1MG8A

Nmr structure of ubiquitin-like domain in murine parkin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
b'MGMIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parkin
publication title NMR structure of ubiquitin-like domain in PARKIN: Gene product of familial Parkinson's disease.
pubmed doi rcsb
molecule tags Apoptosis
total genus 13
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2002-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1mg8A00
3A4SC 3VUXA 1V6EA 2YVCA 5G55A 1E7VA 1WIAA 4IUMB 3RZWC 1WJNA 4ANUA 5HKHA 2PE9A 4MJSA 4M8NA 1R4NI 1V5TA 2GBKA 3APCA 2D3GA 3EC8A 3L13A 3GOEA 3BINA 2GOWA 2D07B 3AULA 1RRBA 1YJ1A 3D32A 4HLEA 3ZNZB 1P3QU 1V80A 4JL9A 3TMPB 4AJWA 2UYZB 3MHSD 2M8SA 3PGEA 4B9KA 1LQBA 5JHAA 3UIOB 1EF1A 3RD2A 2DAJA 2KTRB 3RYTA 3A9JA 2NPTB 3ONSA 2KQSA 2LGYA 2RSUA 3I3TB 2GBNA 2JT4B 1U4AA 3AXCA 4FJZA 2LWPA 2KNBA 3M95A 2Y5BB 4AOFA 1WM2A 2O6VA 1WX7A 2G45B 2JXXA 1WJ4A 3QHTA 5JHBA 3CMMB 3PLUA 2LVOA 3K9OB 4EEWA 4IWPA 4EKUA 2IO1B 2HTHA 1UBQA 1S1QB 1GNUA 2DHZA 2IYDB 2KANA 1LM8B 4E71A 3ML9A 3KUDB 2G4SA 2L00B 4HWIB 1LXDA 3PTFC 3VTVA 3PV1A 2C7HA 4G11A 4KSLC 3VFKA 3LDZE 3AU4A 3VUWA 1WZ0A 3CSTA 3ZTDA 1Z5SB 3U7DA 1SE9A 1C1YB 2MBOA 3QX1A 5CX3A 4AJYB 5CHVC 2OJRA 4K81A 4JIOU 3WAOA 1WXVA 1WGYA 4IM3A 4GMVA 4B95A 2NVUI 1GUAB 3H7PA 4DBGA 1C3TA 2AL6A 2K6DB 2AWTA 1Z2MA 2LGDA 2FIDA 2DX5B 3H9DA 3OJ4B 3R3MA 1P98A 1WRDB 4IWQA 4BKGA 1SGHA 2L3ZA 3V62A 1GC6A 2N9PC 1WMHA 2JWZA 3JW0X 3HIZA 4FA6A 2ASQA 2KZRA 2K8HA 2M4NA 3TL5A 4NNJB 2R2QA 3H7SA 1H4RA 3PSEB 2XK5B 4OVUA 4GIVA 4WJOA 3VHTC 3ZKJC 1HE8A 5D94A 2V4LA 2D2QA 2KDFB 3VXWA 2CKHB 2PJHA 3Q3JA 4GDKB 2K39A 4YL8A 3U8ZA 1E8YA 2CHZA 3PREA 2M1MA 2JZZA 3ZW3A 4LJPB 3W1SC 4GB9A 2LVPA 3B0AA 4WQOB 3EECA 3ZNID 2FCMA 3NZSA 2KJRA 3U30A 2N9XA 2L8JA 2REXA 4NQKE 1I42A 1Q0WB 2KX0A 2K6QA 4WWOA 3DVGY 2D10A 4HVBA 3KVFB 3HHMA 4IM2A 1V81A 4KV2A 2MCNB 2O6VD 3RUIB 2KJHB 4A3OA 4DK5A 5GMVA 4GDLA 3QK0A 4MGYE 3W1YA 4LJOB 5KHQA 4BKTA 1OEYJ 2XBBC 1TZ1A 3N30A 4GOCA 5AZHA 3ZLZA 3PVLA 2JRIB 1J19A 2KQ7A 3DBRI 2AEHA 3PRZA 3QAQA 3NZUA 3P2BA 4EZKA 4II3B 2OOBB 4ICVA 1NDDA 5D2MB 5D6JB 3VAWA 1P1AA 3QC8B 2BPSA 2ZCCA 5LLIA 5C23A 2VRRB 5IAAC 4BBNF 2B3AA 3ZNGC 2GMIC 3X23A 1KLVA 2CHWA 2MQJA 3BY4B 1OQYA 5G2NA 1WI0A 1G6JA 4F1SA 2CHXA 1KJTA 4A3PA 5EDSA 4KDLB 5JH5C 3N3KB 4NY0A 3A9KA 1YQBA 2MBBB 3VDZA 4RM8A 4I6NB 3V60A 4W9CA 3L0WB 4PYZA 1WR1A 2W9NA 2IO0B 2M0XA 2QHOA 4MSMB 2BWES 2DYBA 2N1VA 4KIKB 3SHQA 4URKA 4HJKA 3KH0A 4PS3A 3KUCB 3LJ3A 3CSFA 2YLMA 1E8XA 1TBEA 3WAMA 2LRWA 2N7EA 2N1WA 1GJZA 2DZMA 2J0MA 1X1MA 2KHWB 2PPHA 4GXBA 3QA8A 4HK2A 4MSQB 4EOYA 2JZ3B 2CU1A 4JLCA 5L83A 1EO6A 4NJ7A 4ZRKA 3ENEA 3PT2B 3UIPB 3ZO5B 1IYFA 2O2VB 2R2OA 4GN1A 2NR2A 3A33B 3NS8A 2D11A 4II2B 4BKSD 3M63B 4EUTA 2I1JA 3MTNB 4FN2A 4FHJA 5CTRC 4KVGB 4ANVA 1V49A 1WH3A 4WJPA 4XC2A 4AP4C 3DBLI 2KN5A 3V6EB 3SD5A 2IO2B 4K7SA 2LD9A 2ZCBA 2A5UA 1OEYA 4NAWA 5DPSA 2JPHA 2NS5A 2ZVNA 3IBEA 4HDOA 4KDIC 5DCNA 3ZIMA 2G3QB 2C60A 4ASWC 4B6WA 5JZEB 1E90A 4W9JA 4MGKE 4W9HA 1CMXB 2BYFA 2KMCA 5J18A 1J0GA 2EKEC 1ZGUB 4MJSB 2Z59B 3A1QA 4BFRA 4DXAB 3ZDTA 3HM3A 1OTRB 3A4RA 5E6PA 3VH3B 3N32A 3IFWB 2MBQA 4ZYNA 5LXIB 1WX9A 3R7RA 3M62B 4NJ6A 4P7IA 4FLHA 1BT0A 1WJUA 3V6CB 2NCNA 3ML8A 3A9JB 2BWFA 5L95C 3DQVA 3X0WA 3ZNHB 2ZJDA 3IVFA 2MP2A 2HD5B 2KMAA 2O6VB 3PS6A 1P0RA 4DHJB 4G3XB 4GU2A 5FR6A 4ZDVA 2EMTA 2EMSA 5DPRA 3EFUA 4HCNB 2RD0A 1E7UA 2MSED 1WGGA 1K8RB 4GGQA 3KYCD 2GBRA 1P9DU 3AU5A 1UD7A 3C0RB 3OJ3A 3OLMD 1WGDA 2KWUB 4HDQA 4MEMA 3ZDMC 1WXAA 2LVQA 1GG3A 3S2AA 2LI5A 3IHPC 4ANWA 3PRMB 4TQ1A 1YX6B 2WWZA 5IA7A 3JYUA 3QCAA 3PZDA 2MWSB 4G0NB 5AZGA 2ZPYA 2RPQA 4WWPA 1UZXB 3WANA 1Y8RC 2Z0DB 3KYDD 1WX8A 2NBVB 1Q5WB 1KM7A 2FUHB 3SDLC 4WJQA 3EHVA 3VTUA 1S3SG 3H7PB 4I6LB 2DYMA 4TQ0A 2M17A 2BF8B 4DHJD 3UINB 1NI2A 2CR5A 2V1YA 4M8MA 3T8MA 1L7YA 3RULA 3UQBA 2LGXA 2LXCA 3VH4B 2KC2A 2MW5A 2LZ6A 1WGHA 1J8CA 2JY6A 4CO7A 1SIFA 4EZLA 3TCAA 2DYOA 2KXJA 1AARA 2RR9A 3IG3A 2A4ZA 1WMHB 3K9PB 1E8ZA 1V9JA 3QJZA 4I6PA 1WE7A 1ISNA 4BVUC 4HPLB 2MA9B 1EUVB 3W1SA 1WJ6A 3M3JA 3WIMA 2KTFA 2NBUA 2BYVE 4BBNC 1TGZB 2JRHA 4F7ZA 1KOTA 2C7MB 2WDTB 4GSWA 3PLVA 3B1LX 2KTRA 3L10B 4J6IA 2ZVOA 5DPTA 2NPTA 1UH6A 3WAPA 4XZ4A 3V61A 4FADA 4KZ0A 3PHWB 2KWCA 1XT9B 4E74A 3TBLD 2FCSA 2K25A 2AL3A 2V3SA 4LCDE 1E5WA 2BKFA 4MELA 3PHXB 2KLCA 1VD2A 1WF9A 2FCQA 2HE7A 3R7QA 4WWNA 2Z0EB 5C1ZA 2IY0B 3Q3FA 5AEKB 1XD3B 1XQQA 4GDLB 4CHKA 4K7UA 1WE6A 3PPAA 2KFKA 1WXSA 2J0JA 4TKNA 4MDKE 1LFDA 5J2RA 2N9EB 4DDID 4IW0A 3QWZB 1ZW7A 1M94A 3PRPB 2FIFA 4HXDA 3ECIA 2J0KA 3NOBA 2LJ5A 3NY5A 3ALBA 4W9LA 1R4MI 2L0FA 1PQSA 1TTNA 1V86A 2KD0A 3JSVA 2KVRA 3L08A 1QZEA 3QQ8B 2C5LC 4LDTB 4NPNA 1WGRA 4F8CB 2IZVB 2KDIA 4W9GA 2K8BA 4W9IA 4X57B 1T0YA 3VQIA 4G50A 3ZUNA 1YD8U 2WX0A 3DCGA 2KC1A 3APFA 3A9KB 3ZRCA 4W9EA 4MM3A 4KZCA 4PS7A 1MG8A 2ZZPB 2L0TA 2KWVB 4HPMB 2BGFA 4WAAA 2KDEB 2JUOA 2KLGA 2IO3B 2ZEQA 3RZFA 2N4FA 1WFYA 2L05A 2WX1A 2ZNVB 3VUYA 3ZRFA 4A20A 3L54A 4BOZB 4IG7B 1D3ZA 1OGWA 5E6NA 4FHKA 2XK5A 3VTWA 3VVWB 3WA0A 1RAXA 4W9KA 2G4DB 4PYUA 2LRUA 5DPWA 1GC7A 3UGBB 4FBJB 4DHZB 2C7NB 2LASA 2KFKB 4GDKA 5BO4B 3RT3B 3H6NA 2AYOB 4LDTD 1YIWA 2FAZA 3DBHI 4IM0A 4EZJA 1E8WA 2HJ8A 4HCPB 4N9F4 4AUQC 1A5RA 3TIXA 4K7WA 2KX3A 3UQAA 4MGIE 2KJ6A 1UGMA 3R66C 3JSVB 2K1FA 3DDCB 3UF8A 3JVZX 2FNJB 3GZNI 4NAWB 3HM6X 3DVNV 3DPDA 3OAWA 4W9DA 3ZVVA 1WZ3A 4EFOA 5CHWA 4AWJA 2L7RA 2MLBA 4IC7B 1V2YA 3HK0A 5LXHA 5E6OA 3A1QB 3NHEB 5CHFA 2J7QB 1Q1OA 2KOXA 3QARA 5D7GA 1L2NA 3DVNU 4RMAA 2JF5A 2JVCA 4OVVA 4KSKC 4JQWC 3RCZA 1NBFC 4DWFA 4W9FA 2XEWA 1RLFA 2KDBA 2L76A 2LXAA 4MH0E 3ZTCA 2I1KA 3KUZA 2K8CA 3DBSA 4TV3A 5KHOA 2DZIA 4BKSA 5AZFA 2FCNA 1IP9A 3H1UA 1FXTB 2MRPA 1WYWB 2KO3A 5TR5A 3KW5B 2MBHA 3APDA 2CS4A 4JGHB 1H8CA 4RM9A 2DZKA 2IBIB 1RFAA 2MP2B 2MX2A 1UBIA 2C9WB 4FULA 2DZJA 4DHZE 1WR6E 3AI5A 2DAFA 2BKRB 2PE6B 4ICUA 4KIKA 4MGZE 4XX5A 2GBJA 3T9LA 5J17A 3DOWA 3WALA 4E3CA 4WJNA 1WXMA 4K1RB 2MBEA 4PS8A 2LUEA 4ZRJA 2NBWB 4M0WB 2UWQA 4FJYA 2PEAA 4IWOA 3CF6E 3MJWA 2RGFA 4DDGD 3B08A 1JRUA 1YX5B 2DENB 2KKCA 2WYQA 2ZNVC 2ZPNA 3L17A 1F9JA 2O2VA 1V5OA 2IY1B 2KFJA 4ANXA 2KK8A 1VCBA 4CYEA 2BYEA 3O65B 2N7DA 3QIJA 1EF5A 1ZKHA 3DVGX 4FJVB 3SU8X 1WM3A 3L16A 4TUUA 1WY8A 4BOSC 3TJPA 2GBMA 1UELA 1IPGA 1I35A 4ZRIA 4NQLB
chains in the Genus database with same CATH superfamily
