1MG4A

Structure of n-terminal doublecortin domain from dclk: wild type protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
b'KKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOUBLECORTIN-LIKE KINASE (N-TERMINAL DOMAIN)
publication title The DCX-domain Tandems of Doublecortin and Doublecortin-like Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 101
sequence length 101
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 1mg4A00
1MJDA 5IOIA 5IN7A 2BQQA 5IP4D 2DNFA 5IO9A 1UF0A 5IKCM 1MG4A 1MFWA
chains in the Genus database with same CATH superfamily
2V3SA 3Q3JA 1D4BA 4MACA 2V3NA 2D07B 4GMVA 3PLVA 5G2NA 5D3IB 1M94A 1FNVA 1WGYA 3AE6B 4XYCA 2LUEA 3P4QB 1MPEA 2L00B 4MGIE 2GI9A 3QAQA 1YNTE 1BT0A 2Y5CA 2O6VA 2CJNA 1VZ6A 1XLQA 4WAFA 2V9HA 3EA6A 4DHJD 4BFRA 2KNBA 2L76A 5J17A 1V1PA 2RDHA 2UU7A 3AI5A 4FADA 4LCDE 4YSZB 1PGBA 4R3DA 1E8WA 1ZOYB 3HHMA 2MP2A 1YJ1A 2BGFA 1ACCA 3VHTC 2JQRB 3KYDD 2M17A 3TSSA 1WJNA 2E6XA 1B1ZA 5DPRA 4CO7A 1QZEA 2KYWA 4YL8A 4IM0A 4NPNA 3BY4B 4KDIC 3WALA 3I3TB 4XWWA 3X23A 2WU2B 2NTTA 3A33B 1VDVA 1I4HA 2DHZA 4E3CA 3LDZE 4LLGM 2OEDA 5FR3A 2QMTA 4XX5A 3KUZA 3RI7C 3IT6B 4LTUA 4WAAA 3RCZA 1SB3C 1R4NI 4WJQA 3APFA 2EKEC 3VUYA 2IZVB 3NZUA 2X8XX 1ZP0B 2AL6A 4K1RB 2NPTB 4OVZA 1WGDA 3W5UB 2KLCA 3TEZA 3ALBA 3BINA 2ONQA 2UYZB 3ZGZA 4NAWA 2UWQA 3H8HA 4P1BC 3URYA 4XC2A 3ZNGC 3PO0A 1EF5A 3OJ4B 2L52A 3C8YA 4OW0A 1NBFC 4WURA 5LNK1 3DBLB 2BS4B 1E8XA 2MCNB 1IGCA 1I4XA 2IO3B 1U4AA 1UH6A 3BK2A 1FRRA 3CWIA 3TEWA 1TYGB 4CYEA 2FIDA 2KC2A 3IBEA 4BZAA 1QF6A 5C2TB 4YTNB 2AQ3B 3U4EG 2GRIA 3M63B 4W9GA 5LXHA 1IPGA 1WYWB 1V8CA 3OWEB 1STEA 2K39A 2WP9B 2V1YA 3AE5B 3ZJTA 5EE9A 1P7FA 3AB5A 2ZPYA 1SIFA 1KM7A 2DLBA 2JSVX 1F9JA 3TBLD 1NVID 4GLSC 4KZ0A 3DBHB 3UQAA 1C4CA 4FHKA 3SU8X 3VRAB 1SJHD 3NVWA 2IYDB 3MJ5A 4ASWC 4MJSA 5EE0A 2PVGC 1I4PA 1TT5B 5DPTA 1YIWA 1FFUA 1DOXA 4XWTA 4S17A 3TL5A 4ANWA 4HKQA 1SBBB 2XN9C 3H7PA 1WXSA 3W1YA 5BYSA 2RPVA 4F1SA 1SE2A 2NR2A 1WY8A 4K7SA 3OLMD 4DXGA 2IGHA 1TKEA 3KH0A 1Y8RC 3W2DA 2C5LC 3EUB2 5BMGA 2ZNVC 2G1EA 2IY1B 2KJRA 4LNOA 5BMIA 3TJPA 2LHEA 2IBIB 2CKHB 4NY0A 5IN7A 2BT6A 4DXFA 4A3OA 2JZZA 3ZIMA 3V62A 2J53A 3DVGY 1YN3A 3HK0A 1T0QC 2KQ4X 3SHQA 1JWSD 4KDLB 3DQVA 3ML9A 2AEHA 3ZKJC 4NJ7A 1F0ZA 2ZW0A 3ZNHB 4ZRJA 4MM3B 3Q8FA 4FLHA 1P98A 2W55A 4RNAA 4TMAB 1T3QA 2GBJA 2R61A 3L54A 2C9WB 3AEBB 1YN4A 4JIOU 1SEBD 2JT4B 1HTOA 5TR5A 2K3UA 1QOGA 1QT9A 2DAJA 1V49A 4N58A 5L95C 5BYRA 2KQSA 1MHXA 1K50A 3P1MA 1ZW7A 1Q1OA 3UINB 4YWGG 5JHBA 1L4ZB 4GDLB 2LFIA 5CHWA 4M0WA 4P1CC 1UBQA 4YSXB 2JY6A 2IJ0A 1ROEA 2FAZA 4C00A 2YLMA 2L8JA 3O13A 5IAAC 1E0ZA 3H9DA 4P7IA 1ESFA 1HEZE 1PYWD 1E10A 1HZ6A 1EM7A 4HK2A 3RPFC 4DK5A 2PIAA 4B9KA 2BTEA 1FIQA 4TQ1A 2LRWA 4DWFA 2HTME 2KOXA 2HTHA 1XLPA 2W82A 3HIZA 1GG3A 3PZ7A 3R8BA 4HCNB 4IDIA 3DOWA 2WXMA 1RRBA 3V60A 1WSPA 2DZIA 2MEKA 4PYUA 4HJGE 2MSED 5D2MB 1SXTA 4XDCA 2AL3A 4ACFA 4FXCA 2BW2A 1MVKA 3VH4B 4ZRIA 5AZFA 4BVUC 1AN8A 3B9JA 5IO9A 3HVDA 3L17A 1K8RB 3ZRCA 3B2GA 3BK1A 1FNWA 2DYBA 3U2SC 4I6LB 3DBRB 4GOCA 3RNAC 2G9HD 4TUUA 3U7ZA 3NY5A 1V5OA 2WS3B 5C23A 1MI0A 3MTNB 3AEGB 3A4RA 3PZ8A 2J52A 4A3PA 2MH7A 2D3CA 3NS1A 4OZCA 3OG5A 1OQRA 4MGZE 3E56A 2KZRA 2N7EA 1MFWA 1HTQA 2NBUA 3KUDB 2M8SA 3UGBB 2ZZPB 3GB1A 3Q3FA 2GBRA 1J7AA 2KTFA 3R66C 2L0FA 2DYMA 1UUPA 3L08A 4KGRA 2KC1A 1JW9D 2M56B 1KTKA 2JWZA 3R2IA 2LI5A 1L6VA 1R7SA 3DWGC 1JWBD 2RD0A 2LGXA 2ACZB 2MQJA 4BKTA 1E7UA 2VRRB 3TIXA 3RNBC 2A5UA 2FUG1 5CTRC 2W9NA 3KW5B 3DPDA 1RLFA 2LGIA 2H88B 4GIVA 1VJKA 3P4SB 2R2QA 2HE7A 4DHZE 3IFWB 2MJ3A 4DDGD 3ZLZA 1N6ZA 1XEEA 3ZXVA 3U52E 2CS4A 2JWUA 3AMZA 2INNE 