1MG4A

Structure of n-terminal doublecortin domain from dclk: wild type protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
KKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOUBLECORTIN-LIKE KINASE (N-TERMINAL DOMAIN)
publication title The DCX-domain Tandems of Doublecortin and Doublecortin-like Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 101
sequence length 101
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 1mg4A00
5IOIA 1UF0A 5IKCM 2DNFA 5IO9A 1MFWA 5IP4D 2BQQA 5IN7A 1MJDA 1MG4A
chains in the Genus database with same CATH superfamily
1CK1A 3PV1A 2KLCA 3PZDA 4WAFA 1E0ZA 3I63C 1FFVA 3AE9B 2KK8A 4GN1A 2XK5A 4YL8A 3AEBB 5D3DA 2BT6A 4I6LB 1R4NI 3QA8A 4JPSA 2VH1A 3VTVA 3NOBA 2CU3A 2H88B 4A3PA 4HPPA 1C3TA 4NNJB 1IGDA 4BZAA 4FXCA 5G2NA 1RRBA 3DBRB 2JXTA 4A3OA 1DYQA 4IOIE 3NJTA 2JT4B 4IM2A 2ZNVB 1DOXA 3RZWC 1N5WA 2NS5A 3B0AA 2PLPA 4A8XC 1BT0A 3TBLD 2LGXA 3A33B 4AWJA 3ZXVA 3VQIA 3ETRA 2IGHA 1L0YB 1FRRA 2L05A 4ANXA 1GAQB 3D32A 2BKFA 3V6EB 2NBWB 3DBSA 1JRPA 2CHWA 2AX5A 5CX3A 3N1XC 2KJHB 2C5LC 5I4DA 3U7DA 2N7JA 1J8CA 4MH8A 3RD2A 1FXIA 2JYEA 3H7PA 5AZFA 3JSVA 3UIOB 1OGWA 4GB9A 1KTKA 2PE9A 2C60A 3QIJA 1CMXB 1TBEA 1NENB 2BF8B 2OHFA 3P1MA 1XLPA 3APDA 3MC8A 3T8MA 1HA5A 1ENFA 5H8YE 3ZXRA 1ZUD2 2JU6X 2ZZPB 4RGMA 1PDXA 1R4NB 1RLFA 4M01A 4WAAA 1F9JA 4WJOA 5IKCM 3N32A 3MTNB 4EEWA 2M1MA 5GMVA 1V9JA 3R7RA 1D5ZC 1IGCA 3QK0A 2KD0A 4FLHA 4DHZE 2GBMA 3R8BA 4KZ0A 1Z2MA 1ZE3D 2N9PC 1P3QU 3PGEA 3SD5A 3BVZA 1UH6A 1M4VA 4W9LA 4GGQA 1AARA 2K8BA 2ZCCA 4F7ZA 2K8CA 1N62A 4ANUA 2MLBA 4TV3A 3EECA 4IG7B 4AS1A 2KWVB 3ZNID 2QMTA 5EE9A 1WFYA 1C77A 4R3DA 3RI7C 1SSNA 4YT0B 3AB5A 1QKZA 2ACZB 4GMVA 4MM3A 2KX0A 1BXTA 3WAMA 2WXHA 1V1OA 1F1HA 5D94A 4P16A 3KUZA 3DBLI 4XC2A 1ZDXA 1TKGA 4FJZA 2V1YA 2KT7A 2WX1A 3RCZA 2KVRA 2M19A 1V2YA 3NG0A 3CSTA 2DAJA 2DAFA 1JW9D 3AE3B 1V1PB 1STEA 2PEAA 4MSMB 2KFKA 4WJPA 2JY6A 3V05A 2LGDA 2DHZA 2J0JA 3KH0A 3RZFA 1SJHD 3H9DA 2J52A 3R66C 3VH4B 3ZDMC 1YNTE 2N9KA 4ZRPA 1KOTA 2KVZA 1RM6C 4BFRA 2PVOD 4PYUA 1JQ4A 4DWFA 1GPXA 4RGNA 1OEYJ 1YIWA 4EZJA 4AQ7A 1ET6A 1ESFA 1ACCA 3DBLB 1TKYA 4GDLB 1XD3B 4LNNA 4YTPB 4BVUC 1E7VA 2YEPF 3PSEB 4JL9A 5L95C 2ZEQA 3DQVA 4M0WA 5J18A 1K50A 1RWSA 4NJCA 2GB1A 1XF5L 2N9LA 4MSQB 1IBXA 4ZHPA 2LEKA 3AE7B 2XEWA 3OG5A 4W9JA 3V61A 1HQRD 3APCA 3RFZB 5HHDG 3VVWB 3T9LA 2MEKA 2YVCA 1A70A 4HPLB 1P1AA 4FA6A 2KWCA 1WGHA 1NYQA 2LD9A 1E90A 2V3NA 1WXAA 2PIAA 1L2NA 1P9DU 3I3TB 2NCNA 3WAPA 1SE2A 2KDFB 2NPTB 3DVNV 3AE5B 1C76A 2PKOA 1I4RA 1AN8A 3H1UA 1UWXA 1M94A 4IM3A 3SU8X 4LJOB 4ANWA 2IY1B 2SAKA 3CF6E 2OJRA 4AUQC 4KX6B 2FUHB 5EDSA 3FC4A 2Z8LA 3DDCB 2CKHB 4BBNC 1G6JA 2BW2A 2KTFA 2IY0B 2ZPNA 2I2YA 2WU2B 4PS8A 2DYBA 4MDKE 3Q3FA 3NY5A 3DWGC 4LNIA 1CJEA 1FEHA 1MI0A 1MVKA 2QSDA 3H7SA 2EKIA 4K81A 3DVNU 2QEJC 1P0RA 1TJEA 2NMQA 2R2OA 3WA0A 1GJZA 4DXGA 1ZXIA 4WWMA 4E71A 1I4QA 2G9HD 2DBYA 4KKJA 4P6VF 4P7IA 2HJ1A 3DVGX 2L32A 1WIAA 2FUG1 3RNGC 3UIPB 4MGYE 4YXDB 3SFEB 2D10A 2LMCA 4NAWB 1EWYC 5IO9A 2GI9A 4WWOA 1QILA 2LUMA 1QQRA 4JQWC 1NDDA 2CJNA 2ZPYA 2LVPA 2Z0EB 1ZKHA 4XZ4A 5D2MB 1CQVA 4HCPB 4XGAB 4MH0E 4IWPA 4ZYNA 3RNCC 3RNBC 2L0TA 3VR8B 3DHHC 4FBJB 1T6BX 4GDKA 4WWPA 1TS4A 1SJED 2KMCA 1JWUD 4ARCA 4A6QA 3TEYA 4ZRIA 1SGHA 1YQ4B 3OWEB 4RF1A 2ZVNA 1J0GA 5DCNA 2WDTB 1Q0WB 4JLCA 2M56B 3HIZA 2DLBA 1D5MC 1MG8A 4K7WA 2LUEA 1R4MI 1T5XD 3B1LX 3B9JA 3X23A 4URKA 2IO0B 1LXDA 3JYUA 2INNE 3ZLZA 4E3CA 4II3B 1VZ8A 4RCOA 4OZBA 4ACFA 4NQKE 2QIEB 3ZNHB 3EC8A 4M02A 3RNEC 1E8ZA 1VDVA 3RNAC 1SBBB 2KKCA 2LWPA 3HVZA 3NS1A 2J42A 5J2RA 2VZKD 1SXTA 1ROEA 2INDC 1L7YA 2PPHA 4C4VA 5MPOA 2L7RA 