1MG4A

Structure of n-terminal doublecortin domain from dclk: wild type protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
KKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The DCX-domain Tandems of Doublecortin and Doublecortin-like Kinase
pubmed doi rcsb
molecule keywords DOUBLECORTIN-LIKE KINASE (N-TERMINAL DOMAIN)
molecule tags Transferase
source organism Homo sapiens
total genus 22
structure length 101
sequence length 101
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 1mg4A00
5IO9A 5IKCM 2DNFA 1UF0A 2BQQA 5IOIA 5IN7A 1MFWA 1MG4A 1MJDA 5IP4D
chains in the Genus database with same CATH superfamily
3RNAC 4B0EA 2N1WA 1D5XC 2BVCA 2M8SA 3JSVA 4PYUA 4BZAA 3SDLC 4KGRA 5TSSA 1I42A 1WJ6A 2J0MA 1JW9D 2BYFA 2KJHB 3Q8AA 1I4QA 4HEA1 4US8A 4CO7A 5HHDG 4AP4C 5L83A 1RM6C 2KQ4X 1NI2A 4EOYA 4MGKE 1UD7A 4DQOC 4I6NB 3L17A 4HKQA 3EA6A 3NRZA 2KZRA 2BS2B 2KQSA 3WANA 3VHTC 3HRDD 3RNEC 2VH2A 2JXXA 1HE8A 4UDUC 1UUPA 3NHEB 1GJZA 1GC7A 2IO1B 2NBUA 2RPVA 3BK1A 1RYJA 3ZO5B 1DOIA 1ZE3D 5JZEB 1I4PA 2CS4A 4DWFA 3A9KB 4OZCA 1TZ1A 2MQJA 2V4LA 2NPTB 3SFEB 2KQ7A 4MELA 3U4EG 2N9PC 2JXTA 4ZRPA 2DENB 1PFDA 3TEYA 2GMIC 2RPQA 1WE6A 3IHPC 3NY5A 3SU8X 3ZIMA 4MSQB 2K9XA 1WI0A 3VR8B 1UWXA 3RFZB 1S1QB 2JWZA 2KFJA 1VRAB 4DXAB 2NVUI 4S17A 3RNBC 3T3NA 3DBHI 3ZNHB 1MVKA 4HROA 2J7QB 3OJ3A 3VH3B 2CJNA 3A9KA 2NPTA 3N20C 1I4XA 4N59A 2BTEA 4FA6A 3DBLB 4LTUA 4K1RB 3ZJUA 1FIQA 4TQ0A 1MG8A 2KJRA 4IW0A 5LNK1 3APDA 4G3XB 4WWMA 1FNVA 2JZ3B 3B9JA 1GUAB 1WGRA 3P4SB 3AE6B 1P7FA 1OEYJ 4IWOA 2MCNB 2KN5A 2NCNA 3K9PB 5AEKB 3H8HA 3EFUA 2N9EB 2L83A 5IN7A 2KYWA 2J53A 3DHIC 1EF1A 4RM9A 3I63C 1Q0WB 3UINB 1JWSD 2JZZA 1WYWB 2BKRB 2J4XA 5D7GA 1JWUD 4HVBA 1DOYA 2IGHA 2BYTA 1SE4A 5IKCM 1QF6A 3RULA 1HEZE 1JWAD 2JSVX 2RDGA 3NZUA 2OOBB 1I4HA 4A3OA 2R61A 4DDID 1YX6B 2IBIB 3ABVB 4GXBA 2QDFA 4LNFA 3VAWA 2AQ2B 4RM8A 4A55A 3T8MA 3HIZA 4BBNF 1WF9A 2WXQA 4XDCA 3AE5B 3M62B 3Q8EA 1P0RA 3B2GA 3V05A 3AE2B 4W9CA 3JW0X 4ICUA 3ZYYX 1V6EA 1EU4A 1E8YA 3RNGC 1V5OA 2OHFA 2BS4B 4NZLB 3TEZA 2BWFA 2L05A 1YN5A 4TUUA 3NJTA 2C9WB 4LCDE 1XD3B 3KYDD 5TR5A 1L0YB 3Q8CA 5EE1A 3RMKC 2PJHA 2KVZA 1J0GA 1WRDB 2FCMA 1OTRB 3SHQA 1TBEA 5BMIA 3PHWB 4RNAA 1UWMA 3GOEA 2KDFB 2ZNVB 5KHQA 2M0AA 4MJSB 3CF6E 1TS5A 3A9JB 1ACCA 1JROA 2ZPYA 1XEEA 2OJRA 1KM7A 3VRBB 3KLSX 2RMMA 4JIOU 2K6DB 3QJZA 3NUHB 3AE1B 3SFDB 2UYZB 4F7ZA 5DPWA 4DHZB 3MHZA 2QJLA 3VRAB 4FN2A 2W9NA 2WWZA 3DVNU 4MJSA 1TYGB 4XZ4A 1AN8A 4RF0A 3A9JA 4WQMA 2H88B 1PDXA 3EHVA 1FXAA 2FIFA 5CHWA 1UGJA 2LRWA 1C4CA 2Y5CA 2FIDA 1MHXA 3FC4A 1LXDA 2VZKB 4GOCA 3OLMD 4IM2A 4NJ6A 5G5GA 3VTWA 1V9JA 2V3SA 4N58A 5FK9C 4OVUA 2JU6X 3PT2B 3AE9B 1V49A 4LNOA 4ANVA 2LHDA 1G6JA 2MJEA 4GGQA 4II3B 1WRIA 4BKGA 4GIVA 3W1YA 1PGXA 3VUWA 1L0VB 1NVID 1FRDA 1R4NI 4LNKA 5E6OA 2D07B 1WZ3A 3QIJA 1VCBA 2K8HA 4LJPB 1D6EC 3DOWA 2Q5WD 1R7SA 1ZXHA 3L08A 4PS3A 4WWNA 4MH8A 2V0GA 2KLCA 4LK0M 2KX3A 3S2AA 2EMTA 4DHJB 3KUZA 3V61A 4KX6B 3BVZA 4EEWA 5BO4B 2ZW1A 1QT9A 2MX2A 1E6EB 5J2RA 1HXYD 4XWWA 2LXAA 1SJHD 3C8YA 4JWUC 2Y3AA 1WR1A 3LB8C 1EWYC 1E7VA 5GMVA 4B6WA 3OAWA 2MBBB 3I3TB 1OQQA 3GE3C 4OHJA 4NY0A 2IYDB 3I57A 1MHHE 1GC6A 4RGTA 1AWDA 3I9V1 3TCAA 1SE3A 2REXA 2BS3B 3UIPB 1N5XA 3DVGY 3PS6A 3PTFC 4F1SA 2NS5A 1Y56A 4NNJB 1NENB 1V1OA 1Q5WB 4FJYA 1ZOYB 4HCPB 3L0WB 2W82A 2MA9B 1A70A 3LXFA 1TJEA 3PLVA 5FKAC 2BB6A 1NEKB 1SIJA 3H7PB 1WGGA 5CX3A 5BMGA 2QILA 4K7UA 4YXDB 3P42A 1FFUA 2LGIA 1ZUD2 2KC2A 4E74A 4D2KA 5DCNA 2L0TA 2LMCA 2KDEB 4PS8A 2N9KA 3N1XC 4NPNA 2MBEA 4ICVA 2DAFA 3GS2A 2KT7A 3CSFA 3ZTCA 3H7PA 3DBSA 4G11A 3RPFC 1R4MB 3CMMB 4K7SA 2KD0A 4KDIC 3H6NA 4ARCA 1CZPA 