3A4SC 2YVCA 4IUMB 3ZXVA 1JALA 2PE9A 4MJSA 2GBKA 1WRIA 1TJEA 3GOEA 3BINA 1RRBA 2G1EA 3ZNZB 3DWGC 1LQBA 3RD2A 2DAJA 2RSUA 4L2YA 4RGOS 2LWPA 5TSSA 1YN3A 4EKUA 3K9OB 1QLBB 2HTHA 2DHZA 2IYDB 1LM8B 3ML9A 2L00B 2JX5A 2BS2B 4S17A 3GE3C 3VFKA 2SAKA 3LDZE 3AU4A 3DHGC 1J7CA 2GB1A 3VUWA 1WZ0A 3CSTA 3U7DA 1SE9A 3I5JC 2ACZB 3QX1A 1YN4A 4REZA 1ESFA 4JIOU 1IBXA 3WAOA 1QKZA 5H92C 4GMVA 4B95A 1OQRA 2N9LA 2J42A 1C3TA 1L6UA 2WHIA 1Z2MA 2DX5B 4MM3B 3ZQ4A 3R3MA 1P98A 3AEAB 2L3ZA 3B9JA 1WMHA 2D3AA 3URYA 3HIZA 2ASQA 4NNJB 3H7SA 3PSEB 1CJEA 3CIRB 3VHTC 4N58A 2G9HD 4KKJA 2CHZA 3MC9A 3RI7C 3U2SC 3ZNID 1NI3A 2L8JA 1JQ4A 1NVID 2KX0A 4WWOA 4IM2A 2O6VD 4A3OA 5HG2A 3QK0A 5KHQA 4LJOB 4BKTA 2XBBC 1TZ1A 5AZHA 3PVLA 3PRZA 1XLNA 4II3B 5D2MB 3BK1A 5D6JB 3VAWA 1P1AA 2QIEB 5IAAC 2MQJA 1N60A 1OQYA 4F1SA 1FNWA 2INCC 3V60A 5E6JA 4MSMB 4URKA 3UQAA 1D4BA 4HJKA 1FXIA 1A70A 3LJ3A 1D5XC 2MH7A 3CSFA 2YLMA 4C80A 2LRWA 2N1WA 2DZMA 2J0MA 1TKEA 3AV8A 1RM6C 1X1MA 3NVVA 2PPHA 5BYRA 4GXBA 4M00A 4HK2A 4US8A 1N61A 3L4PA 5BMIA 1EO6A 2WXHA 4ZRKA 3UIPB 3ZO5B 1IYFA 4GN1A 3HVDA 3NS8A 4EUTA 4FN2A 4ANVA 4WJPA 1XLQA 2WGSA 3DBLI 1ZXHA 2ZW1A 1N5WA 2LD9A 3IBEA 3ZIMA 2G3QB 4B6WA 4YSZB 1B1ZA 2PVOD 4W9JA 2BYFA 2VZKB 4MJSB 2D5GA 3EFCA 4LLGM 2Z59B 1MHHE 1OTRB 3A4RA 5T8IA 4Q2JA 5LXIB 3NVYA 3R7RA 4JPSA 2K5PA 4FLHA 1WXQA 2WDQB 5L95C 3X0WA 2MP2A 4DHJB 1B9RA 4GU2A 1TIFA 4P16A 3EFUA 4HCNB 3AEFB 2RD0A 2WXOA 5FKAC 1FRRA 4GGQA 2GBRA 1P9DU 3C0RB 3OLMD 2VZKD 2W54A 2LHDA 3PRMB 1FFVA 4TQ1A 4JE3B 3W5UB 4NZLB 1FIQA 1IBXB 2J53A 4WJQA 4GLSC 1ZXIA 2BF8B 4DHJD 1MG4A 2CR5A 3RULA 3VRAB 2RDHA 2LXCA 5BYSA 2OEDA 2MW5A 2WXKA 4A8XC 2QCZA 2JY6A 4EZLA 3LXFA 2LJIA 3K9PB 1WMHB 3QJZA 1I4GA 3W1SA 1J7AA 1STEA 3AEBB 2KTRA 5DPTA 1ET6A 1UH6A 5G5HA 4KZ0A 3AM9A 3PHWB 4OHJA 1ZP0B 2K25A 2V3SA 4LCDE 3NS1A 1VD2A 2FCQA 2Z0EB 5AEKB 2INDC 1XQQA 4CHKA 3ZJUA 1JWAD 3IT6B 1I4QA 2N9EB 3PRPB 2WXNA 2J0KA 2ON8A 4W9LA 3QQ8B 2KMMA 4ZRIA 1ACCA 4F8CB 4EE2A 2BS3B 2WX0A 5EE3A 3APFA 5EE1A 4W9EA 2K22A 4PS7A 1MG8A 2ZZPB 4HPMB 2IJ0A 3R2TA 4WAAA 2KDEB 2JUOA 1WFYA 1UWXA 4A20A 5E6NA 2XK5A 3VTWA 1C76A 1GC7A 2WU5B 1K51A 1TKYA 3RT3B 4C56C 2CJNA 2PIAA 1YIWA 3FKYA 4ACFA 4EZJA 1SB3C 1SE4A 1UGMA 3AE8B 4JX1C 3MJ5A 2JXTA 2FBWB 3DPDA 4W9DA 1WZ3A 3TSSA 5CHWA 4IC7B 1K52A 5CHFA 5D7GA 2JF5A 2JVCA 4KSKC 4DWFA 4W9FA 1RLFA 3C8YA 2LXAA 2I1KA 4TV3A 4BKSA 4KKIA 1IP9A 3H1UA 1KF6B 2K0PA 3KW5B 3HUIA 1H8CA 4RM9A 3TUOA 4FULA 2IBIB 1RFAA 2MP2B 2M19A 3AI5A 4KIKA 4WAFA 2GBJA 1MVKA 1WXMA 2MBEA 2W3SA 2JZPA 2L1AA 4PS8A 4IOIE 2LUEA 2JU6X 2KAJA 2PEAA 4IWOA 3I9V1 1CZPA 1JW9D 1JWBD 2KKCA 3RNCC 3Q8EA 2IY1B 2LFIA 3TEYA 3O65B 1ZKHA 1I4HA 3L16A 1UELA 4LTUA 3W2DA 5KHOA 3VUXA 1FCLA 1V6EA 3RNFC 3RZWC 1WJNA 2N7JA 1V5TA 3APCA 1WWTA 4RNAA 3EC8A 2QJLA 3AULA 4YXDB 3D32A 1V80A 3TMPB 4AJWA 2UYZB 1YJJA 2M8SA 3UIOB 2KTRB 2KQSA 2LGYA 1QT9A 2GBNA 4FJZA 1U4AA 3M95A 3HVZA 3ZGZA 1WM2A 1GOZA 2O6VA 2G45B 4HROA 1HZ6A 1XF5L 3CMMB 3PLUA 2VH2A 1TT5B 1JWSD 1S1QB 1VJKA 2IGGA 2RPVA 1LXDA 3VTVA 4WIPA 4OZAA 3ZTDA 1YQ3B 3Q14C 3WCQA 1C1YB 2MBOA 3SFEB 5CX3A 4AJYB 5CHVC 4K81A 2LEKA 4TMAB 3V05A 1WGYA 2NVUI 3H7PA 2AL6A 2AWTA 1DOXA 2BB5A 1R7SA 2FIDA 3H9DA 3OJ4B 1WRDB 4IWQA 2KDMA 1UGJA 1RFKA 1SGHA 3V62A 1SIJA 1SBBB 2M4NA 2KZRA 2K8HA 2MJ3A 1EWCA 1H4RA 2XK5B 3ZKJC 1PGAA 3AECB 3Q3JA 3U8ZA 4YL8A 2QMTA 3Q3NC 1QOAA 3PREA 1FPYA 4LJPB 2YEPB 1MPEA 3FC4A 3NZSA 3U30A 3PZ7A 2IPKD 3DVGY 2KN4A 3RUIB 2MCNB 4DK5A 2KJHB 5GMVA 2AQ2B 2JRIB 2KQ7A 3P2BA 4ICVA 1HA5A 2JWUA 5LLIA 5C23A 1VRAB 3GE8C 2W82A 4LNNA 5G2NA 2CHXA 2ZW0A 4WURA 5JH5C 3N3KB 3A9KA 1HTOA 2MBBB 4RF1A 2R61A 5HI1A 1R4MB 2Q5WD 2M0XA 2QHOA 4KIKB 3R8BA 3MC0B 4AS1A 2N7EA 2VH1A 2DNFA 4EOYA 2JZ3B 2CU1A 4JLCA 1E7PB 2BQQA 3DHHC 3AN1A 1YJIA 1F2RC 2GI9A 3A33B 4II2B 4BKSD 2V3PA 2X38A 1SE2A 1WH3A 4XC2A 2KN5A 2W55A 1E10A 2ZCBA 3DBHB 3FAHA 2WXFA 1F0ZA 5DPSA 2ZVNA 3BVMA 5GXGB 1L0VB 2V0GA 2C60A 4OZCA 1ZGUB 4HRSA 4BFRA 1WYGA 5D3IB 3B2GA 1CQVA 4JWUC 4ZYNA 1WX9A 3M62B 3DWMA 4ARCA 1BT0A 2WP9B 3V6CB 2BWFA 3DQVA 2CJOA 1YOVB 5HHDG 2KMAA 2O6VB 1L0XB 4KGSA 3Q8FA 2HTME 1UD7A 4MEMA 1GG3A 3S2AA 4XWWA 3IHPC 4ANWA 2IGDA 3ZXRA 1QQRA 4XGAB 2WWZA 2MWSB 2Y3AA 3DHIC 5EE9A 2AQ1B 3VR8B 4WWPA 3GS2A 1WX8A 3VR9B 2WXIA 3SDLC 5HFYA 3VTUA 3EHVA 2ONQA 4I6LB 3H7PB 2DYMA 2M17A 3UINB 2V1YA 2WXRA 4XYCA 3UQBA 3RPFC 4QAYA 2LZ6A 1J8CA 2DYOA 3IG3A 1SJED 1V9JA 1D6EC 3TEXA 1EUVB 2NBUA 2BYVE 4HKZE 1T0SC 1KOTA 3AE1B 2MJDA 3PLVA 3L10B 2NPTA 3WAPA 3V61A 1N63A 3AE9B 2AL3A 1E5WA 1XCQL 4NJCA 5C3JB 2HE7A 5C1ZA 2WXMA 3ABVB 1KFYB 1FFUA 1CK1A 1XD3B 4ZOHC 3PPAA 2J0JA 3IAM1 2V9HA 1EU4A 4DDID 4IW0A 4WWMA 1M94A 2I2YA 1NYRA 3NRZA 1IGCA 3NY5A 1TTNA 2L0FA 3L08A 3C19A 2C5LC 4NPNA 1WGRA 2IZVB 2WQYB 4W9GA 4X57B 1T0YA 1YD8U 3A9KB 3ZRCA 4KZCA 2GRIA 1KLGD 2KLGA 2ZEQA 3RZFA 1EWYC 3LYYA 4LNKA 2ZNVB 4D2KA 1D3ZA 3MP9A 1ZOYB 4XDCA 2G4DB 4PYUA 4FBJB 3UGBB 1ZDXA 2NMQA 1SJHD 1FEHA 2KFKB 4GDKA 1VZ6A 4YTPB 2AYOB 2FAZA 4IM0A 1L0YB 3CWIA 1E8WA 4ZRPA 2XN9C 4K7WA 2KX3A 2KJ6A 4J3OD 3JSVB 2K1FA 2Y5CA 2XNAC 3GZNI 5IO9A 4KGTA 1JRPA 1RYJA 4LNIA 3AEGB 3NUHB 1L6VA 3HK0A 5LXHA 2J7QB 1Q1OA 2KOXA 3QARA 4OVVA 1T0RC 3U52E 2D3BA 4MH0E 3ZTCA 4MT5A 3DBSA 4CQNA 1E6EB 2MRPA 1WYWB 3EGRA 2MBHA 2CS4A 3P4QB 2DZKA 2MX2A 3BVZA 1UBIA 1WR6E 2H89B 2DAFA 4MGZE 4DBGA 4O1NA 4XX5A 2QC8A 3UI3A 2UWQA 3P63A 4FJYA 2HDEA 2RGFA 4DDGD 3B08A 5LNK1 2DENB 3P4SB 1GAQB 1YN5A 1VZ7A 2N7DA 3QIJA 1T0QC 4ZYSA 2NTTA 4FJVB 3SU8X 1PDXA 1AYFA 3TJPA 2GBMA 4B0MA 1GB4A 1I35A 3NVZA 5G55A 3I57A 4RF0A 2QEJC 3DBLB 4M8NA 1R4NI 3AE7B 3L13A 4XWTA 3BK2A 2GOWA 2D07B 4H2AA 4YT0B 1YJ1A 4JWSC 1XLOA 1P3QU 1UWMA 3PGEA 4C7YA 4B9KA 1QOBA 3RYTA 2NPTB 1F1HA 2KQ4X 3I3TB 5C2TB 2KNBA 4C4VA 1WX7A 3KWLA 2JXXA 1WJ4A 5G5GA 2J4XA 3E9SA 4EEWA 1UBQA 4E71A 4RGNA 4P1CC 3KUDB 4HWIB 3BIID 1AWDA 4P1BC 1SE3A 3PV1A 2C7HA 2WLBA 4G11A 4K3CA 1NENB 1F77A 1HXYD 1UNSA 4L23A 2OJRA 4C7ZA 2L83A 1GUAB 3Q2AC 2K6DB 2PKOA 1SEBD 1V97A 4BKGA 1GC6A 2WDVB 3JW0X 2MEKA 3TL5A 1E0ZA 1C4AA 2R2QA 5FR3A 2W3RA 2WXPA 5IN7A 2V4LA 2LGIA 3VXWA 2CKHB 4GDKB 1E8YA 4ITKA 2M1MA 2LMCA 4FXCA 3V3XA 3W1SC 4GB9A 3P42A 2N0SB 3B0AA 4WQOB 3EECA 2N9XA 1Q0WB 3NVWA 3ZYYX 3OG5A 1RWSA 1OFFA 3KVFB 4KV2A 4HVBA 4MGYE 3R2IA 1OEYJ 4GOCA 1J19A 1HQRD 1FRDA 3QAQA 1NDDA 3QC8B 2BPSA 2ZCCA 3P4PB 2GMIC 3X23A 1KLVA 2CHWA 3BY4B 1IGDA 1G6JA 1KJTA 4MACA 4US9A 5EDSA 4KDLB 4I6NB 3L0WB 4PYZA 2W9NA 2IO0B 3SHQA 2Y5PA 2BWES 2N1VA 1K53A 3KH0A 4PS3A 3KUCB 4LK0M 2BTEA 1E8XA 1TBEA 1GJZA 4BZAA 5FK9C 1V1PA 3O13A 2KT7A 2K9XA 2FUG1 3HRDD 1PGXA 1XXGA 4NJ7A 1N5XA 3ENEA 3PT2B 2PLPA 2NR2A 1VDVA 3M63B 2D3CA 2I1JA 2OJWA 3MTNB 2EKIA 4KVGB 1V49A 4AP4C 2WS3B 3V6EB 3SD5A 2A5UA 1JROA 4NAWA 2BBCA 2JPHA 2NS5A 4HDOA 5JZEB 4MGKE 1CMXB 4R3DA 5J18A 3A1QA 2LGSA 5E6PA 3VH3B 4NJ6A 4P7IA 1F52A 3ML8A 4TSSA 2MHJA 3ZNHB 1L5PA 4C4VB 3PS6A 2IDYA 4G3XB 1LO5D 5FR6A 4ZDVA 2EMTA 2MSED 1WGGA 4IDIA 3KYCD 3Q69A 2KWDA 3AU5A 1ROEA 1WGDA 1WXAA 4M0WA 3N1ZC 2TSSA 4USAA 3IT4B 5IA7A 3JYUA 3NJTA 3QCAA 3KWVA 4G0NB 5AZGA 2WXJA 2RPQA 4OW0A 1ZE3D 3WANA 2J52A 1Y8RC 2KYWA 2Z0DB 3KYDD 1KM7A 2FUHB 1N62A 1TS5A 1QILA 1S3SG 4TQ0A 2L32A 3AB5A 2WXQA 1QOGA 3T8MA 1L7YA 1F2RI 3I63C 4CO7A 3NZ3A 2RR9A 1AARA 1E8ZA 1WE7A 1DYQA 1GB1A 4DQOC 3KQ4A 4BVUC 1E9MA 2MA9B 1WJ6A 3M3JA 3WIMA 4BBNC 1TGZB 4RGMA 4F7ZA 2C7MB 2QILA 2WDTB 2PTLA 1TS3A 1XT9B 4E74A 2FCSA 4HJGE 4MELA 3PHXB 1WF9A 1ET9A 4WH4A 1TY2A 3R7QA 4WWNA 2IY0B 4LNOA 4HEA1 1HEZE 2KFKA 3AE3B 1WXSA 4TKNA 2WXLA 4MDKE 2M56B 3IAS1 3FILA 5J2RA 3T3OA 2PMVA 1ZW7A 4HXDA 2FIFA 3ECIA 2X8XX 3NOBA 5EE0A 2LJ5A 1PQSA 3GP7A 1V86A 3JSVA 2KVRA 2GLSA 1T5XD 4OVZA 2K8BA 4W9IA 2B76B 3VQIA 3ZUNA 1MFWA 1I4XA 2KC1A 1M4VA 1TZOA 1C4PA 2WXGA 1DOIA 2IO3B 1V1OA 2WX1A 1XCTL 1Y56A 4IKGA 1OGWA 1V1PB 4FHKA 2DBYA 4YSYB 1T6BX 4DHZB 4ZHOA 5BO4B 1P7FA 2BB6A 3Q3MC 4AQ7A 4N9F4 2IGHA 3TIXA 1DOYA 2BT6A 3DDCB 3UF8A 3JVZX 3GB1A 4NAWB 4XE0A 1JWUD 2BVCA 3J9CA 5I4DA 3MHZA 2AX5A 4AWJA 4C00A 5E6OA 1OQQA 3A1QB 1PGBA 3NHEB 4MH8A 3DVNU 3BWUD 1NBFC 2RDBC 2XEWA 3Q3OC 2L76A 2EELA 3KUZA 2K8CA 2FCNA 1FXTB 1TS2A 3AH7A 5TR5A 1KLUD 2DWQA 4RCOA 5DPWA 1N6ZA 4ICUA 