3APCA 1YX5B 2G4SA 2KWUB 1CZPA 5KHQA 2N4FA 3OJ3A 2QSDA 4RFBA 1NDDA 2MX2A 3Q6BA 3PREA 1QKZA 3ZW3A 2PPHA 1EWYC 1WI0A 2WLBA 2O2VA 1T6BX 1IBXB 2Y5PA 1GB1A 3QC8B 3PRZA 1OQYA 2C7HA 2ON8A 2N9XA 3AE7B 3GP7A 2KO3A 3ONSA 2BS3B 2KMMA 5IOIA 5CHVC 3M62B 4FJZA 1Q0WB 3TMPB 3ZYYX 1XCQL 2KX0A 4YT0B 1WGHA 4MEMA 1JALA 3CSFA 1X1MA 1J8CA 2D10A 1GJZA 1TS4A 1ISNA 3QK0A 1WXVA 2CHZA 2J4XA 3RMKC 2AQ1B 3SR6A 2XK5A 2OJRA 1WZ0A 2BS2B 1NYQA 1WM3A 1V5TA 1WR1A 1K51A 3HVZA 3RULA 3RN9C 5EDSA 1VR9A 1WR6E 3AU5A 1SE3A 4L2YA 5EE1A 4ZDVA 3VXWA 4M01A 2L0TA 1MG4A 4A8XC 2LASA 5D94A 4TKNA 2KDMA 3NG0A 3ZTDA 4WJPA 1C76A 1EU3A 3P2BA 2WXNA 4NQLB 4DQOC 1NEKB 2KD0A 2I2YA 4HROA 2WXHA 1YJIA 3DCGA 1I4GA 2IO0B 4F8CB 2M0AA 1P7EA 2N1VA 4GSWA 1KJTA 5LXIB 4KIKB 3TUOA 4KSLC 4PT5A 1ZDVA 4RM8A 1V80A 3RYTA 2KN4A 3X0WA 2CU1A 3QHTA 1E7VA 1EWCA 1H4RA 2JYTA 2V3PA 1Y56A 2KTRB 2JXTA 4KSKC 3NOBA 3HUIA 1N5WA 3Q3NC 3I5JC 4K7WA 2D5GA 4K3BA 2BYTA 2WXOA 1SSNA 3VR8B 2BYEA 1FD6A 1J7BA 4HWIB 2JUOA 1SGHA 4ZYNA 1R4MI 3LYYA 2GBKA 1R4NB 3NVZA 4EOYA 1V81A 2LD9A 3AEDB 1N60A 2PKOA 2DBYA 2WDVB 1VD2A 1XLNA 1JQ4A 3MHSD 2DENB 3MJWA 4JGHB 2C7NB 1GAQB 2BWFA 3RNGC 2JYEA 2ZCCA 3H1UA 1L5PA 2MLBA 1JROA 4EKUA 2KN5A 1TY0A 1XF5L 1L0VB 1WXMA 4OVVA 2J0KA 3N1YC 3VTUA 1TZ1A 1EUVB 5D6JB 4G11A 4MGKE 2QILA 2NS5A 2K8HA 3SFDB 4B0MA 5BMHA 1L7YA 3NZ3A 2LVQA 2NVUI 2KFKB 2K8BA 3E9SA 2B3AA 3QJZA 4M8NA 2OJWA 4JX1C 2WNMA 1F2RC 1EF1A 3DBSA 2KDFB 3PVLA 1J0GA 4O1NA 3VDZA 1YQBA 4FULA 2KJ6A 4YSYB 3VRBB 2LJ5A 3KWLA 4AP4C 4XE0A 3APDA 4ANXA 4K3CA 3Q8EA 3S2AA 2MHJA 5E6OA 2WXRA 3A9KA 1OGWA 2KDIA 1AW7A 1KLVA 1V97A 3JVZX 1D5ZC 3T9LA 1FCCC 2AQ2B 2Z59B 4LNFA 3P4PB 2QCZA 3C19A 1D5MC 2O6VB 3N20C 1DOYA 3DBLI 2DNFA 4GB9A 3Q8BA 3M95A 1VCBA 3VH3B 3AEEB 4WWNA 2LZ6A 2KANA 1Q10A 2JXXA 5TSSA 3A9JA 4HRSA 3PRPB 2B76B 3A1QA 3DHGC 2X38A 2BYVE 4E74A 4JWUC 1XLOA 4NNJB 2KHWB 3GS2A 1TJEA 3W1SA 1E8ZA 2LXCA 2MJDA 3IAM1 3QARA 4EZJA 3QQ8B 1JWUD 1CJEA 3JW0X 2NMQA 3VR9B 4BKSD 5HHDG 1F2RI 1GC7A 2Y5BB 1WZ3A 2PJHA 2WXQA 2N9PC 2AWTA 2BWES 3PRMB 4A9AA 4FJYA 4M8MA 3DBHI 3B1LX 2VH1A 2K6DB 4ANUA 1VZ8A 2KDEB 4RH6A 1K52A 1PFDA 2BBCA 1WXAA 2NTSA 3FILA 4RGMA 4I6PA 4OZAA 3DVNU 2M1MA 4LJOB 2D3AA 1HA5A 4KGTA 3ABVB 1UD7A 1GC6A 4IM3A 2LMCA 3NVVA 2JPHA 2MW5A 2BQQA 3D32A 3UF8A 5E6JA 2C7MB 1WGGA 2FBWB 4AS1A 1XQQA 2Z0DB 2K6QA 1V1OA 2K25A 5J18A 1XCTL 5C1ZA 3BVMA 1BXTA 1SE9A 3J9CA 1SJED 3AN1A 4C56C 2KACA 2J7QB 1E5WA 3W1SC 3NJTA 2W3SA 2L32A 2EMTA 1K53A 2AYOB 3R7QA 1Q5WB 1V86A 3ETRA 2KJHB 1I7HA 4ZOHC 1C9FA 4FBJB 2V4LA 1E7PB 2IPKD 1WRDB 1E9MA 4US8A 2KXJA 4ARCA 3H6NA 4L23A 5HI1A 1C1YB 2KDBA 1N61A 3Q8AA 3ZXRA 3ZNZB 3L16A 2JF5A 3CSTA 3VQIA 2CU3A 3MHZA 5AUIA 5E6NA 1ET6A 1WJ6A 3AXCA 3W5VB 3NS8A 4KX6B 4KVGB 1L4DB 4ICVA 5EE3A 3I63C 4ZHOA 2IGGA 2HD5B 1RWSA 2QDFA 1MJDA 3ZUNA 3H7SA 3RNFC 3H7PB 3ZO5B 1L0YB 2KWCA 3K9PB 4USAA 3B2FA 2IY0B 3IG3A 1XT9B 1FCLA 2GBMA 3SDLC 1PQSA 3BZDB 3ZQ4A 4GN1A 3ZDMC 2ZVNA 3B08A 4JLCA 2KK8A 1YQ4B 2RPQA 1V2YA 3RUIB 1A5RA 2M0XA 1TY2A 1WX9A 4GXBA 2LRUA 2BKFA 4HLEA 1FM0D 3AE8B 3N3KB 2KLGA 1VRAB 2BB5A 3GE8C 1TS3A 2HJ8A 3U7DA 4BOSC 2MBQA 1JWAD 4II2B 1I4QA 3FAHA 1C79A 4BBNF 5G5GA 5I4DA 2K8CA 4WWOA 2D3GA 4X57B 4P6VF 3Q2AC 1UF0A 3L10B 1ZE3D 2WXPA 4B0EA 5KHOA 4IKGA 3CIRB 3ZJVA 3P63A 4XGAB 1AWDA 5JZEB 4G3XB 2DYOA 3NVYA 1WJUA 3R2TA 2DZKA 4IOIE 3MFGA 5H8YE 2N9LA 1WMHA 2KQ7A 5D7GA 1SE4A 2FCNA 5IKCM 1LO5D 4YTPB 1FNUA 2OOBB 2N9KA 3DHIC 3UIOB 1PUTA 5AZHA 5BO4B 2O6VD 3DBRI 4EZLA 1HXYD 3UIPB 2N9EB 2FCSA 5C3JB 2KAJA 1OTRB 2SAKA 1DYQA 1KLUD 3NHEB 1UNSA 2INDC 5GXGB 4WIPA 4QAYA 4II3B 4RGNA 3QWZB 3SFEB 2PW9A 3DVNV 3EGRA 4M0WB 4B6WA 2WQYB 4HJKA 