2I38A 1WXMA 1WY8A 4LDTB 4XWTA 4ZRKA 4IWQA 2FUHB 2JYTA 1WX7A 2N7DA 1C79A 4I6PA 4KKIA 2MRPA 3OWEB 4BKSA 2BKFA 2CR5A 1HQRD 3PO0A 2RD0A 1ESFA 4P1BC 4DK5A 2LGYA 2RDHA 1B1ZA 1CJEA 4C4VB 4E3CA 4YT0B 2PIAA 5HKHA 1P7EA 2D5GA 1AW7A 4FLHA 2J0KA 2GBNA 3H1UA 3NOBA 2O6VD 2PVGC 3VUXA 2JT4B 2LUMA 3O13A 4HK2A 4KSKC 1WJNA 2YEPF 3Q3MC 1SE2A 1UBIA 1AARA 2BQQA 4PS7A 4ZYSA 4YTPB 1XT9B 1UZXB 1RWSA 3R2IA 3TMPB 4C4VA 3RNCC 4IM0A 3D32A 1EWCA 1XCTL 2SAKA 1UELA 2ASQA 2B76B 1KLUD 2KWUB 2WGSA 1J7CA 3AI5A 1E8ZA 3PHXB 1ZW7A 2WU2B 1KJTA 3IT4B 3N1YC 1ET6A 2L00B 4JX1C 2JUOA 2G4DB 4JQWC 5CTRC 4IOIE 1LFDA 2ZVNA 2NBVB 1Q10A 1TY0A 4P6VF 3UGBB 3VFKA 2LVOA 2V1YA 3AEAB 2MSED 4YTMB 1C3TA 1YN3A 3M95A 3PZ8A 3VTVA 4W9FA 3TJPA 4C7YA 4C7ZA 3KH0A 3NVYA 1OFFA 1XLOA 3WCQA 2R2QA 2W55A 3KWLA 3BYTB 2QCZA 2WXLA 2K22A 4BBNC 2WNMA 3KYCD 3P63A 3V62A 2K0PA 4L2YA 2MP2B 1E7PB 1OGWA 4GSWA 4DBGA 3BWUD 2D10A 1V81A 2HJ1A 2KLGA 5BYRA 4OVZA 1K53A 4OZAA 2MWSB 4YTNB 4YSXB 1P98A 1WIAA 1CMXB 1MJDA 3HM6X 1SGHA 3BINA 1V97A 1TY2A 2WX1A 2MP2A 1VR9A 2RSUA 2AL3A 2KKCA 2N7JA 3DVGX 2FE8A 4DXGA 2X8XX 3HVZA 2LUEA 1C78A 3MJWA 2PE6B 1IP9A 4HRSA 1J8CA 2BGFA 4JPSA 4II2B 3TBLD 3CIRB 2LRUA 1YJJA 1PGBA 3UF8A 1WFYA 3QHTA 3DHGC 1FD6A 2E6XA 1FPYA 2IY0B 1QQRA 1V86A 3U52E 2JYEA 4AJYB 1V1PB 2ZW0A 3A1QB 3VXWA 5AUKA 1VZ6A 2ZNVC 3GZNB 4TKNA 3EUB2 1D5MC 2LGXA 5CHFA 3R8BA 3AEGB 4A20A 2LHEA 4WAAA 1IGDA 2LASA 4RMAA 1IGCA 1DGJA 4FULA 3ETRA 4PT5A 2MHJA 3TSSA 2PTLA 1MG4A 2DZJA 1NI3A 4HJKA 4IUMB 1V1PA 1YJIA 3A1QA 3M3JA 1TGZB 3L10B 3ML8A 5HI1A 5J18A 4FHKA 3RCZA 1FXIA 3BIID 3PSEB 4GDLB 1FMAD 4ZRJA 1ZP0B 2K1FA 3IT6B 3DBRB 4OZBA 1N62A 3L16A 3MC0B 3NVVA 2KACA 1XLQA 2KHWB 1D3ZA 3AECB 5HG2A 3SR6A 2JF5A 2QIEB 4XGAB 3RUIB 2GB1A 1WZ0A 3U8ZA 2N4FA 4BOZB 2WXGA 4GDLA 2C7MB 3WALA 2PKOA 2WXFA 2MH7A 4W9EA 4HJGE 2IPKD 5AUIA 2A5UA 2PMVA 4C56C 1QOFA 4XE0A 3AN1A 2JQRB 3P1MA 5EE9A 3FAHA 5LXIB 5E6JA 2W3RA 2N7EA 2KJ6A 3SD5A 1QOAA 1VZ8A 4HWIB 3W2DA 5G5HA 5JXVA 5MPOA 1ZPSA 3DDCB 2D3AA 2HDEA 3A4SC 1RAXA 4MEMA 2LEKA 1JCKB 2WXRA 3HVDA 4L1BA 2WQYB 1ISNA 4NJCA 5CHVC 1J7BA 4HPPA 2O2VB 2WDQB 1DYQA 2LWPA 4N6EB 2JZPA 1NYQA 2V3NA 4BAXA 1WE7A 2PW9A 4CHKA 2M56B 4ZYNA 5AZHA 2Y5BB 2AQ1B 3ZUNA 2M1MA 3MTNB 4Q2JA 3X23A 2G9HD 4GU2A 2QC8A 2IJ0A 1SF0A 2ICIA 1UF0A 2O2VA 4S0RA 4TQ1A 2LZ6A 2GI9A 4AJWA 1VLBA 2PPHA 3ZJTA 1BT0A 2IY1B 2G4SA 2WXPA 2HD5B 2HE7A 3CWIA 4USAA 4NQLB 3VVWB 2FNJB 1E9MA 4WAFA 2INDC 3CSTA 5FR6A 3FILB 1JALA 2ZEQA 4CYEA 1FRRA 2XK5B 2M19A 1GAQB 1V8CA 2FCNA 4HDQA 3P4RB 4CQNA 3IXSA 3L4PA 1YD8U 1PUTA 4HPLB 2K5PA 4GB9A 2B3AA 2GBMA 4A90A 2DYBA 4K3CA 4GN1A 3W9CB 1WXAA 1TKGA 3W5VB 4P7IA 4TMAB 3FILA 2WXOA 3N32A 2BT6A 3EGRA 5G55A 5GXGB 4JWSC 4EUTA 2XK5A 1ENFA 2C5LC 4OVVA 1RFAA 4ANXA 4KGTA 1R4NB 2VH1A 1L2NA 1N60A 1YN4A 2K25A 3IAS1 3BVGA 5HFYA 5E6NA 5IO9A 3PGEA 1WJUA 2MLBA 1KLVA 4MDKE 4W9KA 4K3BA 3SEBA 1WSPA 2VRRB 4HDOA 2L1AA 4M0WB 3AEDB 2G3QB 2MBQA 1N6ZA 4XDDA 3VDZA 1H4RA 3ONSA 1YQ4B 4W9DA 2LD9A 3EECA 1D4BA 2ZZPB 3NVWA 3BVMA 2J52A 2KN4A 3GB1A 2CU1A 4LLGM 3R3MA 2K39A 2KTRB 2LXCA 2M17A 1WGYA 3ZRCA 3NS8A 4WQOB 1XQQA 4PK1A 5E6PA 1V5TA 1FNUA 3ZW3A 3W1SA 3LJ3A 2DYOA 2INNE 4M0WA 4ASWC 3LDZE 4JL9A 2DWQA 2L7RA 4W9JA 3T3OA 1M94A 3ZGZA 1VDVA 2A4ZA 4LDTD 3W5UB 4KKJA 4BFRA 1KF6B 2CJOA 3U30A 2WLBA 4YWGG 3ZTDA 2QEJC 4HKZE 2XBBC 3Q69A 2M0XA 1JMLA 2I1JA 2ON8A 1QILA 5C3JB 2KTRA 2WXIA 2NMQA 3MFGA 2UU7A 2ZCBA 3PZDA 3V6CB 2DLBA 2LI5A 3PV1A 3BK2A 4ZOHC 2IDYA 2GLSA 1SSNA 5C2TB 1I7HA 4RGMA 1V2YA 4ZHPA 1L4ZB 1QOBA 1WM3A 4N9F4 3X0WA 1Z2MA 4KIKB 4WJQA 3WIMA 1QOGA 3Q3FA 2DBYA 2EELA 5FR3A 4EZJA 4EZLA 3ZJVA 2JRHA 5IP4D 1YMHE 1F2RC 4WWOA 1WX9A 