2BB6A 4W9HA 3Q3MC 2WGSA 1QLBB 3MC9A 2WQYB 4K7SA 3W1SA 3W1SC 1R4MB 5G5GA 3NZSA 3ZJTA 2DYOA 5AUIA 2JRHA 5BYRA 3Q6BA 1WRIA 4A9AA 2FNJB 1V5TA 2W54A 4NAMA 4DHJD 3DOWA 2NTSA 5JH5C 1NBFC 4HJGE 3TJPA 3Q8AA 1YN5A 1WMHB 4Q2JA 1QT9A 2DZIA 3VXWA 1T0RC 2IGDA 3SDLC 3PHWB 2DENB 4D2KA 3ZTDA 1WY8A 1PUTA 3B2FA 1MG4A 1NEKB 1VCBA 1WR6E 1XO3A 4XWTA 2Y5PA 5C3JB 3GZNI 3L13A 3Q69A 3C0RB 2N0SB 4LJPB 1RFKA 4KKIA 4BOSC 2KDBA 4NY0A 5TR5A 1C4AA 2HD5B 1PGXA 2Y5BB 1FD6A 1VLBA 4A90A 3DBRI 4LCDE 3LB8C 2JZZA 2WDRB 2Z0DB 3P2BA 1XEEA 4O1NA 3VHTC 2MA9B 4OHJA 2BYVE 4LNOA 2EMTA 3FILA 4C56C 2L52A 3EHVA 3UI3A 1D4BA 2JX5A 2KN5A 3GB1A 4YTNB 2WS3B 3H8HA 1E8YA 1UF0A 4US9A 4K1RB 3TEXA 1NVID 2IJ0A 3K9PB 4ZDVA 2VRRB 1WR1A 1VZ7A 3L10B 4ICUA 3U52E 2PMVA 2H89B 3GE3C 3IT6B 4AP4C 3A4SC 4WURA 3RUIB 4W9CA 3VR9B 3GZNB 4C00A 3TSSA 5HFYA 3IHPC 3Q8BA 1QOAA 3BY4B 5BMHA 3HHMA 3K9OB 5JHBA 1WXVA 2IO1B 5IAAC 4DDID 4IKGA 2HE7A 3UQBA 4DHZB 3ZGZA 3Q3JA 5E6NA 4C80A 1RAXA 4G11A 1QZEA 4M0WB 3TL5A 2LXAA 1IYFA 2L3ZA 2MBBB 2N7DA 3ZDTA 2EMSA 3W5VB 3UF8A 3O65B 3PT2B 1WYGA 2KANA 2GBNA 3B08A 3KVFB 1WGKA 3LDZE 1EU4A 4MEMA 3MC0B 2KDMA 1SE4A 2KXJA 4HCNB 1TY2A 2GLSA 4EZLA 1WJUA 4DK5A 2KLGA 3IG3A 1WJ6A 4HXDA 2MJ3A 3RYTA 1TS3A 4AOFA 1FNWA 1XLNA 1IPGA 2WXQA 4ZRJA 2NBUA 2LGYA 2JZ3B 2JPHA 1I42A 4W9IA 1ZGUB 2A5UA 1K51A 5LXIB 2QHOA 1B1ZA 4K7UA 1VD2A 1IUEA 5CTRC 1JWAD 1XXGA 2M4NA 2O2VA 4TUUA 2MBHA 4JIOU 1J7BA 1LM8B 2RSUA 4WWNA 3Q8EA 3QHTA 1PQSA 4WIPA 4PS7A 3L17A 4MJSA 5DPSA 3A9KA 1E5WA 3DWMA 1K52A 1V80A 2C7MB 3U2SC 3U8ZA 2LJIA 2C9WB 3PVLA 3Q3NC 2K6DB 1QF6A 2LGIA 1EUVB 4KIKB 4EZKA 1WXMA 2L1AA 1OQQA 5H92C 4A20A 4DDGD 4EOYA 1YOVB 4I6PA 4ICVA 3OLMD 2D3AA 4C7YA 3W1YA 5G55A 4X57B 2WDQB 3ZYYX 5LNK1 2DZJA 4CHKA 2KJRA 2W55A 3HK0A 1TIFA 3MHSD 3MFGA 1YQ3B 1FO4A 1AW7A 4CQNA 2JXXA 2J0MA 2MW5A 1N60A 4FJVB 4OZAA 3ZTCA 3PLVA 4KDIC 3HM3A 1HZ6A 2I1KA 1JMLA 2B76B 2WNMA 4OVVA 3DHGC 1J7AA 3HM6X 3PRMB 1OEYA 5JHAA 2MBQA 2KO3A 1PYWD 3WAOA 4LTUA 2KHWB 3AEFB 2D11A 1MHHE 1L0VB 3W9CB 1YN3A 1FMAD 3M3JA 3TEWA 3VUWA 2YLMA 3MJ5A 5CHWA 3X0WA 3N1ZC 1SIJA 3NZ3A 4KV2A 1TY0A 1QOBA 2JRIB 2D3BA 1SF0A 2ZNVC 2V9HA 3VRBB 2IBIB 5FK9C 1MFWA 1Y56A 4G0NB 5LLIA 2RPQA 3N1YC 4BAXA 1F2RC 1EWCA 4HK2A 1J19A 3CSFA 5FR6A 4ANVA 3V60A 4C4VB 2N9XA 1LQBA 3BYYB 4B6WA 2X8XX 1HTQA 4NZLB 1YN4A 4GIVA 2WXMA 1WXSA 2UWQA 3R7QA 2WXJA 1JWSD 5GXGB 1WWTA 2BWFA 2DYMA 2LXCA 4MACA 3NZUA 1K53A 2JVCA 2WX0A 4QAYA 2B3AA 2NBVB 1WZ3A 4EE2A 2Y5CA 4WQMA 4B0EA 3U30A 2NTTA 3AEDB 3VTUA 4BOZB 1DGJA 3S2AA 1S1QB 1N63A 5HKHA 2K39A 1E10A 3ONSA 3DPDA 4C7ZA 2VH2A 1I35A 2J53A 1OFFA 5IOIA 3MJWA 2M0XA 1I7HA 2X38A 4REZA 5E6PA 2JWUA 2KWDA 3PLUA 4E74A 3B2GA 3L4PA 5DPTA 3ZRCA 2ONQA 2W82A 3W5UB 4WJNA 2RMMA 1PFDA 2K1FA 2LGSA 4CO7A 3M95A 4KDLB 1U4AA 3ALBA 4IM0A 1UELA 2RDBC 2AQ2B 2V4LA 4W9KA 4DHJB 3AE2B 2I38A 1ISNA 1UGJA 3ZIMA 4KVGB 1OTRB 2FIFA 5EE3A 1YX6B 2K6QA 2LRUA 2KC1A 4II2B 3I57A 2G3QB 1AYFA 4FADA 3JW0X 1KRHA 3P4QB 1UGMA 1N6ZA 2K3UA 3QAQA 2V0GA 5CHVC 5D6JB 4USAA 2GBRA 2FCSA 1V86A 1XCQL 1EF5A 3Q2AC 4GOCA 1C79A 2KQ4X 4HJKA 1L5PA 2D07B 1V1PA 2XK5B 2JYTA 5EE1A 1FXTB 3PRZA 1L0XB 3CIRB 3AU4A 2WP9B 1F0ZA 2MRPA 4BKSD 3VDZA 1E8WA 3QQ8B 4RF0A 3PZ7A 4HROA 3N30A 2JQRB 5AEKB 4HDOA 5T8IA 4W9DA 3NVWA 3ML8A 1FFUA 2G1EA 4IWOA 3PHXB 2R61A 3WALA 2K5PA 4MT5A 5DPWA 2N4FA 1L4ZB 2HTME 1FCLA 3BVMA 1ZDVA 3PTFC 1ZXHA 2IPKD 3ABVB 3JVZX 2RDHA 1TGZB 3TIXA 1TTNA 4FHJA 1WGGA 4TMAB 1RYJA 1T3QA 3QX1A 2C7NB 1V5OA 3FKYA 3AE1B 3H7PB 4XDCA 1KF6B 3JSVB 2AWTA 1V6EA 4BKSA 4W9EA 4YSZB 3PS6A 4ZRKA 3V6CB 2ICIA 4KGTA 5LXHA 2RPVA 1D6EC 3NVVA 5AZGA 4B9KA 1L4DB 4OVUA 1Z5SB 4P1CC 4RMAA 4LLGM 