1MG8A

Nmr structure of ubiquitin-like domain in murine parkin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
MGMIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parkin
publication title NMR structure of ubiquitin-like domain in PARKIN: Gene product of familial Parkinson's disease.
pubmed doi rcsb
molecule tags Apoptosis
total genus 13
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2002-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1mg8A00
4DHZE 4M8NA 4TV3A 1SIFA 3UIPB 4WJOA 2JRHA 2KDBA 1T0YA 2BPSA 2LVPA 2MWSB 1WZ3A 2NBVB 3M3JA 4GB9A 4IM2A 4K7SA 3ZRFA 3UF8A 2R2QA 2LGXA 4F8CB 1WR6E 5TR5A 3VXWA 2YVCA 2IO2B 1E5WA 4HWIB 4HDOA 2FCNA 1WE7A 2KK8A 4BKTA 4W9DA 4ICVA 3ZIMA 1V2YA 1UELA 2MRPA 4TKNA 2ZVNA 1KOTA 3R7RA 4FA6A 4B95A 2ZJDA 5DPTA 3QIJA 4EZJA 4GXBA 2JT4B 2NBUA 4LJOB 1GJZA 2V1YA 3KH0A 1Z5SB 1V81A 1WI0A 2G4SA 3KYDD 1VCBA 3CSFA 3T9LA 4AOFA 4MDKE 5J17A 2JVCA 5CTRC 4II3B 4RM9A 3RULA 1YIWA 2REXA 1IP9A 2OOBB 3NS8A 2N9XA 2XBBC 1D3ZA 3ZTCA 1WXSA 1WX9A 3K9PB 4MSMB 4HVBA 4FJZA 1VD2A 4AP4C 2BF8B 2G4DB 4W9KA 4G3XB 4HPMB 1CMXB 2M8SA 5CHWA 4IUMB 4W9GA 2N4FA 3MHSD 1E8ZA 3HM6X 4MGIE 3L0WB 2K6DB 4GGQA 4A20A 4X57B 5L83A 4W9HA 1Q5WB 1WJ4A 2KC1A 1NDDA 2KQ7A 4BBNC 2BGFA 3ENEA 4JL9A 4IWOA 2FUHB 1J0GA 3DVNU 5D7GA 1E8WA 1V86A 2PE9A 4B6WA 1YD8U 2CHXA 2FCSA 3B1LX 3RCZA 2AWTA 2FIFA 3Q3JA 2MLBA 1V49A 3PHXB 4GDKB 3VH4B 4BOZB 3X0WA 2BYFA 2JWZA 3ECIA 4I6LB 4JGHB 4AWJA 1E90A 2MBEA 2RGFA 4LDTB 1ZKHA 4DHJB 1ISNA 1WFYA 3PZDA 3H1UA 3VQIA 4WWOA 3ZVVA 4WJQA 3ZRCA 3TBLD 3PRZA 3QA8A 2K39A 3A1QA 3JSVB 3EC8A 3RYTA 4IWQA 4I6NB 2MX2A 3SHQA 4EOYA 3QK0A 4CHKA 4G50A 1LQBA 2MP2B 1WM2A 3N32A 4FHJA 5E6PA 2EMTA 3IVFA 1E7UA 2IY1B 3TL5A 4MM3A 4M8MA 5C23A 5LXHA 4DXAB 4CYEA 3L17A 4NQKE 2KXJA 1V9JA 1NI2A 3WAOA 1U4AA 5CHVC 2XK5A 4E3CA 4KDIC 3D32A 4BKGA 2MBOA 3L13A 1KLVA 3VH3B 4F7ZA 4FN2A 1YJ1A 4JLCA 1UGMA 2KTRA 2XEWA 3CF6E 1H8CA 2GOWA 1P0RA 3A4SC 2LXCA 2NPTB 3L54A 2N9PC 2LVOA 4I6PA 2KDFB 2DYOA 1EO6A 4WWPA 4DDID 1PQSA 4ASWC 4NY0A 5IAAC 4ANUA 3T8MA 3AU5A 1WGHA 2EMSA 3DDCB 5AZFA 2KC2A 2KKCA 2ASQA 3ML8A 4ANWA 4JQWC 4GDLB 2LRUA 4AJWA 5DPWA 5LXIB 3EHVA 3ZTDA 4PS8A 2N7EA 2KN5A 4ICUA 4TQ1A 1C3TA 4WJPA 2DZJA 3JW0X 4KDLB 3I3TB 3OLMD 2FIDA 3V6CB 3AI5A 2M4NA 1BT0A 1WF9A 3M63B 2O6VB 3A9JB 3DVNV 3KYCD 2K1FA 3PLVA 3VTWA 2KANA 1RFAA 3HIZA 4E74A 1WRDB 3DBRI 4HLEA 1L7YA 2DZIA 2K8HA 1TGZB 2BYVE 2KWCA 1TBEA 3BINA 3PS6A 5D2MB 3UQAA 1WJNA 3X23A 2DAFA 4WJNA 4KSLC 1RAXA 2LD9A 3H7PA 3PREA 2AYOB 2CKHB 2UWQA 3NZUA 3L16A 2K8BA 3ONSA 1WX8A 3ZNHB 2MQJA 4AUQC 4DBGA 3IFWB 2DHZA 1Q1OA 2KDEB 3OJ3A 4EZKA 1WE6A 3A9KB 1QZEA 2D10A 1Y8RC 1R4MI 2K8CA 4J6IA 1M94A 2KLCA 2O2VB 4DWFA 3B0AA 4MJSB 5D6JB 3VUXA 4ZRKA 1F9JA 4N9F4 2O6VD 1XD3B 2JPHA 4W9JA 3JVZX 3AU4A 1S1QB 3EECA 3PGEA 2CR5A 1GC6A 3ZNID 3H6NA 2CS4A 4FLHA 1OQYA 2QHOA 3RUIB 2D11A 1L2NA 2FCQA 2A5UA 4DHZB 2YLMA 1OTRB 2J0JA 2R2OA 2L8JA 3ALBA 3RT3B 2KMCA 2ZZPB 4FADA 3PT2B 2MA9B 2MW5A 4ZRIA 1UZXB 3APDA 3PV1A 3KUZA 3R7QA 3IBEA 4G0NB 1UH6A 3ML9A 1ZGUB 4M0WB 2NS5A 4JIOU 2C60A 3NY5A 2KZRA 3U7DA 1V6EA 2WX0A 3QHTA 3TMPB 3UIOB 2DYMA 3VTVA 2NBWB 3DCGA 1R4NI 1S3SG 1V5TA 2Z0EB 3DBSA 3RD2A 3A4RA 5JHBA 4IC7B 2WX1A 4ZRJA 2ZNVB 4F1SA 1SGHA 2A4ZA 4NQLB 2ZCCA 1IYFA 2JRIB 1XQQA 3WALA 1J19A 2LJ5A 3PSEB 3QWZB 2WDTB 4ANXA 4BFRA 3DPDA 1JRUA 4GDLA 3VVWB 4KIKB 4NPNA 1WMHA 2CHZA 2GBMA 2HD5B 3RZWC 5E6NA 2DZKA 4NAWA 2IBIB 2KJ6A 3PLUA 2AEHA 2J0KA 2BKRB 4W9LA 5BO4B 5KHOA 2HE7A 1V5OA 4K81A 4KSKC 2I1KA 4YL8A 2MBQA 4KZCA 1WIAA 2C7MB 3U8ZA 2D3GA 2LZ6A 1WGGA 2GBKA 1I35A 2MBBB 1IPGA 1YX6B 1UBQA 3PTFC 2DZMA 4GN1A 3PPAA 4WAAA 3WAMA 4IM3A 5JZEB 3QCAA 2KO3A 2RD0A 2GMIC 1WGYA 4LDTD 2G45B 4KV2A 4W9EA 3SU8X 2K6QA 4BKSD 4DHJD 4KVGB 1TZ1A 2RR9A 2AL6A 3IHPC 1WJ6A 2JY6A 2M17A 1WY8A 3LJ3A 3PVLA 1WGDA 3SD5A 5C1ZA 2KQSA 1NBFC 2IY0B 3PHWB 1K8RB 4E71A 4WQOB 4URKA 3TCAA 4NNJB 1V80A 2LVQA 5AZHA 4HJKA 4MGYE 3VTUA 2KX3A 4NJ6A 2BKFA 4LJPB 4MJSA 3GOEA 4OVVA 2CU1A 2ZPYA 4MEMA 2GBJA 1GNUA 2J0MA 1GC7A 3IG3A 2Y5BB 4FULA 4PYZA 3P2BA 3O65B 1WR1A 3B08A 4EZLA 1E8XA 3CSTA 3S2AA 2KWUB 4W9IA 3VUWA 4P7IA 3HHMA 2PPHA 3GZNI 2KHWB 4EEWA 2VRRB 1WX7A 4AJYB 4K1RB 3V6EB 1C1YB 3U30A 2N1WA 3HK0A 3QJZA 4RM8A 3NHEB 3VAWA 2NCNA 4FBJB 3NZSA 1KM7A 2G3QB 3ZW3A 2KLGA 1E7VA 2Z0DB 1RLFA 1LM8B 4FJYA 5GMVA 3WAPA 3N30A 4DK5A 2C7NB 5G55A 2DX5B 4MELA 4W9CA 2M1MA 4PS7A 1EF5A 2LI5A 2KJHB 2LWPA 4GDKA 5J18A 4IWPA 5CX3A 2PJHA 2LASA 1AARA 1MG8A 4EUTA 1LFDA 2JF5A 4BKSA 2KVRA 3HM3A 3V62A 1E8YA 2LUEA 3A1QB 4TQ0A 3ZLZA 3ZUNA 5AEKB 1GUAB 2M0XA 2GBRA 4GOCA 2L0FA 3VUYA 4EKUA 1P3QU 2LGYA 3JSVA 4HPLB 3UGBB 4MSQB 2EKEC 3KUDB 1WGRA 3ZO5B 2MCNB 2B3AA 2KMAA 2MP2A 2IO3B 1WJUA 1YQBA 5AZGA 2DYBA 2RSUA 2AL3A 2BWES 2IO1B 4A3OA 1KJTA 3WANA 3W1SC 4CO7A 2XK5B 4BVUC 4BBNF 4GSWA 2GBNA 3WIMA 1FXTB 3AULA 3QC8B 2DAJA 1WXVA 1YX5B 2I1JA 1EF1A 2KTRB 4IW0A 1LXDA 3W1YA 3DQVA 4K7WA 4TUUA 2MBHA 3A33B 3R3MA 5DPSA 1Z2MA 4EFOA 4MGKE 2NPTA 4LCDE 2BYEA 3MJWA 2ZNVC 3OJ4B 4G11A 2ZVOA 3ZNGC 3UQBA 1H4RA 3VFKA 4KZ0A 1GG3A 2C9WB 2PE6B 4HK2A 2L00B 3APCA 1ZW7A 4ZDVA 2LRWA 3DOWA 3N3KB 1J8CA 1HE8A 2KOXA 2DENB 2C7HA 2ZPNA 2MSED 2UYZB 3DBHI 5D94A 3R66C 2KWVB 4XC2A 3H7SA 2KFKB 2L3ZA 2LXAA 4HCNB 1XT9B 3CMMB 3M95A 1WH3A 2KNBA 2HJ8A 2WYQA 3KVFB 5IA7A 3SDLC 3QQ8B 3QARA 1UBIA 2O6VA 3A9JA 1RRBA 5FR6A 2KJRA 3DBLI 3V61A 2N9EB 3KW5B 3VDZA 4B9KA 4GMVA 5HKHA 1P1AA 2FNJB 4RMAA 3EFUA 3H7PB 1OGWA 1SE9A 2IO0B 3M62B 3Q3FA 2D07B 2KD0A 4HXDA 4II2B 2V3SA 4IM0A 3MTNB 1X1MA 2BWFA 2KDIA 2HTHA 5EDSA 3K9OB 1OEYA 2JZ3B 5DCNA 3V60A 2ZCBA 2L0TA 3ZDTA 2V4LA 3A9KA 5JHAA 2L7RA 4IG7B 4XZ4A 4MH0E 2C5LC 2IYDB 2OJRA 2O2VA 4ANVA 1EUVB 3LDZE 3UINB 1WYWB 3KUCB 5L95C 4FHKA 3L08A 3VHTC 1WZ0A 2FCMA 3DVGX 3APFA 3AXCA 3C0RB 1I42A 4WWNA 4XX5A 1P9DU 5G2NA 2FAZA 3L10B 5J2RA 2J7QB 4A3PA 2JZZA 2L05A 1A5RA 4GIVA 1OEYJ 2PEAA 1TTNA 1WM3A 2K25A 2KFJA 3JYUA 4ZYNA 5LLIA 3ZNZB 4W9FA 3W1SA 4GU2A 3DVGY 3WA0A 2LGDA 3QX1A 1G6JA 3H9DA 4PS3A 4DDGD 5KHQA 4FJVB 2JUOA 5E6OA 4HDQA 5JH5C 3TIXA 3BY4B 2N7DA 3ZKJC 1UD7A 4MGZE 2NR2A 1P98A 3NOBA 2Z59B 2ZEQA 3RZFA 3PRPB 2KX0A 1Q0WB 3QAQA 2CHWA 3PRMB 4BOSC 4OVUA 2WWZA 1WMHB 4HCPB 4PYUA 3ZDMC 2JXXA 4NJ7A 2W9NA 4KIKA 2N1VA 1WXAA 2IZVB 4K7UA 4NAWB 5DPRA 3OAWA 2L76A 2D2QA 2NVUI 3TJPA 1WXMA 5CHFA 2RPQA 2KTFA 2KFKA
chains in the Genus database with same CATH superfamily