3Q3OC 4O1NA 3MHSD 5IOIA 3IAM1 2NTTA 1K51A 1WM2A 3AU4A 4ANUA 1DOXA 3NVZA 1WX8A 2JY6A 2UWQA 3L54A 4IC7B 2PLPA 3ZQ4A 4OW0A 4DHZE 4XYCA 4KIKA 1UGMA 3V6EB 3ZNID 3DVNV 1ZKHA 2HTME 3JVZX 2JX5A 3PLUA 3GE8C 2AX5A 2MJDA 2QHOA 4AUQC 2RDBC 2BBCA 3AU5A 1T0SC 2NTSA 4KZ0A 2GBKA 3DQVA 1RFKA 2AQ3B 2N9XA 2WXMA 2YEPB 1YOVB 3AB5A 4ANWA 1EUVB 5AZFA 1EM7A 1UBQA 2BPSA 3FKYA 3QX1A 3B2FA 4B95A 1R4MI 5EE0A 2INPE 4W9GA 2FBWB 2LGDA 3ZKJC 3ECIA 3DHHC 1JWMD 4MGYE 3OG5A 2DYMA 3DWGC 3A33B 1KOTA 3RT3B 3ZLZA 2BF8B 1TKEA 1Z5SB 2KTFA 2ZJDA 1RRBA 5C23A 2I2YA 4WJNA 4GDKB 1OQYA 2Z59B 1ZGUB 4FJZA 4JLCA 1TZOA 2DZMA 4EE2A 4EZKA 5J17A 3TEXA 1T0QC 2WDTB 4W9HA 1SEBD 4X57B 2BYEA 5LLIA 4WWPA 1N63A 1K52A 1ZDXA 2AL6A 2QSDA 1EO6A 2QMTA 4W9LA 1WXSA 1FO4A 3IG3A 2IGGA 2MEKA 4HPMB 2H89B 2PE9A 3RNFC 2KK8A 2X38A 4WURA 4WIPA 2FAZA 3Q8FA 5KHOA 4RCOA 4GDKA 3ZNGC 1ZXIA 4AQ7A 4MT5A 2TSSA 3Q8BA 2IO0B 2OJWA 2KO3A 1M4VA 2KDMA 4C00A 3BY4B 3AXCA 3AE7B 1EF5A 2N1VA 4M02A 3Q14C 1JRUA 1LM8B 3ZXRA 5LXHA 1ET9A 1C4PA 4A9AA 2LJIA 4KGSA 1WJ4A 5G2NA 2YVCA 4M8NA 3AMZA 2CHXA 4MACA 3ZDMC 3QA8A 2ZPNA 2O6VB 3MC9A 1FEHA 1TTNA 1VJKA 4KZCA 2CHZA 4EFOA 1NYRA 2WDRB 1PGAA 2MBOA 3ALBA 4RFBA 3RN9C 1YX5B 2K6QA 2MBHA 2WX0A 4HXDA 3WAOA 1D5ZC 1WXQA 2KWVB 1HZ5A 3ZDTA 1TKYA 3KUDB 4REZA 2DHZA 4ZHOA 4EKUA 1WR6E 4IG7B 3URYA 4XC2A 1L6VA 2K8BA 3V3XA 2O6VA 2WHIA 1FXTB 2D3BA 3QWZB 1YIWA 3U7DA 2IO2B 3AH7A 2LJ5A 3RZWC 1SBBB 2KC1A 1JWBD 4HLEA 1F2RI 3AE3B 3QQ8B 4IDIA 3R7QA 3WAPA 2JPHA 1X1MA 2L32A 2L3ZA 3DBHB 4C80A 1IUEA 1JRPA 3LYYA 3C0RB 1JQ4A 4BKTA 4WJPA 4QAYA 2M4NA 2AWTA 1CQVA 2Z0EB 1AYFA 1HTOA 4ZRIA 5EE3A 4FBJB 4WH4A 3WA0A 1BMLC 2RR9A 3OJ4B 3PVLA 1GOZA 4FHJA 3KW5B 1WYGA 3PZ7A 4LJOB 2J0JA 4LNIA 4TSSA 1RLFA 5BYQA 1MI0A 4DXFA 3RD2A 2KMCA 3B08A 3GZNI 2KXJA 3IVFA 4F8CB 1KTKA 4NJ7A 5D94A 3VQIA 1F77A 3ZNZB 2KVRA 1SXTA 2K8CA 3DBLI 3QARA 3IFWB 3QK0A 5C1ZA 1U4AA 2J42A 2KAJA 2FCSA 1I4RA 2ACZB 2WXKA 3N30A 2GOWA 3H7SA 1SIFA 1E90A 4MSMB 3Q3NC 2EKEC 4JE3B 3RYTA 3DBRI 1C1YB 1KH0A 3HUIA 4RGNA 4H2AA 3NS1A 3VUYA 3W1SC 3Q3JA 2NR2A 1SJED 3APCA 4AS1A 1FCLA 1IPGA 1P9DU 3N1ZC 1FFVA 1GG3A 1Q1OA 3E56A 5T8IA 1SB3C 2LVPA 1WGDA 2INCC 4R3DA 1TS2A 1T3QA 3PPAA 2DX5B 2XN9C 3MJ5A 1E8XA 4RF1A 2JVCA 3TUOA 4G0NB 1L0XB 3KWVA 1K8RB 1IYFA 1LGRA 4K7WA 1MPEA 3MC8A 4RH6A 2L52A 1C9FA 2KANA 1TT5B 2MJ3A 3N3KB 4GLSC 3TIXA 5JHBA 2WU5B 4IM3A 3EC8A 2LGSA 1XLPA 1BUIC 2AEHA 1YJ1A 3QAQA 2LVQA 1P1AA 1H8CA 2V3PA 2CHWA 2VZKD 2WXHA 2L8JA 1F9JA 2DZIA 3TEWA 1QKZA 1C76A 1FNWA 2GRIA 1PQSA 2ONQA 3B1LX 2KDBA 3AEEB 5JH5C 2DAJA 2NBWB 1GB1A 2KWDA 3MP9A 4FADA 2N0SB 2KFKB 1V80A 3EFCA 2HJ8A 2Y5PA 4FJVB 4J6IA 5DPTA 2HTHA 4DHJD 4TV3A 4YSYB 3KQ4A 4US9A 3ZXVA 2V4IB 3ML9A 1TS4A 2C7NB 4P1CC 5AZGA 1XF5L 2KFKA 2KMAA 2R2OA 3T9LA 1T0YA 4E71A 5IA7A 4A3PA 4K81A 4NQKE 4ARIA 5H8YE 3I5JC 2N9LA 3VH4B 4BOSC 2BYVE 1P3QU 5D6JB 3H9DA 1OEYA 2KNBA 1Y8RC 3PRMB 2OEDA 4B9KA 4WJOA 4IWPA 2D2QA 2GBJA 4YL8A 5D3DA 2PEAA 4URKA 2KX0A 3BZDB 4LNNA 3AM9A 4MM3B 3HK0A 4DDGD 3JYUA 1WMHB 2L76A 1KLGD 2CKHB 3QCAA 1N61A 2DNFA 3J9CA 2D3GA 2D11A 3VR9B 4FXCA 3B0AA 2E3TA 2EMSA 2WXJA 4BKSD 4ITKA 2D3CA 1LO5D 4ZRQA 1YNTE 1T5XD 3NZSA 1E8WA 1E10A 4MM3A 1L4DB 1WMHA 2AYOB 5BYSA 4NAMA 5BMHA 3K9OB 3R66C 4A6QA 2WP9B 4XX5A 1B9RA 1KFYB 1E5WA 1VD2A 5JHAA 3BYYB 3C19A 2L0FA 3UIOB 1WWTA 3P2BA 1YQBA 3U7ZA 2JWUA 2I1KA 2RGFA 2ZCCA 3HHMA 1N5WA 2KOXA 3A4RA 5H92C 2G45B 1GNUA 1QLBB 1LQBA 1TIFA 4AWJA 3P4QB 3N9YC 2CU3A 4M01A 1F0ZA 2WDVB 3WAMA 1ZDVA 1K50A 2BB5A 1L5PA 3AV8A 4IKGA 1HA5A 3GP7A 1KRHA 4L23A 3UI3A 1F1HA 1TS3A 2KMMA 4B0MA 4HCNB 1S3SG 1VZ7A 2W3SA 3DWMA 2YLMA 4M00A 2XNAC 1T0RC 4KV2A 1I35A 2Z8LA 4ACFA 