2PE6B 4LNFA 5J17A 3T9LA 3BZDB 3WALA 4E3CA 1I4PA 4WJNA 4K1RB 4DXFA 4ZRJA 2NBWB 4M0WB 3B2FA 3CF6E 1XLPA 3MJWA 4RH6A 1YMHE 1YX5B 2WYQA 2ZNVC 1PYWD 4L1BA 4OZBA 3L17A 3Q6BA 2O2VA 1V5OA 1AW7A 2H88B 4ANXA 2KK8A 2PW9A 4CYEA 1T3QA 2N9KA 1WY8A 4BOSC 5IKCM 1TYGB 4N59A 3W5VB 3AE4B 1E7VA 1WIAA 4ANUA 5HKHA 2WNMA 3Q8CA 3AEDB 4ZHPA 2D3GA 2LHEA 4HLEA 1C77A 4JL9A 3MHSD 4RFBA 5JHAA 1EF1A 1V8CA 2INPE 3A9JA 3ONSA 2JT4B 3AXCA 4YTNB 1AN8A 1SXTA 2Y5BB 4AOFA 5AUKA 3EA6A 3QHTA 5JHBA 2LVOA 4IWPA 2QDFA 2IO1B 1GNUA 2YEPF 2KANA 3VRBB 1FMAD 2G4SA 1ZUD2 2UU7A 2KVZA 3PTFC 3NG0A 4KSLC 4WQMA 3AMZA 4BAXA 1D5MC 4K3BA 1Z5SB 5MPOA 3FILB 1FO4A 2V4IB 1WXVA 4IM3A 5BYQA 4RGTA 2V3NA 2JQRB 2LGDA 1MJDA 2E3TA 1ZDVA 3RNBC 2BW2A 4P6VF 2N9PC 1FCCC 2JWZA 4FA6A 4HKQA 2DLBA 1TKGA 4OVUA 4GIVA 1KRHA 4N6EB 1FM0D 3U4EG 1HE8A 5D94A 2D2QA 2KDFB 2PJHA 2K39A 1C4CA 2JZZA 3Q8BA 3ZW3A 2LVPA 2BS4B 2FCMA 2KJRA 2REXA 4NQKE 2JYEA 1I42A 4NAMA 2K6QA 1UF0A 1UUPA 2D10A 3HHMA 1V81A 1MI0A 2CU3A 4GDLA 2BYTA 3W1YA 3ZLZA 3N30A 3DBRI 4EZKA 2AEHA 2E6XA 3NZUA 2OOBB 2M0AA 4DXGA 2VRRB 1DGJA 4BBNF 2B3AA 3ZNGC 1HTQA 1KH0A 1WI0A 3AE5B 2INNE 4A3PA 4NY0A 1YQBA 3VDZA 4RM8A 3ZJTA 4B0EA 4W9CA 3P4RB 1WR1A 2DYBA 4PT5A 3WAMA 1SF0A 2KHWB 3QA8A 1L4ZB 4MSQB 5L83A 2K3UA 3RFZB 2O2VB 4YWGG 2R2OA 2D11A 1I7HA 1GPXA 4FHJA 1C79A 5CTRC 1YQ4B 1VR9A 4YTMB 5H8YE 2IO2B 4K7SA 2RMMA 1OEYA 3U7ZA 5DCNA 4KDIC 4ZRQA 2JYTA 4ASWC 1E90A 3Q8AA 4S0RA 4W9HA 2KMCA 3E56A 1J0GA 1D5ZC 2EKEC 1HZ5A 3RNGC 5AUIA 3RNAC 3ZDTA 3GZNB 3HM3A 3N32A 3IFWB 2MBQA 1JWMD 1PFDA 1WJUA 1BUIC 2NCNA 3A9JB 3H8HA 1I4RA 3N1YC 2ZJDA 3IVFA 2RDGA 2HD5B 1P0RA 2EMSA 5DPRA 1XEEA 3LB8C 1E7UA 1K8RB 2AQ3B 4A9AA 3OJ3A 3ZDMC 4HDQA 2KWUB 2FE8A 3N9YC 2KACA 2LVQA 2LI5A 3AEEB 2I38A 1YX6B 4A6QA 3MFGA 1FD6A 3TEWA 1IUEA 3PZDA 2ZPYA 1UZXB 1KTKA 2MJEA 3IXSA 3RN9C 2NBVB 1Q5WB 1C78A 3PO0A 3DBRB 1PUTA 1NI2A 1NEKB 3RNEC 4M8MA 3BYYB 3MC8A 4YSXB 2LGXA 3VH4B 2KC2A 1FNVA 4PK1A 1WGHA 1SIFA 3TCAA 2KXJA 3ETRA 2A4ZA 4I6PA 1ISNA 1SSNA 4HPLB 3W9CB 2KTFA 2JRHA 4GSWA 1XO3A 2LUMA 1R4NB 1WGKA 3B1LX 3EUB2 4J6IA 2ZVOA 1JCKB 4XZ4A 4FADA 1WSPA 2KWCA 3TBLD 2BKFA 1L4DB 2KLCA 2WU2B 5IP4D 1YNTE 4KGRA 1EM7A 2WDRB 3Q3FA 3P1MA 4GDLB 4K7UA 1WE6A 4XDDA 1LFDA 4UDUC 3QWZB 1FXAA 3SFDB 3PZ8A 4WJOA 3ALBA 1R4MI 4LDTB 2KD0A 1QZEA 2QSDA 2OHFA 2KDIA 4G50A 3DCGA 3KLSX 4MM3A 2L0TA 2KWVB 3ZJVA 2BGFA 3SR6A 2N4FA 2L05A 4KX6B 3VUYA 3ZRFA 3L54A 4BOZB 4IG7B 4A90A 3VVWB 3WA0A 1RAXA 4M02A 4W9KA 2LRUA 2C7NB 2LASA 3H6NA 1BXTA 1ZPSA 4LDTD 1J7BA 1NYQA 3DBHI 1C9FA 1FNUA 1TS4A 3BYTB 3TEZA 2HJ8A 1ENFA 4HCPB 4AUQC 1A5RA 5IOIA 4MGIE 3R66C 3AE2B 3SEBA 1EU3A 2FNJB 3HM6X 3DVNV 3OAWA 3ZVVA 4EFOA 1P7EA 4M01A 2L7RA 2MLBA 1V2YA 4ARIA 3OWEB 1L2NA 1BMLC 1VLBA 4RMAA 2SEBD 4JQWC 3RCZA 2HJ1A 2KDBA 2L52A 3BVGA 3RMKC 1Q10A 5D3DA 2DZIA 1JMLA 5AZFA 4A55A 2KO3A 1VZ8A 3APDA 4JGHB 2PVGC 2NTSA 4DHZE 2C9WB 4DXAB 2DZJA 2BKRB 3T3NA 3DOWA 5BMGA 2JSVX 5BMHA 4HPPA 2Z8LA 5JXVA 1LGRA 3AE6B 1TY0A 3N1XC 1JRUA 2ZPNA 3N20C 1F9JA 1QOFA 2ICIA 2KFJA 1VCBA 2BYEA 1EF5A 3DVGX 1WM3A 4TUUA 1QF6A 1MHXA 1IPGA 4NQLB 1K50A
chains in the Genus database with same CATH topology
3A4SC 3VUXA 1V6EA 2YVCA 5G55A 1E7VA 1WIAA 4IUMB 3RZWC 1WJNA 4ANUA 5HKHA 2PE9A 4MJSA 4M8NA 1R4NI 1V5TA 2GBKA 3APCA 2D3GA 3EC8A 3L13A 3GOEA 3BINA 2GOWA 2D07B 3AULA 1RRBA 1YJ1A 3D32A 4HLEA 3ZNZB 1P3QU 1V80A 4JL9A 3TMPB 4AJWA 2UYZB 3MHSD 2M8SA 3PGEA 4B9KA 1LQBA 5JHAA 3UIOB 1EF1A 3RD2A 2DAJA 2KTRB 3RYTA 3A9JA 2NPTB 3ONSA 2KQSA 2LGYA 2RSUA 3I3TB 2GBNA 2JT4B 1U4AA 3AXCA 4FJZA 2LWPA 2KNBA 3M95A 2Y5BB 4AOFA 1WM2A 2O6VA 1WX7A 2G45B 2JXXA 1WJ4A 3QHTA 5JHBA 3CMMB 3PLUA 2LVOA 3K9OB 4EEWA 4IWPA 4EKUA 2IO1B 2HTHA 1UBQA 1S1QB 1GNUA 2DHZA 2IYDB 2KANA 1LM8B 4E71A 3ML9A 3KUDB 2G4SA 2L00B 4HWIB 1LXDA 3PTFC 3VTVA 3PV1A 2C7HA 4G11A 4KSLC 3VFKA 3LDZE 3AU4A 3VUWA 1WZ0A 3CSTA 3ZTDA 1Z5SB 3U7DA 1SE9A 1C1YB 2MBOA 3QX1A 5CX3A 4AJYB 5CHVC 2OJRA 4K81A 4JIOU 3WAOA 1WXVA 1WGYA 4IM3A 4GMVA 4B95A 2NVUI 1GUAB 3H7PA 4DBGA 1C3TA 2AL6A 2K6DB 2AWTA 1Z2MA 2LGDA 2FIDA 2DX5B 3H9DA 3OJ4B 3R3MA 1P98A 1WRDB 4IWQA 4BKGA 1SGHA 2L3ZA 3V62A 1GC6A 2N9PC 1WMHA 2JWZA 3JW0X 3HIZA 4FA6A 2ASQA 2KZRA 2K8HA 2M4NA 3TL5A 4NNJB 2R2QA 3H7SA 1H4RA 3PSEB 2XK5B 4OVUA 4GIVA 4WJOA 3VHTC 3ZKJC 1HE8A 5D94A 2V4LA 2D2QA 2KDFB 3VXWA 2CKHB 2PJHA 3Q3JA 4GDKB 2K39A 4YL8A 3U8ZA 1E8YA 2CHZA 3PREA 2M1MA 2JZZA 3ZW3A 4LJPB 3W1SC 4GB9A 2LVPA 3B0AA 4WQOB 3EECA 3ZNID 2FCMA 3NZSA 2KJRA 3U30A 2N9XA 2L8JA 2REXA 4NQKE 1I42A 1Q0WB 2KX0A 2K6QA 4WWOA 3DVGY 2D10A 4HVBA 3KVFB 3HHMA 4IM2A 1V81A 4KV2A 2MCNB 2O6VD 3RUIB 2KJHB 4A3OA 4DK5A 5GMVA 4GDLA 3QK0A 4MGYE 3W1YA 4LJOB 5KHQA 4BKTA 1OEYJ 2XBBC 1TZ1A 3N30A 4GOCA 5AZHA 3ZLZA 3PVLA 2JRIB 1J19A 2KQ7A 3DBRI 2AEHA 3PRZA 3QAQA 3NZUA 3P2BA 4EZKA 4II3B 2OOBB 4ICVA 1NDDA 5D2MB 5D6JB 3VAWA 1P1AA 3QC8B 2BPSA 2ZCCA 5LLIA 5C23A 2VRRB 5IAAC 4BBNF 2B3AA 3ZNGC 2GMIC 3X23A 1KLVA 2CHWA 2MQJA 3BY4B 1OQYA 5G2NA 1WI0A 1G6JA 4F1SA 2CHXA 1KJTA 4A3PA 5EDSA 4KDLB 5JH5C 3N3KB 4NY0A 3A9KA 1YQBA 2MBBB 3VDZA 4RM8A 4I6NB 3V60A 4W9CA 3L0WB 4PYZA 1WR1A 2W9NA 2IO0B 2M0XA 2QHOA 4MSMB 2BWES 2DYBA 2N1VA 4KIKB 3SHQA 4URKA 4HJKA 3KH0A 4PS3A 3KUCB 3LJ3A 3CSFA 2YLMA 1E8XA 1TBEA 3WAMA 2LRWA 2N7EA 2N1WA 1GJZA 2DZMA 2J0MA 1X1MA 2KHWB 2PPHA 4GXBA 3QA8A 4HK2A 4MSQB 4EOYA 2JZ3B 2CU1A 4JLCA 5L83A 1EO6A 4NJ7A 4ZRKA 3ENEA 3PT2B 3UIPB 3ZO5B 1IYFA 2O2VB 2R2OA 4GN1A 2NR2A 3A33B 3NS8A 2D11A 4II2B 4BKSD 3M63B 4EUTA 2I1JA 3MTNB 4FN2A 4FHJA 5CTRC 4KVGB 4ANVA 1V49A 1WH3A 4WJPA 4XC2A 4AP4C 3DBLI 2KN5A 3V6EB 3SD5A 2IO2B 4K7SA 2LD9A 2ZCBA 2A5UA 1OEYA 4NAWA 5DPSA 2JPHA 2NS5A 2ZVNA 3IBEA 4HDOA 4KDIC 5DCNA 3ZIMA 2G3QB 2C60A 4ASWC 4B6WA 5JZEB 1E90A 4W9JA 4MGKE 4W9HA 1CMXB 2BYFA 2KMCA 5J18A 1J0GA 2EKEC 1ZGUB 4MJSB 2Z59B 3A1QA 4BFRA 4DXAB 3ZDTA 3HM3A 1OTRB 3A4RA 5E6PA 3VH3B 3N32A 3IFWB 2MBQA 4ZYNA 5LXIB 1WX9A 3R7RA 3M62B 4NJ6A 4P7IA 4FLHA 1BT0A 1WJUA 3V6CB 2NCNA 3ML8A 3A9JB 2BWFA 5L95C 3DQVA 3X0WA 3ZNHB 2ZJDA 3IVFA 2MP2A 2HD5B 2KMAA 2O6VB 3PS6A 1P0RA 4DHJB 4G3XB 4GU2A 5FR6A 4ZDVA 2EMTA 2EMSA 5DPRA 3EFUA 4HCNB 2RD0A 1E7UA 2MSED 1WGGA 1K8RB 4GGQA 3KYCD 2GBRA 1P9DU 3AU5A 1UD7A 3C0RB 3OJ3A 3OLMD 1WGDA 2KWUB 4HDQA 4MEMA 3ZDMC 1WXAA 2LVQA 1GG3A 3S2AA 2LI5A 3IHPC 4ANWA 3PRMB 4TQ1A 1YX6B 2WWZA 5IA7A 3JYUA 3QCAA 3PZDA 2MWSB 4G0NB 5AZGA 2ZPYA 2RPQA 4WWPA 1UZXB 3WANA 1Y8RC 2Z0DB 3KYDD 1WX8A 2NBVB 1Q5WB 1KM7A 2FUHB 3SDLC 4WJQA 3EHVA 3VTUA 1S3SG 3H7PB 4I6LB 2DYMA 4TQ0A 2M17A 2BF8B 4DHJD 3UINB 1NI2A 2CR5A 2V1YA 4M8MA 3T8MA 1L7YA 3RULA 3UQBA 2LGXA 2LXCA 3VH4B 2KC2A 2MW5A 2LZ6A 1WGHA 1J8CA 2JY6A 4CO7A 1SIFA 4EZLA 3TCAA 2DYOA 2KXJA 1AARA 2RR9A 3IG3A 2A4ZA 1WMHB 3K9PB 1E8ZA 1V9JA 3QJZA 4I6PA 1WE7A 1ISNA 4BVUC 4HPLB 2MA9B 1EUVB 3W1SA 1WJ6A 3M3JA 3WIMA 2KTFA 2NBUA 2BYVE 4BBNC 1TGZB 2JRHA 4F7ZA 1KOTA 2C7MB 2WDTB 4GSWA 3PLVA 3B1LX 2KTRA 3L10B 4J6IA 2ZVOA 5DPTA 2NPTA 1UH6A 3WAPA 4XZ4A 3V61A 4FADA 4KZ0A 3PHWB 2KWCA 1XT9B 4E74A 3TBLD 2FCSA 2K25A 2AL3A 2V3SA 4LCDE 1E5WA 2BKFA 4MELA 3PHXB 2KLCA 1VD2A 1WF9A 2FCQA 2HE7A 3R7QA 4WWNA 2Z0EB 5C1ZA 2IY0B 3Q3FA 5AEKB 1XD3B 1XQQA 4GDLB 4CHKA 4K7UA 1WE6A 3PPAA 2KFKA 1WXSA 2J0JA 4TKNA 4MDKE 1LFDA 5J2RA 2N9EB 4DDID 4IW0A 3QWZB 1ZW7A 1M94A 3PRPB 2FIFA 4HXDA 