4DHZE 4M8NA 1SIFA 2W3SA 3UIPB 1TZOA 2NBVB 2BPSA 3J9CA 2MWSB 1WZ3A 1I4XA 2R2QA 4OZAA 5TR5A 3HVDA 1WE7A 3DHGC 4W9DA 4ICVA 4TKNA 2ZVNA 4EZJA 4GXBA 3P4SB 3P4RB 1V81A 2KN4A 4AOFA 5J17A 4II3B 4RM9A 2PW9A 1F0ZA 1IP9A 1WXSA 1AWDA 3K9PB 4KGRA 2BF8B 1I4RA 2OJWA 5CHWA 2N4FA 1E8ZA 1C78A 1ET6A 4JL9A 4IWOA 2PE9A 1YD8U 4L23A 2CHXA 1QLBB 2FCSA 1V49A 3PHXB 1SSNA 3ECIA 4I6LB 4JGHB 4AWJA 1E90A 2AQ3B 2MBEA 4LDTB 1F2RI 1SEBD 4JX1C 4DHJB 1WFYA 2M56B 4AS1A 2CJOA 3ZRCA 3PRZA 1SE2A 2V3NA 1HA5A 4C56C 3QK0A 4G50A 2MP2B 3N32A 1ZDVA 5E6PA 4O1NA 4MM3A 3ZGZA 4OZCA 3L17A 4NQKE 2XK5A 4E3CA 4N6EB 1FNVA 1RFKA 1D5XC 3VH3B 1UGMA 2KTRA 3SFEB 2KAJA 2NTSA 1GB1A 5EE9A 2N9PC 2Z8LA 4LNFA 2WDRB 2KDFB 4ASWC 1DGJA 5IAAC 2K22A 3T8MA 2N9KA 2KQ4X 4JWUC 2ASQA 4JQWC 5LXIB 3NZ3A 1VJKA 2KN5A 3IT6B 3OLMD 4P16A 4ZHOA 1BT0A 1WF9A 1XLNA 1J7BA 4YSZB 5IN7A 3DVNV 1WRDB 3DBRI 4HLEA 5D2MB 5BYRA 3TEWA 3U2SC 2DAFA 2V9HA 2LHDA 4KSLC 2CKHB 3L16A 2K8BA 1WX8A 2MQJA 3TUOA 2DHZA 1Q1OA 2W3RA 3OJ3A 2XN9C 3A9KB 4XWWA 1Y8RC 2G1EA 2KLCA 2AX5A 3B0AA 3RNGC 5LNK1 3Q8BA 4N58A 1XD3B 2JPHA 3EECA 3PGEA 1GC6A 2CS4A 4FLHA 2JYTA 1XCTL 2D11A 2WS3B 2A5UA 4DHZB 2WXGA 2J0JA 4FADA 3MP9A 1UZXB 1ZUD2 3R2IA 3R7QA 3IBEA 4G0NB 2DLBA 2NS5A 4IKGA 4JIOU 3QHTA 2NBWB 2BS2B 3DCGA 1HZ6A 2WX1A 2A4ZA 4NQLB 2JRIB 3WALA 4ANXA 4L2YA 4NPNA 2CHZA 2GBMA 1SIJA 5E6NA 1UWMA 2B76B 3HUIA 2DZKA 5GXGB 3KQ4A 4LNOA 3B2GA 4KSKC 3E9SA 2MBQA 2C7MB 4A90A 3MC0B 1PDXA 1IPGA 4OVZA 4WAAA 3QCAA 2RD0A 1HTQA 3P63A 3AE9B 4KV2A 3IHPC 1PYWD 1WJ6A 5H92C 3SD5A 2KQSA 1NBFC 3BYYB 5AZHA 4HJKA 3VTUA 1EWYC 4OVVA 3AECB 2WGSA 2GBJA 1GNUA 2J0MA 1FM0D 1GC7A 2Y5BB 1JWSD 1PGBA 4K3BA 4P7IA 2BYTA 4ZRPA 3HHMA 2PPHA 1FNUA 3RPFC 1WX7A 3HK0A 3NHEB 1KM7A 4M01A 1ZXHA 4FJYA 2QDFA 2M1MA 1JCKB 4PS7A 4IWPA 2DWQA 3W5UB 1LFDA 1LGRA 1IGCA 3HM3A 1N61A 2LUEA 3A1QB 3ZLZA 3UI3A 1GUAB 2L0FA 3VUYA 2JZPA 3NVVA 1TKGA 2QEJC 1NYQA 3KUDB 1EU4A 2KMAA 2MP2A 2IO3B 4C00A 2PIAA 1KLGD 1KJTA 2JSVX 3W1SC 3WIMA 3P1MA 1FXTB 2KDMA 1CJEA 3QC8B 4CQNA 1WXVA 1VZ6A 2I1JA 5FK9C 1FD6A 5D3IB 1I7HA 1HTOA 4TUUA 5DPSA 1Z2MA 3B9JA 5C2TB 4LCDE 3BK1A 2ZNVC 3OJ4B 1H4RA 3AEFB 3VFKA 2JU6X 4HK2A 2L00B 2WU5B 2DENB 1MI0A 4ACFA 5D94A 3AE8B 3R66C 1L6VA 1RYJA 4HCNB 1PGXA 1XT9B 1ZDXA 3CMMB 5IA7A 3SDLC 3QARA 1UBIA 2KJRA 3DBLI 2N9EB 5HKHA 3EFUA 2D07B 4HXDA 1L6UA 3KLSX 4KX6B 3VR8B 2VZKD 5DCNA 2ZCBA 2PLPA 3A9KA 4IG7B 2C5LC 3PO0A 2LUMA 4ANVA 3GE3C 2IGHA 1VRAB 3GB1A 1UWXA 3APFA 5BYQA 3AXCA 5G5HA 5J2RA 1KH0A 1T6BX 4GIVA 2GRIA 1WM3A 3JYUA 4XGAB 2KFJA 3ZNZB 3QX1A 1G6JA 1FIQA 3H9DA 4DDGD 4LNKA 4HDQA 5JH5C 3ZKJC 2N7DA 1UD7A 4TMAB 2NR2A 4LNIA 1XF5L 4PYUA 2JXXA 4NJ7A 4K7UA 1JWUD 2D2QA 2SEBD 3TJPA 3LYYA 4TV3A 1T0YA 3IXSA 2WXHA 3AMZA 2LGXA 4F8CB 1WR6E 3VXWA 4HWIB 3O13A 4BKTA 2L52A 1V2YA 2WXRA 2ZJDA 3QIJA 2JT4B 2NBUA 4LJOB 2V1YA 1C9FA 1DOYA 2K5PA 1Z5SB 4LLGM 2RDBC 2G4SA 1FCLA 1VCBA 1L0XB 2GB1A 1N62A 4HVBA 4FJZA 1VD2A 4W9KA 2G4DB 4G3XB 4OW0A 4ZHPA 1HXYD 2WXQA 3MHSD 1PUTA 4MGIE 2K6DB 4GGQA 4X57B 4W9HA 4BBNC 2BGFA 1QT9A 2PVOD 3HRDD 1J0GA 5D7GA 1V86A 2WXJA 2MHJA 2X38A 3R2TA 3RCZA 2AWTA 1E10A 3VH4B 2JWZA 4DQOC 2RGFA 1ZKHA 1VLBA 1L0YB 1ISNA 3PZDA 3N9YC 5BYSA 1RM6C 5HI1A 4WWOA 1I4HA 2K39A 3A1QA 3JSVB 3SHQA 1WRIA 1V97A 1LQBA 1V1PB 1STEA 4FHJA 3ZJTA 1AW7A 4M8MA 4DXAB 1FO4A 1E9MA 2INPE 2LGSA 3D32A 2Y5PA 2TSSA 4FN2A 1YJ1A 4JLCA 5HHDG 2XEWA 2JWUA 2V4IB 3DWGC 4HEA1 2LXCA 3N20C 4DDID 4NY0A 4ANUA 1WGHA 1D5MC 1TJEA 3C19A 1TIFA 3ZTDA 4DXGA 3IAS1 2DZJA 3JW0X 1JROA 3I3TB 2FIDA 3V6CB 2O6VB 3PLVA 3VTWA 1VZ7A 3HIZA 2L83A 3N1YC 2DZIA 2K8HA 3BINA 2BYVE 1TBEA 2XNAC 1WJNA 4B0MA 1LO5D 1RAXA 2LD9A 2LHEA 4DBGA 4EZKA 2D10A 1ZOYB 5IP4D 2O2VB 1DOIA 4DWFA 3VUXA 2MJ3A 4UDUC 4H2AA 3AU4A 3EA6A 2WQYB 2CR5A 2OEDA 3RUIB 1OTRB 1YMHE 2R2OA 3PT2B 2MA9B 4ZRIA 1YJJA 5H8YE 1P7FA 2BT6A 1C4AA 4A8XC 1XLQA 1KFYB 3ML9A 2FE8A 4M0WB 4YSYB 2C60A 3U7DA 1IBXB 1E0ZA 1UF0A 3A4RA 5JHBA 3DBRB 2ZNVB 4F1SA 1SGHA 1IYFA 3V3XA 4YTPB 2LJ5A 3PSEB 3RMKC 3VVWB 4GDLA 5E6JA 3RZWC 3VR9B 4ZOHC 4A9AA 3ZQ4A 2BKRB 4W9LA 4K81A 4KZCA 2AQ1B 1WGGA 1XO3A 2GBKA 1I35A 2BBCA 1UBQA 2DZMA 3PPAA 3WAMA 1ZPSA 3EUB2 2YEPB 1N60A 4W9EA 5AUKA 2K6QA 4BKSD 2RR9A 2EELA 1WGDA 4E71A 1K8RB 1R7SA 4WQOB 4URKA 2LVQA 3FC4A 1WGKA 2BW2A 5BMIA 4DXFA 4MJSA 4BZAA 2CU1A 4MEMA 3U52E 4C4VB 3T3NA 1FXAA 4PYZA 3O65B 1AN8A 2BVCA 2KWUB 4AJYB 4HJGE 3VAWA 3AEAB 3DHHC 2G3QB 1E7VA 2Z0DB 1RLFA 3WAPA 5GMVA 4DK5A 5G55A 4RH6A 2DX5B 4XDCA 1N63A 4MELA 3VRAB 3BVZA 5J18A 1P7EA 1AARA 2JF5A 4JPSA 1MFWA 4TQ0A 3ZUNA 2MJEA 2M0XA 2GBRA 4EKUA 5BMHA 3NVZA 1P3QU 2LGYA 3URYA 3JSVA 4HPLB 4MSQB 3Q8FA 2W55A 1WGRA 2B3AA 3NRZA 1V1PA 3P4PB 5AZGA 2DYBA 2RSUA 2AL3A 2ONQA 4A3OA 3BYTB 3WANA 4CO7A 3AEDB 4BVUC 1QF6A 4GSWA 3AULA 2DAJA 1YX5B 4A6QA 1XLOA 1LXDA 3W1YA 3DQVA 3FKYA 4WQMA 3A33B 1XXGA 3DHIC 4IOIE 4RNAA 2MJDA 2N9LA 3UQBA 2JX5A 2C9WB 1TS2A 2PE6B 4YWGG 1ZW7A 2KT7A 2MSED 2UYZB 3DBHI 2KWVB 2L3ZA 2LXAA 1WH3A 1T3QA 1K53A 4ZYSA 1F77A 5D3DA 2QMTA 3AEGB 2O6VA 1NEKB 3KW5B 1Y56A 4GMVA 4XYCA 1ZXIA 4WWMA 3FILB 1AYFA 4RGMA 2KDIA 2BTEA 5EDSA 1OEYA 3NUHB 3Q3OC 3ZJUA 2L1AA 5HG2A 3ZDTA 2PKOA 2V4LA 5JHAA 2WDVB 2L7RA 4XZ4A 4MH0E 2OJRA 2O2VA 1I4QA 3DWMA 4WURA 3UINB 1YN3A 4FHKA 3L08A 2ACZB 1FNWA 2D5GA 2FCMA 1PGAA 3AE7B 4XX5A 5G2NA 2FAZA 2AQ2B 2QCZA 1T0SC 5LLIA 3W1SA 1GB4A 3DVGY 1ACCA 3WA0A 2LGDA 3TEZA 3BVGA 3FAHA 1YN4A 3TIXA 4M0WA 1IBXA 4M00A 4MGZE 1P98A 3NOBA 3RZFA 3DBLB 1ROEA 3PRPB 2W54A 1Q0WB 2D3CA 4BOSC 3OWEB 2WWZA 4RGNA 2WDQB 2W9NA 1NVID 2N1VA 3OAWA 2H88B 2L76A 5CHFA 2KFKA 2WXKA 3U4EG 3AE2B 3I5JC 2WXOA 1J7CA 2KDBA 4GB9A 4K7SA 4IM2A 3UF8A 2L32A 2IO2B 1E5WA 4HDOA 4MT5A 3ETRA 2KK8A 1FPYA 1UELA 3BK2A 2M19A 2MRPA 4OZBA 3AE3B 3R7RA 1KOTA 4B95A 5DPTA 1GJZA 3KYDD 4XDDA 3CSFA 2WP9B 1YIWA 1TS3A 2REXA 3ZXRA 3NS8A 2XBBC 3ZTCA 4MSMB 4C4VA 1RWSA 2UU7A 1CMXB 5G5GA 4IUMB 3RI7C 3HM6X 5L83A 4A20A 1UNSA 1C79A 1EU3A 2KC1A 1NDDA 3MFGA 2BS4B 2FUHB 5T8IA 3DVNU 1JWBD 1D4BA 2YEPF 4LK0M 3RNFC 1FXIA 3AEBB 3Q3JA 4GDKB 1QILA 4BOZB 3X0WA 2BYFA 1TKEA 1DYQA 1DOXA 2QILA 4C7YA 4LNNA 2DBYA 1T5XD 3H1UA 3VQIA 4WJQA 2X8XX 1QOBA 3RYTA 4IWQA 2MX2A 4EOYA 1B9RA 4US8A 3L4PA 1WM2A 2EMTA 3IVFA 1FRDA 2IY1B 2K0PA 5C23A 2WXNA 4CYEA 1D6EC 1NI2A 1YOVB 3WAOA 4KDIC 4BKGA 3U7ZA 1F52A 4KKJA 4F7ZA 3CF6E 1P0RA 3PZ7A 4A55A 1R4NB 2DYOA 1PQSA 4B0EA 2EMSA 5AZFA 2FUG1 3ML8A 4GDLB 2E3TA 4AJWA 5DPWA 3EHVA 4ICUA 2QJLA 1C3TA 5IO9A 4KDLB 1BXTA 1MHXA 3AI5A 5HFYA 2M4NA 1RFAA 4KKIA 1L7YA 2IPKD 3PS6A 1TGZB 2KWCA 3UQAA 4N59A 4WJNA 3GS2A 4ARIA 3FILA 2AYOB 3NS1A 3NZUA 3ZNHB 3ONSA 1TY0A 1V1OA 4AUQC 1QOAA 1CQVA 4J6IA 2K8CA 1M94A 3RNCC 2MH7A 4L1BA 4MJSB 4ZRKA 1F9JA 2O6VD 3BVMA 4W9JA 1YQ3B 3ZNID 3H6NA 1OQYA 2QHOA 3NVWA 1L2NA 3B2FA 2YLMA 1TS4A 3RT3B 3APDA 4C80A 3KUZA 2KYWA 1YJIA 3V05A 2KZRA 1VZ8A 1V6EA 3UIOB 3AE4B 1R4NI 1S3SG 1V5TA 3DBSA 1Q10A 1SE3A 3KWVA 4JWSC 1J19A 3QWZB 2WDTB 3RNEC 3DPDA 2JQRB 5I4DA 3EFCA 4KGSA 2J42A 3NJTA 4IDIA 2IBIB 2KJ6A 4RFBA 2DNFA 2J0KA 4S0RA 2LJIA 1MJDA 1WIAA 3U8ZA 4PT5A 4WH4A 1YX6B 1FRRA 2KO3A 1WGYA 4LDTD 4DHJD 4D2KA 2AL6A 2JY6A 2M17A 3PVLA 1JQ4A 5C1ZA 2IY0B 3PHWB 4NNJB 1V80A 1B1ZA 4K3CA 2HDEA 1MHHE 4NJ6A 2BKFA 4LJPB 2ZPYA 1L0VB 3Q8AA 2E6XA 3IG3A 4FULA 2ICIA 3P2BA 1ET9A 1WR1A 3W5VB 3TEYA 3S2AA 2G9HD 2INNE 4W9IA 3VUWA 3GZNI 2QIEB 2VRRB 3IAM1 4K1RB 3V6EB 2N1WA 3QJZA 3T3OA 4FBJB 3NZSA 1LM8B 3H8HA 4P1BC 4W9CA 4EE2A 1TS5A 2LI5A 4GDKA 5CX3A 4EUTA 2KVRA 2QC8A 2R61A 3UGBB 2EKEC 2NMQA 3I63C 3ZO5B 4RF1A 2MCNB 2KMMA 1TKYA 2WHIA 1YQBA 2BB6A 2IO1B 2RDGA 1SXTA 4YTMB 2GBNA 1ZP0B 2QSDA 2I2YA 2KACA 3RFZB 3Q3MC 1EF1A 1JWAD 4IW0A 3AM9A 1L5PA 3AE6B 1SF0A 2V3PA 3R3MA 4XE0A 4HPPA 4MGKE 3MJWA 4HRSA 4G11A 5EE0A 2BS3B 4NZLB 3ZNGC 4WIPA 1FCCC 4PK1A 3N1ZC 4ZDVA 2LRWA 3GE8C 4TSSA 1JALA 1HE8A 2ZPNA 1C4PA 2KFKB 1A70A 3M95A 2KNBA 2HJ8A 2LEKA 4RGTA 5IOIA 1IGDA 3AH7A 2RMMA 1RRBA 3EGRA 3AEEB 3V61A 1K51A 3VDZA 4B9KA 1QOGA 2FNJB 1E7PB 3H7PB 4GLSC 1SE9A 2IO0B 3M62B 3N1XC 3Q3FA 2KD0A 4II2B 2V3SA 1X1MA 1WXQA 3K9OB 2JZ3B 1TYGB 2L0TA 2WLBA 2ZW1A 2IYDB 2INCC 2RDHA 1TY2A 1WYWB 3KUCB 3Q8CA 5L95C 1K52A 2HJ1A 2LFIA 2Y5CA 3DVGX 4P6VF 4Q2JA 2K3UA 1P9DU 2ZW0A 3SR6A 3L10B 4A3PA 1WSPA 2JZZA 1A5RA 1OEYJ 2PEAA 3MHZA 4ZYNA 3DBHB 4W9FA 4ARCA 4GU2A 4PS3A 4FXCA 4FJVB 1SB3C 2WU2B 5C3JB 1MG4A 1NI3A 2Z59B 2Y3AA 3E56A 1D5ZC 3QAQA 2CHWA 4OVUA 1WMHB 4HCPB 3ZDMC 4NAWB 1WXAA 1I4GA 2KTFA 2WXLA 4WJOA 2JRHA 3M3JA 2LVPA 3MC9A 3ZRFA 4US9A 1HQRD 1XEEA 2YVCA 2FCNA 1KTKA 2GI9A 3ZIMA 2D3AA 1C76A 2RPVA 4FA6A 4AQ7A 4HROA 2SAKA 3KH0A 1WI0A 1ZE3D 2J53A 3T9LA 2J4XA 4MDKE 2IJ0A 2JVCA 5CTRC 3RULA 1VR9A 4MH8A 1C4CA 2OOBB 2N9XA 1D3ZA 1WX9A 1BMLC 4AP4C 4HPMB 2M8SA 1KRHA 1OQQA 1SJHD 4W9GA 1PFDA 3L0WB 2N0SB 1Q5WB 1WJ4A 3RNBC 1CZPA 2KQ7A 3NG0A 3IT4B 1QKZA 1WWTA 3ENEA 1T0QC 1ESFA 1E8WA 2NTTA 4B6WA 3Q3NC 3B1LX 4HKQA 2FIFA 1BUIC 2MLBA 2HTME 2IDYA 2K9XA 1XLPA 3I57A 1I4PA 1F1HA 1UGJA 3TEXA 3ZVVA 3TBLD 3QA8A 1R4MB 3EC8A 1N5WA 4I6NB 1KLUD 4CHKA 1YN5A 3BIID 1SE4A 1E7UA 2WXFA 3TL5A 2OHFA 5LXHA 3NVYA 1VDVA 2M0AA 2KXJA 1V9JA 3KWLA 4BAXA 1U4AA 5CHVC 1KF6B 2WXPA 2MBOA 3L13A 1KLVA 1H8CA 2GOWA 3A4SC 2NPTB 3HVZA 3L54A 2BB5A 2LVOA 4I6PA 1MVKA 1FFUA 1F2RC 1EO6A 4WWPA 2H89B 1EWCA 3AU5A 3DDCB 2KC2A 2LGIA 1UUPA 2KKCA 4ANWA 2LRUA 5EE1A 4XWTA 4YSXB 4PS8A 3AB5A 2N7EA 2PVGC 3SEBA 4TQ1A 4WJPA 3M63B 3A9JB 3KYCD 2K1FA 2KANA 4E74A 1OQRA 4HKZE 1SJED 3VRBB 2CJNA 1L4DB 1TT5B 3X23A 3H7PA 3PREA 2UWQA 3IFWB 4M02A 4LTUA 2KDEB 1WE6A 1QZEA 3GP7A 1R4MI 5D6JB 1GPXA 4N9F4 3AN1A 3JVZX 1S1QB 1CK1A 2CU3A 1NENB 4QAYA 2FCQA 3ALBA 2L8JA 1K50A 4ZRQA 2KMCA 2ZZPB 1GOZA 2MW5A 1HEZE 3P42A 3PV1A 3OG5A 1UH6A 1ZGUB 3NY5A 4ITKA 2WX0A 4JE3B 3TMPB 3VTVA 1N6ZA 2DYMA 2Z0EB 3I9V1 3RD2A 4IC7B 4ZRJA 2ZCCA 1XQQA 2V0GA 4BFRA 1T0RC 1JRUA 4KIKB 3Q8EA 1WMHA 2HD5B 1SBBB 2VH1A 4NAWA 3PLUA 2AEHA 4YXDB 4REZA 5BO4B 5KHOA 2EKIA 1V5OA 2HE7A 2I1KA 4YL8A 3AV8A 2JYEA 3BWUD 2D3GA 2LZ6A 3LXFA 1N5XA 2Q5WD 1OFFA 2MBBB 1ENFA 4YT0B 3CWIA 3PTFC 4GN1A 4RCOA 3AE5B 5JZEB 4IM3A 1C77A 2GMIC 2G45B 2N7JA 3SU8X 4KVGB 1TZ1A 1E6EB 1WY8A 3LJ3A 3TCAA 1MPEA 4MGYE 2KX3A 1IUEA 3PZ8A 3GOEA 2J52A 3RN9C 2W82A 4MACA 1J7AA 4RF0A 3B08A 4EZLA 1E8XA 3CSTA 1NYRA 3C8YA 2KHWB 4EEWA 5BMGA 1L4ZB 1YNTE 1C1YB 3U30A 4RM8A 2NCNA 3TSSA 3ZW3A 2KLGA 4S17A 3N30A 2C7NB 1EF5A 2KJHB 2LWPA 1FEHA 2PJHA 2LASA 1MG8A 2ON8A 1QOFA 4USAA 4BKSA 3V62A 1YQ4B 1E8YA 5JXVA 2KVZA 2WXIA 5AEKB 1QQRA 4GOCA 1HZ5A 2I38A 2JXTA 4NJCA 4WAFA 4R3DA 4MM3B 4NAMA 3P4QB 1WJUA 3MC8A 5MPOA 3RNAC 2BWES 2WNMA 2XK5B 3Q2AC 4BBNF 3GZNB 1JWMD 2WXMA 3ABVB 3Q69A 2KTRB 2KWDA 1V8CA 4K7WA 3Q6BA 2MBHA 2IGGA 2VH2A 4EFOA 2NPTA 5FKAC 2BYEA 2ZVOA 4KZ0A 1GG3A 3ZXVA 1XCQL 3APCA 1FMAD 3DOWA 4RGOS 3N3KB 3W9CB 1J8CA 1EM7A 2KOXA 2C7HA 1M4VA 5AUIA 3WCQA 2VZKB 2INDC 4XC2A 3H7SA 2FBWB 1FFVA 3KVFB 2WYQA 4YTNB 5IKCM 3QQ8B 3SFDB 3AE1B 3A9JA 2PTLA 5FR6A 3ZYYX 1WYGA 1P1AA 4RMAA 1JMLA 1JW9D 3W2DA 1OGWA 3ZJVA 1JRPA 4IM0A 4C7ZA 3MTNB 2BWFA 2HTHA 5TSSA 3V60A 2IGDA 5EE3A 1EUVB 2MEKA 3CIRB 3LDZE 4OHJA 3VHTC 1WZ0A 3C0RB 1I42A 4WWNA 4P1CC 3R8BA 2J7QB 3Q14C 2L05A 2PMVA 1TTNA 2K25A 2LMCA 3BZDB 2GLSA 5FR3A 5KHQA 2JUOA 5E6OA 3BY4B 2D3BA 3LB8C 2ZEQA 4J3OD 2BQQA 2KX0A 3PRMB 4KIKA 2IZVB 4KGTA 5DPRA 2NVUI 1WXMA 3MJ5A 2RPQA 1GAQB
chains in the Genus database with same CATH topology
4DHZE 4M8NA 4TV3A 1SIFA 3UIPB 4WJOA 2JRHA 2KDBA 1T0YA 2BPSA 2LVPA 2MWSB 1WZ3A 2NBVB 3M3JA 4GB9A 4IM2A 4K7SA 3ZRFA 3UF8A 2R2QA 2LGXA 4F8CB 1WR6E 5TR5A 3VXWA 2YVCA 2IO2B 1E5WA 4HWIB 4HDOA 2FCNA 1WE7A 2KK8A 4BKTA 4W9DA 4ICVA 3ZIMA 1V2YA 1UELA 2MRPA 4TKNA 2ZVNA 1KOTA 3R7RA 4FA6A 4B95A 2ZJDA 5DPTA 3QIJA 4EZJA 4GXBA 2JT4B 2NBUA 4LJOB 1GJZA 2V1YA 3KH0A 1Z5SB 1V81A 1WI0A 2G4SA 3KYDD 1VCBA 3CSFA 3T9LA 4AOFA 4MDKE 5J17A 2JVCA 5CTRC 4II3B 4RM9A 3RULA 1YIWA 2REXA 1IP9A 2OOBB 3NS8A 2N9XA 2XBBC 1D3ZA 3ZTCA 1WXSA 1WX9A 3K9PB 4MSMB 4HVBA 4FJZA 1VD2A 4AP4C 2BF8B 2G4DB 4W9KA 4G3XB 4HPMB 1CMXB 2M8SA 5CHWA 4IUMB 4W9GA 2N4FA 3MHSD 1E8ZA 3HM6X 4MGIE 3L0WB 2K6DB 4GGQA 4A20A 4X57B 5L83A 4W9HA 1Q5WB 1WJ4A 2KC1A 1NDDA 2KQ7A 4BBNC 2BGFA 3ENEA 4JL9A 4IWOA 2FUHB 1J0GA 3DVNU 5D7GA 1E8WA 1V86A 2PE9A 4B6WA 1YD8U 2CHXA 2FCSA 3B1LX 3RCZA 2AWTA 2FIFA 3Q3JA 2MLBA 1V49A 3PHXB 4GDKB 3VH4B 4BOZB 3X0WA 2BYFA 2JWZA 3ECIA 4I6LB 4JGHB 4AWJA 1E90A 2MBEA 2RGFA 4LDTB 1ZKHA 4DHJB 1ISNA 1WFYA 3PZDA 3H1UA 3VQIA 4WWOA 3ZVVA 4WJQA 3ZRCA 3TBLD 3PRZA 3QA8A 2K39A 3A1QA 3JSVB 3EC8A 3RYTA 4IWQA 4I6NB 2MX2A 3SHQA 4EOYA 3QK0A 4CHKA 4G50A 1LQBA 2MP2B 1WM2A 3N32A 4FHJA 5E6PA 2EMTA 3IVFA 1E7UA 2IY1B 3TL5A 4MM3A 4M8MA 5C23A 5LXHA 4DXAB 4CYEA 3L17A 4NQKE 2KXJA 1V9JA 1NI2A 3WAOA 1U4AA 5CHVC 2XK5A 4E3CA 4KDIC 3D32A 4BKGA 2MBOA 3L13A 1KLVA 3VH3B 4F7ZA 4FN2A 1YJ1A 4JLCA 1UGMA 2KTRA 2XEWA 3CF6E 1H8CA 2GOWA 1P0RA 3A4SC 2LXCA 2NPTB 3L54A 2N9PC 2LVOA 4I6PA 2KDFB 2DYOA 1EO6A 4WWPA 4DDID 1PQSA 4ASWC 4NY0A 5IAAC 4ANUA 3T8MA 3AU5A 1WGHA 2EMSA 3DDCB 5AZFA 2KC2A 2KKCA 2ASQA 3ML8A 4ANWA 4JQWC 4GDLB 2LRUA 4AJWA 5DPWA 5LXIB 3EHVA 3ZTDA 4PS8A 2N7EA 2KN5A 4ICUA 4TQ1A 1C3TA 4WJPA 2DZJA 3JW0X 4KDLB 3I3TB 3OLMD 2FIDA 3V6CB 3AI5A 2M4NA 1BT0A 1WF9A 3M63B 2O6VB 3A9JB 3DVNV 3KYCD 2K1FA 3PLVA 3VTWA 2KANA 1RFAA 3HIZA 4E74A 1WRDB 3DBRI 4HLEA 1L7YA 2DZIA 2K8HA 1TGZB 2BYVE 2KWCA 1TBEA 3BINA 3PS6A 5D2MB 3UQAA 1WJNA 3X23A 2DAFA 4WJNA 4KSLC 1RAXA 2LD9A 3H7PA 3PREA 2AYOB 2CKHB 2UWQA 3NZUA 3L16A 2K8BA 3ONSA 1WX8A 3ZNHB 2MQJA 4AUQC 4DBGA 3IFWB 2DHZA 1Q1OA 2KDEB 3OJ3A 4EZKA 1WE6A 3A9KB 1QZEA 2D10A 1Y8RC 1R4MI 2K8CA 4J6IA 1M94A 2KLCA 2O2VB 4DWFA 3B0AA 4MJSB 5D6JB 3VUXA 4ZRKA 1F9JA 4N9F4 2O6VD 1XD3B 2JPHA 4W9JA 3JVZX 3AU4A 1S1QB 3EECA 3PGEA 2CR5A 1GC6A 3ZNID 3H6NA 2CS4A 4FLHA 1OQYA 2QHOA 3RUIB 2D11A 1L2NA 2FCQA 2A5UA 4DHZB 2YLMA 1OTRB 2J0JA 2R2OA 2L8JA 3ALBA 3RT3B 2KMCA 2ZZPB 4FADA 3PT2B 2MA9B 2MW5A 4ZRIA 1UZXB 3APDA 3PV1A 3KUZA 3R7QA 3IBEA 4G0NB 1UH6A 3ML9A 1ZGUB 4M0WB 2NS5A 4JIOU 2C60A 3NY5A 2KZRA 3U7DA 1V6EA 2WX0A 3QHTA 3TMPB 3UIOB 2DYMA 3VTVA 2NBWB 3DCGA 1R4NI 1S3SG 1V5TA 2Z0EB 3DBSA 3RD2A 3A4RA 5JHBA 4IC7B 2WX1A 4ZRJA 2ZNVB 4F1SA 1SGHA 2A4ZA 4NQLB 2ZCCA 1IYFA 2JRIB 1XQQA 3WALA 1J19A 2LJ5A 3PSEB 3QWZB 2WDTB 4ANXA 4BFRA 3DPDA 1JRUA 4GDLA 3VVWB 4KIKB 4NPNA 1WMHA 2CHZA 2GBMA 2HD5B 3RZWC 5E6NA 2DZKA 4NAWA 2IBIB 2KJ6A 3PLUA 2AEHA 2J0KA 2BKRB 4W9LA 5BO4B 5KHOA 2HE7A 1V5OA 4K81A 4KSKC 2I1KA 4YL8A 2MBQA 4KZCA 1WIAA 2C7MB 