2Z0DB 1E0ZA 3Q2AC 5I4DA 2WXNA 3KVFB 5D2MB 5DPRA 3ENEA 1GB4A 4AOFA 1CK1A 2FCQA 4GMVA 3V60A 1T6BX 1C77A 1YQ3B 4I6LB 1FM0D 1WGKA 2WYQA 3UQBA 5EDSA 1E7UA 4M8MA 2WS3B 2ZVOA 3DCGA 4J3OD 2IO3B 4ZDVA 3APFA 1L7YA 4MH0E 2GBRA 1EU3A 2G1EA 4MGZE 1F52A 4YSZB 1IBXB 1C4AA 2BW2A 3U2SC 5DPSA 1MFWA 4W9IA 3AE8B 1I4GA 1NBFC 3NZ3A 4MGIE 4BVUC 4NAWB 4KDLB 3PREA 5D3IB 1NDDA 3DPDA 3PRZA 2PVOD 1GPXA 1UH6A 2IGDA 2SEBD 4JGHB 3RZFA 2C7HA 1BXTA 1WXVA 1XO3A 1XXGA 4G50A 5L95C 3UQAA 1WGHA 3HM3A 1STEA 5IAAC 1IBXA 4P16A 3AEBB 4A8XC 2KWCA 2IZVB 1XLNA 1PYWD 3PRPB 3Q6BA 4NAWA 1UNSA 3R2TA 1OQRA 2W54A 2DZKA 2EKIA 4KSLC 3VTUA 3QC8B 3E9SA 3L13A 1ROEA 2BWES 3NG0A 3P4PB 3AULA 1J19A 3RI7C 1HZ6A 3AE4B 1QZEA 2LFIA 4RGOS 3O65B 1J7AA 3IBEA 3TL5A 3ZRFA 2MW5A 4KVGB 3R7RA 3JSVB 3ZVVA 1A5RA 1HTQA 3M63B 2C60A 1L6UA 2V9HA 2FUG1 3AEFB 2JRIB 3KUCB 1WH3A 1SE9A 1XCQL 2XEWA 4PYZA 2KDIA 1FCCC 2K3UA
chains in the Genus database with same CATH topology
5IO9A 5IKCM 2DNFA 1UF0A 2BQQA 5IOIA 5IN7A 1MFWA 1MG4A 1MJDA 5IP4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IO9 A;  5IKC M;  2DNF A;  1UF0 A;  2BQQ A;  5IOI A;  5IN7 A;  1MFW A;  1MG4 A;  1MJD A;  5IP4 D; 
#chains in the Genus database with same CATH topology
 3RNA C;  4B0E A;  2N1W A;  1D5X C;  2BVC A;  2M8S A;  3JSV A;  4PYU A;  4BZA A;  3SDL C;  4KGR A;  5TSS A;  1I42 A;  1WJ6 A;  2J0M A;  1JW9 D;  2BYF A;  2KJH B;  3Q8A A;  1I4Q A;  4HEA 1;  4US8 A;  4CO7 A;  5HHD G;  4AP4 C;  5L83 A;  1RM6 C;  2KQ4 X;  1NI2 A;  4EOY A;  4MGK E;  1UD7 A;  4DQO C;  4I6N B;  3L17 A;  4HKQ A;  3EA6 A;  3NRZ A;  2KZR A;  2BS2 B;  2KQS A;  3WAN A;  3VHT C;  3HRD D;  3RNE C;  2VH2 A;  2JXX A;  1HE8 A;  4UDU C;  1UUP A;  3NHE B;  1GJZ A;  1GC7 A;  2IO1 B;  2NBU A;  2RPV A;  3BK1 A;  1RYJ A;  3ZO5 B;  1DOI A;  1ZE3 D;  5JZE B;  1I4P A;  2CS4 A;  4DWF A;  3A9K B;  4OZC A;  1TZ1 A;  2MQJ A;  2V4L A;  2NPT B;  3SFE B;  2KQ7 A;  4MEL A;  3U4E G;  2N9P C;  2JXT A;  4ZRP A;  2DEN B;  1PFD A;  3TEY A;  2GMI C;  2RPQ A;  1WE6 A;  3IHP C;  3NY5 A;  3SU8 X;  3ZIM A;  4MSQ B;  2K9X A;  1WI0 A;  3VR8 B;  1UWX A;  3RFZ B;  1S1Q B;  2JWZ A;  2KFJ A;  1VRA B;  4DXA B;  2NVU I;  4S17 A;  3RNB C;  3T3N A;  3DBH I;  3ZNH B;  1MVK A;  4HRO A;  2J7Q B;  3OJ3 A;  3VH3 B;  2CJN A;  3A9K A;  2NPT A;  3N20 C;  1I4X A;  4N59 A;  2BTE A;  4FA6 A;  3DBL B;  4LTU A;  4K1R B;  3ZJU A;  1FIQ A;  4TQ0 A;  1MG8 A;  2KJR A;  4IW0 A;  5LNK 1;  3APD A;  4G3X B;  4WWM A;  1FNV A;  2JZ3 B;  3B9J A;  1GUA B;  1WGR A;  3P4S B;  3AE6 B;  1P7F A;  1OEY J;  4IWO A;  2MCN B;  2KN5 A;  2NCN A;  3K9P B;  5AEK B;  3H8H A;  3EFU A;  2N9E B;  2L83 A;  5IN7 A;  2KYW A;  2J53 A;  3DHI C;  1EF1 A;  4RM9 A;  3I63 C;  1Q0W B;  3UIN B;  1JWS D;  2JZZ A;  1WYW B;  2BKR B;  2J4X A;  5D7G A;  1JWU D;  4HVB A;  1DOY A;  2IGH A;  2BYT A;  1SE4 A;  5IKC M;  1QF6 A;  3RUL A;  1HEZ E;  1JWA D;  2JSV X;  2RDG A;  3NZU A;  2OOB B;  1I4H A;  4A3O A;  2R61 A;  4DDI D;  1YX6 B;  2IBI B;  3ABV B;  4GXB A;  2QDF A;  4LNF A;  3VAW A;  2AQ2 B;  4RM8 A;  4A55 A;  3T8M A;  3HIZ A;  4BBN F;  1WF9 A;  2WXQ A;  4XDC A;  3AE5 B;  3M62 B;  3Q8E A;  1P0R A;  3B2G A;  3V05 A;  3AE2 B;  4W9C A;  3JW0 X;  4ICU A;  3ZYY X;  1V6E A;  1EU4 A;  1E8Y A;  3RNG C;  1V5O A;  2OHF A;  2BS4 B;  4NZL B;  3TEZ A;  2BWF A;  2L05 A;  1YN5 A;  4TUU A;  3NJT A;  2C9W B;  4LCD E;  1XD3 B;  3KYD D;  5TR5 A;  1L0Y B;  3Q8C A;  5EE1 A;  3RMK C;  2PJH A;  2KVZ A;  1J0G A;  1WRD B;  2FCM A;  1OTR B;  3SHQ A;  1TBE A;  5BMI A;  3PHW B;  4RNA A;  1UWM A;  3GOE A;  2KDF B;  2ZNV B;  5KHQ A;  2M0A A;  