3ECIA 2J0KA 3NOBA 2LJ5A 3NY5A 3ALBA 4W9LA 1R4MI 2L0FA 1PQSA 1TTNA 1V86A 2KD0A 3JSVA 2KVRA 3L08A 1QZEA 3QQ8B 2C5LC 4LDTB 4NPNA 1WGRA 4F8CB 2IZVB 2KDIA 4W9GA 2K8BA 4W9IA 4X57B 1T0YA 3VQIA 4G50A 3ZUNA 1YD8U 2WX0A 3DCGA 2KC1A 3APFA 3A9KB 3ZRCA 4W9EA 4MM3A 4KZCA 4PS7A 1MG8A 2ZZPB 2L0TA 2KWVB 4HPMB 2BGFA 4WAAA 2KDEB 2JUOA 2KLGA 2IO3B 2ZEQA 3RZFA 2N4FA 1WFYA 2L05A 2WX1A 2ZNVB 3VUYA 3ZRFA 4A20A 3L54A 4BOZB 4IG7B 1D3ZA 1OGWA 5E6NA 4FHKA 2XK5A 3VTWA 3VVWB 3WA0A 1RAXA 4W9KA 2G4DB 4PYUA 2LRUA 5DPWA 1GC7A 3UGBB 4FBJB 4DHZB 2C7NB 2LASA 2KFKB 4GDKA 5BO4B 3RT3B 3H6NA 2AYOB 4LDTD 1YIWA 2FAZA 3DBHI 4IM0A 4EZJA 1E8WA 2HJ8A 4HCPB 4N9F4 4AUQC 1A5RA 3TIXA 4K7WA 2KX3A 3UQAA 4MGIE 2KJ6A 1UGMA 3R66C 3JSVB 2K1FA 3DDCB 3UF8A 3JVZX 2FNJB 3GZNI 4NAWB 3HM6X 3DVNV 3DPDA 3OAWA 4W9DA 3ZVVA 1WZ3A 4EFOA 5CHWA 4AWJA 2L7RA 2MLBA 4IC7B 1V2YA 3HK0A 5LXHA 5E6OA 3A1QB 3NHEB 5CHFA 2J7QB 1Q1OA 2KOXA 3QARA 5D7GA 1L2NA 3DVNU 4RMAA 2JF5A 2JVCA 4OVVA 4KSKC 4JQWC 3RCZA 1NBFC 4DWFA 4W9FA 2XEWA 1RLFA 2KDBA 2L76A 2LXAA 4MH0E 3ZTCA 2I1KA 3KUZA 2K8CA 3DBSA 4TV3A 5KHOA 2DZIA 4BKSA 5AZFA 2FCNA 1IP9A 3H1UA 1FXTB 2MRPA 1WYWB 2KO3A 5TR5A 3KW5B 2MBHA 3APDA 2CS4A 4JGHB 1H8CA 4RM9A 2DZKA 2IBIB 1RFAA 2MP2B 2MX2A 1UBIA 2C9WB 4FULA 2DZJA 4DHZE 1WR6E 3AI5A 2DAFA 2BKRB 2PE6B 4ICUA 4KIKA 4MGZE 4XX5A 2GBJA 3T9LA 5J17A 3DOWA 3WALA 4E3CA 4WJNA 1WXMA 4K1RB 2MBEA 4PS8A 2LUEA 4ZRJA 2NBWB 4M0WB 2UWQA 4FJYA 2PEAA 4IWOA 3CF6E 3MJWA 2RGFA 4DDGD 3B08A 1JRUA 1YX5B 2DENB 2KKCA 2WYQA 2ZNVC 2ZPNA 3L17A 1F9JA 2O2VA 1V5OA 2IY1B 2KFJA 4ANXA 2KK8A 1VCBA 4CYEA 2BYEA 3O65B 2N7DA 3QIJA 1EF5A 1ZKHA 3DVGX 4FJVB 3SU8X 1WM3A 3L16A 4TUUA 1WY8A 4BOSC 3TJPA 2GBMA 1UELA 1IPGA 1I35A 4ZRIA 4NQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A4S C;  3VUX A;  1V6E A;  2YVC A;  5G55 A;  1E7V A;  1WIA A;  4IUM B;  3RZW C;  1WJN A;  4ANU A;  5HKH A;  2PE9 A;  4MJS A;  4M8N A;  1R4N I;  1V5T A;  2GBK A;  3APC A;  2D3G A;  3EC8 A;  3L13 A;  3GOE A;  3BIN A;  2GOW A;  2D07 B;  3AUL A;  1RRB A;  1YJ1 A;  3D32 A;  4HLE A;  3ZNZ B;  1P3Q U;  1V80 A;  4JL9 A;  3TMP B;  4AJW A;  2UYZ B;  3MHS D;  2M8S A;  3PGE A;  4B9K A;  1LQB A;  5JHA A;  3UIO B;  1EF1 A;  3RD2 A;  2DAJ A;  2KTR B;  3RYT A;  3A9J A;  2NPT B;  3ONS A;  2KQS A;  2LGY A;  2RSU A;  3I3T B;  2GBN A;  2JT4 B;  1U4A A;  3AXC A;  4FJZ A;  2LWP A;  2KNB A;  3M95 A;  2Y5B B;  4AOF A;  1WM2 A;  2O6V A;  1WX7 A;  2G45 B;  2JXX A;  1WJ4 A;  3QHT A;  5JHB A;  3CMM B;  3PLU A;  2LVO A;  3K9O B;  4EEW A;  4IWP A;  4EKU A;  2IO1 B;  2HTH A;  1UBQ A;  1S1Q B;  1GNU A;  2DHZ A;  2IYD B;  2KAN A;  1LM8 B;  4E71 A;  3ML9 A;  3KUD B;  2G4S A;  2L00 B;  4HWI B;  1LXD A;  3PTF C;  3VTV A;  3PV1 A;  2C7H A;  4G11 A;  4KSL C;  3VFK A;  3LDZ E;  3AU4 A;  3VUW A;  1WZ0 A;  3CST A;  3ZTD A;  1Z5S B;  3U7D A;  1SE9 A;  1C1Y B;  2MBO A;  3QX1 A;  5CX3 A;  4AJY B;  5CHV C;  2OJR A;  4K81 A;  4JIO U;  3WAO A;  1WXV A;  1WGY A;  4IM3 A;  4GMV A;  4B95 A;  2NVU I;  1GUA B;  3H7P A;  4DBG A;  1C3T A;  2AL6 A;  2K6D B;  2AWT A;  1Z2M A;  2LGD A;  2FID A;  2DX5 B;  3H9D A;  3OJ4 B;  3R3M A;  1P98 A;  1WRD B;  4IWQ A;  4BKG A;  1SGH A;  2L3Z A;  3V62 A;  1GC6 A;  2N9P C;  1WMH A;  2JWZ A;  3JW0 X;  3HIZ A;  4FA6 A;  2ASQ A;  2KZR A;  2K8H A;  2M4N A;  3TL5 A;  4NNJ B;  2R2Q A;  3H7S A;  1H4R A;  3PSE B;  2XK5 B;  4OVU A;  4GIV A;  4WJO A;  3VHT C;  3ZKJ C;  1HE8 A;  5D94 A;  2V4L A;  2D2Q A;  2KDF B;  3VXW A;  2CKH B;  2PJH A;  3Q3J A;  4GDK B;  2K39 A;  4YL8 A;  3U8Z A;  1E8Y A;  2CHZ A;  3PRE A;  2M1M A;  2JZZ A;  3ZW3 A;  4LJP B;  3W1S C;  4GB9 A;  2LVP A;  3B0A A;  4WQO B;  3EEC A;  3ZNI D;  2FCM A;  3NZS A;  2KJR A;  3U30 A;  2N9X A;  2L8J A;  2REX A;  4NQK E;  1I42 A;  1Q0W B;  2KX0 A;  2K6Q A;  4WWO A;  3DVG Y;  2D10 A;  4HVB A;  3KVF B;  3HHM A;  4IM2 A;  1V81 A;  4KV2 A;  2MCN B;  2O6V D;  3RUI B;  2KJH B;  4A3O A;  4DK5 A;  5GMV A;  4GDL A;  3QK0 A;  4MGY E;  3W1Y A;  4LJO B;  5KHQ A;  4BKT A;  1OEY J;  2XBB C;  1TZ1 A;  3N30 A;  4GOC A;  5AZH A;  3ZLZ A;  3PVL A;  2JRI B;  1J19 A;  2KQ7 A;  3DBR I;  2AEH A;  3PRZ A;  3QAQ A;  3NZU A;  3P2B A;  4EZK A;  4II3 B;  2OOB B;  4ICV A;  1NDD A;  5D2M B;  5D6J B;  3VAW A;  1P1A A;  3QC8 B;  2BPS A;  2ZCC A;  5LLI A;  5C23 A;  2VRR B;  5IAA C;  4BBN F;  2B3A A;  3ZNG C;  2GMI C;  3X23 A;  1KLV A;  2CHW A;  2MQJ A;  3BY4 B;  1OQY A;  5G2N A;  1WI0 A;  1G6J A;  4F1S A;  2CHX A;  1KJT A;  4A3P A;  5EDS A;  4KDL B;  5JH5 C;  3N3K B;  4NY0 A;  3A9K A;  1YQB A;  2MBB B;  3VDZ A;  4RM8 A;  4I6N B;  3V60 A;  4W9C A;  3L0W B;  4PYZ A;  1WR1 A;  2W9N A;  2IO0 B;  2M0X A;  2QHO A;  4MSM B;  2BWE S;  2DYB A;  2N1V A;  4KIK B;  3SHQ A;  4URK A;  4HJK A;  3KH0 A;  4PS3 A;  3KUC B;  3LJ3 A;  3CSF A;  2YLM A;  1E8X A;  1TBE A;  3WAM A;  2LRW A;  2N7E A;  2N1W A;  1GJZ A;  2DZM A;  2J0M A;  1X1M A;  2KHW B;  2PPH A;  4GXB A;  3QA8 A;  4HK2 A;  4MSQ B;  4EOY A;  2JZ3 B;  2CU1 A;  4JLC A;  5L83 A;  1EO6 A;  4NJ7 A;  4ZRK A;  3ENE A;  3PT2 B;  3UIP B;  3ZO5 B;  1IYF A;  2O2V B;  2R2O A;  4GN1 A;  2NR2 A;  3A33 B;  3NS8 A;  2D11 A;  4II2 B;  4BKS D;  3M63 B;  4EUT A;  2I1J A;  3MTN B;  4FN2 A;  4FHJ A;  5CTR C;  4KVG B;  4ANV A;  1V49 A;  1WH3 A;  4WJP A;  4XC2 A;  4AP4 C;  3DBL I;  2KN5 A;  3V6E B;  3SD5 A;  2IO2 B;  4K7S A;  2LD9 A;  2ZCB A;  2A5U A;  1OEY A;  4NAW A;  5DPS A;  2JPH A;  2NS5 A;  2ZVN A;  3IBE A;  4HDO A;  4KDI C;  5DCN A;  3ZIM A;  2G3Q B;  2C60 A;  4ASW C;  4B6W A;  5JZE B;  1E90 A;  4W9J A;  4MGK E;  4W9H A;  1CMX B;  2BYF A;  2KMC A;  5J18 A;  1J0G A;  2EKE C;  1ZGU B;  4MJS B;  2Z59 B;  3A1Q A;  4BFR A;  4DXA B;  3ZDT A;  3HM3 A;  1OTR B;  3A4R A;  5E6P A;  3VH3 B;  3N32 A;  3IFW B;  2MBQ A;  4ZYN A;  5LXI B;  1WX9 A;  3R7R A;  3M62 B;  4NJ6 A;  4P7I A;  4FLH A;  1BT0 A;  1WJU A;  3V6C B;  2NCN A;  3ML8 A;  3A9J B;  2BWF A;  5L95 C;  3DQV A;  3X0W A;  3ZNH B;  2ZJD A;  3IVF A;  2MP2 A;  2HD5 B;  2KMA A;  2O6V B;  3PS6 A;  1P0R A;  4DHJ B;  4G3X B;  4GU2 A;  5FR6 A;  4ZDV A;  2EMT A;  2EMS A;  5DPR A;  3EFU A;  4HCN B;  2RD0 A;  1E7U A;  2MSE D;  1WGG A;  1K8R B;  4GGQ A;  3KYC D;  2GBR A;  1P9D U;  3AU5 A;  1UD7 A;  3C0R B;  3OJ3 A;  3OLM D;  1WGD A;  2KWU B;  4HDQ A;  4MEM A;  3ZDM C;  1WXA A;  2LVQ A;  1GG3 A;  3S2A A;  2LI5 A;  3IHP C;  4ANW A;  3PRM B;  4TQ1 A;  1YX6 B;  2WWZ A;  5IA7 A;  3JYU A;  3QCA A;  3PZD A;  2MWS B;  4G0N B;  5AZG A;  2ZPY A;  2RPQ A;  4WWP A;  1UZX B;  3WAN A;  1Y8R C;  2Z0D B;  3KYD D;  1WX8 A;  2NBV B;  1Q5W B;  1KM7 A;  2FUH B;  3SDL C;  4WJQ A;  3EHV A;  3VTU A;  1S3S G;  3H7P B;  4I6L B;  2DYM A;  4TQ0 A;  2M17 A;  2BF8 B;  4DHJ D;  3UIN B;  1NI2 A;  2CR5 A;  2V1Y A;  4M8M A;  3T8M A;  1L7Y A;  3RUL A;  3UQB A;  2LGX A;  2LXC A;  3VH4 B;  2KC2 A;  2MW5 A;  2LZ6 A;  1WGH A;  1J8C A;  2JY6 A;  4CO7 A;  1SIF A;  4EZL A;  3TCA A;  2DYO A;  2KXJ A;  1AAR A;  2RR9 A;  3IG3 A;  2A4Z A;  1WMH B;  3K9P B;  1E8Z A;  1V9J A;  3QJZ A;  4I6P A;  1WE7 A;  1ISN A;  4BVU C;  4HPL B;  2MA9 B;  1EUV B;  3W1S A;  1WJ6 A;  3M3J A;  3WIM A;  2KTF A;  2NBU A;  2BYV E;  4BBN C;  1TGZ B;  2JRH A;  4F7Z A;  1KOT A;  2C7M B;  2WDT B;  4GSW A;  3PLV A;  3B1L X;  2KTR A;  3L10 B;  4J6I A;  2ZVO A;  5DPT A;  2NPT A;  1UH6 A;  3WAP A;  4XZ4 A;  3V61 A;  4FAD A;  4KZ0 A;  3PHW B;  2KWC A;  1XT9 B;  4E74 A;  3TBL D;  2FCS A;  2K25 A;  2AL3 A;  2V3S A;  4LCD E;  1E5W A;  2BKF A;  4MEL A;  3PHX B;  2KLC A;  1VD2 A;  1WF9 A;  2FCQ A;  2HE7 A;  3R7Q A;  4WWN A;  2Z0E B;  5C1Z A;  2IY0 B;  3Q3F A;  5AEK B;  1XD3 B;  1XQQ A;  4GDL B;  4CHK A;  4K7U A;  1WE6 A;  3PPA A;  2KFK A;  1WXS A;  2J0J A;  4TKN A;  4MDK E;  1LFD A;  5J2R A;  2N9E B;  4DDI D;  4IW0 A;  3QWZ B;  1ZW7 A;  1M94 A;  3PRP B;  2FIF A;  4HXD A;  3ECI A;  2J0K A;  3NOB A;  2LJ5 A;  3NY5 A;  3ALB A;  4W9L A;  1R4M I;  2L0F A;  1PQS A;  1TTN A;  1V86 A;  2KD0 A;  3JSV A;  2KVR A;  3L08 A;  1QZE A;  3QQ8 B;  2C5L C;  4LDT B;  4NPN A;  1WGR A;  4F8C B;  2IZV B;  2KDI A;  4W9G A;  2K8B A;  4W9I A;  4X57 B;  1T0Y A;  3VQI A;  4G50 A;  3ZUN A;  1YD8 U;  2WX0 A;  3DCG A;  2KC1 A;  3APF A;  3A9K B;  3ZRC A;  4W9E A;  4MM3 A;  4KZC A;  4PS7 A;  1MG8 A;  2ZZP B;  2L0T A;  2KWV B;  4HPM B;  2BGF A;  4WAA A;  2KDE B;  2JUO A;  2KLG A;  2IO3 B;  2ZEQ A;  3RZF A;  2N4F A;  1WFY A;  2L05 A;  2WX1 A;  2ZNV B;  3VUY A;  3ZRF A;  4A20 A;  3L54 A;  4BOZ B;  4IG7 B;  1D3Z A;  1OGW A;  5E6N A;  4FHK A;  2XK5 A;  3VTW A;  3VVW B;  3WA0 A;  1RAX A;  4W9K A;  2G4D B;  4PYU A;  2LRU A;  5DPW A;  1GC7 A;  3UGB B;  4FBJ B;  4DHZ B;  2C7N B;  2LAS A;  2KFK B;  4GDK A;  5BO4 B;  3RT3 B;  3H6N A;  2AYO B;  4LDT D;  1YIW A;  2FAZ A;  3DBH I;  4IM0 A;  4EZJ A;  1E8W A;  2HJ8 A;  4HCP B;  4N9F 4;  4AUQ C;  1A5R A;  3TIX A;  4K7W A;  2KX3 A;  3UQA A;  4MGI E;  2KJ6 A;  1UGM A;  3R66 C;  3JSV B;  2K1F A;  3DDC B;  3UF8 A;  3JVZ X;  2FNJ B;  3GZN I;  4NAW B;  3HM6 X;  3DVN V;  3DPD A;  3OAW A;  4W9D A;  3ZVV A;  1WZ3 A;  4EFO A;  5CHW A;  4AWJ A;  2L7R A;  2MLB A;  4IC7 B;  1V2Y A;  3HK0 A;  5LXH A;  5E6O A;  3A1Q B;  3NHE B;  5CHF A;  2J7Q B;  1Q1O A;  2KOX A;  3QAR A;  5D7G A;  1L2N A;  3DVN U;  4RMA A;  2JF5 A;  2JVC A;  4OVV A;  4KSK C;  4JQW C;  3RCZ A;  1NBF C;  4DWF A;  4W9F A;  2XEW A;  1RLF A;  2KDB A;  2L76 A;  2LXA A;  4MH0 E;  3ZTC A;  2I1K A;  3KUZ A;  2K8C A;  3DBS A;  4TV3 A;  5KHO A;  2DZI A;  4BKS A;  5AZF A;  2FCN A;  1IP9 A;  3H1U A;  1FXT B;  2MRP A;  1WYW B;  2KO3 A;  5TR5 A;  3KW5 B;  2MBH A;  3APD A;  2CS4 A;  4JGH B;  1H8C A;  4RM9 A;  2DZK A;  2IBI B;  1RFA A;  2MP2 B;  2MX2 A;  1UBI A;  2C9W B;  4FUL A;  2DZJ A;  4DHZ E;  1WR6 E;  3AI5 A;  2DAF A;  2BKR B;  2PE6 B;  4ICU A;  4KIK A;  4MGZ E;  4XX5 A;  2GBJ A;  3T9L A;  5J17 A;  3DOW A;  3WAL A;  4E3C A;  4WJN A;  1WXM A;  4K1R B;  2MBE A;  4PS8 A;  2LUE A;  4ZRJ A;  2NBW B;  4M0W B;  2UWQ A;  4FJY A;  2PEA A;  4IWO A;  3CF6 E;  3MJW A;  2RGF A;  4DDG D;  3B08 A;  1JRU A;  1YX5 B;  2DEN B;  2KKC A;  2WYQ A;  2ZNV C;  2ZPN A;  3L17 A;  1F9J A;  2O2V A;  1V5O A;  2IY1 B;  2KFJ A;  4ANX A;  2KK8 A;  1VCB A;  4CYE A;  2BYE A;  3O65 B;  2N7D A;  3QIJ A;  1EF5 A;  1ZKH A;  3DVG X;  4FJV B;  3SU8 X;  1WM3 A;  3L16 A;  4TUU A;  1WY8 A;  4BOS C;  3TJP A;  2GBM A;  1UEL A;  1IPG A;  1I35 A;  4ZRI A;  4NQL B; 
#chains in the Genus database with same CATH topology
 3A4S C;  2YVC A;  4IUM B;  3ZXV A;  1JAL A;  2PE9 A;  4MJS A;  2GBK A;  1WRI A;  1TJE A;  3GOE A;  3BIN A;  1RRB A;  2G1E A;  3ZNZ B;  3DWG C;  1LQB A;  3RD2 A;  2DAJ A;  2RSU A;  4L2Y A;  4RGO S;  2LWP A;  5TSS A;  1YN3 A;  4EKU A;  3K9O B;  1QLB B;  2HTH A;  2DHZ A;  2IYD B;  1LM8 B;  3ML9 A;  2L00 B;  2JX5 A;  2BS2 B;  4S17 A;  3GE3 C;  3VFK A;  2SAK A;  3LDZ E;  3AU4 A;  3DHG C;  1J7C A;  2GB1 A;  3VUW A;  1WZ0 A;  3CST A;  3U7D A;  1SE9 A;  3I5J C;  2ACZ B;  3QX1 A;  1YN4 A;  4REZ A;  1ESF A;  4JIO U;  1IBX A;  3WAO A;  1QKZ A;  5H92 C;  4GMV A;  4B95 A;  1OQR A;  2N9L A;  2J42 A;  1C3T A;  1L6U A;  2WHI A;  1Z2M A;  2DX5 B;  4MM3 B;  3ZQ4 A;  3R3M A;  1P98 A;  3AEA B;  2L3Z A;  3B9J A;  1WMH A;  2D3A A;  3URY A;  3HIZ A;  2ASQ A;  4NNJ B;  3H7S A;  3PSE B;  1CJE A;  3CIR B;  3VHT C;  4N58 A;  2G9H D;  4KKJ A;  2CHZ A;  3MC9 A;  3RI7 C;  3U2S C;  3ZNI D;  1NI3 A;  2L8J A;  1JQ4 A;  1NVI D;  2KX0 A;  4WWO A;  4IM2 A;  2O6V D;  4A3O A;  5HG2 A;  3QK0 A;  5KHQ A;  4LJO B;  4BKT A;  2XBB C;  1TZ1 A;  5AZH A;  3PVL A;  3PRZ A;  1XLN A;  4II3 B;  5D2M B;  3BK1 A;  5D6J B;  3VAW A;  1P1A A;  2QIE B;  5IAA C;  2MQJ A;  1N60 A;  1OQY A;  4F1S A;  1FNW A;  2INC C;  3V60 A;  5E6J A;  4MSM B;  4URK A;  3UQA A;  1D4B A;  4HJK A;  1FXI A;  1A70 A;  3LJ3 A;  1D5X C;  2MH7 A;  3CSF A;  2YLM A;  4C80 A;  2LRW A;  2N1W A;  2DZM A;  2J0M A;  1TKE A;  3AV8 A;  1RM6 C;  1X1M A;  3NVV A;  2PPH A;  5BYR A;  4GXB A;  4M00 A;  4HK2 A;  4US8 A;  1N61 A;  3L4P A;  5BMI A;  1EO6 A;  2WXH A;  4ZRK A;  3UIP B;  3ZO5 B;  1IYF A;  4GN1 A;  3HVD A;  3NS8 A;  4EUT A;  4FN2 A;  4ANV A;  4WJP A;  1XLQ A;  2WGS A;  3DBL I;  1ZXH A;  2ZW1 A;  1N5W A;  2LD9 A;  3IBE A;  3ZIM A;  2G3Q B;  4B6W A;  4YSZ B;  1B1Z A;  2PVO D;  4W9J A;  2BYF A;  2VZK B;  4MJS B;  2D5G A;  3EFC A;  4LLG M;  2Z59 B;  1MHH E;  1OTR B;  3A4R A;  5T8I A;  4Q2J A;  5LXI B;  3NVY A;  3R7R A;  4JPS A;  2K5P A;  4FLH A;  1WXQ A;  2WDQ B;  5L95 C;  3X0W A;  2MP2 A;  4DHJ B;  1B9R A;  4GU2 A;  1TIF A;  4P16 A;  3EFU A;  4HCN B;  3AEF B;  2RD0 A;  2WXO A;  5FKA C;  1FRR A;  4GGQ A;  2GBR A;  1P9D U;  3C0R B;  3OLM D;  2VZK D;  2W54 A;  2LHD A;  3PRM B;  1FFV A;  4TQ1 A;  4JE3 B;  3W5U B;  4NZL B;  1FIQ A;  1IBX B;  2J53 A;  4WJQ A;  4GLS C;  1ZXI A;  2BF8 B;  4DHJ D;  1MG4 A;  2CR5 A;  3RUL A;  3VRA B;  2RDH A;  2LXC A;  5BYS A;  2OED A;  2MW5 A;  2WXK A;  4A8X C;  2QCZ A;  2JY6 A;  4EZL A;  3LXF A;  2LJI A;  3K9P B;  1WMH B;  3QJZ A;  1I4G A;  3W1S A;  1J7A A;  1STE A;  3AEB B;  2KTR A;  5DPT A;  1ET6 A;  1UH6 A;  5G5H A;  4KZ0 A;  3AM9 A;  3PHW B;  4OHJ A;  1ZP0 B;  2K25 A;  2V3S A;  4LCD E;  3NS1 A;  1VD2 A;  2FCQ A;  2Z0E B;  5AEK B;  2IND C;  1XQQ A;  4CHK A;  3ZJU A;  1JWA D;  3IT6 B;  1I4Q A;  2N9E B;  3PRP B;  2WXN A;  2J0K A;  2ON8 A;  4W9L A;  3QQ8 B;  2KMM A;  4ZRI A;  1ACC A;  4F8C B;  4EE2 A;  2BS3 B;  2WX0 A;  5EE3 A;  3APF A;  5EE1 A;  4W9E A;  2K22 A;  4PS7 A;  1MG8 A;  2ZZP B;  4HPM B;  2IJ0 A;  3R2T A;  4WAA A;  2KDE B;  2JUO A;  1WFY A;  1UWX A;  4A20 A;  5E6N A;  2XK5 A;  3VTW A;  1C76 A;  1GC7 A;  2WU5 B;  1K51 A;  1TKY A;  3RT3 B;  4C56 C;  2CJN A;  2PIA A;  1YIW A;  3FKY A;  4ACF A;  4EZJ A;  1SB3 C;  1SE4 A;  1UGM A;  3AE8 B;  4JX1 C;  3MJ5 A;  2JXT A;  2FBW B;  3DPD A;  4W9D A;  1WZ3 A;  3TSS A;  5CHW A;  4IC7 B;  1K52 A;  5CHF A;  5D7G A;  2JF5 A;  2JVC A;  4KSK C;  4DWF A;  4W9F A;  1RLF A;  3C8Y A;  2LXA A;  2I1K A;  4TV3 A;  4BKS A;  4KKI A;  1IP9 A;  3H1U A;  1KF6 B;  2K0P A;  3KW5 B;  3HUI A;  1H8C A;  4RM9 A;  3TUO A;  4FUL A;  2IBI B;  1RFA A;  2MP2 B;  2M19 A;  3AI5 A;  4KIK A;  4WAF A;  2GBJ A;  1MVK A;  1WXM A;  2MBE A;  2W3S A;  2JZP A;  2L1A A;  4PS8 A;  4IOI E;  2LUE A;  2JU6 X;  2KAJ A;  2PEA A;  4IWO A;  3I9V 1;  1CZP A;  1JW9 D;  1JWB D;  