3U8ZA 2D3GA 2LZ6A 1WGGA 2GBKA 1I35A 2MBBB 1IPGA 1YX6B 1UBQA 3PTFC 2DZMA 4GN1A 3PPAA 4WAAA 3WAMA 4IM3A 5JZEB 3QCAA 2KO3A 2RD0A 2GMIC 1WGYA 4LDTD 2G45B 4KV2A 4W9EA 3SU8X 2K6QA 4BKSD 4DHJD 4KVGB 1TZ1A 2RR9A 2AL6A 3IHPC 1WJ6A 2JY6A 2M17A 1WY8A 3LJ3A 3PVLA 1WGDA 3SD5A 5C1ZA 2KQSA 1NBFC 2IY0B 3PHWB 1K8RB 4E71A 4WQOB 4URKA 3TCAA 4NNJB 1V80A 2LVQA 5AZHA 4HJKA 4MGYE 3VTUA 2KX3A 4NJ6A 2BKFA 4LJPB 4MJSA 3GOEA 4OVVA 2CU1A 2ZPYA 4MEMA 2GBJA 1GNUA 2J0MA 1GC7A 3IG3A 2Y5BB 4FULA 4PYZA 3P2BA 3O65B 1WR1A 3B08A 4EZLA 1E8XA 3CSTA 3S2AA 2KWUB 4W9IA 3VUWA 4P7IA 3HHMA 2PPHA 3GZNI 2KHWB 4EEWA 2VRRB 1WX7A 4AJYB 4K1RB 3V6EB 1C1YB 3U30A 2N1WA 3HK0A 3QJZA 4RM8A 3NHEB 3VAWA 2NCNA 4FBJB 3NZSA 1KM7A 2G3QB 3ZW3A 2KLGA 1E7VA 2Z0DB 1RLFA 1LM8B 4FJYA 5GMVA 3WAPA 3N30A 4DK5A 2C7NB 5G55A 2DX5B 4MELA 4W9CA 2M1MA 4PS7A 1EF5A 2LI5A 2KJHB 2LWPA 4GDKA 5J18A 4IWPA 5CX3A 2PJHA 2LASA 1AARA 1MG8A 4EUTA 1LFDA 2JF5A 4BKSA 2KVRA 3HM3A 3V62A 1E8YA 2LUEA 3A1QB 4TQ0A 3ZLZA 3ZUNA 5AEKB 1GUAB 2M0XA 2GBRA 4GOCA 2L0FA 3VUYA 4EKUA 1P3QU 2LGYA 3JSVA 4HPLB 3UGBB 4MSQB 2EKEC 3KUDB 1WGRA 3ZO5B 2MCNB 2B3AA 2KMAA 2MP2A 2IO3B 1WJUA 1YQBA 5AZGA 2DYBA 2RSUA 2AL3A 2BWES 2IO1B 4A3OA 1KJTA 3WANA 3W1SC 4CO7A 2XK5B 4BVUC 4BBNF 4GSWA 2GBNA 3WIMA 1FXTB 3AULA 3QC8B 2DAJA 1WXVA 1YX5B 2I1JA 1EF1A 2KTRB 4IW0A 1LXDA 3W1YA 3DQVA 4K7WA 4TUUA 2MBHA 3A33B 3R3MA 5DPSA 1Z2MA 4EFOA 4MGKE 2NPTA 4LCDE 2BYEA 3MJWA 2ZNVC 3OJ4B 4G11A 2ZVOA 3ZNGC 3UQBA 1H4RA 3VFKA 4KZ0A 1GG3A 2C9WB 2PE6B 4HK2A 2L00B 3APCA 1ZW7A 4ZDVA 2LRWA 3DOWA 3N3KB 1J8CA 1HE8A 2KOXA 2DENB 2C7HA 2ZPNA 2MSED 2UYZB 3DBHI 5D94A 3R66C 2KWVB 4XC2A 3H7SA 2KFKB 2L3ZA 2LXAA 4HCNB 1XT9B 3CMMB 3M95A 1WH3A 2KNBA 2HJ8A 2WYQA 3KVFB 5IA7A 3SDLC 3QQ8B 3QARA 1UBIA 2O6VA 3A9JA 1RRBA 5FR6A 2KJRA 3DBLI 3V61A 2N9EB 3KW5B 3VDZA 4B9KA 4GMVA 5HKHA 1P1AA 2FNJB 4RMAA 3EFUA 3H7PB 1OGWA 1SE9A 2IO0B 3M62B 3Q3FA 2D07B 2KD0A 4HXDA 4II2B 2V3SA 4IM0A 3MTNB 1X1MA 2BWFA 2KDIA 2HTHA 5EDSA 3K9OB 1OEYA 2JZ3B 5DCNA 3V60A 2ZCBA 2L0TA 3ZDTA 2V4LA 3A9KA 5JHAA 2L7RA 4IG7B 4XZ4A 4MH0E 2C5LC 2IYDB 2OJRA 2O2VA 4ANVA 1EUVB 3LDZE 3UINB 1WYWB 3KUCB 5L95C 4FHKA 3L08A 3VHTC 1WZ0A 2FCMA 3DVGX 3APFA 3AXCA 3C0RB 1I42A 4WWNA 4XX5A 1P9DU 5G2NA 2FAZA 3L10B 5J2RA 2J7QB 4A3PA 2JZZA 2L05A 1A5RA 4GIVA 1OEYJ 2PEAA 1TTNA 1WM3A 2K25A 2KFJA 3JYUA 4ZYNA 5LLIA 3ZNZB 4W9FA 3W1SA 4GU2A 3DVGY 3WA0A 2LGDA 3QX1A 1G6JA 3H9DA 4PS3A 4DDGD 5KHQA 4FJVB 2JUOA 5E6OA 4HDQA 5JH5C 3TIXA 3BY4B 2N7DA 3ZKJC 1UD7A 4MGZE 2NR2A 1P98A 3NOBA 2Z59B 2ZEQA 3RZFA 3PRPB 2KX0A 1Q0WB 3QAQA 2CHWA 3PRMB 4BOSC 4OVUA 2WWZA 1WMHB 4HCPB 4PYUA 3ZDMC 2JXXA 4NJ7A 2W9NA 4KIKA 2N1VA 1WXAA 2IZVB 4K7UA 4NAWB 5DPRA 3OAWA 2L76A 2D2QA 2NVUI 3TJPA 1WXMA 5CHFA 2RPQA 2KTFA 2KFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DHZ E;  4M8N A;  4TV3 A;  1SIF A;  3UIP B;  4WJO A;  2JRH A;  2KDB A;  1T0Y A;  2BPS A;  2LVP A;  2MWS B;  1WZ3 A;  2NBV B;  3M3J A;  4GB9 A;  4IM2 A;  4K7S A;  3ZRF A;  3UF8 A;  2R2Q A;  2LGX A;  4F8C B;  1WR6 E;  5TR5 A;  3VXW A;  2YVC A;  2IO2 B;  1E5W A;  4HWI B;  4HDO A;  2FCN A;  1WE7 A;  2KK8 A;  4BKT A;  4W9D A;  4ICV A;  3ZIM A;  1V2Y A;  1UEL A;  2MRP A;  4TKN A;  2ZVN A;  1KOT A;  3R7R A;  4FA6 A;  4B95 A;  2ZJD A;  5DPT A;  3QIJ A;  4EZJ A;  4GXB A;  2JT4 B;  2NBU A;  4LJO B;  1GJZ A;  2V1Y A;  3KH0 A;  1Z5S B;  1V81 A;  1WI0 A;  2G4S A;  3KYD D;  1VCB A;  3CSF A;  3T9L A;  4AOF A;  4MDK E;  5J17 A;  2JVC A;  5CTR C;  4II3 B;  4RM9 A;  3RUL A;  1YIW A;  2REX A;  1IP9 A;  2OOB B;  3NS8 A;  2N9X A;  2XBB C;  1D3Z A;  3ZTC A;  1WXS A;  1WX9 A;  3K9P B;  4MSM B;  4HVB A;  4FJZ A;  1VD2 A;  4AP4 C;  2BF8 B;  2G4D B;  4W9K A;  4G3X B;  4HPM B;  1CMX B;  2M8S A;  5CHW A;  4IUM B;  4W9G A;  2N4F A;  3MHS D;  1E8Z A;  3HM6 X;  4MGI E;  3L0W B;  2K6D B;  4GGQ A;  4A20 A;  4X57 B;  5L83 A;  4W9H A;  1Q5W B;  1WJ4 A;  2KC1 A;  1NDD A;  2KQ7 A;  4BBN C;  2BGF A;  3ENE A;  4JL9 A;  4IWO A;  2FUH B;  1J0G A;  3DVN U;  5D7G A;  1E8W A;  1V86 A;  2PE9 A;  4B6W A;  1YD8 U;  2CHX A;  2FCS A;  3B1L X;  3RCZ A;  2AWT A;  2FIF A;  3Q3J A;  2MLB A;  1V49 A;  3PHX B;  4GDK B;  3VH4 B;  4BOZ B;  3X0W A;  2BYF A;  2JWZ A;  3ECI A;  4I6L B;  4JGH B;  4AWJ A;  1E90 A;  2MBE A;  2RGF A;  4LDT B;  1ZKH A;  4DHJ B;  1ISN A;  1WFY A;  3PZD A;  3H1U A;  3VQI A;  4WWO A;  3ZVV A;  4WJQ A;  3ZRC A;  3TBL D;  3PRZ A;  3QA8 A;  2K39 A;  3A1Q A;  3JSV B;  3EC8 A;  3RYT A;  4IWQ A;  4I6N B;  2MX2 A;  3SHQ A;  4EOY A;  3QK0 A;  4CHK A;  4G50 A;  1LQB A;  2MP2 B;  1WM2 A;  3N32 A;  4FHJ A;  5E6P A;  2EMT A;  3IVF A;  1E7U A;  2IY1 B;  3TL5 A;  4MM3 A;  4M8M A;  5C23 A;  5LXH A;  4DXA B;  4CYE A;  3L17 A;  4NQK E;  2KXJ A;  1V9J A;  1NI2 A;  3WAO A;  1U4A A;  5CHV C;  2XK5 A;  4E3C A;  4KDI C;  3D32 A;  4BKG A;  2MBO A;  3L13 A;  1KLV A;  3VH3 B;  4F7Z A;  4FN2 A;  1YJ1 A;  4JLC A;  1UGM A;  2KTR A;  2XEW A;  3CF6 E;  1H8C A;  2GOW A;  1P0R A;  3A4S C;  2LXC A;  2NPT B;  3L54 A;  2N9P C;  2LVO A;  4I6P A;  2KDF B;  2DYO A;  1EO6 A;  4WWP A;  4DDI D;  1PQS A;  4ASW C;  4NY0 A;  5IAA C;  4ANU A;  3T8M A;  3AU5 A;  1WGH A;  2EMS A;  3DDC B;  5AZF A;  2KC2 A;  2KKC A;  2ASQ A;  3ML8 A;  4ANW A;  4JQW C;  4GDL B;  2LRU A;  4AJW A;  5DPW A;  5LXI B;  3EHV A;  3ZTD A;  4PS8 A;  2N7E A;  2KN5 A;  4ICU A;  4TQ1 A;  1C3T A;  4WJP A;  2DZJ A;  3JW0 X;  4KDL B;  3I3T B;  3OLM D;  2FID A;  3V6C B;  3AI5 A;  2M4N A;  1BT0 A;  1WF9 A;  3M63 B;  2O6V B;  3A9J B;  3DVN V;  3KYC D;  2K1F A;  3PLV A;  3VTW A;  2KAN A;  1RFA A;  3HIZ A;  4E74 A;  1WRD B;  3DBR I;  4HLE A;  1L7Y A;  2DZI A;  2K8H A;  1TGZ B;  2BYV E;  2KWC A;  1TBE A;  3BIN A;  3PS6 A;  5D2M B;  3UQA A;  1WJN A;  3X23 A;  2DAF A;  4WJN A;  4KSL C;  1RAX A;  2LD9 A;  3H7P A;  3PRE A;  2AYO B;  2CKH B;  2UWQ A;  3NZU A;  3L16 A;  2K8B A;  3ONS A;  1WX8 A;  3ZNH B;  2MQJ A;  4AUQ C;  4DBG A;  3IFW B;  2DHZ A;  1Q1O A;  2KDE B;  3OJ3 A;  4EZK A;  1WE6 A;  3A9K B;  1QZE A;  2D10 A;  1Y8R C;  1R4M I;  2K8C A;  4J6I A;  1M94 A;  2KLC A;  2O2V B;  4DWF A;  3B0A A;  4MJS B;  5D6J B;  3VUX A;  4ZRK A;  1F9J A;  4N9F 4;  2O6V D;  1XD3 B;  2JPH A;  4W9J A;  3JVZ X;  3AU4 A;  1S1Q B;  3EEC A;  3PGE A;  2CR5 A;  1GC6 A;  3ZNI D;  3H6N A;  2CS4 A;  4FLH A;  1OQY A;  2QHO A;  3RUI B;  2D11 A;  1L2N A;  2FCQ A;  2A5U A;  4DHZ B;  2YLM A;  1OTR B;  2J0J A;  2R2O A;  2L8J A;  3ALB A;  3RT3 B;  2KMC A;  2ZZP B;  4FAD A;  3PT2 B;  2MA9 B;  2MW5 A;  4ZRI A;  1UZX B;  3APD A;  3PV1 A;  3KUZ A;  3R7Q A;  3IBE A;  4G0N B;  1UH6 A;  3ML9 A;  1ZGU B;  4M0W B;  2NS5 A;  4JIO U;  2C60 A;  3NY5 A;  2KZR A;  3U7D A;  1V6E A;  2WX0 A;  3QHT A;  3TMP B;  3UIO B;  2DYM A;  3VTV A;  2NBW B;  3DCG A;  1R4N I;  1S3S G;  1V5T A;  2Z0E B;  3DBS A;  3RD2 A;  3A4R A;  5JHB A;  4IC7 B;  