2K5PA 1N62A 3Q3OC 3ZNID 4F7ZA 4LK0M 2BYFA 4WQMA 2K0PA 1ZXHA 2DAFA 2J0MA 3TEYA 4KIKA 1ZPSA 2N1WA 2WDRB 2VZKB 4AOFA 3PZDA 4HDOA 3T3OA 1P0RA 4RMAA 4W9FA 3U30A 3OAWA 2EKIA 4MT5A 2KTRA 3PT2B 2DZMA 5JHAA 1D5XC 4IG7B 4K81A 4Q2JA 1ZKHA 3EFCA 1MG8A 2Z8LA 2FIFA 1JRPA 2ZCBA 4C4VB 2G45B 3BVZA 2ICIA 3BIID 1WJ4A 3AE4B 2QJLA 4LNIA 2RR9A 1AYFA 1YJJA 4NJ6A 2JZ3B 2N7JA 3Q3MC 2RSUA 4W9HA 5GMVA 5AEKB 1VLBA 4RGTA 3RD2A 4N9F4 1PGXA 1QQRA 3HRDD 1ZXIA 1RFAA 1NI2A 2NBVB 1JCKB 1H8CA 1YD8U 4JPSA 2INPE 1IUEA 1ENFA 3CF6E 3NRZA 2KMCA 4DXAB 2WU5B 3U8ZA 3VTWA 4WH4A 1WM2A 5MPOA 5CHFA 1TZOA 2ZVOA 1UZXB 4GDKB 2MBEA 2MRPA 2QIEB 1NYRA 2NPTA 2WX0A 3IAS1 4C7ZA 4EE2A 1J19A 4WJOA 4W9EA 2KFJA 2QHOA 2PVOD 3SEBA 3I9V1 3QIJA 4L1BA 4ZRKA 1D3ZA 4MSMB 5BYQA 4W9DA 1KF6B 2REXA 1WYGA 3EFUA 4MDKE 3PGEA 4JE3B 2PLPA 1F77A 2KX3A 2KT7A 4KGSA 2MBBB 4A90A 1MHHE 2Z0EB 4MGYE 1OEYA 3PHWB 4N59A 2I38A 2V4IB 1RAXA 1QILA 1R4MB 3GZNI 3NUHB 4EFOA 2L83A 4LDTB 1UWMA 4DDID 1IYFA 1TIFA 4XDDA 2L05A 3PLUA 2C60A 2BVCA 3ENEA 3NZSA 3JSVB 1N63A 4MELA 1CK1A 4IWPA 2GB1A 1HZ5A 2TSSA 4IWQA 3WANA 3PTFC 1YN5A 3ECIA 2ASQA 1JRUA 3PV1A 3ZRFA 4WQOB 1B9RA 2O2VB 3N9YC 2LJIA 1WGKA 2J0JA 4PS8A 2K9XA 1QLBB 1PDXA 4HXDA 2LVPA 3O65B 1SIJA 3V61A 1CMXB 3FC4A 2WHIA 2D2QA 3K9OB 2DZJA 1GB4A 1T0RC 5H92C 2EELA 4PS7A 2PE6B 3RNCC 3RNEC 1FXIA 1UWXA 1KRHA 2D3BA 1OQQA 2XK5B 1YOVB 1T0SC 3I57A 4J3OD 3AEAB 2IGDA 3DHHC 1CQVA 1S3SG 1XXGA 2H89B 3RZFA 3ML8A 3AECB 3PS6A 3BVGA 3VUXA 2QC8A 2GMIC 4RCOA 4AJWA 1NENB 1G6JA 2V0GA 3ZJUA 2KKCA 4LJPB 2CHXA 1T0YA 2ZPNA 2W54A 4ICUA 1YQ3B 4IM2A 4IWOA 1YX6B 3M3JA 3AM9A 1TTNA 4OZBA 1QOAA 2RMMA 2BPSA 2OHFA 5AZGA 4CQNA 3WAOA 1IGDA 2W3RA 2M4NA 2WGSA 4JWSC 4XZ4A 5IA7A 2CHWA 3DVGX 2JVCA 2WXGA 2YEPF 2WXIA 1GPXA 1OEYJ 4MM3A 3TEXA 4TSSA 1TS2A 2D11A 1VZ7A 1FFVA 1SF0A 1S1QB 3MC0B 2LEKA 2NBWB 1D6EC 1GUAB 2YEPB 5DPWA 1BUIC 2KVZA 3AE2B 2VZKD 3QCAA 4MH0E 1GNUA 4HVBA 4MH8A 1V1PB 4LNKA 4HPPA 3AEFB 2JRIB 3P4RB 3BYTB 1LM8B 2MP2B 3IXSA 1XO3A 2IO1B 4W9JA 1UGMA 2LGYA 4ZHPA 1WX8A 4GDLA 5HFYA 1FO4A 2ZEQA 3Q8CA 3B0AA 4WJNA 1FXTB 4FA6A 3R3MA 4W9KA 4KKIA 3SD5A 3T8MA 1WRIA 3AH7A 4NJCA 2HJ1A 2Q5WD 3VUWA 1GOZA 3ZVVA 1E6EB 1P9DU 2LGDA 1DOIA 4RF1A 1P3QU 2GBNA 1WE6A 2BF8B 1EO6A 2INCC 3R7RA 2Y3AA 3MC9A 4S0RA 1E8YA 4US9A 4ITKA 2BB6A 4CHKA 3UQBA 4YXDB 2I1JA 4NAWB 2N0SB 5JH5C 4UDUC 2WDQB 1V9JA 1LGRA 4HKZE 3LB8C 3WA0A 1IP9A 3V3XA 1TGZB 2EMSA 1HQRD 1C3TA 4TQ0A 3V6EB 2K22A 2KMAA 4E71A 4WWPA 2DWQA 1KFYB 2JX5A 3EHVA 5FK9C 1I42A 4W9IA 1XD3B 4B95A 1F52A 2ZNVB 4HCPB 2WXKA 3A9KB 2XEWA 2FE8A 1JWMD 1KLGD 1HE8A 2LUMA 5J2RA 2WX1A 5FR6A 4G50A 4LDTD 4AQ7A 4YTMB 3V6CB 1ET9A 1F1HA 2N7DA 4WWMA 1QOFA 1C77A 2AX5A 3L0WB 1FXAA 5IP4D 4MJSB 1WGRA 3WAMA 3A9JB 1N5XA 3AE9B 3A1QB 4C7YA 3WIMA 4H2AA 2PEAA 3FKYA 3ZDTA 2PMVA 2QEJC 4C80A 1JMLA 3WCQA 2WXJA 5AUKA 2LVOA 2WXLA 5HKHA 4HEA1 3KUCB 2ZW1A 3AULA 4W9LA 2R2OA 4NQKE 4AJYB 4EEWA 2G3QB 2MBOA 3Q14C 5LLIA 4DHJB 1A70A 4DHZB 3VTVA 1DGJA 3N32A 3VFKA 3BWUD 2HDEA 2L1AA 4IW0A 1FEHA 1KOTA 1WXQA 4IC7B 3ZTCA 2L7RA 3A4SC 4K7UA 4I6NB 1RFKA 4JQWC 1P1AA 3P42A 2G4DB 3FILB 2K1FA 3MC8A 1WFYA 1Z2MA 1I4RA 1WIAA 2RGFA 4RF0A 4BBNC 4BOZB 4C4VA 1EU4A 1L6UA 3N30A 3L4PA 1L0XB 1IBXA 4GU2A 3C0RB 2KVRA 5JXVA 2YVCA 3W9CB 1Z5SB 3KWVA 2NCNA 2RDBC 1L2NA 3GOEA 5DPSA 3N1XC 4BKSA 2WWZA 3RFZB 4ANVA 1YMHE 3IHPC 4M00A 3UI3A 3KVFB 3MP9A 4TV3A 3JYUA 2LGSA 3LXFA 5E6PA 4W9CA 2LXAA 4FJVB 2WDTB 2CR5A 1T5XD 2MA9B 3PPAA 4NZLB 5CX3A 1WH3A 5DCNA 4NAMA 1WF9A 2KWVB 1FMAD 4ARIA 1NI3A 4OVUA 3EC8A 3T3NA 3DDCB 2LWPA 4GDKA 4HPMB 2FNJB 3IT4B 4ZRPA 4KV2A 4ZYSA 2MBHA 2FUHB 3PSEB 4BKGA 1C4PA 2IO2B 4J6IA 4MSQB 3GE3C 