2KKC A;  3RNC C;  3Q8E A;  2IY1 B;  2LFI A;  3TEY A;  3O65 B;  1ZKH A;  1I4H A;  3L16 A;  1UEL A;  4LTU A;  3W2D A;  5KHO A;  3VUX A;  1FCL A;  1V6E A;  3RNF C;  3RZW C;  1WJN A;  2N7J A;  1V5T A;  3APC A;  1WWT A;  4RNA A;  3EC8 A;  2QJL A;  3AUL A;  4YXD B;  3D32 A;  1V80 A;  3TMP B;  4AJW A;  2UYZ B;  1YJJ A;  2M8S A;  3UIO B;  2KTR B;  2KQS A;  2LGY A;  1QT9 A;  2GBN A;  4FJZ A;  1U4A A;  3M95 A;  3HVZ A;  3ZGZ A;  1WM2 A;  1GOZ A;  2O6V A;  2G45 B;  4HRO A;  1HZ6 A;  1XF5 L;  3CMM B;  3PLU A;  2VH2 A;  1TT5 B;  1JWS D;  1S1Q B;  1VJK A;  2IGG A;  2RPV A;  1LXD A;  3VTV A;  4WIP A;  4OZA A;  3ZTD A;  1YQ3 B;  3Q14 C;  3WCQ A;  1C1Y B;  2MBO A;  3SFE B;  5CX3 A;  4AJY B;  5CHV C;  4K81 A;  2LEK A;  4TMA B;  3V05 A;  1WGY A;  2NVU I;  3H7P A;  2AL6 A;  2AWT A;  1DOX A;  2BB5 A;  1R7S A;  2FID A;  3H9D A;  3OJ4 B;  1WRD B;  4IWQ A;  2KDM A;  1UGJ A;  1RFK A;  1SGH A;  3V62 A;  1SIJ A;  1SBB B;  2M4N A;  2KZR A;  2K8H A;  2MJ3 A;  1EWC A;  1H4R A;  2XK5 B;  3ZKJ C;  1PGA A;  3AEC B;  3Q3J A;  3U8Z A;  4YL8 A;  2QMT A;  3Q3N C;  1QOA A;  3PRE A;  1FPY A;  4LJP B;  2YEP B;  1MPE A;  3FC4 A;  3NZS A;  3U30 A;  3PZ7 A;  2IPK D;  3DVG Y;  2KN4 A;  3RUI B;  2MCN B;  4DK5 A;  2KJH B;  5GMV A;  2AQ2 B;  2JRI B;  2KQ7 A;  3P2B A;  4ICV A;  1HA5 A;  2JWU A;  5LLI A;  5C23 A;  1VRA B;  3GE8 C;  2W82 A;  4LNN A;  5G2N A;  2CHX A;  2ZW0 A;  4WUR A;  5JH5 C;  3N3K B;  3A9K A;  1HTO A;  2MBB B;  4RF1 A;  2R61 A;  5HI1 A;  1R4M B;  2Q5W D;  2M0X A;  2QHO A;  4KIK B;  3R8B A;  3MC0 B;  4AS1 A;  2N7E A;  2VH1 A;  2DNF A;  4EOY A;  2JZ3 B;  2CU1 A;  4JLC A;  1E7P B;  2BQQ A;  3DHH C;  3AN1 A;  1YJI A;  1F2R C;  2GI9 A;  3A33 B;  4II2 B;  4BKS D;  2V3P A;  2X38 A;  1SE2 A;  1WH3 A;  4XC2 A;  2KN5 A;  2W55 A;  1E10 A;  2ZCB A;  3DBH B;  3FAH A;  2WXF A;  1F0Z A;  5DPS A;  2ZVN A;  3BVM A;  5GXG B;  1L0V B;  2V0G A;  2C60 A;  4OZC A;  1ZGU B;  4HRS A;  4BFR A;  1WYG A;  5D3I B;  3B2G A;  1CQV A;  4JWU C;  4ZYN A;  1WX9 A;  3M62 B;  3DWM A;  4ARC A;  1BT0 A;  2WP9 B;  3V6C B;  2BWF A;  3DQV A;  2CJO A;  1YOV B;  5HHD G;  2KMA A;  2O6V B;  1L0X B;  4KGS A;  3Q8F A;  2HTM E;  1UD7 A;  4MEM A;  1GG3 A;  3S2A A;  4XWW A;  3IHP C;  4ANW A;  2IGD A;  3ZXR A;  1QQR A;  4XGA B;  2WWZ A;  2MWS B;  2Y3A A;  3DHI C;  5EE9 A;  2AQ1 B;  3VR8 B;  4WWP A;  3GS2 A;  1WX8 A;  3VR9 B;  2WXI A;  3SDL C;  5HFY A;  3VTU A;  3EHV A;  2ONQ A;  4I6L B;  3H7P B;  2DYM A;  2M17 A;  3UIN B;  2V1Y A;  2WXR A;  4XYC A;  3UQB A;  3RPF C;  4QAY A;  2LZ6 A;  1J8C A;  2DYO A;  3IG3 A;  1SJE D;  1V9J A;  1D6E C;  3TEX A;  1EUV B;  2NBU A;  2BYV E;  4HKZ E;  1T0S C;  1KOT A;  3AE1 B;  2MJD A;  3PLV A;  3L10 B;  2NPT A;  3WAP A;  3V61 A;  1N63 A;  3AE9 B;  2AL3 A;  1E5W A;  1XCQ L;  4NJC A;  5C3J B;  2HE7 A;  5C1Z A;  2WXM A;  3ABV B;  1KFY B;  1FFU A;  1CK1 A;  1XD3 B;  4ZOH C;  3PPA A;  2J0J A;  3IAM 1;  2V9H A;  1EU4 A;  4DDI D;  4IW0 A;  4WWM A;  1M94 A;  2I2Y A;  1NYR A;  3NRZ A;  1IGC A;  3NY5 A;  1TTN A;  2L0F A;  3L08 A;  3C19 A;  2C5L C;  4NPN A;  1WGR A;  2IZV B;  2WQY B;  4W9G A;  4X57 B;  1T0Y A;  1YD8 U;  3A9K B;  3ZRC A;  4KZC A;  2GRI A;  1KLG D;  2KLG A;  2ZEQ A;  3RZF A;  1EWY C;  3LYY A;  4LNK A;  2ZNV B;  4D2K A;  1D3Z A;  3MP9 A;  1ZOY B;  4XDC A;  2G4D B;  4PYU A;  4FBJ B;  3UGB B;  1ZDX A;  2NMQ A;  1SJH D;  1FEH A;  2KFK B;  4GDK A;  1VZ6 A;  4YTP B;  2AYO B;  2FAZ A;  4IM0 A;  1L0Y B;  3CWI A;  1E8W A;  4ZRP A;  2XN9 C;  4K7W A;  2KX3 A;  2KJ6 A;  4J3O D;  3JSV B;  2K1F A;  2Y5C A;  2XNA C;  3GZN I;  5IO9 A;  4KGT A;  1JRP A;  1RYJ A;  4LNI A;  3AEG B;  3NUH B;  1L6V A;  3HK0 A;  5LXH A;  2J7Q B;  1Q1O A;  2KOX A;  3QAR A;  4OVV A;  1T0R C;  3U52 E;  2D3B A;  4MH0 E;  3ZTC A;  4MT5 A;  3DBS A;  4CQN A;  1E6E B;  2MRP A;  1WYW B;  3EGR A;  2MBH A;  2CS4 A;  3P4Q B;  2DZK A;  2MX2 A;  3BVZ A;  1UBI A;  1WR6 E;  2H89 B;  2DAF A;  4MGZ E;  4DBG A;  4O1N A;  4XX5 A;  2QC8 A;  3UI3 A;  2UWQ A;  3P63 A;  4FJY A;  2HDE A;  2RGF A;  4DDG D;  3B08 A;  5LNK 1;  2DEN B;  3P4S B;  1GAQ B;  1YN5 A;  1VZ7 A;  2N7D A;  3QIJ A;  1T0Q C;  4ZYS A;  2NTT A;  4FJV B;  3SU8 X;  1PDX A;  1AYF A;  3TJP A;  2GBM A;  4B0M A;  1GB4 A;  1I35 A;  3NVZ A;  5G55 A;  3I57 A;  4RF0 A;  2QEJ C;  3DBL B;  4M8N A;  1R4N I;  3AE7 B;  3L13 A;  4XWT A;  3BK2 A;  2GOW A;  2D07 B;  4H2A A;  4YT0 B;  1YJ1 A;  4JWS C;  1XLO A;  1P3Q U;  1UWM A;  3PGE A;  4C7Y A;  4B9K A;  1QOB A;  3RYT A;  2NPT B;  1F1H A;  2KQ4 X;  3I3T B;  5C2T B;  2KNB A;  4C4V A;  1WX7 A;  3KWL A;  2JXX A;  1WJ4 A;  5G5G A;  2J4X A;  3E9S A;  4EEW A;  1UBQ A;  4E71 A;  4RGN A;  4P1C C;  3KUD B;  4HWI B;  3BII D;  1AWD A;  4P1B C;  1SE3 A;  3PV1 A;  2C7H A;  2WLB A;  4G11 A;  4K3C A;  1NEN B;  1F77 A;  1HXY D;  1UNS A;  4L23 A;  2OJR A;  4C7Z A;  2L83 A;  1GUA B;  3Q2A C;  2K6D B;  2PKO A;  1SEB D;  1V97 A;  4BKG A;  1GC6 A;  2WDV B;  3JW0 X;  2MEK A;  3TL5 A;  1E0Z A;  1C4A A;  2R2Q A;  5FR3 A;  2W3R A;  2WXP A;  5IN7 A;  2V4L A;  2LGI A;  3VXW A;  2CKH B;  4GDK B;  1E8Y A;  4ITK A;  2M1M A;  2LMC A;  4FXC A;  3V3X A;  3W1S C;  4GB9 A;  3P42 A;  2N0S B;  3B0A A;  4WQO B;  3EEC A;  2N9X A;  1Q0W B;  3NVW A;  3ZYY X;  3OG5 A;  1RWS A;  1OFF A;  3KVF B;  4KV2 A;  4HVB A;  4MGY E;  3R2I A;  1OEY J;  4GOC A;  1J19 A;  1HQR D;  1FRD A;  3QAQ A;  1NDD A;  3QC8 B;  2BPS A;  2ZCC A;  3P4P B;  2GMI C;  3X23 A;  1KLV A;  2CHW A;  3BY4 B;  1IGD A;  1G6J A;  1KJT A;  4MAC A;  4US9 A;  5EDS A;  4KDL B;  4I6N B;  3L0W B;  4PYZ A;  2W9N A;  2IO0 B;  3SHQ A;  2Y5P A;  2BWE S;  2N1V A;  1K53 A;  3KH0 A;  4PS3 A;  3KUC B;  4LK0 M;  2BTE A;  1E8X A;  1TBE A;  1GJZ A;  4BZA A;  5FK9 C;  1V1P A;  3O13 A;  2KT7 A;  2K9X A;  2FUG 1;  3HRD D;  1PGX A;  1XXG A;  4NJ7 A;  1N5X A;  3ENE A;  3PT2 B;  2PLP A;  2NR2 A;  1VDV A;  3M63 B;  2D3C A;  2I1J A;  2OJW A;  3MTN B;  2EKI A;  4KVG B;  1V49 A;  4AP4 C;  2WS3 B;  3V6E B;  3SD5 A;  2A5U A;  1JRO A;  4NAW A;  2BBC A;  2JPH A;  2NS5 A;  4HDO A;  5JZE B;  4MGK E;  1CMX B;  4R3D A;  5J18 A;  3A1Q A;  2LGS A;  5E6P A;  3VH3 B;  4NJ6 A;  4P7I A;  1F52 A;  3ML8 A;  4TSS A;  2MHJ A;  3ZNH B;  1L5P A;  4C4V B;  3PS6 A;  2IDY A;  4G3X B;  1LO5 D;  5FR6 A;  4ZDV A;  2EMT A;  2MSE D;  1WGG A;  4IDI A;  3KYC D;  3Q69 A;  2KWD A;  3AU5 A;  1ROE A;  1WGD A;  1WXA A;  4M0W A;  3N1Z C;  2TSS A;  4USA A;  3IT4 B;  5IA7 A;  3JYU A;  3NJT A;  3QCA A;  3KWV A;  4G0N B;  5AZG A;  2WXJ A;  2RPQ A;  4OW0 A;  1ZE3 D;  3WAN A;  2J52 A;  1Y8R C;  2KYW A;  2Z0D B;  3KYD D;  1KM7 A;  2FUH B;  1N62 A;  1TS5 A;  1QIL A;  1S3S G;  4TQ0 A;  2L32 A;  3AB5 A;  2WXQ A;  1QOG A;  3T8M A;  1L7Y A;  1F2R I;  3I63 C;  4CO7 A;  3NZ3 A;  2RR9 A;  1AAR A;  1E8Z A;  1WE7 A;  1DYQ A;  1GB1 A;  4DQO C;  3KQ4 A;  4BVU C;  1E9M A;  2MA9 B;  1WJ6 A;  3M3J A;  3WIM A;  4BBN C;  1TGZ B;  4RGM A;  4F7Z A;  2C7M B;  2QIL A;  2WDT B;  2PTL A;  1TS3 A;  1XT9 B;  4E74 A;  2FCS A;  4HJG E;  4MEL A;  3PHX B;  1WF9 A;  1ET9 A;  4WH4 A;  1TY2 A;  3R7Q A;  4WWN A;  2IY0 B;  4LNO A;  4HEA 1;  1HEZ E;  2KFK A;  3AE3 