2WX1 A;  4ZRJ A;  2ZNV B;  4F1S A;  1SGH A;  2A4Z A;  4NQL B;  2ZCC A;  1IYF A;  2JRI B;  1XQQ A;  3WAL A;  1J19 A;  2LJ5 A;  3PSE B;  3QWZ B;  2WDT B;  4ANX A;  4BFR A;  3DPD A;  1JRU A;  4GDL A;  3VVW B;  4KIK B;  4NPN A;  1WMH A;  2CHZ A;  2GBM A;  2HD5 B;  3RZW C;  5E6N A;  2DZK A;  4NAW A;  2IBI B;  2KJ6 A;  3PLU A;  2AEH A;  2J0K A;  2BKR B;  4W9L A;  5BO4 B;  5KHO A;  2HE7 A;  1V5O A;  4K81 A;  4KSK C;  2I1K A;  4YL8 A;  2MBQ A;  4KZC A;  1WIA A;  2C7M B;  3U8Z A;  2D3G A;  2LZ6 A;  1WGG A;  2GBK A;  1I35 A;  2MBB B;  1IPG A;  1YX6 B;  1UBQ A;  3PTF C;  2DZM A;  4GN1 A;  3PPA A;  4WAA A;  3WAM A;  4IM3 A;  5JZE B;  3QCA A;  2KO3 A;  2RD0 A;  2GMI C;  1WGY A;  4LDT D;  2G45 B;  4KV2 A;  4W9E A;  3SU8 X;  2K6Q A;  4BKS D;  4DHJ D;  4KVG B;  1TZ1 A;  2RR9 A;  2AL6 A;  3IHP C;  1WJ6 A;  2JY6 A;  2M17 A;  1WY8 A;  3LJ3 A;  3PVL A;  1WGD A;  3SD5 A;  5C1Z A;  2KQS A;  1NBF C;  2IY0 B;  3PHW B;  1K8R B;  4E71 A;  4WQO B;  4URK A;  3TCA A;  4NNJ B;  1V80 A;  2LVQ A;  5AZH A;  4HJK A;  4MGY E;  3VTU A;  2KX3 A;  4NJ6 A;  2BKF A;  4LJP B;  4MJS A;  3GOE A;  4OVV A;  2CU1 A;  2ZPY A;  4MEM A;  2GBJ A;  1GNU A;  2J0M A;  1GC7 A;  3IG3 A;  2Y5B B;  4FUL A;  4PYZ A;  3P2B A;  3O65 B;  1WR1 A;  3B08 A;  4EZL A;  1E8X A;  3CST A;  3S2A A;  2KWU B;  4W9I A;  3VUW A;  4P7I A;  3HHM A;  2PPH A;  3GZN I;  2KHW B;  4EEW A;  2VRR B;  1WX7 A;  4AJY B;  4K1R B;  3V6E B;  1C1Y B;  3U30 A;  2N1W A;  3HK0 A;  3QJZ A;  4RM8 A;  3NHE B;  3VAW A;  2NCN A;  4FBJ B;  3NZS A;  1KM7 A;  2G3Q B;  3ZW3 A;  2KLG A;  1E7V A;  2Z0D B;  1RLF A;  1LM8 B;  4FJY A;  5GMV A;  3WAP A;  3N30 A;  4DK5 A;  2C7N B;  5G55 A;  2DX5 B;  4MEL A;  4W9C A;  2M1M A;  4PS7 A;  1EF5 A;  2LI5 A;  2KJH B;  2LWP A;  4GDK A;  5J18 A;  4IWP A;  5CX3 A;  2PJH A;  2LAS A;  1AAR A;  1MG8 A;  4EUT A;  1LFD A;  2JF5 A;  4BKS A;  2KVR A;  3HM3 A;  3V62 A;  1E8Y A;  2LUE A;  3A1Q B;  4TQ0 A;  3ZLZ A;  3ZUN A;  5AEK B;  1GUA B;  2M0X A;  2GBR A;  4GOC A;  2L0F A;  3VUY A;  4EKU A;  1P3Q U;  2LGY A;  3JSV A;  4HPL B;  3UGB B;  4MSQ B;  2EKE C;  3KUD B;  1WGR A;  3ZO5 B;  2MCN B;  2B3A A;  2KMA A;  2MP2 A;  2IO3 B;  1WJU A;  1YQB A;  5AZG A;  2DYB A;  2RSU A;  2AL3 A;  2BWE S;  2IO1 B;  4A3O A;  1KJT A;  3WAN A;  3W1S C;  4CO7 A;  2XK5 B;  4BVU C;  4BBN F;  4GSW A;  2GBN A;  3WIM A;  1FXT B;  3AUL A;  3QC8 B;  2DAJ A;  1WXV A;  1YX5 B;  2I1J A;  1EF1 A;  2KTR B;  4IW0 A;  1LXD A;  3W1Y A;  3DQV A;  4K7W A;  4TUU A;  2MBH A;  3A33 B;  3R3M A;  5DPS A;  1Z2M A;  4EFO A;  4MGK E;  2NPT A;  4LCD E;  2BYE A;  3MJW A;  2ZNV C;  3OJ4 B;  4G11 A;  2ZVO A;  3ZNG C;  3UQB A;  1H4R A;  3VFK A;  4KZ0 A;  1GG3 A;  2C9W B;  2PE6 B;  4HK2 A;  2L00 B;  3APC A;  1ZW7 A;  4ZDV A;  2LRW A;  3DOW A;  3N3K B;  1J8C A;  1HE8 A;  2KOX A;  2DEN B;  2C7H A;  2ZPN A;  2MSE D;  2UYZ B;  3DBH I;  5D94 A;  3R66 C;  2KWV B;  4XC2 A;  3H7S A;  2KFK B;  2L3Z A;  2LXA A;  4HCN B;  1XT9 B;  3CMM B;  3M95 A;  1WH3 A;  2KNB A;  2HJ8 A;  2WYQ A;  3KVF B;  5IA7 A;  3SDL C;  3QQ8 B;  3QAR A;  1UBI A;  2O6V A;  3A9J A;  1RRB A;  5FR6 A;  2KJR A;  3DBL I;  3V61 A;  2N9E B;  3KW5 B;  3VDZ A;  4B9K A;  4GMV A;  5HKH A;  1P1A A;  2FNJ B;  4RMA A;  3EFU A;  3H7P B;  1OGW A;  1SE9 A;  2IO0 B;  3M62 B;  3Q3F A;  2D07 B;  2KD0 A;  4HXD A;  4II2 B;  2V3S A;  4IM0 A;  3MTN B;  1X1M A;  2BWF A;  2KDI A;  2HTH A;  5EDS A;  3K9O B;  1OEY A;  2JZ3 B;  5DCN A;  3V60 A;  2ZCB A;  2L0T A;  3ZDT A;  2V4L A;  3A9K A;  5JHA A;  2L7R A;  4IG7 B;  4XZ4 A;  4MH0 E;  2C5L C;  2IYD B;  2OJR A;  2O2V A;  4ANV A;  1EUV B;  3LDZ E;  3UIN B;  1WYW B;  3KUC B;  5L95 C;  4FHK A;  3L08 A;  3VHT C;  1WZ0 A;  2FCM A;  3DVG X;  3APF A;  3AXC A;  3C0R B;  1I42 A;  4WWN A;  4XX5 A;  1P9D U;  5G2N A;  2FAZ A;  3L10 B;  5J2R A;  2J7Q B;  4A3P A;  2JZZ A;  2L05 A;  1A5R A;  4GIV A;  1OEY J;  2PEA A;  1TTN A;  1WM3 A;  2K25 A;  2KFJ A;  3JYU A;  4ZYN A;  5LLI A;  3ZNZ B;  4W9F A;  3W1S A;  4GU2 A;  3DVG Y;  3WA0 A;  2LGD A;  3QX1 A;  1G6J A;  3H9D A;  4PS3 A;  4DDG D;  5KHQ A;  4FJV B;  2JUO A;  5E6O A;  4HDQ A;  5JH5 C;  3TIX A;  3BY4 B;  2N7D A;  3ZKJ C;  1UD7 A;  4MGZ E;  2NR2 A;  1P98 A;  3NOB A;  2Z59 B;  2ZEQ A;  3RZF A;  3PRP B;  2KX0 A;  1Q0W B;  3QAQ A;  2CHW A;  3PRM B;  4BOS C;  4OVU A;  2WWZ A;  1WMH B;  4HCP B;  4PYU A;  3ZDM C;  2JXX A;  4NJ7 A;  2W9N A;  4KIK A;  2N1V A;  1WXA A;  2IZV B;  4K7U A;  4NAW B;  5DPR A;  3OAW A;  2L76 A;  2D2Q A;  2NVU I;  3TJP A;  1WXM A;  5CHF A;  2RPQ A;  2KTF A;  2KFK A; 
#chains in the Genus database with same CATH topology
 4DHZ E;  4M8N A;  1SIF A;  2W3S A;  3UIP B;  1TZO A;  2NBV B;  2BPS A;  3J9C A;  2MWS B;  1WZ3 A;  1I4X A;  2R2Q A;  4OZA A;  5TR5 A;  3HVD A;  1WE7 A;  3DHG C;  4W9D A;  4ICV A;  4TKN A;  2ZVN A;  4EZJ A;  4GXB A;  3P4S B;  3P4R B;  1V81 A;  2KN4 A;  4AOF A;  5J17 A;  4II3 B;  4RM9 A;  2PW9 A;  1F0Z A;  1IP9 A;  1WXS A;  1AWD A;  3K9P B;  4KGR A;  2BF8 B;  1I4R A;  2OJW A;  5CHW A;  2N4F A;  1E8Z A;  1C78 A;  1ET6 A;  4JL9 A;  4IWO A;  2PE9 A;  1YD8 U;  4L23 A;  2CHX A;  1QLB B;  2FCS A;  1V49 A;  3PHX B;  1SSN A;  3ECI A;  4I6L B;  4JGH B;  4AWJ A;  1E90 A;  2AQ3 B;  2MBE A;  4LDT B;  1F2R I;  1SEB D;  4JX1 C;  4DHJ B;  1WFY A;  2M56 B;  4AS1 A;  2CJO A;  3ZRC A;  3PRZ A;  1SE2 A;  2V3N A;  1HA5 A;  4C56 C;  3QK0 A;  4G50 A;  2MP2 B;  3N32 A;  1ZDV A;  5E6P A;  4O1N A;  4MM3 A;  3ZGZ A;  4OZC A;  3L17 A;  4NQK E;  2XK5 A;  4E3C A;  4N6E B;  1FNV A;  1RFK A;  1D5X C;  3VH3 B;  1UGM A;  2KTR A;  3SFE B;  2KAJ A;  2NTS A;  1GB1 A;  5EE9 A;  2N9P C;  2Z8L A;  4LNF A;  2WDR B;  2KDF B;  4ASW C;  1DGJ A;  5IAA C;  2K22 A;  3T8M A;  2N9K A;  2KQ4 X;  4JWU C;  2ASQ A;  4JQW C;  5LXI B;  3NZ3 A;  1VJK A;  2KN5 A;  3IT6 B;  3OLM D;  4P16 A;  4ZHO A;  1BT0 A;  1WF9 A;  1XLN A;  1J7B A;  4YSZ B;  5IN7 A;  3DVN V;  1WRD B;  3DBR I;  4HLE A;  5D2M B;  5BYR A;  3TEW A;  3U2S C;  2DAF A;  2V9H A;  2LHD A;  4KSL C;  2CKH B;  3L16 A;  2K8B A;  1WX8 A;  2MQJ A;  3TUO A;  2DHZ A;  1Q1O A;  2W3R A;  3OJ3 A;  2XN9 C;  3A9K B;  4XWW A;  1Y8R C;  2G1E A;  2KLC A;  2AX5 A;  3B0A A;  3RNG C;  5LNK 1;  3Q8B A;  4N58 A;  1XD3 B;  2JPH A;  3EEC A;  3PGE A;  1GC6 A;  2CS4 A;  4FLH A;  2JYT A;  1XCT L;  2D11 A;  2WS3 B;  2A5U A;  4DHZ B;  2WXG A;  2J0J A;  4FAD A;  3MP9 A;  1UZX B;  1ZUD 2;  3R2I A;  3R7Q A;  3IBE A;  4G0N B;  2DLB A;  2NS5 A;  4IKG A;  4JIO U;  3QHT A;  2NBW B;  2BS2 B;  3DCG A;  1HZ6 A;  2WX1 A;  2A4Z A;  4NQL B;  2JRI B;  3WAL A;  4ANX A;  4L2Y A;  4NPN A;  2CHZ A;  2GBM A;  1SIJ A;  5E6N A;  1UWM A;  2B76 B;  3HUI A;  2DZK A;  5GXG B;  3KQ4 A;  4LNO A;  3B2G A;  4KSK C;  3E9S A;  2MBQ A;  2C7M B;  4A90 A;  3MC0 B;  1PDX A;  1IPG A;  4OVZ A;  