2ZJDA 3A4RA 4NJ7A 2INCC 1GUAB 3QWZB 4ZRQA 4DXFA 5KHQA 2V4IB 1R7SA 2WXNA 4RH6A 4M8MA 1L6VA 3AEAB 1I4XA 2WYQA 3IVFA 2WXOA 5HI1A 3HUIA 3J9CA 1VZ6A 1VR9A 1I4GA 2ASQA 2KJ6A 3KW5B 1TZOA 2UYZB 3SR6A 4AJYB 3AI5A 1PGAA 1NI3A 2O2VB 1MPEA 3VH3B 3N9YC 3ZO5B 2N7EA 4HLEA 1TYGB 4MM3B 1FRDA 2N1WA 3Q14C 4MJSB 1UNSA 1YD8U 2BPSA 2HDEA 1ET9A 4I6NB 1LGRA 4DBGA 4PYZA 3M63B 1YQBA 2KDEB 4IUMB 5BMGA 4RM8A 2WHIA 2FE8A 4FHKA 4US8A 4NQLB 3AH7A 2KTRA 2ON8A 1HEZE 2KAJA 2AEHA 2L8JA 4PT5A 2MWSB 1HXYD 4EFOA 3OAWA 4GLSC 2J7QB 5IN7A 1WI0A 3E9SA 4KSLC 2FCQA 3BIID 2N1VA 1FNVA 1E6EB 2DWQA 4LNKA 1I4PA 4RGOS 3DCGA 4HRSA 4ARIA 2MBOA 2KFKB 1FM0D 1WF9A 4J3OD 4L1BA 2PJHA 2G4DB 1DOIA 4BBNF 3C19A 1WGYA 3KQ4A 4YSXB 2M8SA 1TS5A 1JWBD 4EUTA 2BVCA 1BMLC 1YJIA 4M8NA 4G50A 2BS3B 3A1QA 4IWQA 3RN9C 2GOWA 2WXKA 1GG3A 2DZMA 4XX5A 4OZCA 2SEBD 1EF1A 1WYWB 4UDUC 2D3GA 2WXRA 2RDGA 4N6EB 3VAWA 1IBXB 5L83A 1NI2A 3ZJVA 4KGRA 4TQ1A 2BYEA 1WE7A 3BYTB 3NS8A 3E56A 3VFKA 1WM3A 3MHZA 1KH0A 3ZW3A 3P4RB 2LZ6A 1TS2A 1GC6A 4KZCA 2JWZA 1E7PB 2JF5A 4N9F4 3Q8CA 2CHXA 2PTLA 1SE3A 4S17A 2V3SA 4K3CA 3WIMA 2O6VD 2N9EB 2K22A 5D7GA 3LXFA 5BO4B 2RR9A 3KYDD 2JUOA 4DXAB 2MJEA 2KQSA 2ZVOA 2AQ1B 1L6UA 4LNFA 5HG2A 3P4SB 4WQOB 5JZEB 1GC7A 2ZW1A 2KOXA 3ML9A 4L2YA 1UWMA 2K9XA 4MGZE 4ZOHC 2QJLA 4LDTD 3NVYA 3VTWA 1WX9A 2RD0A 3QARA 1OQYA 2CHZA 2ZW0A 5D3IB 1PGBA 1SB3C 3UGBB 4FJYA 3WCQA 3ECIA 4ASWC 2IYDB 3HRDD 2CR5A 1WRDB 3PZ8A 2WXFA 2GBKA 2I1JA 2KX3A 2O6VA 1ZW7A 1WMHA 4GXBA 3APFA 2TSSA 4YSYB 3UINB 2E3TA 3NVZA 1BUIC 1XLOA 2G4SA 2BGFA 1YMHE 1OQRA 3KUDB 3KWVA 1KM7A 2JSVX 3P4PB 4KGSA 1C1YB 3IAS1 5G5HA 1V49A 4DQOC 3NUHB 1J7CA 4A55A 4GSWA 3V62A 1NYRA 3A9JA 2R2QA 3L08A 5JXVA 2MP2A 1GB4A 1D5XC 4GDKB 4S0RA 1XCTL 5J17A 3PRPB 2BTEA 3EUB2 4MGIE 2LI5A 1GB1A 4NPNA 3KUCB 1MHXA 1WJNA 2MHJA 2MQJA 1RFAA 4HDQA 2MSED 1WX8A 3AN1A 3L0WB 3SFDB 1WZ0A 4MELA 3AM9A 3ZVVA 2LHDA 2QC8A 3DHIC 2PW9A 2JZPA 2WXGA 4HVBA 3QC8B 1LFDA 1JROA 1UZXB 3AECB 5EE0A 1XQQA 2D3CA 5DPRA 1A5RA 2IO2B 1P98A 1Q10A 3VUXA 2KYWA 5KHOA 2BWES 3LJ3A 2INPE 2MX2A 3AV8A 2WXLA 1TT5B 2DZKA 3EFUA 3ZJUA 1B9RA 1VJKA 1LO5D 1F52A 3BWUD 2BS4B 3V3XA 4NJ6A 4W9GA 3M62B 1E7UA 1P7FA 4LK0M 2V3PA 2FCNA 3Q8FA 4RGTA 4F1SA 2KWUB 4IW0A 3TCAA 3URYA 4J6IA 2GRIA 1JRUA 4HEA1 4WJQA 2Q5WD 4HWIB 1UUPA 2BB5A 2WXPA 3ZNGC 2W3RA 4EKUA 4B0MA 5IA7A 2LFIA 3R2TA 1WXQA 4RNAA 1V81A 5C23A 5E6JA 2OJWA 2ZCBA 3BZDB 1WGRA 1X1MA 2OOBB 1P7EA 5FR3A 1T0YA 1N5XA 1WH3A 1JCKB 2M0AA 4XE0A 2WWZA 4OVZA 1FXAA 1SEBD 1WX7A 2WDVB 4WH4A 1XLQA 4AJWA 3IAM1 3T3NA 2LHEA 3T3OA 2VZKB 2LVOA 3WANA 1QOGA 1TZ1A 3H6NA 4H2AA 2XNAC 1KLVA 2AL6A 2W9NA 1WM2A 1C9FA 1MJDA 1ZPSA 3IT4B 2L00B 4F8CB 4BKGA 1C78A 4JWSC 2LJ5A 2BKRB 1KJTA 2NVUI 1FNUA 1SIFA 5CHFA 1KLUD 4G3XB 2UU7A 2D5GA 5AZHA 2KQ7A 4BKTA 4PK1A 2YEPB 3AMZA 2LASA 3GOEA 4GU2A 2K25A 3FILB 4FULA 3VUYA 3L54A 3SHQA 2IZVB 1FIQA 2CU1A 4JWUC 2KTRB 2E6XA 2BS2B 2BBCA 3PREA 1HTOA 4KIKA 5C2TB 2KMMA 1FPYA 3N20C 2IO3B 2XN9C 2MBEA 5BYSA 4XDDA 2KN4A 1C4CA 2KDIA 2W3SA 1JALA 4JE3B 5IP4D 1Y8RC 4RM9A 4JX1C 5TSSA 2PE6B 3HVDA 2M17A 3KLSX 2L0FA 4HKQA 4ZHOA 5E6OA 2KMAA 2WU5B 2IDYA 1T0SC 5BMIA 3LYYA 2OEDA 2QCZA 3RNFC 3EGRA 2KC2A 3R3MA 3VRAB 3A1QB 2REXA 3ZRFA 2XBBC 2D2QA 3AE8B 3QCAA 3NRZA 2DX5B 2C7HA 3AE4B 4JGHB 1FCCC 1KFYB 1S3SG 2MJDA 1WE6A 3PO0A 3FAHA 4TKNA 1AWDA 3GS2A 1EM7A 1N61A 1Q5WB 1K8RB 3EFCA 4GDLA 3RULA 2KFJA 2CS4A 1YJ1A 3DVGY 3W2DA 2WXIA 1EO6A 3BK1A 1QOFA 2AYOB 3L16A 3TMPB 2EKEC 3AU5A 2EELA 5AUKA 3BK2A 3AXCA 2CJOA 2AQ3B 1E8XA 3CWIA 3O13A 2GMIC 1SE9A 4P1BC 1I4HA 4TSSA 3C8YA 3AE6B 2HJ8A 2PVGC 3U4EG 2KACA 4N58A 1Q1OA 4FN2A 3ZQ4A 4IDIA 1CZPA 4KSKC 1D3ZA 