4MJS B;  3CF6 E;  1TS5 A;  3A9J B;  1ACC A;  1JRO A;  2ZPY A;  1XEE A;  2OJR A;  1KM7 A;  3VRB B;  3KLS X;  2RMM A;  4JIO U;  2K6D B;  3QJZ A;  3NUH B;  3AE1 B;  3SFD B;  2UYZ B;  4F7Z A;  5DPW A;  4DHZ B;  3MHZ A;  2QJL A;  3VRA B;  4FN2 A;  2W9N A;  2WWZ A;  3DVN U;  4MJS A;  1TYG B;  4XZ4 A;  1AN8 A;  4RF0 A;  3A9J A;  4WQM A;  2H88 B;  1PDX A;  3EHV A;  1FXA A;  2FIF A;  5CHW A;  1UGJ A;  2LRW A;  1C4C A;  2Y5C A;  2FID A;  1MHX A;  3FC4 A;  1LXD A;  2VZK B;  4GOC A;  3OLM D;  4IM2 A;  4NJ6 A;  5G5G A;  3VTW A;  1V9J A;  2V3S A;  4N58 A;  5FK9 C;  4OVU A;  2JU6 X;  3PT2 B;  3AE9 B;  1V49 A;  4LNO A;  4ANV A;  2LHD A;  1G6J A;  2MJE A;  4GGQ A;  4II3 B;  1WRI A;  4BKG A;  4GIV A;  3W1Y A;  1PGX A;  3VUW A;  1L0V B;  1NVI D;  1FRD A;  1R4N I;  4LNK A;  5E6O A;  2D07 B;  1WZ3 A;  3QIJ A;  1VCB A;  2K8H A;  4LJP B;  1D6E C;  3DOW A;  2Q5W D;  1R7S A;  1ZXH A;  3L08 A;  4PS3 A;  4WWN A;  4MH8 A;  2V0G A;  2KLC A;  4LK0 M;  2KX3 A;  3S2A A;  2EMT A;  4DHJ B;  3KUZ A;  3V61 A;  4KX6 B;  3BVZ A;  4EEW A;  5BO4 B;  2ZW1 A;  1QT9 A;  2MX2 A;  1E6E B;  5J2R A;  1HXY D;  4XWW A;  2LXA A;  1SJH D;  3C8Y A;  4JWU C;  2Y3A A;  1WR1 A;  3LB8 C;  1EWY C;  1E7V A;  5GMV A;  4B6W A;  3OAW A;  2MBB B;  3I3T B;  1OQQ A;  3GE3 C;  4OHJ A;  4NY0 A;  2IYD B;  3I57 A;  1MHH E;  1GC6 A;  4RGT A;  1AWD A;  3I9V 1;  3TCA A;  1SE3 A;  2REX A;  2BS3 B;  3UIP B;  1N5X A;  3DVG Y;  3PS6 A;  3PTF C;  4F1S A;  2NS5 A;  1Y56 A;  4NNJ B;  1NEN B;  1V1O A;  1Q5W B;  4FJY A;  1ZOY B;  4HCP B;  3L0W B;  2W82 A;  2MA9 B;  1A70 A;  3LXF A;  1TJE A;  3PLV A;  5FKA C;  2BB6 A;  1NEK B;  1SIJ A;  3H7P B;  1WGG A;  5CX3 A;  5BMG A;  2QIL A;  4K7U A;  4YXD B;  3P42 A;  1FFU A;  2LGI A;  1ZUD 2;  2KC2 A;  4E74 A;  4D2K A;  5DCN A;  2L0T A;  2LMC A;  2KDE B;  4PS8 A;  2N9K A;  3N1X C;  4NPN A;  2MBE A;  4ICV A;  2DAF A;  3GS2 A;  2KT7 A;  3CSF A;  3ZTC A;  3H7P A;  3DBS A;  4G11 A;  3RPF C;  1R4M B;  3CMM B;  4K7S A;  2KD0 A;  4KDI C;  3H6N A;  4ARC A;  1CZP A;  2I38 A;  1WXM A;  1WY8 A;  4LDT B;  4XWT A;  4ZRK A;  4IWQ A;  2FUH B;  2JYT A;  1WX7 A;  2N7D A;  1C79 A;  4I6P A;  4KKI A;  2MRP A;  3OWE B;  4BKS A;  2BKF A;  2CR5 A;  1HQR D;  3PO0 A;  2RD0 A;  1ESF A;  4P1B C;  4DK5 A;  2LGY A;  2RDH A;  1B1Z A;  1CJE A;  4C4V B;  4E3C A;  4YT0 B;  2PIA A;  5HKH A;  1P7E A;  2D5G A;  1AW7 A;  4FLH A;  2J0K A;  2GBN A;  3H1U A;  3NOB A;  2O6V D;  2PVG C;  3VUX A;  2JT4 B;  2LUM A;  3O13 A;  4HK2 A;  4KSK C;  1WJN A;  2YEP F;  3Q3M C;  1SE2 A;  1UBI A;  1AAR A;  2BQQ A;  4PS7 A;  4ZYS A;  4YTP B;  1XT9 B;  1UZX B;  1RWS A;  3R2I A;  3TMP B;  4C4V A;  3RNC C;  4IM0 A;  3D32 A;  1EWC A;  1XCT L;  2SAK A;  1UEL A;  2ASQ A;  2B76 B;  1KLU D;  2KWU B;  2WGS A;  1J7C A;  3AI5 A;  1E8Z A;  3PHX B;  1ZW7 A;  2WU2 B;  1KJT A;  3IT4 B;  3N1Y C;  1ET6 A;  2L00 B;  4JX1 C;  2JUO A;  2G4D B;  4JQW C;  5CTR C;  4IOI E;  1LFD A;  2ZVN A;  2NBV B;  1Q10 A;  1TY0 A;  4P6V F;  3UGB B;  3VFK A;  2LVO A;  2V1Y A;  3AEA B;  2MSE D;  4YTM B;  1C3T A;  1YN3 A;  3M95 A;  3PZ8 A;  3VTV A;  4W9F A;  3TJP A;  4C7Y A;  4C7Z A;  3KH0 A;  3NVY A;  1OFF A;  1XLO A;  3WCQ A;  2R2Q A;  2W55 A;  3KWL A;  3BYT B;  2QCZ A;  2WXL A;  2K22 A;  4BBN C;  2WNM A;  3KYC D;  3P63 A;  3V62 A;  2K0P A;  4L2Y A;  2MP2 B;  1E7P B;  1OGW A;  4GSW A;  4DBG A;  3BWU D;  2D10 A;  1V81 A;  2HJ1 A;  2KLG A;  5BYR A;  4OVZ A;  1K53 A;  4OZA A;  2MWS B;  4YTN B;  4YSX B;  1P98 A;  1WIA A;  1CMX B;  1MJD A;  3HM6 X;  1SGH A;  3BIN A;  1V97 A;  1TY2 A;  2WX1 A;  2MP2 A;  1VR9 