4WAA A;  3QCA A;  2RD0 A;  1HTQ A;  3P63 A;  3AE9 B;  4KV2 A;  3IHP C;  1PYW D;  1WJ6 A;  5H92 C;  3SD5 A;  2KQS A;  1NBF C;  3BYY B;  5AZH A;  4HJK A;  3VTU A;  1EWY C;  4OVV A;  3AEC B;  2WGS A;  2GBJ A;  1GNU A;  2J0M A;  1FM0 D;  1GC7 A;  2Y5B B;  1JWS D;  1PGB A;  4K3B A;  4P7I A;  2BYT A;  4ZRP A;  3HHM A;  2PPH A;  1FNU A;  3RPF C;  1WX7 A;  3HK0 A;  3NHE B;  1KM7 A;  4M01 A;  1ZXH A;  4FJY A;  2QDF A;  2M1M A;  1JCK B;  4PS7 A;  4IWP A;  2DWQ A;  3W5U B;  1LFD A;  1LGR A;  1IGC A;  3HM3 A;  1N61 A;  2LUE A;  3A1Q B;  3ZLZ A;  3UI3 A;  1GUA B;  2L0F A;  3VUY A;  2JZP A;  3NVV A;  1TKG A;  2QEJ C;  1NYQ A;  3KUD B;  1EU4 A;  2KMA A;  2MP2 A;  2IO3 B;  4C00 A;  2PIA A;  1KLG D;  1KJT A;  2JSV X;  3W1S C;  3WIM A;  3P1M A;  1FXT B;  2KDM A;  1CJE A;  3QC8 B;  4CQN A;  1WXV A;  1VZ6 A;  2I1J A;  5FK9 C;  1FD6 A;  5D3I B;  1I7H A;  1HTO A;  4TUU A;  5DPS A;  1Z2M A;  3B9J A;  5C2T B;  4LCD E;  3BK1 A;  2ZNV C;  3OJ4 B;  1H4R A;  3AEF B;  3VFK A;  2JU6 X;  4HK2 A;  2L00 B;  2WU5 B;  2DEN B;  1MI0 A;  4ACF A;  5D94 A;  3AE8 B;  3R66 C;  1L6V A;  1RYJ A;  4HCN B;  1PGX A;  1XT9 B;  1ZDX A;  3CMM B;  5IA7 A;  3SDL C;  3QAR A;  1UBI A;  2KJR A;  3DBL I;  2N9E B;  5HKH A;  3EFU A;  2D07 B;  4HXD A;  1L6U A;  3KLS X;  4KX6 B;  3VR8 B;  2VZK D;  5DCN A;  2ZCB A;  2PLP A;  3A9K A;  4IG7 B;  2C5L C;  3PO0 A;  2LUM A;  4ANV A;  3GE3 C;  2IGH A;  1VRA B;  3GB1 A;  1UWX A;  3APF A;  5BYQ A;  3AXC A;  5G5H A;  5J2R A;  1KH0 A;  1T6B X;  4GIV A;  2GRI A;  1WM3 A;  3JYU A;  4XGA B;  2KFJ A;  3ZNZ B;  3QX1 A;  1G6J A;  1FIQ A;  3H9D A;  4DDG D;  4LNK A;  4HDQ A;  5JH5 C;  3ZKJ C;  2N7D A;  1UD7 A;  4TMA B;  2NR2 A;  4LNI A;  1XF5 L;  4PYU A;  2JXX A;  4NJ7 A;  4K7U A;  1JWU D;  2D2Q A;  2SEB D;  3TJP A;  3LYY A;  4TV3 A;  1T0Y A;  3IXS A;  2WXH A;  3AMZ A;  2LGX A;  4F8C B;  1WR6 E;  3VXW A;  4HWI B;  3O13 A;  4BKT A;  2L52 A;  1V2Y A;  2WXR A;  2ZJD A;  3QIJ A;  2JT4 B;  2NBU A;  4LJO B;  2V1Y A;  1C9F A;  1DOY A;  2K5P A;  1Z5S B;  4LLG M;  2RDB C;  2G4S A;  1FCL A;  1VCB A;  1L0X B;  2GB1 A;  1N62 A;  4HVB A;  4FJZ A;  1VD2 A;  4W9K A;  2G4D B;  4G3X B;  4OW0 A;  4ZHP A;  1HXY D;  2WXQ A;  3MHS D;  1PUT A;  4MGI E;  2K6D B;  4GGQ A;  4X57 B;  4W9H A;  4BBN C;  2BGF A;  1QT9 A;  2PVO D;  3HRD D;  1J0G A;  5D7G A;  1V86 A;  2WXJ A;  2MHJ A;  2X38 A;  3R2T A;  3RCZ A;  2AWT A;  1E10 A;  3VH4 B;  2JWZ A;  4DQO C;  2RGF A;  1ZKH A;  1VLB A;  1L0Y B;  1ISN A;  3PZD A;  3N9Y C;  5BYS A;  1RM6 C;  5HI1 A;  4WWO A;  1I4H A;  2K39 A;  3A1Q A;  3JSV B;  3SHQ A;  1WRI A;  1V97 A;  1LQB A;  1V1P B;  1STE A;  4FHJ A;  3ZJT A;  1AW7 A;  4M8M A;  4DXA B;  1FO4 A;  1E9M A;  2INP E;  2LGS A;  3D32 A;  2Y5P A;  2TSS A;  4FN2 A;  1YJ1 A;  4JLC A;  5HHD G;  2XEW A;  2JWU A;  2V4I B;  3DWG C;  4HEA 1;  2LXC A;  3N20 C;  4DDI D;  4NY0 A;  4ANU A;  1WGH A;  1D5M C;  1TJE A;  3C19 A;  1TIF A;  3ZTD A;  4DXG A;  3IAS 1;  2DZJ A;  3JW0 X;  1JRO A;  3I3T B;  2FID A;  3V6C B;  2O6V B;  3PLV A;  3VTW A;  1VZ7 A;  3HIZ A;  2L83 A;  3N1Y C;  2DZI A;  2K8H A;  3BIN A;  2BYV E;  1TBE A;  2XNA C;  1WJN A;  4B0M A;  1LO5 D;  1RAX A;  2LD9 A;  2LHE A;  4DBG A;  4EZK A;  2D10 A;  1ZOY B;  5IP4 D;  2O2V B;  1DOI A;  4DWF A;  3VUX A;  2MJ3 A;  4UDU C;  4H2A A;  3AU4 A;  3EA6 A;  2WQY B;  2CR5 A;  2OED A;  3RUI B;  1OTR B;  1YMH E;  2R2O A;  3PT2 B;  2MA9 B;  4ZRI A;  1YJJ A;  5H8Y E;  1P7F A;  2BT6 A;  1C4A A;  4A8X C;  1XLQ A;  1KFY B;  3ML9 A;  2FE8 A;  4M0W B;  4YSY B;  2C60 A;  3U7D A;  1IBX B;  1E0Z A;  1UF0 A;  3A4R A;  5JHB A;  3DBR B;  2ZNV B;  4F1S A;  1SGH A;  1IYF A;  3V3X A;  4YTP B;  2LJ5 A;  3PSE B;  3RMK C;  3VVW B;  4GDL A;  5E6J A;  3RZW C;  3VR9 B;  4ZOH C;  4A9A A;  3ZQ4 A;  2BKR B;  4W9L A;  4K81 A;  4KZC A;  2AQ1 B;  1WGG A;  1XO3 A;  2GBK A;  1I35 A;  2BBC A;  1UBQ A;  2DZM A;  3PPA A;  3WAM A;  1ZPS A;  3EUB 2;  2YEP B;  1N60 A;  4W9E A;  5AUK A;  2K6Q A;  4BKS D;  2RR9 A;  2EEL A;  1WGD A;  4E71 A;  1K8R B;  1R7S A;  4WQO B;  4URK A;  2LVQ A;  3FC4 A;  1WGK A;  2BW2 A;  5BMI A;  4DXF A;  4MJS A;  4BZA A;  2CU1 A;  4MEM A;  3U52 E;  4C4V B;  3T3N A;  1FXA A;  4PYZ A;  3O65 B;  1AN8 A;  2BVC A;  2KWU B;  4AJY B;  4HJG E;  3VAW A;  3AEA B;  3DHH C;  2G3Q B;  1E7V A;  2Z0D B;  1RLF A;  3WAP A;  5GMV A;  4DK5 A;  5G55 A;  4RH6 A;  2DX5 B;  4XDC A;  1N63 A;  4MEL A;  3VRA B;  3BVZ A;  5J18 A;  1P7E A;  1AAR A;  2JF5 A;  4JPS A;  1MFW A;  4TQ0 A;  3ZUN A;  2MJE A;  2M0X A;  2GBR A;  4EKU A;  5BMH A;  3NVZ A;  1P3Q U;  2LGY A;  3URY A;  3JSV A;  4HPL B;  4MSQ B;  3Q8F A;  2W55 A;  1WGR A;  2B3A A;  3NRZ A;  1V1P A;  3P4P B;  5AZG A;  2DYB A;  2RSU A;  2AL3 A;  2ONQ A;  4A3O A;  3BYT B;  3WAN A;  4CO7 A;  3AED B;  4BVU C;  1QF6 A;  4GSW A;  3AUL A;  2DAJ A;  1YX5 B;  4A6Q A;  1XLO A;  1LXD A;  3W1Y A;  3DQV A;  3FKY A;  4WQM A;  3A33 B;  1XXG A;  3DHI C;  4IOI E;  4RNA A;  2MJD A;  2N9L A;  3UQB A;  2JX5 A;  2C9W B;  1TS2 A;  2PE6 B;  4YWG G;  1ZW7 A;  2KT7 A;  2MSE D;  2UYZ B;  3DBH I;  2KWV B;  2L3Z A;  2LXA A;  1WH3 A;  1T3Q A;  1K53 A;  4ZYS A;  1F77 A;  5D3D A;  2QMT A;  3AEG B;  2O6V A;  1NEK B;  3KW5 B;  1Y56 A;  4GMV A;  4XYC A;  1ZXI A;  4WWM A;  3FIL B;  1AYF A;  4RGM A;  2KDI A;  2BTE A;  5EDS A;  1OEY A;  3NUH B;  3Q3O C;  3ZJU A;  2L1A A;  5HG2 A;  3ZDT A;  2PKO A;  2V4L A;  5JHA A;  2WDV B;  2L7R A;  4XZ4 A;  4MH0 E;  2OJR A;  2O2V A;  1I4Q A;  3DWM A;  4WUR A;  3UIN B;  1YN3 A;  4FHK A;  3L08 A;  2ACZ B;  1FNW A;  2D5G A;  2FCM A;  1PGA A;  3AE7 B;  4XX5 A;  5G2N A;  2FAZ A;  2AQ2 B;  2QCZ A;  1T0S C;  5LLI A;  3W1S A;  1GB4 A;  3DVG Y;  1ACC A;  3WA0 A;  2LGD A;  3TEZ A;  3BVG A;  3FAH A;  1YN4 A;  3TIX A;  4M0W A;  1IBX A;  4M00 A;  4MGZ E;  1P98 A;  3NOB A;  3RZF A;  3DBL B;  1ROE A;  3PRP B;  2W54 A;  1Q0W B;  2D3C A;  4BOS C;  3OWE B;  2WWZ A;  4RGN A;  2WDQ B;  2W9N A;  1NVI D;  2N1V A;  3OAW A;  2H88 B;  2L76 A;  5CHF A;  2KFK A;  2WXK A;  3U4E G;  3AE2 B;  3I5J C;  2WXO A;  1J7C A;  2KDB A;  4GB9 A;  4K7S A;  4IM2 A;  3UF8 A;  2L32 A;  2IO2 B;  1E5W A;  4HDO A;  4MT5 A;  3ETR A;  2KK8 A;  1FPY A;  1UEL A;  3BK2 A;  2M19 A;  2MRP A;  4OZB A;  3AE3 B;  3R7R A;  1KOT A;  4B95 A;  5DPT A;  1GJZ A;  3KYD D;  4XDD A;  3CSF A;  2WP9 B;  1YIW A;  1TS3 A;  2REX A;  3ZXR A;  3NS8 A;  2XBB C;  3ZTC A;  4MSM B;  4C4V A;  1RWS A;  2UU7 A;  1CMX B;  5G5G A;  4IUM B;  3RI7 C;  3HM6 X;  5L83 A;  4A20 A;  1UNS A;  1C79 A;  1EU3 A;  2KC1 A;  1NDD A;  3MFG A;  2BS4 B;  2FUH B;  5T8I A;  3DVN U;  1JWB D;  1D4B A;  2YEP F;  4LK0 M;  3RNF C;  1FXI A;  3AEB B;  3Q3J A;  4GDK B;  1QIL A;  4BOZ B;  3X0W A;  2BYF A;  1TKE A;  1DYQ A;  1DOX A;  2QIL A;  4C7Y A;  4LNN A;  2DBY A;  1T5X D;  3H1U