2LRWA 1E9MA 4W9FA 1V97A 2FIDA 2NPTA 1ZP0B 3AEGB 3RT3B 2QDFA 5C1ZA 3P42A 1ZOYB 1KLGD 2FCMA 1C4PA 2K8HA 1YJJA 2J4XA 3TUOA 1VRAB 3OJ3A 3RMKC 2A4ZA 3BVGA 4PS3A 3NHEB 3GP7A 4XYCA 3QJZA 4HKZE 4B95A 3IFWB 2RGFA 2K0PA 2MH7A 4N59A 1GNUA 2HTHA 4M00A 2J0KA 2O6VB 3IBEA 3BINA 2FAZA 1EU3A 2IGGA 2BYFA 2L83A 1T0QC 4IC7B 2WLBA 1TKEA 4HPMB 3A9KB 3AULA 2G45B 3DBHI 3PPAA 1WJ4A 1WSPA 3U7ZA 3EA6A 2BYTA 3I9V1 2FBWB 2KZRA 4RFBA 4TQ0A 5BYQA 4LDTB 3N3KB 1HZ5A 2QILA 3KWLA 4OW0A 4ZYSA 3I5JC 3MP9A 4XWWA 1DOYA 4NAWA 2DNFA 3P63A 2Y3AA 4ITKA 2AL3A 3A9JB 2KNBA 5FKAC 3AEEB 3Q3OC 1HE8A 2GBJA 2MP2B 4MGKE 3TEZA 3ZKJC 1H8CA 4CYEA 3R2IA 3GE8C 3CMMB 3KYCD 4K3BA 2MCNB 1F2RI 2Z59B 1V8CA 3RPFC 2LVQA 3OJ4B 1GOZA 1H4RA 4L23A 4YWGG 1XT9B 2NR2A 3ZUNA 3UQAA 2BQQA 3IXSA 1F77A 1IP9A 1UBQA 1JWMD 1UD7A 1WGDA 1UBIA 2L76A 1YX5B 4YTMB 3ENEA 3DBHB 3SEBA 3ZNZB
chains in the Genus database with same CATH topology
5IOIA 1UF0A 5IKCM 2DNFA 5IO9A 1MFWA 5IP4D 2BQQA 5IN7A 1MJDA 1MG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOI A;  1UF0 A;  5IKC M;  2DNF A;  5IO9 A;  1MFW A;  5IP4 D;  2BQQ A;  5IN7 A;  1MJD A;  1MG4 A; 
#chains in the Genus database with same CATH topology
 1CK1 A;  3PV1 A;  2KLC A;  3PZD A;  4WAF A;  1E0Z A;  3I63 C;  1FFV A;  3AE9 B;  2KK8 A;  4GN1 A;  2XK5 A;  4YL8 A;  3AEB B;  5D3D A;  2BT6 A;  4I6L B;  1R4N I;  3QA8 A;  4JPS A;  2VH1 A;  3VTV A;  3NOB A;  2CU3 A;  2H88 B;  4A3P A;  4HPP A;  1C3T A;  4NNJ B;  1IGD A;  4BZA A;  4FXC A;  5G2N A;  1RRB A;  3DBR B;  2JXT A;  4A3O A;  1DYQ A;  4IOI E;  3NJT A;  2JT4 B;  4IM2 A;  2ZNV B;  1DOX A;  3RZW C;  1N5W A;  2NS5 A;  3B0A A;  2PLP A;  4A8X C;  1BT0 A;  3TBL D;  2LGX A;  3A33 B;  4AWJ A;  3ZXV A;  3VQI A;  3ETR A;  2IGH A;  1L0Y B;  1FRR A;  2L05 A;  4ANX A;  1GAQ B;  3D32 A;  2BKF A;  3V6E B;  2NBW B;  3DBS A;  1JRP A;  2CHW A;  2AX5 A;  5CX3 A;  3N1X C;  2KJH B;  2C5L C;  5I4D A;  3U7D A;  2N7J A;  1J8C A;  4MH8 A;  3RD2 A;  1FXI A;  2JYE A;  3H7P A;  5AZF A;  3JSV A;  3UIO B;  1OGW A;  4GB9 A;  1KTK A;  2PE9 A;  2C60 A;  3QIJ A;  1CMX B;  1TBE A;  1NEN B;  2BF8 B;  2OHF A;  3P1M A;  1XLP A;  3APD A;  3MC8 A;  3T8M A;  1HA5 A;  1ENF A;  5H8Y E;  3ZXR A;  1ZUD 2;  2JU6 X;  2ZZP B;  4RGM A;  1PDX A;  1R4N B;  1RLF A;  4M01 A;  4WAA A;  1F9J A;  4WJO A;  5IKC M;  3N32 A;  3MTN B;  4EEW A;  2M1M A;  5GMV A;  1V9J A;  3R7R A;  1D5Z C;  1IGC A;  3QK0 A;  2KD0 A;  4FLH A;  4DHZ E;  2GBM A;  3R8B A;  4KZ0 A;  1Z2M A;  1ZE3 D;  2N9P C;  1P3Q U;  3PGE A;  3SD5 A;  3BVZ A;  1UH6 A;  1M4V A;  4W9L A;  4GGQ A;  1AAR A;  2K8B A;  2ZCC A;  4F7Z A;  2K8C A;  1N62 A;  4ANU A;  2MLB A;  4TV3 A;  3EEC A;  4IG7 B;  4AS1 A;  2KWV B;  3ZNI D;  2QMT A;  5EE9 A;  1WFY A;  1C77 A;  4R3D A;  3RI7 C;  1SSN A;  4YT0 B;  3AB5 A;  1QKZ A;  2ACZ B;  4GMV A;  4MM3 A;  2KX0 A;  1BXT A;  3WAM A;  2WXH A;  1V1O A;  1F1H A;  5D94 A;  4P16 A;  3KUZ A;  3DBL I;  4XC2 A;  1ZDX A;  1TKG A;  4FJZ A;  2V1Y A;  2KT7 A;  2WX1 A;  3RCZ A;  2KVR A;  2M19 A;  1V2Y A;  3NG0 A;  3CST A;  2DAJ A;  2DAF A;  1JW9 D;  3AE3 B;  1V1P B;  1STE A;  2PEA A;  4MSM B;  2KFK A;  4WJP A;  2JY6 A;  3V05 A;  2LGD A;  2DHZ A;  2J0J A;  3KH0 A;  3RZF A;  1SJH D;  3H9D A;  2J52 A;  3R66 C;  3VH4 B;  3ZDM C;  1YNT E;  2N9K A;  4ZRP A;  1KOT A;  2KVZ A;  1RM6 C;  4BFR A;  2PVO D;  4PYU A;  1JQ4 A;  4DWF A;  1GPX A;  4RGN A;  1OEY J;  1YIW A;  4EZJ A;  4AQ7 A;  1ET6 A;  1ESF A;  1ACC A;  3DBL B;  1TKY A;  4GDL B;  1XD3 B;  4LNN A;  4YTP B;  4BVU C;  1E7V A;  2YEP F;  3PSE B;  4JL9 A;  5L95 C;  2ZEQ A;  3DQV A;  