4EUTA 4A55A 1TKYA 4KKJA 2BKRB 2JRHA 3AU4A 3KLSX 3V05A 4URKA 5T8IA 2VH2A 2J42A 3RT3B 3KYCD 4IUMB 1LQBA 1PGAA 4EZKA 2I1KA 3N1ZC 1TS5A 3TCAA 2LHDA 1QOBA 3QA8A 3VAWA 4D2KA 3RZWC 1E90A 2WYQA 3JSVA 3LJ3A 3AE3B 2PTLA 1C4AA 2KWDA 4OHJA 4A20A 2GOWA 2CJOA 2FCQA 1ZDXA 3VVWB 3PHXB 3DWMA 4G0NB 4FHJA 3EECA 1WWTA 1C78A 4PS3A 1WX7A 4JL9A 2DX5B 4FN2A 1M4VA 4RM9A 4N6EB 5L83A 2XNAC 1RYJA 4REZA 2E3TA 3CMMB 4PK1A 2XBBC 3Q69A 2JZPA 1FPYA 4KZCA 3AV8A 2RDGA 4PYZA 1V6EA 3AE1B 3BYYB 1ZGUB 2FCMA 1BMLC 1KH0A 3QX1A 2M19A 2PE9A 4ZRQA 4GGQA 5G55A 2IDYA 1ZUD2 1WMHB 2MJEA 3HM6X 4RGOS 3GZNB 4A6QA 2L3ZA 3KQ4A 5G5HA 2SEBD 1UGJA 3IVFA 2ZJDA 1TBEA 1J7CA 4DBGA 1FRDA 1LFDA 4HDQA 2KFKA 4AWJA 4BAXA 2GLSA 2WXFA 2A4ZA 1WE7A 4LNNA 2MWSB 3HM3A 1TKGA 5D3DA 5HG2A 1I35A 1AARA 1LXDA 4P16A 3L13A 5FKAC 3WAPA 1UELA 4AUQC 1RM6C 4HPLB 1OFFA 2JU6X 4M02A 1UBIA
chains in the Genus database with same CATH topology
1MJDA 5IOIA 5IN7A 2BQQA 5IP4D 2DNFA 5IO9A 1UF0A 5IKCM 1MG4A 1MFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJD A;  5IOI A;  5IN7 A;  2BQQ A;  5IP4 D;  2DNF A;  5IO9 A;  1UF0 A;  5IKC M;  1MG4 A;  1MFW A; 
#chains in the Genus database with same CATH topology
 2V3S A;  3Q3J A;  1D4B A;  4MAC A;  2V3N A;  2D07 B;  4GMV A;  3PLV A;  5G2N A;  5D3I B;  1M94 A;  1FNV A;  1WGY A;  3AE6 B;  4XYC A;  2LUE A;  3P4Q B;  1MPE A;  2L00 B;  4MGI E;  2GI9 A;  3QAQ A;  1YNT E;  1BT0 A;  2Y5C A;  2O6V A;  2CJN A;  1VZ6 A;  1XLQ A;  4WAF A;  2V9H A;  3EA6 A;  4DHJ D;  4BFR A;  2KNB A;  2L76 A;  5J17 A;  1V1P A;  2RDH A;  2UU7 A;  3AI5 A;  4FAD A;  4LCD E;  4YSZ B;  1PGB A;  4R3D A;  1E8W A;  1ZOY B;  3HHM A;  2MP2 A;  1YJ1 A;  2BGF A;  1ACC A;  3VHT C;  2JQR B;  3KYD D;  2M17 A;  3TSS A;  1WJN A;  2E6X A;  1B1Z A;  5DPR A;  4CO7 A;  1QZE A;  2KYW A;  4YL8 A;  4IM0 A;  4NPN A;  3BY4 B;  4KDI C;  3WAL A;  3I3T B;  4XWW A;  3X23 A;  2WU2 B;  2NTT A;  3A33 B;  1VDV A;  1I4H A;  2DHZ A;  4E3C A;  3LDZ E;  4LLG M;  2OED A;  5FR3 A;  2QMT A;  4XX5 A;  3KUZ A;  3RI7 C;  3IT6 B;  4LTU A;  4WAA A;  3RCZ A;  1SB3 C;  1R4N I;  4WJQ A;  3APF A;  2EKE C;  3VUY A;  2IZV B;  3NZU A;  2X8X X;  1ZP0 B;  2AL6 A;  4K1R B;  2NPT B;  4OVZ A;  1WGD A;  3W5U B;  2KLC A;  3TEZ A;  3ALB A;  3BIN A;  2ONQ A;  2UYZ B;  3ZGZ A;  4NAW A;  2UWQ A;  3H8H A;  4P1B C;  3URY A;  4XC2 A;  3ZNG C;  3PO0 A;  1EF5 A;  3OJ4 B;  2L52 A;  3C8Y A;  4OW0 A;  1NBF C;  4WUR A;  5LNK 1;  3DBL B;  2BS4 B;  1E8X A;  2MCN B;  1IGC A;  1I4X A;  2IO3 B;  1U4A A;  1UH6 A;  3BK2 A;  1FRR A;  3CWI A;  3TEW A;  1TYG B;  4CYE A;  2FID A;  2KC2 A;  3IBE A;  4BZA A;  1QF6 A;  5C2T B;  4YTN B;  2AQ3 B;  3U4E G;  2GRI A;  3M63 B;  4W9G A;  5LXH A;  1IPG A;  1WYW B;  1V8C A;  3OWE B;  1STE A;  2K39 A;  2WP9 B;  2V1Y A;  3AE5 B;  3ZJT A;  5EE9 A;  1P7F A;  3AB5 A;  2ZPY A;  1SIF A;  1KM7 A;  2DLB A;  2JSV X;  1F9J A;  3TBL D;  1NVI D;  4GLS C;  4KZ0 A;  3DBH B;  3UQA A;  1C4C A;  4FHK A;  3SU8 X;  3VRA B;  1SJH D;  3NVW A;  2IYD B;  3MJ5 A;  4ASW C;  4MJS A;  5EE0 A;  2PVG C;  1I4P A;  1TT5 B;  5DPT A;  1YIW A;  1FFU A;  1DOX A;  4XWT A;  4S17 A;  3TL5 A;  4ANW A;  4HKQ A;  1SBB B;  2XN9 C;  3H7P A;  1WXS A;  3W1Y A;  5BYS A;  2RPV A;  4F1S A;  1SE2 A;  2NR2 A;  1WY8 A;  4K7S A;  3OLM D;  4DXG A;  2IGH A;  1TKE A;  3KH0 A;  1Y8R C;  3W2D A;  2C5L C;  3EUB 2;  5BMG A;  2ZNV C;  2G1E A;  2IY1 B;  2KJR A;  4LNO A;  5BMI A;  3TJP A;  2LHE A;  2IBI B;  2CKH B;  4NY0 A;  5IN7 A;  2BT6 A;  4DXF A;  4A3O A;  2JZZ A;  3ZIM A;  3V62 A;  2J53 A;  3DVG Y;  1YN3 A;  3HK0 A;  1T0Q C;  2KQ4 X;  