B;  1WXS A;  4TKN A;  2WXL A;  4MDK E;  2M56 B;  3IAS 1;  3FIL A;  5J2R A;  3T3O A;  2PMV A;  1ZW7 A;  4HXD A;  2FIF A;  3ECI A;  2X8X X;  3NOB A;  5EE0 A;  2LJ5 A;  1PQS A;  3GP7 A;  1V86 A;  3JSV A;  2KVR A;  2GLS A;  1T5X D;  4OVZ A;  2K8B A;  4W9I A;  2B76 B;  3VQI A;  3ZUN A;  1MFW A;  1I4X A;  2KC1 A;  1M4V A;  1TZO A;  1C4P A;  2WXG A;  1DOI A;  2IO3 B;  1V1O A;  2WX1 A;  1XCT L;  1Y56 A;  4IKG A;  1OGW A;  1V1P B;  4FHK A;  2DBY A;  4YSY B;  1T6B X;  4DHZ B;  4ZHO A;  5BO4 B;  1P7F A;  2BB6 A;  3Q3M C;  4AQ7 A;  4N9F 4;  2IGH A;  3TIX A;  1DOY A;  2BT6 A;  3DDC B;  3UF8 A;  3JVZ X;  3GB1 A;  4NAW B;  4XE0 A;  1JWU D;  2BVC A;  3J9C A;  5I4D A;  3MHZ A;  2AX5 A;  4AWJ A;  4C00 A;  5E6O A;  1OQQ A;  3A1Q B;  1PGB A;  3NHE B;  4MH8 A;  3DVN U;  3BWU D;  1NBF C;  2RDB C;  2XEW A;  3Q3O C;  2L76 A;  2EEL A;  3KUZ A;  2K8C A;  2FCN A;  1FXT B;  1TS2 A;  3AH7 A;  5TR5 A;  1KLU D;  2DWQ A;  4RCO A;  5DPW A;  1N6Z A;  4ICU A;  2PE6 B;  4LNF A;  5J17 A;  3T9L A;  3BZD B;  3WAL A;  4E3C A;  1I4P A;  4WJN A;  4K1R B;  4DXF A;  4ZRJ A;  2NBW B;  4M0W B;  3B2F A;  3CF6 E;  1XLP A;  3MJW A;  4RH6 A;  1YMH E;  1YX5 B;  2WYQ A;  2ZNV C;  1PYW D;  4L1B A;  4OZB A;  3L17 A;  3Q6B A;  2O2V A;  1V5O A;  1AW7 A;  2H88 B;  4ANX A;  2KK8 A;  2PW9 A;  4CYE A;  1T3Q A;  2N9K A;  1WY8 A;  4BOS C;  5IKC M;  1TYG B;  4N59 A;  3W5V B;  3AE4 B;  1E7V A;  1WIA A;  4ANU A;  5HKH A;  2WNM A;  3Q8C A;  3AED B;  4ZHP A;  2D3G A;  2LHE A;  4HLE A;  1C77 A;  4JL9 A;  3MHS D;  4RFB A;  5JHA A;  1EF1 A;  1V8C A;  2INP E;  3A9J A;  3ONS A;  2JT4 B;  3AXC A;  4YTN B;  1AN8 A;  1SXT A;  2Y5B B;  4AOF A;  5AUK A;  3EA6 A;  3QHT A;  5JHB A;  2LVO A;  4IWP A;  2QDF A;  2IO1 B;  1GNU A;  2YEP F;  2KAN A;  3VRB B;  1FMA D;  2G4S A;  1ZUD 2;  2UU7 A;  2KVZ A;  3PTF C;  3NG0 A;  4KSL C;  4WQM A;  3AMZ A;  4BAX A;  1D5M C;  4K3B A;  1Z5S B;  5MPO A;  3FIL B;  1FO4 A;  2V4I B;  1WXV A;  4IM3 A;  5BYQ A;  4RGT A;  2V3N A;  2JQR B;  2LGD A;  1MJD A;  2E3T A;  1ZDV A;  3RNB C;  2BW2 A;  4P6V F;  2N9P C;  1FCC C;  2JWZ A;  4FA6 A;  4HKQ A;  2DLB A;  1TKG A;  4OVU A;  4GIV A;  1KRH A;  4N6E B;  1FM0 D;  3U4E G;  1HE8 A;  5D94 A;  2D2Q A;  2KDF B;  2PJH A;  2K39 A;  1C4C A;  2JZZ A;  3Q8B A;  3ZW3 A;  2LVP A;  2BS4 B;  2FCM A;  2KJR A;  2REX A;  4NQK E;  2JYE A;  1I42 A;  4NAM A;  2K6Q A;  1UF0 A;  1UUP A;  2D10 A;  3HHM A;  1V81 A;  1MI0 A;  2CU3 A;  4GDL A;  2BYT A;  3W1Y A;  3ZLZ A;  3N30 A;  3DBR I;  4EZK A;  2AEH A;  2E6X A;  3NZU A;  2OOB B;  2M0A A;  4DXG A;  2VRR B;  1DGJ A;  4BBN F;  2B3A A;  3ZNG C;  1HTQ A;  1KH0 A;  1WI0 A;  3AE5 B;  2INN E;  4A3P A;  4NY0 A;  1YQB A;  3VDZ A;  4RM8 A;  3ZJT A;  4B0E A;  4W9C A;  3P4R B;  1WR1 A;  2DYB A;  4PT5 A;  3WAM A;  1SF0 A;  2KHW B;  3QA8 A;  1L4Z B;  4MSQ B;  5L83 A;  2K3U A;  3RFZ B;  2O2V B;  4YWG G;  2R2O A;  2D11 A;  1I7H A;  1GPX A;  4FHJ A;  1C79 A;  5CTR C;  1YQ4 B;  1VR9 A;  4YTM B;  5H8Y E;  2IO2 B;  4K7S A;  2RMM A;  1OEY A;  3U7Z A;  5DCN A;  4KDI C;  4ZRQ A;  2JYT A;  4ASW C;  1E90 A;  3Q8A A;  4S0R A;  4W9H A;  2KMC A;  3E56 A;  1J0G A;  1D5Z C;  2EKE C;  1HZ5 A;  3RNG C;  5AUI A;  3RNA C;  3ZDT A;  3GZN B;  3HM3 A;  3N32 A;  3IFW B;  2MBQ A;  1JWM D;  1PFD A;  1WJU A;  1BUI C;  2NCN A;  3A9J B;  3H8H A;  1I4R A;  3N1Y C;  2ZJD A;  3IVF A;  2RDG A;  2HD5 B;  1P0R A;  2EMS A;  5DPR A;  1XEE A;  3LB8 C;  1E7U A;  1K8R B;  2AQ3 B;  4A9A A;  3OJ3 A;  3ZDM C;  4HDQ A;  2KWU B;  2FE8 A;  3N9Y C;  2KAC A;  2LVQ A;  2LI5 A;  3AEE B;  2I38 A;  1YX6 B;  4A6Q A;  3MFG A;  1FD6 A;  3TEW A;  1IUE A;  3PZD A;  2ZPY A;  1UZX B;  1KTK A;  2MJE A;  3IXS A;  3RN9 C;  2NBV B;  1Q5W B;  1C78 A;  3PO0 A;  3DBR B;  1PUT A;  1NI2 A;  1NEK B;  3RNE C;  4M8M A;  3BYY B;  3MC8 A;  4YSX B;  2LGX A;  3VH4 B;  2KC2 A;  1FNV A;  4PK1 A;  1WGH A;  1SIF A;  3TCA A;  2KXJ A;  3ETR A;  2A4Z A;  4I6P A;  1ISN A;  1SSN A;  4HPL B;  3W9C B;  2KTF A;  2JRH A;  4GSW A;  1XO3 A;  2LUM A;  1R4N B;  1WGK A;  3B1L X;  3EUB 2;  4J6I A;  2ZVO A;  1JCK B;  4XZ4 A;  4FAD A;  1WSP A;  2KWC A;  3TBL D;  2BKF A;  1L4D B;  2KLC A;  2WU2 B;  5IP4 D;  1YNT E;  4KGR A;  1EM7 A;  2WDR B;  3Q3F A;  3P1M A;  4GDL B;  4K7U A;  1WE6 A;  4XDD A;  1LFD A;  4UDU C;  3QWZ B;  1FXA A;  3SFD B;  3PZ8 A;  4WJO A;  3ALB A;  1R4M I;  4LDT B;  2KD0 A;  1QZE A;  2QSD A;  2OHF A;  2KDI A;  4G50 A;  3DCG A;  3KLS X;  4MM3 A;  2L0T A;  2KWV B;  3ZJV A;  2BGF A;  3SR6 A;  2N4F A;  2L05 A;  4KX6 B;  3VUY A;  3ZRF A;  3L54 A;  4BOZ B;  4IG7 B;  4A90 A;  3VVW B;  3WA0 A;  1RAX A;  4M02 A;  4W9K A;  2LRU A;  2C7N B;  2LAS A;  3H6N A;  1BXT A;  1ZPS A;  4LDT D;  1J7B A;  1NYQ A;  3DBH I;  1C9F A;  1FNU A;  1TS4 A;  3BYT B;  3TEZ A;  2HJ8 A;  1ENF A;  4HCP B;  4AUQ C;  1A5R A;  5IOI A;  4MGI E;  3R66 C;  3AE2 B;  3SEB A;  1EU3 A;  2FNJ B;  3HM6 X;  3DVN V;  3OAW A;  3ZVV A;  4EFO A;  1P7E A;  4M01 A;  2L7R A;  2MLB A;  1V2Y A;  4ARI A;  3OWE B;  1L2N A;  1BML C;  1VLB A;  4RMA A;  2SEB D;  4JQW C;  3RCZ A;  2HJ1 A;  2KDB A;  2L52 A;  3BVG A;  3RMK C;  1Q10 A;  5D3D A;  2DZI A;  1JML A;  5AZF A;  4A55 A;  2KO3 A;  1VZ8 A;  3APD A;  4JGH B;  2PVG C;  2NTS A;  4DHZ E;  2C9W B;  4DXA B;  2DZJ A;  2BKR B;  3T3N A;  3DOW A;  5BMG A;  2JSV X;  5BMH A;  4HPP A;  2Z8L A;  5JXV A;  1LGR A;  3AE6 B;  1TY0 A;  3N1X C;  1JRU A;  2ZPN A;  3N20 C;  1F9J A;  1QOF A;  2ICI A;  2KFJ A;  1VCB A;  2BYE A;  1EF5 A;  3DVG X;  1WM3 A;  4TUU A;  1QF6 A;  1MHX A;  1IPG A;  4NQL B;  1K50 A; 
#chains in the Genus database with same CATH homology
 3A4S C;  3VUX A;  1V6E A;  2YVC A;  5G55 A;  1E7V A;  1WIA A;  4IUM B;  3RZW C;  1WJN A;  4ANU A;  5HKH A;  2PE9 A;  4MJS A;  4M8N A;  1R4N I;  1V5T A;  2GBK A;  3APC A;  2D3G A;  3EC8 A;  3L13 A;  3GOE A;  3BIN A;  2GOW A;  2D07 B;  3AUL A;  1RRB A;  1YJ1 A;  3D32 A;  4HLE A;  3ZNZ B;  1P3Q U;  1V80 A;  4JL9 A;  3TMP B;  4AJW A;  2UYZ B;  3MHS D;  2M8S A;  3PGE A;  4B9K A;  1LQB A;  5JHA A;  3UIO B;  1EF1 A;  3RD2 A;  2DAJ A;  2KTR B;  3RYT A;  3A9J A;  2NPT B;  3ONS A;  2KQS A;  2LGY A;  2RSU A;  3I3T B;  2GBN A;  2JT4 B;  1U4A A;  3AXC A;  4FJZ A;  2LWP A;  2KNB A;  3M95 A;  2Y5B B;  4AOF A;  1WM2 A;  2O6V A;  1WX7 A;  2G45 B;  2JXX A;  1WJ4 A;  3QHT A;  5JHB A;  3CMM B;  3PLU A;  2LVO A;  3K9O B;  4EEW A;  4IWP A;  4EKU A;  2IO1 B;  2HTH A;  1UBQ A;  1S1Q B;  1GNU A;  2DHZ A;  2IYD B;  2KAN A;  1LM8 B;  4E71 A;  3ML9 A;  3KUD B;  2G4S A;  2L00 B;  4HWI B;  1LXD A;  3PTF C;  3VTV A;  3PV1 A;  2C7H A;  4G11 A;  4KSL C;  3VFK A;  3LDZ E;  3AU4 A;  3VUW A;  1WZ0 A;  3CST A;  3ZTD A;  1Z5S B;  3U7D A;  1SE9 A;  1C1Y B;  2MBO A;  3QX1 A;  5CX3 A;  4AJY B;  5CHV C;  2OJR A;  4K81 A;  4JIO U;  3WAO A;  1WXV A;  1WGY A;  4IM3 A;  4GMV A;  4B95 A;  2NVU I;  1GUA B;  3H7P A;  4DBG A;  1C3T A;  2AL6 A;  2K6D B;  2AWT A;  1Z2M A;  2LGD A;  2FID A;  2DX5 B;  3H9D A;  3OJ4 B;  3R3M A;  1P98 A;  1WRD B;  4IWQ A;  4BKG A;  1SGH A;  2L3Z A;  3V62 A;  1GC6 A;  2N9P C;  1WMH A;  2JWZ A;  3JW0 X;  3HIZ A;  4FA6 A;  2ASQ A;  2KZR A;  