4M0W A;  5J18 A;  1K50 A;  1RWS A;  4NJC A;  2GB1 A;  1XF5 L;  2N9L A;  4MSQ B;  1IBX A;  4ZHP A;  2LEK A;  3AE7 B;  2XEW A;  3OG5 A;  4W9J A;  3V61 A;  1HQR D;  3APC A;  3RFZ B;  5HHD G;  3VVW B;  3T9L A;  2MEK A;  2YVC A;  1A70 A;  4HPL B;  1P1A A;  4FA6 A;  2KWC A;  1WGH A;  1NYQ A;  2LD9 A;  1E90 A;  2V3N A;  1WXA A;  2PIA A;  1L2N A;  1P9D U;  3I3T B;  2NCN A;  3WAP A;  1SE2 A;  2KDF B;  2NPT B;  3DVN V;  3AE5 B;  1C76 A;  2PKO A;  1I4R A;  1AN8 A;  3H1U A;  1UWX A;  1M94 A;  4IM3 A;  3SU8 X;  4LJO B;  4ANW A;  2IY1 B;  2SAK A;  3CF6 E;  2OJR A;  4AUQ C;  4KX6 B;  2FUH B;  5EDS A;  3FC4 A;  2Z8L A;  3DDC B;  2CKH B;  4BBN C;  1G6J A;  2BW2 A;  2KTF A;  2IY0 B;  2ZPN A;  2I2Y A;  2WU2 B;  4PS8 A;  2DYB A;  4MDK E;  3Q3F A;  3NY5 A;  3DWG C;  4LNI A;  1CJE A;  1FEH A;  1MI0 A;  1MVK A;  2QSD A;  3H7S A;  2EKI A;  4K81 A;  3DVN U;  2QEJ C;  1P0R A;  1TJE A;  2NMQ A;  2R2O A;  3WA0 A;  1GJZ A;  4DXG A;  1ZXI A;  4WWM A;  4E71 A;  1I4Q A;  2G9H D;  2DBY A;  4KKJ A;  4P6V F;  4P7I A;  2HJ1 A;  3DVG X;  2L32 A;  1WIA A;  2FUG 1;  3RNG C;  3UIP B;  4MGY E;  4YXD B;  3SFE B;  2D10 A;  2LMC A;  4NAW B;  1EWY C;  5IO9 A;  2GI9 A;  4WWO A;  1QIL A;  2LUM A;  1QQR A;  4JQW C;  1NDD A;  2CJN A;  2ZPY A;  2LVP A;  2Z0E B;  1ZKH A;  4XZ4 A;  5D2M B;  1CQV A;  4HCP B;  4XGA B;  4MH0 E;  4IWP A;  4ZYN A;  3RNC C;  3RNB C;  2L0T A;  3VR8 B;  3DHH C;  4FBJ B;  1T6B X;  4GDK A;  4WWP A;  1TS4 A;  1SJE D;  2KMC A;  1JWU D;  4ARC A;  4A6Q A;  3TEY A;  4ZRI A;  1SGH A;  1YQ4 B;  3OWE B;  4RF1 A;  2ZVN A;  1J0G A;  5DCN A;  2WDT B;  1Q0W B;  4JLC A;  2M56 B;  3HIZ A;  2DLB A;  1D5M C;  1MG8 A;  4K7W A;  2LUE A;  1R4M I;  1T5X D;  3B1L X;  3B9J A;  3X23 A;  4URK A;  2IO0 B;  1LXD A;  3JYU A;  2INN E;  3ZLZ A;  4E3C A;  4II3 B;  1VZ8 A;  4RCO A;  4OZB A;  4ACF A;  4NQK E;  2QIE B;  3ZNH B;  3EC8 A;  4M02 A;  3RNE C;  1E8Z A;  1VDV A;  3RNA C;  1SBB B;  2KKC A;  2LWP A;  3HVZ A;  3NS1 A;  2J42 A;  5J2R A;  2VZK D;  1SXT A;  1ROE A;  2IND C;  1L7Y A;  2PPH A;  4C4V A;  5MPO A;  2L7R A;  2BB6 A;  4W9H A;  3Q3M C;  2WGS A;  1QLB B;  3MC9 A;  2WQY B;  4K7S A;  3W1S A;  3W1S C;  1R4M B;  5G5G A;  3NZS A;  3ZJT A;  2DYO A;  5AUI A;  2JRH A;  5BYR A;  3Q6B A;  1WRI A;  4A9A A;  2FNJ B;  1V5T A;  2W54 A;  4NAM A;  4DHJ D;  3DOW A;  2NTS A;  5JH5 C;  1NBF C;  4HJG E;  3TJP A;  3Q8A A;  1YN5 A;  1WMH B;  4Q2J A;  1QT9 A;  2DZI A;  3VXW A;  1T0R C;  2IGD A;  3SDL C;  3PHW B;  2DEN B;  4D2K A;  3ZTD A;  1WY8 A;  1PUT A;  3B2F A;  1MG4 A;  1NEK B;  1VCB A;  1WR6 E;  1XO3 A;  4XWT A;  2Y5P A;  5C3J B;  3GZN I;  3L13 A;  3Q69 A;  3C0R B;  2N0S B;  4LJP B;  1RFK A;  4KKI A;  4BOS C;  2KDB A;  4NY0 A;  5TR5 A;  1C4A A;  2HD5 B;  1PGX A;  2Y5B B;  1FD6 A;  1VLB A;  4A90 A;  3DBR I;  4LCD E;  3LB8 C;  2JZZ A;  2WDR B;  2Z0D B;  3P2B A;  1XEE A;  4O1N A;  3VHT C;  2MA9 B;  4OHJ A;  2BYV E;  4LNO A;  2EMT A;  3FIL A;  4C56 C;  2L52 A;  3EHV A;  3UI3 A;  1D4B A;  2JX5 A;  2KN5 A;  3GB1 A;  4YTN B;  2WS3 B;  3H8H A;  1E8Y A;  1UF0 A;  4US9 A;  4K1R B;  3TEX A;  1NVI D;  2IJ0 A;  3K9P B;  4ZDV A;  2VRR B;  1WR1 A;  1VZ7 A;  3L10 B;  4ICU A;  3U52 E;  2PMV A;  2H89 B;  3GE3 C;  3IT6 B;  4AP4 C;  3A4S C;  4WUR A;  3RUI B;  4W9C A;  3VR9 B;  3GZN B;  4C00 A;  3TSS A;  5HFY A;  3IHP C;  3Q8B A;  1QOA A;  3BY4 B;  5BMH A;  3HHM A;  3K9O B;  5JHB A;  1WXV A;  2IO1 B;  5IAA C;  4DDI D;  4IKG A;  2HE7 A;  3UQB A;  4DHZ B;  3ZGZ A;  3Q3J A;  5E6N A;  4C80 A;  1RAX A;  4G11 A;  1QZE A;  4M0W B;  3TL5 A;  2LXA A;  1IYF A;  