A;  2RSU A;  2AL3 A;  2KKC A;  2N7J A;  3DVG X;  2FE8 A;  4DXG A;  2X8X X;  3HVZ A;  2LUE A;  1C78 A;  3MJW A;  2PE6 B;  1IP9 A;  4HRS A;  1J8C A;  2BGF A;  4JPS A;  4II2 B;  3TBL D;  3CIR B;  2LRU A;  1YJJ A;  1PGB A;  3UF8 A;  1WFY A;  3QHT A;  3DHG C;  1FD6 A;  2E6X A;  1FPY A;  2IY0 B;  1QQR A;  1V86 A;  3U52 E;  2JYE A;  4AJY B;  1V1P B;  2ZW0 A;  3A1Q B;  3VXW A;  5AUK A;  1VZ6 A;  2ZNV C;  3GZN B;  4TKN A;  3EUB 2;  1D5M C;  2LGX A;  5CHF A;  3R8B A;  3AEG B;  4A20 A;  2LHE A;  4WAA A;  1IGD A;  2LAS A;  4RMA A;  1IGC A;  1DGJ A;  4FUL A;  3ETR A;  4PT5 A;  2MHJ A;  3TSS A;  2PTL A;  1MG4 A;  2DZJ A;  1NI3 A;  4HJK A;  4IUM B;  1V1P A;  1YJI A;  3A1Q A;  3M3J A;  1TGZ B;  3L10 B;  3ML8 A;  5HI1 A;  5J18 A;  4FHK A;  3RCZ A;  1FXI A;  3BII D;  3PSE B;  4GDL B;  1FMA D;  4ZRJ A;  1ZP0 B;  2K1F A;  3IT6 B;  3DBR B;  4OZB A;  1N62 A;  3L16 A;  3MC0 B;  3NVV A;  2KAC A;  1XLQ A;  2KHW B;  1D3Z A;  3AEC B;  5HG2 A;  3SR6 A;  2JF5 A;  2QIE B;  4XGA B;  3RUI B;  2GB1 A;  1WZ0 A;  3U8Z A;  2N4F A;  4BOZ B;  2WXG A;  4GDL A;  2C7M B;  3WAL A;  2PKO A;  2WXF A;  2MH7 A;  4W9E A;  4HJG E;  2IPK D;  5AUI A;  2A5U A;  2PMV A;  4C56 C;  1QOF A;  4XE0 A;  3AN1 A;  2JQR B;  3P1M A;  5EE9 A;  3FAH A;  5LXI B;  5E6J A;  2W3R A;  2N7E A;  2KJ6 A;  3SD5 A;  1QOA A;  1VZ8 A;  4HWI B;  3W2D A;  5G5H A;  5JXV A;  5MPO A;  1ZPS A;  3DDC B;  2D3A A;  2HDE A;  3A4S C;  1RAX A;  4MEM A;  2LEK A;  1JCK B;  2WXR A;  3HVD A;  4L1B A;  2WQY B;  1ISN A;  4NJC A;  5CHV C;  1J7B A;  4HPP A;  2O2V B;  2WDQ B;  1DYQ A;  2LWP A;  4N6E B;  2JZP A;  1NYQ A;  2V3N A;  4BAX A;  1WE7 A;  2PW9 A;  4CHK A;  2M56 B;  4ZYN A;  5AZH A;  2Y5B B;  2AQ1 B;  3ZUN A;  2M1M A;  3MTN B;  4Q2J A;  3X23 A;  2G9H D;  4GU2 A;  2QC8 A;  2IJ0 A;  1SF0 A;  2ICI A;  1UF0 A;  2O2V A;  4S0R A;  4TQ1 A;  2LZ6 A;  2GI9 A;  4AJW A;  1VLB A;  2PPH A;  3ZJT A;  1BT0 A;  2IY1 B;  2G4S A;  2WXP A;  2HD5 B;  2HE7 A;  3CWI A;  4USA A;  4NQL B;  3VVW B;  2FNJ B;  1E9M A;  4WAF A;  2IND C;  3CST A;  5FR6 A;  3FIL B;  1JAL A;  2ZEQ A;  4CYE A;  1FRR A;  2XK5 B;  2M19 A;  1GAQ B;  1V8C A;  2FCN A;  4HDQ A;  3P4R B;  4CQN A;  3IXS A;  3L4P A;  1YD8 U;  1PUT A;  4HPL B;  2K5P A;  4GB9 A;  2B3A A;  2GBM A;  4A90 A;  2DYB A;  4K3C A;  4GN1 A;  3W9C B;  1WXA A;  1TKG A;  3W5V B;  4P7I A;  4TMA B;  3FIL A;  2WXO A;  3N32 A;  2BT6 A;  3EGR A;  5G55 A;  5GXG B;  4JWS C;  4EUT A;  2XK5 A;  1ENF A;  2C5L C;  4OVV A;  1RFA A;  4ANX A;  4KGT A;  1R4N B;  2VH1 A;  1L2N A;  1N60 A;  1YN4 A;  2K25 A;  3IAS 1;  3BVG A;  5HFY A;  5E6N A;  5IO9 A;  3PGE A;  1WJU A;  2MLB A;  1KLV A;  4MDK E;  4W9K A;  4K3B A;  3SEB A;  1WSP A;  2VRR B;  4HDO A;  2L1A A;  4M0W B;  3AED B;  2G3Q B;  2MBQ A;  1N6Z A;  4XDD A;  3VDZ A;  1H4R A;  3ONS A;  1YQ4 B;  4W9D A;  2LD9 A;  3EEC A;  1D4B A;  2ZZP B;  3NVW A;  3BVM A;  2J52 A;  2KN4 A;  3GB1 A;  2CU1 A;  4LLG M;  3R3M A;  2K39 A;  2KTR B;  2LXC A;  2M17 A;  1WGY A;  3ZRC A;  3NS8 A;  4WQO B;  1XQQ A;  4PK1 A;  5E6P A;  1V5T A;  1FNU A;  3ZW3 A;  3W1S A;  3LJ3 A;  2DYO A;  2INN E;  4M0W A;  4ASW C;  3LDZ E;  4JL9 A;  2DWQ A;  2L7R A;  4W9J A;  3T3O A;  1M94 A;  3ZGZ A;  1VDV A;  2A4Z A;  4LDT D;  3W5U B;  4KKJ A;  4BFR A;  1KF6 B;  2CJO A;  3U30 A;  2WLB A;  4YWG G;  3ZTD A;  2QEJ C;  4HKZ E;  2XBB C;  3Q69 A;  2M0X A;  1JML A;  2I1J A;  2ON8 A;  1QIL A;  5C3J B;  2KTR A;  2WXI A;  2NMQ A;  3MFG A;  2UU7 A;  2ZCB A;  3PZD A;  3V6C B;  2DLB A;  2LI5 A;  3PV1 A;  3BK2 A;  4ZOH C;  2IDY A;  2GLS A;  1SSN A;  5C2T B;  1I7H A;  