;  3WFD C;  1P84 D;  5KLI B;  5KAI V;  1DIQ C;  1CSU A;  2B10 B;  3CX5 W;  1CRJ A;  2HV4 A;  4GYD A;  5TIS V;  1H9X A;  1K3H A;  1RZ6 A;  4K3I A;  4J20 A;  3D0W A;  1HJ5 A;  1WEJ F;  4Q5P A;  4L1Q A;  2ZON G;  3C2C A;  3RN1 A;  1YEB A;  4O1W A;  2QJY B;  1M6Z A;  1BL9 A;  3H1L D;  1YEA A;  1CIF A;  1I8O A;  2N3B A;  1GQ1 A;  2VHD A;  1DVH A;  4PD4 D;  4QAO A;  1BGY D;  1KYO W;  1COR A;  1E8E A;  1CHI A;  2OZ1 A;  3H1J D;  2YK3 A;  1QKS A;  5KLV D;  1YFC A;  2C8S A;  1C7M A;  2CE0 A;  1I5T A;  2ZBO A;  2PAC A;  1OAE A;  4AAM A;  1FI3 A;  2JTI B;  3VNW A;  4U3F D;  3OCD B;  3PXW A;  1BCC D;  2FWL A;  2A06 D;  4PWA A;  4GED B;  1QL3 A;  3M97 X;  3DR0 A;  1YTC A;  1ZZH A;  3CX5 D;  1N15 A;  4UB8 V;  1COT A;  1I55 A;  4YE1 A;  2GC4 D;  1MG3 D;  2ZZS 1;  3DP5 A;  3WFB C;  1KV9 A;  1NNO A;  3SJL A;  1NU1 D;  2CA3 B;  1CC5 A;  1KB0 A;  3OA8 A;  3WFC C;  1AOQ A;  1KX2 A;  1CXC A;  2QJP B;  4FA5 A;  2N9I A;  3VRD A;  5GTI V;  3L71 D;  3RN0 A;  2MTA C;  3CXH W;  1NIR A;  4WQ9 A;  5DFS A;  1H33 B;  2CXB A;  1KYO D;  3L4O A;  5B66 V;  1MG2 D;  4WQC A;  3ORV A;  1DT1 A;  1DW0 A;  1VYD A;  1CTZ A;  1CCH A;  1RZ5 A;  1PP9 D;  3ZOY A;  3CU4 A;  2DGE A;  3WC8 A;  1DW3 A;  2QJK B;  1C52 A;  1N9C A;  1I6E A;  1A8C A;  1DW1 A;  1ZRT D;  1FJ0 A;  2FYU D;  4DY9 A;  1CSW A;  3O0R C;  1F1F A;  5CIB B;  3ZIY A;  1IQC A;  1CYC A;  3SVW A;  1LMS A;  3CWB D;  1CHJ A;  1GU2 A;  3A0H V;  3CXH D;  2EXV A;  3PH2 B;  1HJ3 A;  3JBT B;  4KMG A;  3WFE C;  1LC1 A;  3A0B V;  1NTK D;  2IBZ D;  1S5L V;  1WVE C;  2AIU A;  4FAV A;  2C1V A;  4O1Q A;  5CIH B;  2I8F A;  1U75 B;  1CIH A;  351C A;  1IO3 A;  4PJ0 V;  3SWS A;  1CRH A;  5B6Q A;  2ZOO A;  3O1Y A;  4NFG B;  2N18 B;  2N3Y A;  4L3G A;  3HQ9 A;  2CA4 B;  3ZOX A;  4LJI A;  2BCC D;  3L70 D;  3CYT I;  3ZOW A;  2C1D B;  4WQ7 A;  4WQD A;  4FAN A;  1CSV A;  1C75 A;  2B11 B;  1CNO A;  155C A;  4V2K A;  2FYN B;  4WQ8 A;  1NTM D;  2PCC B;  1CRY A;  4AAN A;  3OCD A;  4WQA A;  3RMZ A;  1LFM A;  2N9J A;  1KIB A;  1HCM A;  5C0Z A;  5CIC B;  3KZI V;  4IL6 V;  1C6S A;  2DVH A;  3L4M A;  3WUI A;  2C1U A;  4FB1 A;  3L72 D;  2N18 C;  2V08 A;  4FA4 A;  2PCB B;  1GIW A;  3WU2 V;  1GDV A;  2L4D A;  1HJ4 A;  1H1O A;  1J3S A;  5CIE B;  5KAF V;  1ETP A;  1FI9 A;  2V07 A;  4AAO A;  1CSX A;  1SQQ D;  2C2C A;  2FRC A;  5KKZ B;  1F1C A;  1H33 A;  1DW2 A;  4EID A;  1B7V A;  2B4Z A;  3H1H D;  1BE3 D;  4WQE A;  1QN2 A;  3H1I D;  5C9M