2L3Z A;  2MBB B;  2N7D A;  3ZDT A;  2EMS A;  3W5V B;  3UF8 A;  3O65 B;  3PT2 B;  1WYG A;  2KAN A;  2GBN A;  3B08 A;  3KVF B;  1WGK A;  3LDZ E;  1EU4 A;  4MEM A;  3MC0 B;  2KDM A;  1SE4 A;  2KXJ A;  4HCN B;  1TY2 A;  2GLS A;  4EZL A;  1WJU A;  4DK5 A;  2KLG A;  3IG3 A;  1WJ6 A;  4HXD A;  2MJ3 A;  3RYT A;  1TS3 A;  4AOF A;  1FNW A;  1XLN A;  1IPG A;  2WXQ A;  4ZRJ A;  2NBU A;  2LGY A;  2JZ3 B;  2JPH A;  1I42 A;  4W9I A;  1ZGU B;  2A5U A;  1K51 A;  5LXI B;  2QHO A;  1B1Z A;  4K7U A;  1VD2 A;  1IUE A;  5CTR C;  1JWA D;  1XXG A;  2M4N A;  2O2V A;  4TUU A;  2MBH A;  4JIO U;  1J7B A;  1LM8 B;  2RSU A;  4WWN A;  3Q8E A;  3QHT A;  1PQS A;  4WIP A;  4PS7 A;  3L17 A;  4MJS A;  5DPS A;  3A9K A;  1E5W A;  3DWM A;  1K52 A;  1V80 A;  2C7M B;  3U2S C;  3U8Z A;  2LJI A;  2C9W B;  3PVL A;  3Q3N C;  2K6D B;  1QF6 A;  2LGI A;  1EUV B;  4KIK B;  4EZK A;  1WXM A;  2L1A A;  1OQQ A;  5H92 C;  4A20 A;  4DDG D;  4EOY A;  1YOV B;  4I6P A;  4ICV A;  3OLM D;  2D3A A;  4C7Y A;  3W1Y A;  5G55 A;  4X57 B;  2WDQ B;  3ZYY X;  5LNK 1;  2DZJ A;  4CHK A;  2KJR A;  2W55 A;  3HK0 A;  1TIF A;  3MHS D;  3MFG A;  1YQ3 B;  1FO4 A;  1AW7 A;  4CQN A;  2JXX A;  2J0M A;  2MW5 A;  1N60 A;  4FJV B;  4OZA A;  3ZTC A;  3PLV A;  4KDI C;  3HM3 A;  1HZ6 A;  2I1K A;  1JML A;  2B76 B;  2WNM A;  4OVV A;  3DHG C;  1J7A A;  3HM6 X;  3PRM B;  1OEY A;  5JHA A;  2MBQ A;  2KO3 A;  1PYW D;  3WAO A;  4LTU A;  2KHW B;  3AEF B;  2D11 A;  1MHH E;  1L0V B;  3W9C B;  1YN3 A;  1FMA D;  3M3J A;  3TEW A;  3VUW A;  2YLM A;  3MJ5 A;  5CHW A;  3X0W A;  3N1Z C;  1SIJ A;  3NZ3 A;  4KV2 A;  1TY0 A;  1QOB A;  2JRI B;  2D3B A;  1SF0 A;  2ZNV C;  2V9H A;  3VRB B;  2IBI B;  5FK9 C;  1MFW A;  1Y56 A;  4G0N B;  5LLI A;  2RPQ A;  3N1Y C;  4BAX A;  1F2R C;  1EWC A;  4HK2 A;  1J19 A;  3CSF A;  5FR6 A;  4ANV A;  3V60 A;  4C4V B;  2N9X A;  1LQB A;  3BYY B;  4B6W A;  2X8X X;  1HTQ A;  4NZL B;  1YN4 A;  4GIV A;  2WXM A;  1WXS A;  2UWQ A;  3R7Q A;  2WXJ A;  1JWS D;  5GXG B;  1WWT A;  2BWF A;  2DYM A;  2LXC A;  4MAC A;  3NZU A;  1K53 A;  2JVC A;  2WX0 A;  4QAY A;  2B3A A;  2NBV B;  1WZ3 A;  4EE2 A;  2Y5C A;  4WQM A;  4B0E A;  3U30 A;  2NTT A;  3AED B;  3VTU A;  4BOZ B;  1DGJ A;  3S2A A;  1S1Q B;  1N63 A;  5HKH A;  2K39 A;  1E10 A;  3ONS A;  3DPD A;  4C7Z A;  2VH2 A;  1I35 A;  2J53 A;  1OFF A;  5IOI A;  3MJW A;  2M0X A;  1I7H A;  2X38 A;  4REZ A;  5E6P A;  2JWU A;  2KWD A;  3PLU A;  4E74 A;  3B2G A;  3L4P A;  5DPT A;  3ZRC A;  2ONQ A;  2W82 A;  3W5U B;  4WJN A;  2RMM A;  1PFD A;  2K1F A;  2LGS A;  4CO7 A;  3M95 A;  4KDL B;  1U4A A;  3ALB A;  4IM0 A;  1UEL A;  2RDB C;  2AQ2 B;  2V4L A;  4W9K A;  4DHJ B;  3AE2 B;  2I38 A;  1ISN A;  1UGJ A;  3ZIM A;  4KVG B;  1OTR B;  2FIF A;  5EE3 A;  1YX6 B;  2K6Q A;  2LRU A;  2KC1 A;  4II2 B;  3I57 A;  2G3Q B;  1AYF A;  4FAD A;  3JW0 X;  1KRH A;  3P4Q B;  1UGM A;  1N6Z A;  2K3U A;  3QAQ A;  2V0G A;  5CHV C;  5D6J B;  4USA A;  2GBR A;  2FCS A;  1V86 A;  1XCQ L;  1EF5 A;  3Q2A C;  4GOC A;  1C79 A;  2KQ4 X;  4HJK A;  1L5P A;  2D07 B;  1V1P A;  2XK5 B;  2JYT A;  5EE1 A;  1FXT B;  3PRZ A;  1L0X B;  3CIR B;  3AU4 A;  2WP9 B;  1F0Z A;  2MRP A;  4BKS D;  3VDZ A;  1E8W A;  3QQ8 B;  4RF0 A;  3PZ7 A;  4HRO A;  3N30 A;  2JQR B;  5AEK B;  4HDO A;  5T8I A;  4W9D A;  3NVW A;  3ML8 A;  1FFU A;  2G1E A;  4IWO A;  3PHX B;  2R61 A;  3WAL A;  2K5P A;  4MT5 A;  5DPW A;  2N4F A;  1L4Z B;  2HTM E;  1FCL A;  3BVM A;  1ZDV A;  3PTF C;  1ZXH A;  2IPK D;  3ABV B;  3JVZ X;  2RDH A;  1TGZ B;  3TIX A;  1TTN A;  4FHJ A;  1WGG A;  4TMA B;  1RYJ A;  1T3Q