3SHQ A;  1JWS D;  4KDL B;  3DQV A;  3ML9 A;  2AEH A;  3ZKJ C;  4NJ7 A;  1F0Z A;  2ZW0 A;  3ZNH B;  4ZRJ A;  4MM3 B;  3Q8F A;  4FLH A;  1P98 A;  2W55 A;  4RNA A;  4TMA B;  1T3Q A;  2GBJ A;  2R61 A;  3L54 A;  2C9W B;  3AEB B;  1YN4 A;  4JIO U;  1SEB D;  2JT4 B;  1HTO A;  5TR5 A;  2K3U A;  1QOG A;  1QT9 A;  2DAJ A;  1V49 A;  4N58 A;  5L95 C;  5BYR A;  2KQS A;  1MHX A;  1K50 A;  3P1M A;  1ZW7 A;  1Q1O A;  3UIN B;  4YWG G;  5JHB A;  1L4Z B;  4GDL B;  2LFI A;  5CHW A;  4M0W A;  4P1C C;  1UBQ A;  4YSX B;  2JY6 A;  2IJ0 A;  1ROE A;  2FAZ A;  4C00 A;  2YLM A;  2L8J A;  3O13 A;  5IAA C;  1E0Z A;  3H9D A;  4P7I A;  1ESF A;  1HEZ E;  1PYW D;  1E10 A;  1HZ6 A;  1EM7 A;  4HK2 A;  3RPF C;  4DK5 A;  2PIA A;  4B9K A;  2BTE A;  1FIQ A;  4TQ1 A;  2LRW A;  4DWF A;  2HTM E;  2KOX A;  2HTH A;  1XLP A;  2W82 A;  3HIZ A;  1GG3 A;  3PZ7 A;  3R8B A;  4HCN B;  4IDI A;  3DOW A;  2WXM A;  1RRB A;  3V60 A;  1WSP A;  2DZI A;  2MEK A;  4PYU A;  4HJG E;  2MSE D;  5D2M B;  1SXT A;  4XDC A;  2AL3 A;  4ACF A;  4FXC A;  2BW2 A;  1MVK A;  3VH4 B;  4ZRI A;  5AZF A;  4BVU C;  1AN8 A;  3B9J A;  5IO9 A;  3HVD A;  3L17 A;  1K8R B;  3ZRC A;  3B2G A;  3BK1 A;  1FNW A;  2DYB A;  3U2S C;  4I6L B;  3DBR B;  4GOC A;  3RNA C;  2G9H D;  4TUU A;  3U7Z A;  3NY5 A;  1V5O A;  2WS3 B;  5C23 A;  1MI0 A;  3MTN B;  3AEG B;  3A4R A;  3PZ8 A;  2J52 A;  4A3P A;  2MH7 A;  2D3C A;  3NS1 A;  4OZC A;  3OG5 A;  1OQR A;  4MGZ E;  3E56 A;  2KZR A;  2N7E A;  1MFW A;  1HTQ A;  2NBU A;  3KUD B;  2M8S A;  3UGB B;  2ZZP B;  3GB1 A;  3Q3F A;  2GBR A;  1J7A A;  2KTF A;  3R66 C;  2L0F A;  2DYM A;  1UUP A;  3L08 A;  4KGR A;  2KC1 A;  1JW9 D;  2M56 B;  1KTK A;  2JWZ A;  3R2I A;  2LI5 A;  1L6V A;  1R7S A;  3DWG C;  1JWB D;  2RD0 A;  2LGX A;  2ACZ B;  2MQJ A;  4BKT A;  1E7U A;  2VRR B;  3TIX A;  3RNB C;  2A5U A;  2FUG 1;  5CTR C;  2W9N A;  3KW5 B;  3DPD A;  1RLF A;  2LGI A;  2H88 B;  4GIV A;  1VJK A;  3P4S B;  2R2Q A;  2HE7 A;  4DHZ E;  3IFW B;  2MJ3 A;  4DDG D;  3ZLZ A;  1N6Z A;  1XEE A;  3ZXV A;  3U52 E;  2CS4 A;  2JWU A;  3AMZ A;  2INN E;  3APC A;  1YX5 B;  2G4S A;  2KWU B;  1CZP A;  5KHQ A;  2N4F A;  3OJ3 A;  2QSD A;  4RFB A;  1NDD A;  2MX2 A;  3Q6B A;  3PRE A;  1QKZ A;  3ZW3 A;  2PPH A;  1EWY C;  1WI0 A;  2WLB A;  2O2V A;  1T6B X;  1IBX B;  2Y5P A;  1GB1 A;  3QC8 B;  3PRZ A;  1OQY A;  2C7H A;  2ON8 A;  2N9X A;  3AE7 B;  3GP7 A;  2KO3 A;  3ONS A;  2BS3 B;  2KMM A;  5IOI A;  5CHV C;  3M62 B;  4FJZ A;  1Q0W B;  3TMP B;  3ZYY X;  1XCQ L;  2KX0 A;  4YT0 B;  1WGH A;  4MEM A;  1JAL A;  3CSF A;  1X1M A;  1J8C A;  2D10 A;  1GJZ A;  1TS4 A;  1ISN A;  3QK0 A;  1WXV A;  2CHZ A;  2J4X A;  3RMK C;  2AQ1 B;  3SR6 A;  2XK5 A;  2OJR A;  1WZ0 A;  2BS2 B;  1NYQ A;  1WM3 A;  1V5T A;  1WR1 A;  1K51 A;  3HVZ A;  3RUL A;  3RN9 C;  5EDS A;  1VR9 A;  1WR6 E;  3AU5 A;  1SE3 A;  4L2Y A;  5EE1 A;  4ZDV A;  3VXW A;  4M01 A;  2L0T A;  1MG4 A;  4A8X C;  2LAS A;  5D94 A;  4TKN A;  2KDM A;  3NG0 A;  3ZTD A;  4WJP A;  1C76 A;  1EU3 A;  3P2B A;  2WXN A;  4NQL B;  4DQO C;  1NEK B;  2KD0 A;  2I2Y A;  4HRO A;  2WXH A;  1YJI A;  3DCG A;  1I4G A;  2IO0 B;  4F8C B;  2M0A A;  1P7E A;  2N1V A;  4GSW A;  1KJT A;  5LXI B;  4KIK B;  3TUO A;  4KSL C;  4PT5 A;  1ZDV A;  4RM8 A;  1V80 A;  3RYT A;  2KN4 A;  3X0W A;  2CU1 A;  3QHT A;  1E7V A;  1EWC A;  1H4R A;  2JYT A;  2V3P A;  1Y56 A;  2KTR B;  2JXT A;  4KSK C;  3NOB A;  3HUI A;  1N5W A;  3Q3N C;  3I5J C;  4K7W A;  2D5G A;  4K3B A;  2BYT A;  2WXO A;  1SSN A;  3VR8 B;  2BYE A;  1FD6 A;  1J7B A;  4HWI B;  2JUO A;  1SGH A;  4ZYN A;  1R4M