4RGM A;  1V2Y A;  4ZHP A;  1L4Z B;  1QOB A;  1WM3 A;  4N9F 4;  3X0W A;  1Z2M A;  4KIK B;  4WJQ A;  3WIM A;  1QOG A;  3Q3F A;  2DBY A;  2EEL A;  5FR3 A;  4EZJ A;  4EZL A;  3ZJV A;  2JRH A;  5IP4 D;  1YMH E;  1F2R C;  4WWO A;  1WX9 A;  3Q3O C;  4O1N A;  3MHS D;  5IOI A;  3IAM 1;  2NTT A;  1K51 A;  1WM2 A;  3AU4 A;  4ANU A;  1DOX A;  3NVZ A;  1WX8 A;  2JY6 A;  2UWQ A;  3L54 A;  4IC7 B;  2PLP A;  3ZQ4 A;  4OW0 A;  4DHZ E;  4XYC A;  4KIK A;  1UGM A;  3V6E B;  3ZNI D;  3DVN V;  1ZKH A;  2HTM E;  3JVZ X;  2JX5 A;  3PLU A;  3GE8 C;  2AX5 A;  2MJD A;  2QHO A;  4AUQ C;  2RDB C;  2BBC A;  3AU5 A;  1T0S C;  2NTS A;  4KZ0 A;  2GBK A;  3DQV A;  1RFK A;  2AQ3 B;  2N9X A;  2WXM A;  2YEP B;  1YOV B;  3AB5 A;  4ANW A;  1EUV B;  5AZF A;  1EM7 A;  1UBQ A;  2BPS A;  3FKY A;  3QX1 A;  3B2F A;  4B95 A;  1R4M I;  5EE0 A;  2INP E;  4W9G A;  2FBW B;  2LGD A;  3ZKJ C;  3ECI A;  3DHH C;  1JWM D;  4MGY E;  3OG5 A;  2DYM A;  3DWG C;  3A33 B;  1KOT A;  3RT3 B;  3ZLZ A;  2BF8 B;  1TKE A;  1Z5S B;  2KTF A;  2ZJD A;  1RRB A;  5C23 A;  2I2Y A;  4WJN A;  4GDK B;  1OQY A;  2Z59 B;  1ZGU B;  4FJZ A;  4JLC A;  1TZO A;  2DZM A;  4EE2 A;  4EZK A;  5J17 A;  3TEX A;  1T0Q C;  2WDT B;  4W9H A;  1SEB D;  4X57 B;  2BYE A;  5LLI A;  4WWP A;  1N63 A;  1K52 A;  1ZDX A;  2AL6 A;  2QSD A;  1EO6 A;  2QMT A;  4W9L A;  1WXS A;  1FO4 A;  3IG3 A;  2IGG A;  2MEK A;  4HPM B;  2H89 B;  2PE9 A;  3RNF C;  2KK8 A;  2X38 A;  4WUR A;  4WIP A;  2FAZ A;  3Q8F A;  5KHO A;  4RCO A;  4GDK A;  3ZNG C;  1ZXI A;  4AQ7 A;  4MT5 A;  2TSS A;  3Q8B A;  2IO0 B;  2OJW A;  2KO3 A;  1M4V A;  2KDM A;  4C00 A;  3BY4 B;  3AXC A;  3AE7 B;  1EF5 A;  2N1V A;  4M02 A;  3Q14 C;  1JRU A;  1LM8 B;  3ZXR A;  5LXH A;  1ET9 A;  1C4P A;  4A9A A;  2LJI A;  4KGS A;  1WJ4 A;  5G2N A;  2YVC A;  4M8N A;  3AMZ A;  2CHX A;  4MAC A;  3ZDM C;  3QA8 A;  2ZPN A;  2O6V B;  3MC9 A;  1FEH A;  1TTN A;  1VJK A;  4KZC A;  2CHZ A;  4EFO A;  1NYR A;  2WDR B;  1PGA A;  2MBO A;  3ALB A;  4RFB A;  3RN9 C;  1YX5 B;  2K6Q A;  2MBH A;  2WX0 A;  4HXD A;  3WAO A;  1D5Z C;  1WXQ A;  2KWV B;  1HZ5 A;  3ZDT A;  1TKY A;  3KUD B;  4REZ A;  2DHZ A;  4ZHO A;  4EKU A;  1WR6 E;  4IG7 B;  3URY A;  4XC2 A;  1L6V A;  2K8B A;  3V3X A;  2O6V A;  2WHI A;  1FXT B;  2D3B A;  3QWZ B;  1YIW A;  3U7D A;  2IO2 B;  3AH7 A;  2LJ5 A;  3RZW C;  1SBB B;  2KC1 A;  1JWB D;  4HLE A;  1F2R I;  3AE3 B;  3QQ8 B;  4IDI A;  3R7Q A;  3WAP A;  2JPH A;  1X1M A;  2L32 A;  2L3Z A;  3DBH B;  4C80 A;  1IUE A;  1JRP A;  3LYY A;  3C0R B;  1JQ4 A;  4BKT A;  4WJP A;  4QAY A;  2M4N A;  2AWT A;  1CQV A;  2Z0E B;  1AYF A;  1HTO A;  4ZRI A;  5EE3 A;  4FBJ B;  4WH4 A;  3WA0 A;  1BML C;  2RR9 A;  3OJ4 B;  3PVL A;  1GOZ A;  4FHJ A;  3KW5 B;  1WYG A;  3PZ7 A;  4LJO B;  2J0J A;  4LNI A;  4TSS A;  1RLF A;  5BYQ A;  1MI0 A;  4DXF A;  3RD2 A;  2KMC A;  3B08 A;  3GZN I;  2KXJ A;  3IVF A;  4F8C B;  1KTK A;  4NJ7 A;  5D94 A;  3VQI A;  1F77 A;  3ZNZ B;  2KVR A;  1SXT A;  2K8C A;  3DBL I;  3QAR A;  3IFW B;  3QK0 A;  5C1Z A;  1U4A A;  2J42 A;  2KAJ A;  2FCS A;  1I4R A;  2ACZ B;  2WXK A;  3N30 A;  2GOW A;  3H7S A;  1SIF A;  1E90 A;  4MSM B;  3Q3N C;  2EKE C;  4JE3 B;  3RYT A;  3DBR I;  1C1Y B;  1KH0 A;  3HUI A;  4RGN A;  4H2A A;  3NS1 A;  3VUY A;  3W1S C;  3Q3J A;  2NR2 A;  1SJE D;  3APC A;  4AS1 A;  1FCL A;  1IPG A;  1P9D U;  3N1Z C;  1FFV A;  1GG3 A;  1Q1O A;  3E56 A;  5T8I A;  1SB3 C;  2LVP A;  1WGD A;  2INC C;  4R3D A;  1TS2 A;  1T3Q A;  3PPA A;  2DX5 B;  2XN9 C;  3MJ5 A;  1E8X A;  4RF1 A;  2JVC A;  3TUO A;  4G0N B;  1L0X B;  3KWV A;  1K8R B;  1IYF