A;  3QX1 A;  2C7N B;  1V5O A;  3FKY A;  3AE1 B;  3H7P B;  4XDC A;  1KF6 B;  3JSV B;  2AWT A;  1V6E A;  4BKS A;  4W9E A;  4YSZ B;  3PS6 A;  4ZRK A;  3V6C B;  2ICI A;  4KGT A;  5LXH A;  2RPV A;  1D6E C;  3NVV A;  5AZG A;  4B9K A;  1L4D B;  4OVU A;  1Z5S B;  4P1C C;  4RMA A;  4LLG M;  2ZJD A;  3A4R A;  4NJ7 A;  2INC C;  1GUA B;  3QWZ B;  4ZRQ A;  4DXF A;  5KHQ A;  2V4I B;  1R7S A;  2WXN A;  4RH6 A;  4M8M A;  1L6V A;  3AEA B;  1I4X A;  2WYQ A;  3IVF A;  2WXO A;  5HI1 A;  3HUI A;  3J9C A;  1VZ6 A;  1VR9 A;  1I4G A;  2ASQ A;  2KJ6 A;  3KW5 B;  1TZO A;  2UYZ B;  3SR6 A;  4AJY B;  3AI5 A;  1PGA A;  1NI3 A;  2O2V B;  1MPE A;  3VH3 B;  3N9Y C;  3ZO5 B;  2N7E A;  4HLE A;  1TYG B;  4MM3 B;  1FRD A;  2N1W A;  3Q14 C;  4MJS B;  1UNS A;  1YD8 U;  2BPS A;  2HDE A;  1ET9 A;  4I6N B;  1LGR A;  4DBG A;  4PYZ A;  3M63 B;  1YQB A;  2KDE B;  4IUM B;  5BMG A;  4RM8 A;  2WHI A;  2FE8 A;  4FHK A;  4US8 A;  4NQL B;  3AH7 A;  2KTR A;  2ON8 A;  1HEZ E;  2KAJ A;  2AEH A;  2L8J A;  4PT5 A;  2MWS B;  1HXY D;  4EFO A;  3OAW A;  4GLS C;  2J7Q B;  5IN7 A;  1WI0 A;  3E9S A;  4KSL C;  2FCQ A;  3BII D;  2N1V A;  1FNV A;  1E6E B;  2DWQ A;  4LNK A;  1I4P A;  4RGO S;  3DCG A;  4HRS A;  4ARI A;  2MBO A;  2KFK B;  1FM0 D;  1WF9 A;  4J3O D;  4L1B A;  2PJH A;  2G4D B;  1DOI A;  4BBN F;  3C19 A;  1WGY A;  3KQ4 A;  4YSX B;  2M8S A;  1TS5 A;  1JWB D;  4EUT A;  2BVC A;  1BML C;  1YJI A;  4M8N A;  4G50 A;  2BS3 B;  3A1Q A;  4IWQ A;  3RN9 C;  2GOW A;  2WXK A;  1GG3 A;  2DZM A;  4XX5 A;  4OZC A;  2SEB D;  1EF1 A;  1WYW B;  4UDU C;  2D3G A;  2WXR A;  2RDG A;  4N6E B;  3VAW A;  1IBX B;  5L83 A;  1NI2 A;  3ZJV A;  4KGR A;  4TQ1 A;  2BYE A;  1WE7 A;  3BYT B;  3NS8 A;  3E56 A;  3VFK A;  1WM3 A;  3MHZ A;  1KH0 A;  3ZW3 A;  3P4R B;  2LZ6 A;  1TS2 A;  1GC6 A;  4KZC A;  2JWZ A;  1E7P B;  2JF5 A;  4N9F 4;  3Q8C A;  2CHX A;  2PTL A;  1SE3 A;  4S17 A;  2V3S A;  4K3C A;  3WIM A;  2O6V D;  2N9E B;  2K22 A;  5D7G A;  3LXF A;  5BO4 B;  2RR9 A;  3KYD D;  2JUO A;  4DXA B;  2MJE A;  2KQS A;  2ZVO A;  2AQ1 B;  1L6U A;  4LNF A;  5HG2 A;  3P4S B;  4WQO B;  5JZE B;  1GC7 A;  2ZW1 A;  2KOX A;  3ML9 A;  4L2Y A;  1UWM A;  2K9X A;  4MGZ E;  4ZOH C;  2QJL A;  4LDT D;  3NVY A;  3VTW A;  1WX9 A;  2RD0 A;  3QAR A;  1OQY A;  2CHZ A;  2ZW0 A;  5D3I B;  1PGB A;  1SB3 C;  3UGB B;  4FJY A;  3WCQ A;  3ECI A;  4ASW C;  2IYD B;  3HRD D;  2CR5 A;  1WRD B;  3PZ8 A;  2WXF A;  2GBK A;  2I1J A;  2KX3 A;  2O6V A;  1ZW7 A;  1WMH A;  4GXB A;  3APF A;  2TSS A;  4YSY B;  3UIN B;  2E3T A;  3NVZ A;  1BUI C;  1XLO A;  2G4S A;  2BGF A;  1YMH E;  1OQR A;  3KUD B;  3KWV A;  1KM7 A;  2JSV X;  3P4P B;  4KGS A;  1C1Y B;  3IAS 1;  5G5H A;  1V49 A;  4DQO C;  3NUH B;  1J7C A;  4A55 A;  4GSW A;  3V62 A;  1NYR A;  3A9J A;  2R2Q A;  3L08 A;  5JXV A;  2MP2 A;  1GB4 A;  1D5X C;  4GDK B;  4S0R A;  1XCT L;  5J17 A;  3PRP B;  2BTE A;  3EUB 2;  4MGI E;  2LI5 A;  1GB1 A;  4NPN A;  3KUC B;  1MHX A;  1WJN A;  2MHJ A;  2MQJ A;  1RFA A;  4HDQ A;  2MSE D;  1WX8 A;  3AN1 A;  3L0W B;  3SFD B;  1WZ0 A;  4MEL A;  3AM9 A;  3ZVV A;  2LHD A;  2QC8 A;  3DHI C;  2PW9 A;  2JZP A;  2WXG A;  4HVB A;  3QC8 B;  1LFD A;  1JRO A;  1UZX B;  3AEC B;  5EE0 A;  1XQQ A;  2D3C A;  5DPR A;  1A5R A;  2IO2 B;  1P98 A;  1Q10 A;  3VUX A;  2KYW A;  5KHO A;  2BWE S;  3LJ3 A;  2INP E;  2MX2 A;  3AV8 A;  2WXL A;  1TT5 B;  2DZK A;  3EFU A;  3ZJU A;  1B9R A;  1VJK A;  1LO5 D;  1F52 A;  3BWU D;  2BS4 B;  3V3X A;  4NJ6 A;  4W9G A;  3M62 B;  1E7U A;  1P7F A;  4LK0 M;  2V3P A;  2FCN A;  3Q8F A;  4RGT A;  4F1S A;  2KWU B;  