A;  1KX7 A;  2ZXY A;  3CP5 A;  1H31 B;  5B5E V;  1PPJ D;  4XYD B;  2YIU B;  5AUR A;  2BCN B;  1SQB D;  3RLM A;  3NWV A;  1H31 A;  1E29 A;  5H2F V;  2D0W A;  1SQX D;  1C6O A;  1FOC A;  4D6T D;  3TGU D;  1U74 B;  2B12 B;  2CE1 A;  5CYT R;  1A56 A;  1L9B C;  2C9X B;  3NBS A;  2ORL A;  2LIR A;  3X39 A;  451C A;  3L73 D;  1NTZ D;  1E2R A;  5CID B;  2B0Z B;  1N90 A;  1JDL A;  2BH4 X;  4EIE A;  1CIE A;  5GTH V;  1AKK A;  2LIT A;  3PXT A;  3ZBM A;  1FI7 A;  3ZCF A;  1AYG A;  2GB8 B;  4UB6 V;  5E79 V;  1CCR A;  1RAQ A;  1CRC A;  4N0K A;  1L0N D;  1M70 A;  2BH5 X;  3A9F A;  1CTJ A;  1C2N A; 
#chains in the Genus database with same CATH homology
 2GIW A;  1CO6 A;  2JQR A;  4L3H A;  3H1K D;  5EXQ A;  1FCD C;  4XXL A;  1R0Q A;  2D0S A;  1L9J C;  3O5C A;  3VYM A;  4AAL A;  2OZ1 B;  1AOF A;  1CRG A;  1CTY A;  1GKS A;  5CIF B;  1SQP D;  1IRW A;  3PXS A;  1C2R A;  3HQ8 A;  4FA1 A;  2GC7 D;  4RSZ A;  3SXT A;  1S6V B;  1W5C T;  1IZL 0;  2C1D A;  1A2S A;  1FHB A;  3SLE A;  1YNR A;  3MK7 B;  4EIC A;  2AI5 A;  3DMI A;  1H9Y A;  1CED A;  3OA8 B;  3L74 D;  4Y5R A;  3NBT A;  2BPB B;  4FA9 A;  1M60 A;  2YCC A;  1HH7 A;  1EB7 A;  1HZU A;  3TYI A;  4EIF A;  4WQB A;  1RAP A;  1DII C;  1QL4 A;  5DJQ B;  2MHM A;  1YCC A;  1YIC A;  1N50 A;  1DVV A;  1LS9 A;  1OCD A;  5IY5 1;  1MZ4 A;  1CHH A;  1I54 A;  1CXA A;  4AX3 A;  1L0L D;  1HRC A;  5DF5 A;  1I8P A;  1CYJ A;  1IRV A;  2AXT V;  3MK7 C;  1NMI A;  3ZOO A;  1HZV A;  1SQV D;  1GJQ A;  4PW9 B;  4P4Q B;  1CIG A;  1NML A;  3HQ6 A;  1CRI A;  4MU8 A;  1HRO A;  1EZV D;  2YQB A;  1I6D A;  1LC2 A;  2BGV X;  1YIQ A;  3L75 D;  1W2L A;  3HQ7 A;  2XTS B;  4H0J A;  2BLF B;  5DJQ C;  4H0K A;  1H32 B;  1K3G A;  1C6R A;  1QYZ A;  3BCC D;  4JCG A;  1CYI A;  1KB9 D;  5CIG B;  3O20 A;  1H32 A;  3WFD C;  1P84 D;  5KLI B;  5KAI V;  1DIQ C;  1CSU A;  2B10 B;  3CX5 W;  1CRJ A;  2HV4 A;  4GYD A;  5TIS V;  1H9X A;  1K3H A;  1RZ6 A;  4K3I A;  4J20 A;  1HJ5 A;  1WEJ F;  4Q5P A;  4L1Q A;  2ZON G;  3C2C A;  3RN1 A;  1YEB A;  4O1W A;  2QJY B;  1M6Z A;  1BL9 A;  3H1L D;  1YEA A;  1CIF A;  1I8O A;  2N3B A;  1GQ1 A;  2VHD A;  1DVH A;  4PD4 D;  4QAO A;  1BGY D;  1KYO W;  1COR A;  1E8E A;  1CHI A;  2OZ1 A;  3H1J D;  2YK3 A;  1QKS A;  5KLV D;  1YFC A;  2C8S A;  1C7M A;  2CE0 A;  1I5T A;  2ZBO A;  2PAC A;  1OAE A;  4AAM A;  1FI3 A;  2JTI B;  3VNW A;  4U3F D;  3OCD B;  3PXW A;  1BCC D;  2FWL A;  2A06 D;  4PWA A;  4GED B;  1QL3 A;  