A;  3VQI A;  4WJQ A;  2X8X X;  1QOB A;  3RYT A;  4IWQ A;  2MX2 A;  4EOY A;  1B9R A;  4US8 A;  3L4P A;  1WM2 A;  2EMT A;  3IVF A;  1FRD A;  2IY1 B;  2K0P A;  5C23 A;  2WXN A;  4CYE A;  1D6E C;  1NI2 A;  1YOV B;  3WAO A;  4KDI C;  4BKG A;  3U7Z A;  1F52 A;  4KKJ A;  4F7Z A;  3CF6 E;  1P0R A;  3PZ7 A;  4A55 A;  1R4N B;  2DYO A;  1PQS A;  4B0E A;  2EMS A;  5AZF A;  2FUG 1;  3ML8 A;  4GDL B;  2E3T A;  4AJW A;  5DPW A;  3EHV A;  4ICU A;  2QJL A;  1C3T A;  5IO9 A;  4KDL B;  1BXT A;  1MHX A;  3AI5 A;  5HFY A;  2M4N A;  1RFA A;  4KKI A;  1L7Y A;  2IPK D;  3PS6 A;  1TGZ B;  2KWC A;  3UQA A;  4N59 A;  4WJN A;  3GS2 A;  4ARI A;  3FIL A;  2AYO B;  3NS1 A;  3NZU A;  3ZNH B;  3ONS A;  1TY0 A;  1V1O A;  4AUQ C;  1QOA A;  1CQV A;  4J6I A;  2K8C A;  1M94 A;  3RNC C;  2MH7 A;  4L1B A;  4MJS B;  4ZRK A;  1F9J A;  2O6V D;  3BVM A;  4W9J A;  1YQ3 B;  3ZNI D;  3H6N A;  1OQY A;  2QHO A;  3NVW A;  1L2N A;  3B2F A;  2YLM A;  1TS4 A;  3RT3 B;  3APD A;  4C80 A;  3KUZ A;  2KYW A;  1YJI A;  3V05 A;  2KZR A;  1VZ8 A;  1V6E A;  3UIO B;  3AE4 B;  1R4N I;  1S3S G;  1V5T A;  3DBS A;  1Q10 A;  1SE3 A;  3KWV A;  4JWS C;  1J19 A;  3QWZ B;  2WDT B;  3RNE C;  3DPD A;  2JQR B;  5I4D A;  3EFC A;  4KGS A;  2J42 A;  3NJT A;  4IDI A;  2IBI B;  2KJ6 A;  4RFB A;  2DNF A;  2J0K A;  4S0R A;  2LJI A;  1MJD A;  1WIA A;  3U8Z A;  4PT5 A;  4WH4 A;  1YX6 B;  1FRR A;  2KO3 A;  1WGY A;  4LDT D;  4DHJ D;  4D2K A;  2AL6 A;  2JY6 A;  2M17 A;  3PVL A;  1JQ4 A;  5C1Z A;  2IY0 B;  3PHW B;  4NNJ B;  1V80 A;  1B1Z A;  4K3C A;  2HDE A;  1MHH E;  4NJ6 A;  2BKF A;  4LJP B;  2ZPY A;  1L0V B;  3Q8A A;  2E6X A;  3IG3 A;  4FUL A;  2ICI A;  3P2B A;  1ET9 A;  1WR1 A;  3W5V B;  3TEY A;  3S2A A;  2G9H D;  2INN E;  4W9I A;  3VUW A;  3GZN I;  2QIE B;  2VRR B;  3IAM 1;  4K1R B;  3V6E B;  2N1W A;  3QJZ A;  3T3O A;  4FBJ B;  3NZS A;  1LM8 B;  3H8H A;  4P1B C;  4W9C A;  4EE2 A;  1TS5 A;  2LI5 A;  4GDK A;  5CX3 A;  4EUT A;  2KVR A;  2QC8 A;  2R61 A;  3UGB B;  2EKE C;  2NMQ A;  3I63 C;  3ZO5 B;  4RF1 A;  2MCN B;  2KMM A;  1TKY A;  2WHI A;  1YQB A;  2BB6 A;  2IO1 B;  2RDG A;  1SXT A;  4YTM B;  2GBN A;  1ZP0 B;  2QSD A;  2I2Y A;  2KAC A;  3RFZ B;  3Q3M C;  1EF1 A;  1JWA D;  4IW0 A;  3AM9 A;  1L5P A;  3AE6 B;  1SF0 A;  2V3P A;  3R3M A;  4XE0 A;  4HPP A;  4MGK E;  3MJW A;  4HRS A;  4G11 A;  5EE0 A;  2BS3 B;  4NZL B;  3ZNG C;  4WIP A;  1FCC C;  4PK1 A;  3N1Z C;  4ZDV A;  2LRW A;  3GE8 C;  4TSS A;  1JAL A;  1HE8 A;  2ZPN A;  1C4P A;  2KFK B;  1A70 A;  3M95 A;  2KNB A;  2HJ8 A;  2LEK A;  4RGT A;  5IOI A;  1IGD A;  3AH7 A;  2RMM A;  1RRB A;  3EGR A;  3AEE B;  3V61 A;  1K51 A;  3VDZ A;  4B9K A;  1QOG A;  2FNJ B;  1E7P B;  3H7P B;  4GLS C;  1SE9 A;  2IO0 B;  3M62 B;  3N1X C;  3Q3F A;  2KD0 A;  4II2 B;  2V3S A;  1X1M A;  1WXQ A;  3K9O B;  2JZ3 B;  1TYG B;  2L0T A;  2WLB A;  2ZW1 A;  2IYD B;  2INC C;  2RDH A;  1TY2 A;  1WYW B;  3KUC B;  3Q8C A;  5L95 C;  1K52 A;  2HJ1 A;  2LFI A;  2Y5C A;  3DVG X;  4P6V F;  4Q2J A;  2K3U A;  1P9D U;  2ZW0 A;  3SR6 A;  3L10 B;  4A3P A;  1WSP A;  2JZZ A;  1A5R A;  1OEY J;  2PEA A;  3MHZ A;  4ZYN A;  3DBH B;  4W9F A;  4ARC A;  4GU2 A;  4PS3 A;  4FXC A;  4FJV B;  1SB3 C;  2WU2 B;  5C3J B;  1MG4 A;  1NI3 A;  2Z59 B;  2Y3A A;  3E56 A;  1D5Z C;  3QAQ A;  2CHW A;  4OVU A;  1WMH B;  4HCP B;  3ZDM C;  4NAW B;  1WXA A;  1I4G A;  2KTF A;  2WXL A;  4WJO A;  2JRH A;  3M3J A;  2LVP A;  3MC9 A;  3ZRF A;  4US9 A;  1HQR D;  1XEE A;  2YVC A;  2FCN A;  1KTK A;  2GI9 A;  3ZIM A;  2D3A A;  1C76 A;  2RPV A;  4FA6 A;  4AQ7 A;  4HRO A;  2SAK A;  3KH0 A;  1WI0 A;  1ZE3 D;  2J53 A;  3T9L A;  2J4X A;  4MDK E;  2IJ0 A;  2JVC A;  5CTR C;  3RUL A;  1VR9 A;  4MH8 A;  1C4C A;  2OOB B;  2N9X A;  1D3Z A;  1WX9 A;  1BML C;  4AP4 C;  4HPM B;  2M8S A;  1KRH A;  1OQQ A;  1SJH D;  4W9G A;  1PFD A;  3L0W B;  2N0S B;  1Q5W B;  1WJ4 A;  3RNB C;  1CZP A;  2KQ7 A;  3NG0 A;  3IT4 B;  1QKZ A;  1WWT A;  3ENE A;  1T0Q C;  1ESF A;  1E8W A;  2NTT A;  4B6W A;  3Q3N C;  3B1L X;  4HKQ A;  2FIF A;  1BUI C;  2MLB A;  2HTM E;  2IDY A;  2K9X A;  1XLP A;  3I57 A;  1I4P A;  1F1H A;  1UGJ A;  3TEX A;  3ZVV A;  3TBL D;  3QA8 A;  1R4M B;  3EC8 A;  1N5W A;  4I6N B;  1KLU D;  4CHK A;  1YN5 A;  3BII D;  1SE4 A;  1E7U A;  2WXF A;  3TL5 A;  2OHF A;  5LXH A;  3NVY A;  1VDV A;  2M0A A;  2KXJ A;  1V9J A;  3KWL A;  4BAX A;  1U4A A;  5CHV C;  1KF6 B;  2WXP A;  2MBO A;  3L13 A;  1KLV A;  1H8C A;  2GOW A;  3A4S C;  2NPT B;  3HVZ A;  3L54 A;  2BB5 A;  2LVO A;  4I6P A;  1MVK A;  1FFU A;  1F2R C;  1EO6 A;  4WWP A;  2H89 B;  1EWC A;  3AU5 A;  3DDC B;  2KC2 A;  2LGI A;  1UUP A;  2KKC A;  4ANW A;  2LRU A;  5EE1 A;  4XWT A;  4YSX B;  4PS8 A;  3AB5 A;  2N7E A;  2PVG C;  3SEB A;  4TQ1 A;  4WJP A;  3M63 B;  3A9J B;  3KYC D;  2K1F A;  2KAN A;  4E74 A;  1OQR A;  4HKZ E;  1SJE D;  3VRB B;  2CJN A;  1L4D B;  1TT5 B;  3X23 A;  3H7P A;  3PRE A;  2UWQ A;  3IFW B;  4M02 A;  4LTU A;  2KDE B;  1WE6 A;  1QZE A;  3GP7 A;  1R4M I;  5D6J B;  1GPX A;  4N9F 4;  3AN1 A;  3JVZ X;  1S1Q B;  1CK1 A;  2CU3 A;  1NEN B;  4QAY A;  2FCQ A;  3ALB A;  2L8J A;  1K50 A;  4ZRQ A;  2KMC A;  2ZZP B;  1GOZ A;  2MW5 A;  1HEZ E;  3P42 A;  3PV1 A;  3OG5 A;  1UH6 A;  1ZGU B;  3NY5 A;  4ITK A;  2WX0 A;  4JE3 B;  3TMP B;  3VTV A;  1N6Z A;  2DYM A;  2Z0E B;  3I9V 1;  3RD2 A;  4IC7 B;  4ZRJ A;  2ZCC A;  1XQQ A;  2V0G A;  4BFR A;  1T0R C;  1JRU A;  4KIK B;  3Q8E A;  1WMH A;  2HD5 B;  1SBB B;  2VH1 A;  4NAW A;  3PLU A;  2AEH A;  4YXD B;  4REZ A;  5BO4 B;  5KHO A;  2EKI A;  1V5O A;  2HE7 A;  2I1K A;  4YL8 A;  3AV8 A;  2JYE A;  3BWU D;  2D3G A;  2LZ6 A;  3LXF A;  1N5X A;  2Q5W D;  1OFF A;  2MBB B;  1ENF A;  4YT0 B;  3CWI A;  3PTF C;  4GN1 A;  4RCO A;  3AE5 B;  5JZE B;  4IM3 A;  1C77 A;  2GMI C;  2G45 B;  2N7J A;  3SU8 X;  4KVG B;  1TZ1 A;  1E6E B;  1WY8 A;  3LJ3 A;  3TCA A;  1MPE A;  4MGY E;  2KX3 A;  1IUE A;  3PZ8 A;  3GOE A;  2J52 A;  3RN9 C;  2W82 A;  4MAC A;  1J7A A;  4RF0 A;  3B08 A;  4EZL A;  1E8X A;  3CST A;  1NYR A;  3C8Y A;  2KHW B;  4EEW A;  5BMG A;  1L4Z B;  1YNT E;  1C1Y B;  3U30 A;  4RM8 A;  2NCN A;  3TSS A;  3ZW3 A;  2KLG A;  4S17 A;  3N30 A;  2C7N B;  1EF5 A;  2KJH B;  2LWP A;  1FEH A;  2PJH A;  2LAS A;  1MG8 A;  2ON8 A;  1QOF A;  4USA A;  4BKS A;  3V62 A;  1YQ4 B;  1E8Y A;  5JXV A;  2KVZ A;  2WXI A;  5AEK B;  1QQR A;  4GOC A;  1HZ5 A;  2I38 A;  2JXT A;  4NJC A;  4WAF A;  4R3D A;  4MM3 B;  4NAM A;  3P4Q B;  1WJU A;  3MC8 A;  5MPO A;  3RNA C;  2BWE S;  2WNM A;  2XK5 B;  3Q2A C;  4BBN F;  3GZN B;  1JWM D;  2WXM A;  3ABV B;  3Q69 A;  2KTR B;  2KWD A;  1V8C A;  4K7W A;  3Q6B A;  2MBH A;  2IGG A;  2VH2 A;  4EFO A;  2NPT A;  5FKA C;  2BYE A;  2ZVO A;  4KZ0 A;  1GG3 A;  3ZXV A;  1XCQ L;  3APC A;  1FMA D;  3DOW A;  4RGO S;  3N3K B;  3W9C B;  1J8C A;  1EM7 A;  2KOX A;  2C7H A;  1M4V A;  5AUI A;  3WCQ A;  2VZK B;  2IND C;  4XC2 A;  3H7S A;  2FBW B;  1FFV A;  3KVF B;  2WYQ A;  4YTN B;  5IKC M;  3QQ8 B;  3SFD B;  3AE1 B;  3A9J A;  2PTL A;  5FR6 A;  3ZYY X;  1WYG A;  1P1A A;  4RMA A;  1JML A;  1JW9 D;  3W2D A;  1OGW A;  3ZJV A;  1JRP A;  4IM0 A;  4C7Z A;  3MTN B;  2BWF A;  2HTH A;  5TSS A;  3V60 A;  2IGD A;  5EE3 A;  1EUV B;  2MEK A;  3CIR B;  3LDZ E;  4OHJ A;  3VHT C;  1WZ0 A;  3C0R B;  1I42 A;  4WWN A;  4P1C C;  3R8B A;  2J7Q B;  3Q14 C;  2L05 A;  2PMV A;  1TTN A;  2K25 A;  2LMC A;  3BZD B;  2GLS A;  5FR3 A;  5KHQ A;  2JUO A;  5E6O A;  3BY4 B;  2D3B A;  3LB8 C;  2ZEQ A;  4J3O D;  2BQQ A;  2KX0 A;  3PRM B;  4KIK A;  2IZV B;  4KGT A;  5DPR A;  2NVU I;  1WXM A;  3MJ5 A;  2RPQ A;  1GAQ B; 