I;  3LYY A;  2GBK A;  1R4N B;  3NVZ A;  4EOY A;  1V81 A;  2LD9 A;  3AED B;  1N60 A;  2PKO A;  2DBY A;  2WDV B;  1VD2 A;  1XLN A;  1JQ4 A;  3MHS D;  2DEN B;  3MJW A;  4JGH B;  2C7N B;  1GAQ B;  2BWF A;  3RNG C;  2JYE A;  2ZCC A;  3H1U A;  1L5P A;  2MLB A;  1JRO A;  4EKU A;  2KN5 A;  1TY0 A;  1XF5 L;  1L0V B;  1WXM A;  4OVV A;  2J0K A;  3N1Y C;  3VTU A;  1TZ1 A;  1EUV B;  5D6J B;  4G11 A;  4MGK E;  2QIL A;  2NS5 A;  2K8H A;  3SFD B;  4B0M A;  5BMH A;  1L7Y A;  3NZ3 A;  2LVQ A;  2NVU I;  2KFK B;  2K8B A;  3E9S A;  2B3A A;  3QJZ A;  4M8N A;  2OJW A;  4JX1 C;  2WNM A;  1F2R C;  1EF1 A;  3DBS A;  2KDF B;  3PVL A;  1J0G A;  4O1N A;  3VDZ A;  1YQB A;  4FUL A;  2KJ6 A;  4YSY B;  3VRB B;  2LJ5 A;  3KWL A;  4AP4 C;  4XE0 A;  3APD A;  4ANX A;  4K3C A;  3Q8E A;  3S2A A;  2MHJ A;  5E6O A;  2WXR A;  3A9K A;  1OGW A;  2KDI A;  1AW7 A;  1KLV A;  1V97 A;  3JVZ X;  1D5Z C;  3T9L A;  1FCC C;  2AQ2 B;  2Z59 B;  4LNF A;  3P4P B;  2QCZ A;  3C19 A;  1D5M C;  2O6V B;  3N20 C;  1DOY A;  3DBL I;  2DNF A;  4GB9 A;  3Q8B A;  3M95 A;  1VCB A;  3VH3 B;  3AEE B;  4WWN A;  2LZ6 A;  2KAN A;  1Q10 A;  2JXX A;  5TSS A;  3A9J A;  4HRS A;  3PRP B;  2B76 B;  3A1Q A;  3DHG C;  2X38 A;  2BYV E;  4E74 A;  4JWU C;  1XLO A;  4NNJ B;  2KHW B;  3GS2 A;  1TJE A;  3W1S A;  1E8Z A;  2LXC A;  2MJD A;  3IAM 1;  3QAR A;  4EZJ A;  3QQ8 B;  1JWU D;  1CJE A;  3JW0 X;  2NMQ A;  3VR9 B;  4BKS D;  5HHD G;  1F2R I;  1GC7 A;  2Y5B B;  1WZ3 A;  2PJH A;  2WXQ A;  2N9P C;  2AWT A;  2BWE S;  3PRM B;  4A9A A;  4FJY A;  4M8M A;  3DBH I;  3B1L X;  2VH1 A;  2K6D B;  4ANU A;  1VZ8 A;  2KDE B;  4RH6 A;  1K52 A;  1PFD A;  2BBC A;  1WXA A;  2NTS A;  3FIL A;  4RGM A;  4I6P A;  4OZA A;  3DVN U;  2M1M A;  4LJO B;  2D3A A;  1HA5 A;  4KGT A;  3ABV B;  1UD7 A;  1GC6 A;  4IM3 A;  2LMC A;  3NVV A;  2JPH A;  2MW5 A;  2BQQ A;  3D32 A;  3UF8 A;  5E6J A;  2C7M B;  1WGG A;  2FBW B;  4AS1 A;  1XQQ A;  2Z0D B;  2K6Q A;  1V1O A;  2K25 A;  5J18 A;  1XCT L;  5C1Z A;  3BVM A;  1BXT A;  1SE9 A;  3J9C A;  1SJE D;  3AN1 A;  4C56 C;  2KAC A;  2J7Q B;  1E5W A;  3W1S C;  3NJT A;  2W3S A;  2L32 A;  2EMT A;  1K53 A;  2AYO B;  3R7Q A;  1Q5W B;  1V86 A;  3ETR A;  2KJH B;  1I7H A;  4ZOH C;  1C9F A;  4FBJ B;  2V4L A;  1E7P B;  2IPK D;  1WRD B;  1E9M A;  4US8 A;  2KXJ A;  4ARC A;  3H6N A;  4L23 A;  5HI1 A;  1C1Y B;  2KDB A;  1N61 A;  3Q8A A;  3ZXR A;  3ZNZ B;  3L16 A;  2JF5 A;  3CST A;  3VQI A;  2CU3 A;  3MHZ A;  5AUI A;  5E6N A;  1ET6 A;  1WJ6 A;  3AXC A;  3W5V B;  3NS8 A;  4KX6 B;  4KVG B;  1L4D B;  4ICV A;  5EE3 A;  3I63 C;  4ZHO A;  2IGG A;  2HD5 B;  1RWS A;  2QDF A;  1MJD A;  3ZUN A;  3H7S A;  3RNF C;  3H7P B;  3ZO5 B;  1L0Y B;  2KWC A;  3K9P B;  4USA A;  3B2F A;  2IY0 B;  3IG3 A;  1XT9 B;  1FCL A;  2GBM A;  3SDL C;  1PQS A;  3BZD B;  3ZQ4 A;  4GN1 A;  3ZDM C;  2ZVN A;  3B08 A;  4JLC A;  2KK8 A;  1YQ4 B;  2RPQ A;  1V2Y A;  3RUI B;  1A5R A;  2M0X A;  1TY2 A;  1WX9 A;  4GXB A;  2LRU A;  2BKF A;  4HLE A;  1FM0 D;  3AE8 B;  3N3K B;  2KLG A;  1VRA B;  2BB5 A;  3GE8 C;  1TS3 A;  2HJ8 A;  3U7D A;  4BOS C;  2MBQ A;  1JWA D;  4II2 B;  1I4Q A;  3FAH A;  1C79 A;  4BBN F;  5G5G A;  5I4D A;  2K8C A;  4WWO A;  2D3G A;  4X57 B;  4P6V F;  3Q2A C;  1UF0 A;  3L10 B;  1ZE3 D;  2WXP A;  4B0E A;  5KHO A;  4IKG A;  3CIR B;  3ZJV A;  3P63 A;  4XGA B;  1AWD A;  5JZE B;  4G3X B;  2DYO A;  3NVY A;  1WJU A;  3R2T A;  2DZK A;  4IOI E;  3MFG A;  5H8Y E;  2N9L A;  1WMH A;  2KQ7 A;  5D7G A;  1SE4 A;  2FCN A;  5IKC M;  1LO5 D;  4YTP B;  1FNU A;  2OOB B;  2N9K A;  3DHI C;  3UIO B;  1PUT A;  5AZH