3M97 X;  3DR0 A;  1YTC A;  1ZZH A;  3CX5 D;  1N15 A;  4UB8 V;  1COT A;  1I55 A;  4YE1 A;  2GC4 D;  1MG3 D;  2ZZS 1;  3DP5 A;  3WFB C;  1KV9 A;  1NNO A;  3SJL A;  1NU1 D;  2CA3 B;  1CC5 A;  1KB0 A;  3OA8 A;  3WFC C;  1AOQ A;  1KX2 A;  1CXC A;  2QJP B;  4FA5 A;  2N9I A;  3VRD A;  5GTI V;  3L71 D;  3RN0 A;  2MTA C;  3CXH W;  1NIR A;  4WQ9 A;  5DFS A;  1H33 B;  2CXB A;  1KYO D;  3L4O A;  5B66 V;  1MG2 D;  4WQC A;  3ORV A;  1DT1 A;  1DW0 A;  1VYD A;  1CTZ A;  1CCH A;  1RZ5 A;  1PP9 D;  3ZOY A;  3CU4 A;  2DGE A;  3WC8 A;  1DW3 A;  2QJK B;  1C52 A;  1N9C A;  1I6E A;  1A8C A;  1DW1 A;  1ZRT D;  1FJ0 A;  2FYU D;  4DY9 A;  1CSW A;  3O0R C;  1F1F A;  5CIB B;  3ZIY A;  1IQC A;  1CYC A;  3SVW A;  1LMS A;  3CWB D;  1CHJ A;  1GU2 A;  3A0H V;  3CXH D;  2EXV A;  3PH2 B;  1HJ3 A;  3JBT B;  4KMG A;  3WFE C;  1LC1 A;  3A0B V;  1NTK D;  2IBZ D;  1S5L V;  1WVE C;  2AIU A;  4FAV A;  2C1V A;  4O1Q A;  5CIH B;  2I8F A;  1U75 B;  1CIH A;  351C A;  1IO3 A;  4PJ0 V;  3SWS A;  1CRH A;  5B6Q A;  2ZOO A;  3O1Y A;  4NFG B;  2N18 B;  2N3Y A;  4L3G A;  3HQ9 A;  2CA4 B;  3ZOX A;  4LJI A;  2BCC D;  3L70 D;  3CYT I;  3ZOW A;  2C1D B;  4WQ7 A;  4WQD A;  4FAN A;  1CSV A;  1C75 A;  2B11 B;  1CNO A;  155C A;  4V2K A;  2FYN B;  4WQ8 A;  1NTM D;  2PCC B;  1CRY A;  4AAN A;  3OCD A;  4WQA A;  3RMZ A;  1LFM A;  2N9J A;  1KIB A;  1HCM A;  5C0Z A;  5CIC B;  3KZI V;  4IL6 V;  1C6S A;  2DVH A;  3L4M A;  3WUI A;  2C1U A;  4FB1 A;  3L72 D;  2N18 C;  2V08 A;  4FA4 A;  2PCB B;  1GIW A;  3WU2 V;  1GDV A;  2L4D A;  1HJ4 A;  1H1O A;  1J3S A;  5CIE B;  5KAF V;  1ETP A;  1FI9 A;  2V07 A;  4AAO A;  1CSX A;  1SQQ D;  2C2C A;  2FRC A;  5KKZ B;  1F1C A;  1H33 A;  1DW2 A;  4EID A;  1B7V A;  2B4Z A;  3H1H D;  1BE3 D;  4WQE A;  1QN2 A;  3H1I D;  5C9M A;  1KX7 A;  2ZXY A;  3CP5 A;  1H31 B;  5B5E V;  1PPJ D;  4XYD B;  2YIU B;  5AUR A;  2BCN B;  1SQB D;  3RLM A;  3NWV A;  1H31 A;  1E29 A;  5H2F V;  2D0W A;  1SQX D;  1C6O A;  1FOC A;  4D6T D;  3TGU D;  1U74 B;  2B12 B;  2CE1 A;  5CYT R;  1A56 A;  1L9B C;  2C9X B;  3NBS A;  2ORL A;  2LIR A;  3X39 A;  451C A;  3L73 D;  1NTZ D;  1E2R A;  5CID B;  2B0Z B;  1N90 A;  1JDL A;  2BH4 X;  4EIE A;  1CIE A;  5GTH V;  1AKK A;  2LIT A;  3PXT A;  3ZBM A;  1FI7 A;  3ZCF A;  1AYG A;  2GB8 B;  4UB6 V;  5E79 V;  1CCR A;  1RAQ A;  1CRC A;  4N0K A;  1L0N D;  1M70 A;  2BH5 X;  3A9F A;  1CTJ A;  1C2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...