A;  1LGR A;  4K7W A;  1MPE A;  3MC8 A;  4RH6 A;  2L52 A;  1C9F A;  2KAN A;  1TT5 B;  2MJ3 A;  3N3K B;  4GLS C;  3TIX A;  5JHB A;  2WU5 B;  4IM3 A;  3EC8 A;  2LGS A;  1XLP A;  1BUI C;  2AEH A;  1YJ1 A;  3QAQ A;  2LVQ A;  1P1A A;  1H8C A;  2V3P A;  2CHW A;  2VZK D;  2WXH A;  2L8J A;  1F9J A;  2DZI A;  3TEW A;  1QKZ A;  1C76 A;  1FNW A;  2GRI A;  1PQS A;  2ONQ A;  3B1L X;  2KDB A;  3AEE B;  5JH5 C;  2DAJ A;  2NBW B;  1GB1 A;  2KWD A;  3MP9 A;  4FAD A;  2N0S B;  2KFK B;  1V80 A;  3EFC A;  2HJ8 A;  2Y5P A;  4FJV B;  4J6I A;  5DPT A;  2HTH A;  4DHJ D;  4TV3 A;  4YSY B;  3KQ4 A;  4US9 A;  3ZXV A;  2V4I B;  3ML9 A;  1TS4 A;  2C7N B;  4P1C C;  5AZG A;  1XF5 L;  2KFK A;  2KMA A;  2R2O A;  3T9L A;  1T0Y A;  4E71 A;  5IA7 A;  4A3P A;  4K81 A;  4NQK E;  4ARI A;  5H8Y E;  3I5J C;  2N9L A;  3VH4 B;  4BOS C;  2BYV E;  1P3Q U;  5D6J B;  3H9D A;  1OEY A;  2KNB A;  1Y8R C;  3PRM B;  2OED A;  4B9K A;  4WJO A;  4IWP A;  2D2Q A;  2GBJ A;  4YL8 A;  5D3D A;  2PEA A;  4URK A;  2KX0 A;  3BZD B;  4LNN A;  3AM9 A;  4MM3 B;  3HK0 A;  4DDG D;  3JYU A;  1WMH B;  2L76 A;  1KLG D;  2CKH B;  3QCA A;  1N61 A;  2DNF A;  3J9C A;  2D3G A;  2D11 A;  3VR9 B;  4FXC A;  3B0A A;  2E3T A;  2EMS A;  2WXJ A;  4BKS D;  4ITK A;  2D3C A;  1LO5 D;  4ZRQ A;  1YNT E;  1T5X D;  3NZS A;  1E8W A;  1E10 A;  4MM3 A;  1L4D B;  1WMH A;  2AYO B;  5BYS A;  4NAM A;  5BMH A;  3K9O B;  3R66 C;  4A6Q A;  2WP9 B;  4XX5 A;  1B9R A;  1KFY B;  1E5W A;  1VD2 A;  5JHA A;  3BYY B;  3C19 A;  2L0F A;  3UIO B;  1WWT A;  3P2B A;  1YQB A;  3U7Z A;  2JWU A;  2I1K A;  2RGF A;  2ZCC A;  3HHM A;  1N5W A;  2KOX A;  3A4R A;  5H92 C;  2G45 B;  1GNU A;  1QLB B;  1LQB A;  1TIF A;  4AWJ A;  3P4Q B;  3N9Y C;  2CU3 A;  4M01 A;  1F0Z A;  2WDV B;  3WAM A;  1ZDV A;  1K50 A;  2BB5 A;  1L5P A;  3AV8 A;  4IKG A;  1HA5 A;  3GP7 A;  1KRH A;  4L23 A;  3UI3 A;  1F1H A;  1TS3 A;  2KMM A;  4B0M A;  4HCN B;  1S3S G;  1VZ7 A;  2W3S A;  3DWM A;  2YLM A;  4M00 A;  2XNA C;  1T0R C;  4KV2 A;  1I35 A;  2Z8L A;  4ACF A;  2Z0D B;  1E0Z A;  3Q2A C;  5I4D A;  2WXN A;  3KVF B;  5D2M B;  5DPR A;  3ENE A;  1GB4 A;  4AOF A;  1CK1 A;  2FCQ A;  4GMV A;  3V60 A;  1T6B X;  1C77 A;  1YQ3 B;  4I6L B;  1FM0 D;  1WGK A;  2WYQ A;  3UQB A;  5EDS A;  1E7U A;  4M8M A;  2WS3 B;  2ZVO A;  3DCG A;  4J3O D;  2IO3 B;  4ZDV A;  3APF A;  1L7Y A;  4MH0 E;  2GBR A;  1EU3 A;  2G1E A;  4MGZ E;  1F52 A;  4YSZ B;  1IBX B;  1C4A A;  2BW2 A;  3U2S C;  5DPS A;  1MFW A;  4W9I A;  3AE8 B;  1I4G A;  1NBF C;  3NZ3 A;  4MGI E;  4BVU C;  4NAW B;  4KDL B;  3PRE A;  5D3I B;  1NDD A;  3DPD A;  3PRZ A;  2PVO D;  1GPX A;  1UH6 A;  2IGD A;  2SEB D;  4JGH B;  3RZF A;  2C7H A;  1BXT A;  1WXV A;  1XO3 A;  1XXG A;  4G50 A;  5L95 C;  3UQA A;  1WGH A;  3HM3 A;  1STE A;  5IAA C;  1IBX A;  4P16 A;  3AEB B;  4A8X C;  2KWC A;  2IZV B;  1XLN A;  1PYW D;  3PRP B;  3Q6B A;  4NAW A;  1UNS A;  3R2T A;  1OQR A;  2W54 A;  2DZK A;  2EKI A;  4KSL C;  3VTU A;  3QC8 B;  3E9S A;  3L13 A;  1ROE A;  2BWE S;  3NG0 A;  3P4P B;  3AUL A;  1J19 A;  3RI7 C;  1HZ6 A;  3AE4 B;  1QZE A;  2LFI A;  4RGO S;  3O65 B;  1J7A A;  3IBE A;  3TL5 A;  3ZRF A;  2MW5 A;  4KVG B;  3R7R A;  3JSV B;  3ZVV A;  1A5R A;  1HTQ A;  3M63 B;  2C60 A;  1L6U A;  2V9H A;  2FUG 1;  3AEF B;  2JRI B;  3KUC B;  1WH3 A;  1SE9 A;  1XCQ L;  2XEW A;  4PYZ A;  2KDI A;  1FCC C;  2K3U A; 
#chains in the Genus database with same CATH homology
 5IO9 A;  5IKC M;  2DNF A;  1UF0 A;  2BQQ A;  5IOI A;  5IN7 A;  1MFW A;  1MG4 A;  1MJD A;  5IP4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...