4IW0 A;  3TCA A;  3URY A;  4J6I A;  2GRI A;  1JRU A;  4HEA 1;  4WJQ A;  2Q5W D;  4HWI B;  1UUP A;  2BB5 A;  2WXP A;  3ZNG C;  2W3R A;  4EKU A;  4B0M A;  5IA7 A;  2LFI A;  3R2T A;  1WXQ A;  4RNA A;  1V81 A;  5C23 A;  5E6J A;  2OJW A;  2ZCB A;  3BZD B;  1WGR A;  1X1M A;  2OOB B;  1P7E A;  5FR3 A;  1T0Y A;  1N5X A;  1WH3 A;  1JCK B;  2M0A A;  4XE0 A;  2WWZ A;  4OVZ A;  1FXA A;  1SEB D;  1WX7 A;  2WDV B;  4WH4 A;  1XLQ A;  4AJW A;  3IAM 1;  3T3N A;  2LHE A;  3T3O A;  2VZK B;  2LVO A;  3WAN A;  1QOG A;  1TZ1 A;  3H6N A;  4H2A A;  2XNA C;  1KLV A;  2AL6 A;  2W9N A;  1WM2 A;  1C9F A;  1MJD A;  1ZPS A;  3IT4 B;  2L00 B;  4F8C B;  4BKG A;  1C78 A;  4JWS C;  2LJ5 A;  2BKR B;  1KJT A;  2NVU I;  1FNU A;  1SIF A;  5CHF A;  1KLU D;  4G3X B;  2UU7 A;  2D5G A;  5AZH A;  2KQ7 A;  4BKT A;  4PK1 A;  2YEP B;  3AMZ A;  2LAS A;  3GOE A;  4GU2 A;  2K25 A;  3FIL B;  4FUL A;  3VUY A;  3L54 A;  3SHQ A;  2IZV B;  1FIQ A;  2CU1 A;  4JWU C;  2KTR B;  2E6X A;  2BS2 B;  2BBC A;  3PRE A;  1HTO A;  4KIK A;  5C2T B;  2KMM A;  1FPY A;  3N20 C;  2IO3 B;  2XN9 C;  2MBE A;  5BYS A;  4XDD A;  2KN4 A;  1C4C A;  2KDI A;  2W3S A;  1JAL A;  4JE3 B;  5IP4 D;  1Y8R C;  4RM9 A;  4JX1 C;  5TSS A;  2PE6 B;  3HVD A;  2M17 A;  3KLS X;  2L0F A;  4HKQ A;  4ZHO A;  5E6O A;  2KMA A;  2WU5 B;  2IDY A;  1T0S C;  5BMI A;  3LYY A;  2OED A;  2QCZ A;  3RNF C;  3EGR A;  2KC2 A;  3R3M A;  3VRA B;  3A1Q B;  2REX A;  3ZRF A;  2XBB C;  2D2Q A;  3AE8 B;  3QCA A;  3NRZ A;  2DX5 B;  2C7H A;  3AE4 B;  4JGH B;  1FCC C;  1KFY B;  1S3S G;  2MJD A;  1WE6 A;  3PO0 A;  3FAH A;  4TKN A;  1AWD A;  3GS2 A;  1EM7 A;  1N61 A;  1Q5W B;  1K8R B;  3EFC A;  4GDL A;  3RUL A;  2KFJ A;  2CS4 A;  1YJ1 A;  3DVG Y;  3W2D A;  2WXI A;  1EO6 A;  3BK1 A;  1QOF A;  2AYO B;  3L16 A;  3TMP B;  2EKE C;  3AU5 A;  2EEL A;  5AUK A;  3BK2 A;  3AXC A;  2CJO A;  2AQ3 B;  1E8X A;  3CWI A;  3O13 A;  2GMI C;  1SE9 A;  4P1B C;  1I4H A;  4TSS A;  3C8Y A;  3AE6 B;  2HJ8 A;  2PVG C;  3U4E G;  2KAC A;  4N58 A;  1Q1O A;  4FN2 A;  3ZQ4 A;  4IDI A;  1CZP A;  4KSK C;  1D3Z A;  2LRW A;  1E9M A;  4W9F A;  1V97 A;  2FID A;  2NPT A;  1ZP0 B;  3AEG B;  3RT3 B;  2QDF A;  5C1Z A;  3P42 A;  1ZOY B;  1KLG D;  2FCM A;  1C4P A;  2K8H A;  1YJJ A;  2J4X A;  3TUO A;  1VRA B;  3OJ3 A;  3RMK C;  2A4Z A;  3BVG A;  4PS3 A;  3NHE B;  3GP7 A;  4XYC A;  3QJZ A;  4HKZ E;  4B95 A;  3IFW B;  2RGF A;  2K0P A;  2MH7 A;  4N59 A;  1GNU A;  2HTH A;  4M00 A;  2J0K A;  2O6V B;  3IBE A;  3BIN A;  2FAZ A;  1EU3 A;  2IGG A;  2BYF A;  2L83 A;  1T0Q C;  4IC7 B;  2WLB A;  1TKE A;  4HPM B;  3A9K B;  3AUL A;  2G45 B;  3DBH I;  3PPA A;  1WJ4 A;  1WSP A;  3U7Z A;  3EA6 A;  2BYT A;  3I9V 1;  2FBW B;  2KZR A;  4RFB A;  4TQ0 A;  5BYQ A;  4LDT B;  3N3K B;  1HZ5 A;  2QIL A;  3KWL A;  4OW0 A;  4ZYS A;  3I5J C;  3MP9 A;  4XWW A;  1DOY A;  4NAW A;  2DNF A;  3P63 A;  2Y3A A;  4ITK A;  2AL3 A;  3A9J B;  2KNB A;  5FKA C;  3AEE B;  3Q3O C;  1HE8 A;  2GBJ A;  2MP2 B;  4MGK E;  3TEZ A;  3ZKJ C;  1H8C A;  4CYE A;  3R2I A;  3GE8 C;  3CMM B;  3KYC D;  4K3B A;  2MCN B;  1F2R I;  2Z59 B;  1V8C A;  3RPF C;  2LVQ A;  3OJ4 B;  1GOZ A;  1H4R A;  4L23 A;  4YWG G;  1XT9 B;  2NR2 A;  3ZUN A;  3UQA A;  2BQQ A;  3IXS A;  1F77 A;  1IP9 A;  1UBQ A;  1JWM D;  1UD7 A;  1WGD A;  1UBI A;  2L76 A;  1YX5 B;  4YTM B;  3ENE A;  3DBH B;  3SEB A;  3ZNZ B; 
#chains in the Genus database with same CATH homology
 5IOI A;  1UF0 A;  5IKC M;  2DNF A;  5IO9 A;  1MFW A;  5IP4 D;  2BQQ A;  5IN7 A;  1MJD A;  1MG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...