2K8H A;  2M4N A;  3TL5 A;  4NNJ B;  2R2Q A;  3H7S A;  1H4R A;  3PSE B;  2XK5 B;  4OVU A;  4GIV A;  4WJO A;  3VHT C;  3ZKJ C;  1HE8 A;  5D94 A;  2V4L A;  2D2Q A;  2KDF B;  3VXW A;  2CKH B;  2PJH A;  3Q3J A;  4GDK B;  2K39 A;  4YL8 A;  3U8Z A;  1E8Y A;  2CHZ A;  3PRE A;  2M1M A;  2JZZ A;  3ZW3 A;  4LJP B;  3W1S C;  4GB9 A;  2LVP A;  3B0A A;  4WQO B;  3EEC A;  3ZNI D;  2FCM A;  3NZS A;  2KJR A;  3U30 A;  2N9X A;  2L8J A;  2REX A;  4NQK E;  1I42 A;  1Q0W B;  2KX0 A;  2K6Q A;  4WWO A;  3DVG Y;  2D10 A;  4HVB A;  3KVF B;  3HHM A;  4IM2 A;  1V81 A;  4KV2 A;  2MCN B;  2O6V D;  3RUI B;  2KJH B;  4A3O A;  4DK5 A;  5GMV A;  4GDL A;  3QK0 A;  4MGY E;  3W1Y A;  4LJO B;  5KHQ A;  4BKT A;  1OEY J;  2XBB C;  1TZ1 A;  3N30 A;  4GOC A;  5AZH A;  3ZLZ A;  3PVL A;  2JRI B;  1J19 A;  2KQ7 A;  3DBR I;  2AEH A;  3PRZ A;  3QAQ A;  3NZU A;  3P2B A;  4EZK A;  4II3 B;  2OOB B;  4ICV A;  1NDD A;  5D2M B;  5D6J B;  3VAW A;  1P1A A;  3QC8 B;  2BPS A;  2ZCC A;  5LLI A;  5C23 A;  2VRR B;  5IAA C;  4BBN F;  2B3A A;  3ZNG C;  2GMI C;  3X23 A;  1KLV A;  2CHW A;  2MQJ A;  3BY4 B;  1OQY A;  5G2N A;  1WI0 A;  1G6J A;  4F1S A;  2CHX A;  1KJT A;  4A3P A;  5EDS A;  4KDL B;  5JH5 C;  3N3K B;  4NY0 A;  3A9K A;  1YQB A;  2MBB B;  3VDZ A;  4RM8 A;  4I6N B;  3V60 A;  4W9C A;  3L0W B;  4PYZ A;  1WR1 A;  2W9N A;  2IO0 B;  2M0X A;  2QHO A;  4MSM B;  2BWE S;  2DYB A;  2N1V A;  4KIK B;  3SHQ A;  4URK A;  4HJK A;  3KH0 A;  4PS3 A;  3KUC B;  3LJ3 A;  3CSF A;  2YLM A;  1E8X A;  1TBE A;  3WAM A;  2LRW A;  2N7E A;  2N1W A;  1GJZ A;  2DZM A;  2J0M A;  1X1M A;  2KHW B;  2PPH A;  4GXB A;  3QA8 A;  4HK2 A;  4MSQ B;  4EOY A;  2JZ3 B;  2CU1 A;  4JLC A;  5L83 A;  1EO6 A;  4NJ7 A;  4ZRK A;  3ENE A;  3PT2 B;  3UIP B;  3ZO5 B;  1IYF A;  2O2V B;  2R2O A;  4GN1 A;  2NR2 A;  3A33 B;  3NS8 A;  2D11 A;  4II2 B;  4BKS D;  3M63 B;  4EUT A;  2I1J A;  3MTN B;  4FN2 A;  4FHJ A;  5CTR C;  4KVG B;  4ANV A;  1V49 A;  1WH3 A;  4WJP A;  4XC2 A;  4AP4 C;  3DBL I;  2KN5 A;  3V6E B;  3SD5 A;  2IO2 B;  4K7S A;  2LD9 A;  2ZCB A;  2A5U A;  1OEY A;  4NAW A;  5DPS A;  2JPH A;  2NS5 A;  2ZVN A;  3IBE A;  4HDO A;  4KDI C;  5DCN A;  3ZIM A;  2G3Q B;  2C60 A;  4ASW C;  4B6W A;  5JZE B;  1E90 A;  4W9J A;  4MGK E;  4W9H A;  1CMX B;  2BYF A;  2KMC A;  5J18 A;  1J0G A;  2EKE C;  1ZGU B;  4MJS B;  2Z59 B;  3A1Q A;  4BFR A;  4DXA B;  3ZDT A;  3HM3 A;  1OTR B;  3A4R A;  5E6P A;  3VH3 B;  3N32 A;  3IFW B;  2MBQ A;  4ZYN A;  5LXI B;  1WX9 A;  3R7R A;  3M62 B;  4NJ6 A;  4P7I A;  4FLH A;  1BT0 A;  1WJU A;  3V6C B;  2NCN A;  3ML8 A;  3A9J B;  2BWF A;  5L95 C;  3DQV A;  3X0W A;  3ZNH B;  2ZJD A;  3IVF A;  2MP2 A;  2HD5 B;  2KMA A;  2O6V B;  3PS6 A;  1P0R A;  4DHJ B;  4G3X B;  4GU2 A;  5FR6 A;  4ZDV A;  2EMT A;  2EMS A;  5DPR A;  3EFU A;  4HCN B;  2RD0 A;  1E7U A;  2MSE D;  1WGG A;  1K8R B;  4GGQ A;  3KYC D;  2GBR A;  1P9D U;  3AU5 A;  1UD7 A;  3C0R B;  3OJ3 A;  3OLM D;  1WGD A;  2KWU B;  4HDQ A;  4MEM A;  3ZDM C;  1WXA A;  2LVQ A;  1GG3 A;  3S2A A;  2LI5 A;  3IHP C;  4ANW A;  3PRM B;  4TQ1 A;  1YX6 B;  2WWZ A;  5IA7 A;  3JYU A;  3QCA A;  3PZD A;  2MWS B;  4G0N B;  5AZG A;  2ZPY A;  2RPQ A;  4WWP A;  1UZX B;  3WAN A;  1Y8R C;  2Z0D B;  3KYD D;  1WX8 A;  2NBV B;  1Q5W B;  1KM7 A;  2FUH B;  3SDL C;  4WJQ A;  3EHV A;  3VTU A;  1S3S G;  3H7P B;  4I6L B;  2DYM A;  4TQ0 A;  2M17 A;  2BF8 B;  4DHJ D;  3UIN B;  1NI2 A;  2CR5 A;  2V1Y A;  4M8M A;  3T8M A;  1L7Y A;  3RUL A;  3UQB A;  2LGX A;  2LXC A;  3VH4 B;  2KC2 A;  2MW5 A;  2LZ6 A;  1WGH A;  1J8C A;  2JY6 A;  4CO7 A;  1SIF A;  4EZL A;  3TCA A;  2DYO A;  2KXJ A;  1AAR A;  2RR9 A;  3IG3 A;  2A4Z A;  1WMH B;  3K9P B;  1E8Z A;  1V9J A;  3QJZ A;  4I6P A;  1WE7 A;  1ISN A;  4BVU C;  4HPL B;  2MA9 B;  1EUV B;  3W1S A;  1WJ6 A;  3M3J A;  3WIM A;  2KTF A;  2NBU A;  2BYV E;  4BBN C;  1TGZ B;  2JRH A;  4F7Z A;  1KOT A;  2C7M B;  2WDT B;  4GSW A;  3PLV A;  3B1L X;  2KTR A;  3L10 B;  4J6I A;  2ZVO A;  5DPT A;  2NPT A;  1UH6 A;  3WAP A;  4XZ4 A;  3V61 A;  4FAD A;  4KZ0 A;  3PHW B;  2KWC A;  1XT9 B;  4E74 A;  3TBL D;  2FCS A;  2K25 A;  2AL3 A;  2V3S A;  4LCD E;  1E5W A;  2BKF A;  4MEL A;  3PHX B;  2KLC A;  1VD2 A;  1WF9 A;  2FCQ A;  2HE7 A;  3R7Q A;  4WWN A;  2Z0E B;  5C1Z A;  2IY0 B;  3Q3F A;  5AEK B;  1XD3 B;  1XQQ A;  4GDL B;  4CHK A;  4K7U A;  1WE6 A;  3PPA A;  2KFK A;  1WXS A;  2J0J A;  4TKN A;  4MDK E;  1LFD A;  5J2R A;  2N9E B;  4DDI D;  4IW0 A;  3QWZ B;  1ZW7 A;  1M94 A;  3PRP B;  2FIF A;  4HXD A;  3ECI A;  2J0K A;  3NOB A;  2LJ5 A;  3NY5 A;  3ALB A;  4W9L A;  1R4M I;  2L0F A;  1PQS A;  1TTN A;  1V86 A;  2KD0 A;  3JSV A;  2KVR A;  3L08 A;  1QZE A;  3QQ8 B;  2C5L C;  4LDT B;  4NPN A;  1WGR A;  4F8C B;  2IZV B;  2KDI A;  4W9G A;  2K8B A;  4W9I A;  4X57 B;  1T0Y A;  3VQI A;  4G50 A;  3ZUN A;  1YD8 U;  2WX0 A;  3DCG A;  2KC1 A;  3APF A;  3A9K B;  3ZRC A;  4W9E A;  4MM3 A;  4KZC A;  4PS7 A;  1MG8 A;  2ZZP B;  2L0T A;  2KWV B;  4HPM B;  2BGF A;  4WAA A;  2KDE B;  2JUO A;  2KLG A;  2IO3 B;  2ZEQ A;  3RZF A;  2N4F A;  1WFY A;  2L05 A;  2WX1 A;  2ZNV B;  3VUY A;  3ZRF A;  4A20 A;  3L54 A;  4BOZ B;  4IG7 B;  1D3Z A;  1OGW A;  5E6N A;  4FHK A;  2XK5 A;  3VTW A;  3VVW B;  3WA0 A;  1RAX A;  4W9K A;  2G4D B;  4PYU A;  2LRU A;  5DPW A;  1GC7 A;  3UGB B;  4FBJ B;  4DHZ B;  2C7N B;  2LAS A;  2KFK B;  4GDK A;  5BO4 B;  3RT3 B;  3H6N A;  2AYO B;  4LDT D;  1YIW A;  2FAZ A;  3DBH I;  4IM0 A;  4EZJ A;  1E8W A;  2HJ8 A;  4HCP B;  4N9F 4;  4AUQ C;  1A5R A;  3TIX A;  4K7W A;  2KX3 A;  3UQA A;  4MGI E;  2KJ6 A;  1UGM A;  3R66 C;  3JSV B;  2K1F A;  3DDC B;  3UF8 A;  3JVZ X;  2FNJ B;  3GZN I;  4NAW B;  3HM6 X;  3DVN V;  3DPD A;  3OAW A;  4W9D A;  3ZVV A;  1WZ3 A;  4EFO A;  5CHW A;  4AWJ A;  2L7R A;  2MLB A;  4IC7 B;  1V2Y A;  3HK0 A;  5LXH A;  5E6O A;  3A1Q B;  3NHE B;  5CHF A;  2J7Q B;  1Q1O A;  2KOX A;  3QAR A;  5D7G A;  1L2N A;  3DVN U;  4RMA A;  2JF5 A;  2JVC A;  4OVV A;  4KSK C;  4JQW C;  3RCZ A;  1NBF C;  4DWF A;  4W9F A;  2XEW A;  1RLF A;  2KDB A;  2L76 A;  2LXA A;  4MH0 E;  3ZTC A;  2I1K A;  3KUZ A;  2K8C A;  3DBS A;  4TV3 A;  5KHO A;  2DZI A;  4BKS A;  5AZF A;  2FCN A;  1IP9 A;  3H1U A;  1FXT B;  2MRP A;  1WYW B;  2KO3 A;  5TR5 A;  3KW5 B;  2MBH A;  3APD A;  2CS4 A;  4JGH B;  1H8C A;  4RM9 A;  2DZK A;  2IBI B;  1RFA A;  2MP2 B;  2MX2 A;  1UBI A;  2C9W B;  4FUL A;  2DZJ A;  4DHZ E;  1WR6 E;  3AI5 A;  2DAF A;  2BKR B;  2PE6 B;  4ICU A;  4KIK A;  4MGZ E;  4XX5 A;  2GBJ A;  3T9L A;  5J17 A;  3DOW A;  3WAL A;  4E3C A;  4WJN A;  1WXM A;  4K1R B;  2MBE A;  4PS8 A;  2LUE A;  4ZRJ A;  2NBW B;  4M0W B;  2UWQ A;  4FJY A;  2PEA A;  4IWO A;  3CF6 E;  3MJW A;  2RGF A;  4DDG D;  3B08 A;  1JRU A;  1YX5 B;  2DEN B;  2KKC A;  2WYQ A;  2ZNV C;  2ZPN A;  3L17 A;  1F9J A;  2O2V A;  1V5O A;  2IY1 B;  2KFJ A;  4ANX A;  2KK8 A;  1VCB A;  4CYE A;  2BYE A;  3O65 B;  2N7D A;  3QIJ A;  1EF5 A;  1ZKH A;  3DVG X;  4FJV B;  3SU8 X;  1WM3 A;  3L16 A;  4TUU A;  1WY8 A;  4BOS C;  3TJP A;  2GBM A;  1UEL A;  1IPG A;  1I35 A;  4ZRI A;  4NQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...