A;  5BO4 B;  2O6V D;  3DBR I;  4EZL A;  1HXY D;  3UIP B;  2N9E B;  2FCS A;  5C3J B;  2KAJ A;  1OTR B;  2SAK A;  1DYQ A;  1KLU D;  3NHE B;  1UNS A;  2IND C;  5GXG B;  4WIP A;  4QAY A;  4II3 B;  4RGN A;  3QWZ B;  3SFE B;  2PW9 A;  3DVN V;  3EGR A;  4M0W B;  4B6W A;  2WQY B;  4HJK A;  2K5P A;  1N62 A;  3Q3O C;  3ZNI D;  4F7Z A;  4LK0 M;  2BYF A;  4WQM A;  2K0P A;  1ZXH A;  2DAF A;  2J0M A;  3TEY A;  4KIK A;  1ZPS A;  2N1W A;  2WDR B;  2VZK B;  4AOF A;  3PZD A;  4HDO A;  3T3O A;  1P0R A;  4RMA A;  4W9F A;  3U30 A;  3OAW A;  2EKI A;  4MT5 A;  2KTR A;  3PT2 B;  2DZM A;  5JHA A;  1D5X C;  4IG7 B;  4K81 A;  4Q2J A;  1ZKH A;  3EFC A;  1MG8 A;  2Z8L A;  2FIF A;  1JRP A;  2ZCB A;  4C4V B;  2G45 B;  3BVZ A;  2ICI A;  3BII D;  1WJ4 A;  3AE4 B;  2QJL A;  4LNI A;  2RR9 A;  1AYF A;  1YJJ A;  4NJ6 A;  2JZ3 B;  2N7J A;  3Q3M C;  2RSU A;  4W9H A;  5GMV A;  5AEK B;  1VLB A;  4RGT A;  3RD2 A;  4N9F 4;  1PGX A;  1QQR A;  3HRD D;  1ZXI A;  1RFA A;  1NI2 A;  2NBV B;  1JCK B;  1H8C A;  1YD8 U;  4JPS A;  2INP E;  1IUE A;  1ENF A;  3CF6 E;  3NRZ A;  2KMC A;  4DXA B;  2WU5 B;  3U8Z A;  3VTW A;  4WH4 A;  1WM2 A;  5MPO A;  5CHF A;  1TZO A;  2ZVO A;  1UZX B;  4GDK B;  2MBE A;  2MRP A;  2QIE B;  1NYR A;  2NPT A;  2WX0 A;  3IAS 1;  4C7Z A;  4EE2 A;  1J19 A;  4WJO A;  4W9E A;  2KFJ A;  2QHO A;  2PVO D;  3SEB A;  3I9V 1;  3QIJ A;  4L1B A;  4ZRK A;  1D3Z A;  4MSM B;  5BYQ A;  4W9D A;  1KF6 B;  2REX A;  1WYG A;  3EFU A;  4MDK E;  3PGE A;  4JE3 B;  2PLP A;  1F77 A;  2KX3 A;  2KT7 A;  4KGS A;  2MBB B;  4A90 A;  1MHH E;  2Z0E B;  4MGY E;  1OEY A;  3PHW B;  4N59 A;  2I38 A;  2V4I B;  1RAX A;  1QIL A;  1R4M B;  3GZN I;  3NUH B;  4EFO A;  2L83 A;  4LDT B;  1UWM A;  4DDI D;  1IYF A;  1TIF A;  4XDD A;  2L05 A;  3PLU A;  2C60 A;  2BVC A;  3ENE A;  3NZS A;  3JSV B;  1N63 A;  4MEL A;  1CK1 A;  4IWP A;  2GB1 A;  1HZ5 A;  2TSS A;  4IWQ A;  3WAN A;  3PTF C;  1YN5 A;  3ECI A;  2ASQ A;  1JRU A;  3PV1 A;  3ZRF A;  4WQO B;  1B9R A;  2O2V B;  3N9Y C;  2LJI A;  1WGK A;  2J0J A;  4PS8 A;  2K9X A;  1QLB B;  1PDX A;  4HXD A;  2LVP A;  3O65 B;  1SIJ A;  3V61 A;  1CMX B;  3FC4 A;  2WHI A;  2D2Q A;  3K9O B;  2DZJ A;  1GB4 A;  1T0R C;  5H92 C;  2EEL A;  4PS7 A;  2PE6 B;  3RNC C;  3RNE C;  1FXI A;  1UWX A;  1KRH A;  2D3B A;  1OQQ A;  2XK5 B;  1YOV B;  1T0S C;  3I57 A;  4J3O D;  3AEA B;  2IGD A;  3DHH C;  1CQV A;  1S3S G;  1XXG A;  2H89 B;  3RZF A;  3ML8 A;  3AEC B;  3PS6 A;  3BVG A;  3VUX A;  2QC8 A;  2GMI C;  4RCO A;  4AJW A;  1NEN B;  1G6J A;  2V0G A;  3ZJU A;  2KKC A;  4LJP B;  2CHX A;  1T0Y A;  2ZPN A;  2W54 A;  4ICU A;  1YQ3 B;  4IM2 A;  4IWO A;  1YX6 B;  3M3J A;  3AM9 A;  1TTN A;  4OZB A;  1QOA A;  2RMM A;  2BPS A;  2OHF A;  5AZG A;  4CQN A;  3WAO A;  1IGD A;  2W3R A;  2M4N A;  2WGS A;  4JWS C;  4XZ4 A;  5IA7 A;  2CHW A;  3DVG X;  2JVC A;  2WXG A;  2YEP F;  2WXI A;  1GPX A;  1OEY J;  4MM3 A;  3TEX A;  4TSS A;  1TS2 A;  2D11 A;  1VZ7 A;  1FFV A;  1SF0 A;  1S1Q B;  3MC0 B;  2LEK A;  2NBW B;  1D6E C;  1GUA B;  2YEP B;  5DPW A;  1BUI C;  2KVZ A;  3AE2 B;  2VZK D;  3QCA A;  4MH0 E;  1GNU A;  4HVB A;  4MH8 A;  1V1P B;  4LNK A;  4HPP A;  3AEF B;  2JRI B;  3P4R B;  3BYT B;  1LM8 B;  2MP2 B;  3IXS A;  1XO3 A;  2IO1 B;  4W9J A;  1UGM A;  2LGY A;  4ZHP A;  1WX8 A;  4GDL A;  5HFY A;  1FO4 A;  2ZEQ A;  3Q8C A;  3B0A A;  4WJN A;  1FXT B;  4FA6 A;  3R3M A;  4W9K A;  4KKI A;  3SD5 A;  3T8M A;  1WRI A;  3AH7 A;  4NJC A;  2HJ1 A;  2Q5W D;  3VUW A;  1GOZ A;  3ZVV A;  1E6E B;  1P9D U;  2LGD A;  1DOI A;  4RF1 A;  1P3Q U;  2GBN A;  1WE6 A;  2BF8 B;  1EO6 A;  2INC C;  3R7R A;  2Y3A A;  3MC9 A;  4S0R A;  1E8Y A;  4US9 A;  4ITK A;  2BB6 A;  4CHK A;  3UQB A;  4YXD B;  2I1J A;  4NAW B;  2N0S B;  5JH5 C;  4UDU C;  2WDQ B;  1V9J A;  1LGR A;  4HKZ E;  3LB8 C;  3WA0 A;  1IP9 A;  3V3X A;  1TGZ B;  2EMS A;  1HQR D;  1C3T A;  4TQ0 A;  3V6E B;  2K22 A;  2KMA A;  4E71 A;  4WWP A;  2DWQ A;  1KFY B;  2JX5 A;  3EHV A;  5FK9 C;  1I42 A;  4W9I A;  1XD3 B;  4B95 A;  1F52 A;  2ZNV B;  4HCP B;  2WXK A;  3A9K B;  2XEW A;  2FE8 A;  1JWM D;  1KLG D;  1HE8 A;  2LUM A;  5J2R A;  2WX1 A;  5FR6 A;  4G50 A;  4LDT D;  4AQ7 A;  4YTM B;  3V6C B;  1ET9 A;  1F1H A;  2N7D A;  4WWM A;  1QOF A;  1C77 A;  2AX5 A;  3L0W B;  1FXA A;  5IP4 D;  4MJS B;  1WGR A;  3WAM A;  3A9J B;  1N5X A;  3AE9 B;  3A1Q B;  4C7Y A;  3WIM A;  4H2A A;  2PEA A;  3FKY A;  3ZDT A;  2PMV A;  2QEJ C;  4C80 A;  1JML A;  3WCQ A;  2WXJ A;  5AUK A;  2LVO A;  2WXL A;  5HKH A;  4HEA 1;  3KUC B;  2ZW1 A;  3AUL A;  4W9L A;  2R2O A;  4NQK E;  4AJY B;  4EEW A;  2G3Q B;  2MBO A;  3Q14 C;  5LLI A;  4DHJ B;  1A70 A;  4DHZ B;  3VTV A;  1DGJ A;  3N32 A;  3VFK A;  3BWU D;  2HDE A;  2L1A A;  4IW0 A;  1FEH A;  1KOT A;  1WXQ A;  4IC7 B;  3ZTC A;  2L7R A;  3A4S C;  4K7U A;  4I6N B;  1RFK A;  4JQW C;  1P1A A;  3P42 A;  2G4D B;  3FIL B;  2K1F A;  3MC8 A;  1WFY A;  1Z2M A;  1I4R A;  1WIA A;  2RGF A;  4RF0 A;  4BBN C;  4BOZ B;  4C4V A;  1EU4 A;  1L6U A;  3N30 A;  3L4P A;  1L0X B;  1IBX A;  4GU2 A;  3C0R B;  2KVR A;  5JXV A;  2YVC A;  3W9C B;  1Z5S B;  3KWV A;  2NCN A;  2RDB C;  1L2N A;  3GOE A;  5DPS A;  3N1X C;  4BKS A;  2WWZ A;  3RFZ B;  4ANV A;  1YMH E;  3IHP C;  4M00 A;  3UI3 A;  3KVF B;  3MP9 A;  4TV3 A;  3JYU A;  2LGS A;  3LXF A;  5E6P A;  4W9C A;  2LXA A;  4FJV B;  2WDT B;  2CR5 A;  1T5X D;  2MA9 B;  3PPA A;  4NZL B;  5CX3 A;  1WH3 A;  5DCN A;  4NAM A;  1WF9 A;  2KWV B;  1FMA D;  4ARI A;  1NI3 A;  4OVU A;  3EC8 A;  3T3N A;  3DDC B;  2LWP A;  4GDK A;  4HPM B;  2FNJ B;  3IT4 B;  4ZRP A;  4KV2 A;  4ZYS A;  2MBH A;  2FUH B;  3PSE B;  4BKG A;  1C4P A;  2IO2 B;  4J6I A;  4MSQ B;  3GE3 C;  4EUT A;  4A55 A;  1TKY A;  4KKJ A;  2BKR B;  2JRH A;  3AU4 A;  3KLS X;  3V05 A;  4URK A;  5T8I A;  2VH2 A;  2J42 A;  3RT3 B;  3KYC D;  4IUM B;  1LQB A;  1PGA A;  4EZK A;  2I1K A;  3N1Z C;  1TS5 A;  3TCA A;  2LHD A;  1QOB A;  3QA8 A;  3VAW A;  4D2K A;  3RZW C;  1E90 A;  2WYQ A;  3JSV A;  3LJ3 A;  3AE3 B;  2PTL A;  1C4A A;  2KWD A;  4OHJ A;  4A20 A;  2GOW A;  2CJO A;  2FCQ A;  1ZDX A;  3VVW B;  3PHX B;  3DWM A;  4G0N B;  4FHJ A;  3EEC A;  1WWT A;  1C78 A;  4PS3 A;  1WX7 A;  4JL9 A;  2DX5 B;  4FN2 A;  1M4V A;  4RM9 A;  4N6E B;  5L83 A;  2XNA C;  1RYJ A;  4REZ A;  2E3T A;  3CMM B;  4PK1 A;  2XBB C;  3Q69 A;  2JZP A;  1FPY A;  4KZC A;  3AV8 A;  2RDG A;  4PYZ A;  1V6E A;  3AE1 B;  3BYY B;  1ZGU B;  2FCM A;  1BML C;  1KH0 A;  3QX1 A;  2M19 A;  2PE9 A;  4ZRQ A;  4GGQ A;  5G55 A;  2IDY A;  1ZUD 2;  1WMH B;  2MJE A;  3HM6 X;  4RGO S;  3GZN B;  4A6Q A;  2L3Z A;  3KQ4 A;  5G5H A;  2SEB D;  1UGJ A;  3IVF A;  2ZJD A;  1TBE A;  1J7C A;  4DBG A;  1FRD A;  1LFD A;  4HDQ A;  2KFK A;  4AWJ A;  4BAX A;  2GLS A;  2WXF A;  2A4Z A;  1WE7 A;  4LNN A;  2MWS B;  3HM3 A;  1TKG A;  5D3D A;  5HG2 A;  1I35 A;  1AAR A;  1LXD A;  4P16 A;  3L13 A;  5FKA C;  3WAP A;  1UEL A;  4AUQ C;  1RM6 C;  4HPL B;  1OFF A;  2JU6 X;  4M02 A;  1UBI A; 
#chains in the Genus database with same CATH homology
 1MJD A;  5IOI A;  5IN7 A;  2BQQ A;  5IP4 D;  2DNF A;  5IO9 A;  1UF0 A;  5IKC M;  1MG4 A;  1MFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...