#chains in the Genus database with same CATH homology
 4DHZ E;  4M8N A;  4TV3 A;  1SIF A;  3UIP B;  4WJO A;  2JRH A;  2KDB A;  1T0Y A;  2BPS A;  2LVP A;  2MWS B;  1WZ3 A;  2NBV B;  3M3J A;  4GB9 A;  4IM2 A;  4K7S A;  3ZRF A;  3UF8 A;  2R2Q A;  2LGX A;  4F8C B;  1WR6 E;  5TR5 A;  3VXW A;  2YVC A;  2IO2 B;  1E5W A;  4HWI B;  4HDO A;  2FCN A;  1WE7 A;  2KK8 A;  4BKT A;  4W9D A;  4ICV A;  3ZIM A;  1V2Y A;  1UEL A;  2MRP A;  4TKN A;  2ZVN A;  1KOT A;  3R7R A;  4FA6 A;  4B95 A;  2ZJD A;  5DPT A;  3QIJ A;  4EZJ A;  4GXB A;  2JT4 B;  2NBU A;  4LJO B;  1GJZ A;  2V1Y A;  3KH0 A;  1Z5S B;  1V81 A;  1WI0 A;  2G4S A;  3KYD D;  1VCB A;  3CSF A;  3T9L A;  4AOF A;  4MDK E;  5J17 A;  2JVC A;  5CTR C;  4II3 B;  4RM9 A;  3RUL A;  1YIW A;  2REX A;  1IP9 A;  2OOB B;  3NS8 A;  2N9X A;  2XBB C;  1D3Z A;  3ZTC A;  1WXS A;  1WX9 A;  3K9P B;  4MSM B;  4HVB A;  4FJZ A;  1VD2 A;  4AP4 C;  2BF8 B;  2G4D B;  4W9K A;  4G3X B;  4HPM B;  1CMX B;  2M8S A;  5CHW A;  4IUM B;  4W9G A;  2N4F A;  3MHS D;  1E8Z A;  3HM6 X;  4MGI E;  3L0W B;  2K6D B;  4GGQ A;  4A20 A;  4X57 B;  5L83 A;  4W9H A;  1Q5W B;  1WJ4 A;  2KC1 A;  1NDD A;  2KQ7 A;  4BBN C;  2BGF A;  3ENE A;  4JL9 A;  4IWO A;  2FUH B;  1J0G A;  3DVN U;  5D7G A;  1E8W A;  1V86 A;  2PE9 A;  4B6W A;  1YD8 U;  2CHX A;  2FCS A;  3B1L X;  3RCZ A;  2AWT A;  2FIF A;  3Q3J A;  2MLB A;  1V49 A;  3PHX B;  4GDK B;  3VH4 B;  4BOZ B;  3X0W A;  2BYF A;  2JWZ A;  3ECI A;  4I6L B;  4JGH B;  4AWJ A;  1E90 A;  2MBE A;  2RGF A;  4LDT B;  1ZKH A;  4DHJ B;  1ISN A;  1WFY A;  3PZD A;  3H1U A;  3VQI A;  4WWO A;  3ZVV A;  4WJQ A;  3ZRC A;  3TBL D;  3PRZ A;  3QA8 A;  2K39 A;  3A1Q A;  3JSV B;  3EC8 A;  3RYT A;  4IWQ A;  4I6N B;  2MX2 A;  3SHQ A;  4EOY A;  3QK0 A;  4CHK A;  4G50 A;  1LQB A;  2MP2 B;  1WM2 A;  3N32 A;  4FHJ A;  5E6P A;  2EMT A;  3IVF A;  1E7U A;  2IY1 B;  3TL5 A;  4MM3 A;  4M8M A;  5C23 A;  5LXH A;  4DXA B;  4CYE A;  3L17 A;  4NQK E;  2KXJ A;  1V9J A;  1NI2 A;  3WAO A;  1U4A A;  5CHV C;  2XK5 A;  4E3C A;  4KDI C;  3D32 A;  4BKG A;  2MBO A;  3L13 A;  1KLV A;  3VH3 B;  4F7Z A;  4FN2 A;  1YJ1 A;  4JLC A;  1UGM A;  2KTR A;  2XEW A;  3CF6 E;  1H8C A;  2GOW A;  1P0R A;  3A4S C;  2LXC A;  2NPT B;  3L54 A;  2N9P C;  2LVO A;  4I6P A;  2KDF B;  2DYO A;  1EO6 A;  4WWP A;  4DDI D;  1PQS A;  4ASW C;  4NY0 A;  5IAA C;  4ANU A;  3T8M A;  3AU5 A;  1WGH A;  2EMS A;  3DDC B;  5AZF A;  2KC2 A;  2KKC A;  2ASQ A;  3ML8 A;  4ANW A;  4JQW C;  4GDL B;  2LRU A;  4AJW A;  5DPW A;  5LXI B;  3EHV A;  3ZTD A;  4PS8 A;  2N7E A;  2KN5 A;  4ICU A;  4TQ1 A;  1C3T A;  4WJP A;  2DZJ A;  3JW0 X;  4KDL B;  3I3T B;  3OLM D;  2FID A;  3V6C B;  3AI5 A;  2M4N A;  1BT0 A;  1WF9 A;  3M63 B;  2O6V B;  3A9J B;  3DVN V;  3KYC D;  2K1F A;  3PLV A;  3VTW A;  2KAN A;  1RFA A;  3HIZ A;  4E74 A;  1WRD B;  3DBR I;  4HLE A;  1L7Y A;  2DZI A;  2K8H A;  1TGZ B;  2BYV E;  2KWC A;  1TBE A;  3BIN A;  3PS6 A;  5D2M B;  3UQA A;  1WJN A;  3X23 A;  2DAF A;  4WJN A;  4KSL C;  1RAX A;  2LD9 A;  3H7P A;  3PRE A;  2AYO B;  2CKH B;  2UWQ A;  3NZU A;  3L16 A;  2K8B A;  3ONS A;  1WX8 A;  3ZNH B;  2MQJ A;  4AUQ C;  4DBG A;  3IFW B;  2DHZ A;  1Q1O A;  2KDE B;  3OJ3 A;  4EZK A;  1WE6 A;  3A9K B;  1QZE A;  2D10 A;  1Y8R C;  1R4M I;  2K8C A;  4J6I A;  1M94 A;  2KLC A;  2O2V B;  4DWF A;  3B0A A;  4MJS B;  5D6J B;  3VUX A;  4ZRK A;  1F9J A;  4N9F 4;  2O6V D;  1XD3 B;  2JPH A;  4W9J A;  3JVZ X;  3AU4 A;  1S1Q B;  3EEC A;  3PGE A;  2CR5 A;  1GC6 A;  3ZNI D;  3H6N A;  2CS4 A;  4FLH A;  1OQY A;  2QHO A;  3RUI B;  2D11 A;  1L2N A;  2FCQ A;  2A5U A;  4DHZ B;  2YLM A;  1OTR B;  2J0J A;  2R2O A;  2L8J A;  3ALB A;  3RT3 B;  2KMC A;  2ZZP B;  4FAD A;  3PT2 B;  2MA9 B;  2MW5 A;  4ZRI A;  1UZX B;  3APD A;  3PV1 A;  3KUZ A;  3R7Q A;  3IBE A;  4G0N B;  1UH6 A;  3ML9 A;  1ZGU B;  4M0W B;  2NS5 A;  4JIO U;  2C60 A;  3NY5 A;  2KZR A;  3U7D A;  1V6E A;  2WX0 A;  3QHT A;  3TMP B;  3UIO B;  2DYM A;  3VTV A;  2NBW B;  3DCG A;  1R4N I;  1S3S G;  1V5T A;  2Z0E B;  3DBS A;  3RD2 A;  3A4R A;  5JHB A;  4IC7 B;  2WX1 A;  4ZRJ A;  2ZNV B;  4F1S A;  1SGH A;  2A4Z A;  4NQL B;  2ZCC A;  1IYF A;  2JRI B;  1XQQ A;  3WAL A;  1J19 A;  2LJ5 A;  3PSE B;  3QWZ B;  2WDT B;  4ANX A;  4BFR A;  3DPD A;  1JRU A;  4GDL A;  3VVW B;  4KIK B;  4NPN A;  1WMH A;  2CHZ A;  2GBM A;  2HD5 B;  3RZW C;  5E6N A;  2DZK A;  4NAW A;  2IBI B;  2KJ6 A;  3PLU A;  2AEH A;  2J0K A;  2BKR B;  4W9L A;  5BO4 B;  5KHO A;  2HE7 A;  1V5O A;  4K81 A;  4KSK C;  2I1K A;  4YL8 A;  2MBQ A;  4KZC A;  1WIA A;  2C7M B;  3U8Z A;  2D3G A;  2LZ6 A;  1WGG A;  2GBK A;  1I35 A;  2MBB B;  1IPG A;  1YX6 B;  1UBQ A;  3PTF C;  2DZM A;  4GN1 A;  3PPA A;  4WAA A;  3WAM A;  4IM3 A;  5JZE B;  3QCA A;  2KO3 A;  2RD0 A;  2GMI C;  1WGY A;  4LDT D;  2G45 B;  4KV2 A;  4W9E A;  3SU8 X;  2K6Q A;  4BKS D;  4DHJ D;  4KVG B;  1TZ1 A;  2RR9 A;  2AL6 A;  3IHP C;  1WJ6 A;  2JY6 A;  2M17 A;  1WY8 A;  3LJ3 A;  3PVL A;  1WGD A;  3SD5 A;  5C1Z A;  2KQS A;  1NBF C;  2IY0 B;  3PHW B;  1K8R B;  4E71 A;  4WQO B;  4URK A;  3TCA A;  4NNJ B;  1V80 A;  2LVQ A;  5AZH A;  4HJK A;  4MGY E;  3VTU A;  2KX3 A;  4NJ6 A;  2BKF A;  4LJP B;  4MJS A;  3GOE A;  4OVV A;  2CU1 A;  2ZPY A;  4MEM A;  2GBJ A;  1GNU A;  2J0M A;  1GC7 A;  3IG3 A;  2Y5B B;  4FUL A;  4PYZ A;  3P2B A;  3O65 B;  1WR1 A;  3B08 A;  4EZL A;  1E8X A;  3CST A;  3S2A A;  2KWU B;  4W9I A;  3VUW A;  4P7I A;  3HHM A;  2PPH A;  3GZN I;  2KHW B;  4EEW A;  2VRR B;  1WX7 A;  4AJY B;  4K1R B;  3V6E B;  1C1Y B;  3U30 A;  2N1W A;  3HK0 A;  3QJZ A;  4RM8 A;  3NHE B;  3VAW A;  2NCN A;  4FBJ B;  3NZS A;  1KM7 A;  2G3Q B;  3ZW3 A;  2KLG A;  1E7V A;  2Z0D B;  1RLF A;  1LM8 B;  4FJY A;  5GMV A;  3WAP A;  3N30 A;  4DK5 A;  2C7N B;  5G55 A;  2DX5 B;  4MEL A;  4W9C A;  2M1M A;  4PS7 A;  1EF5 A;  2LI5 A;  2KJH B;  2LWP A;  4GDK A;  5J18 A;  4IWP A;  5CX3 A;  2PJH A;  2LAS A;  1AAR A;  1MG8 A;  4EUT A;  1LFD A;  2JF5 A;  4BKS A;  2KVR A;  3HM3 A;  3V62 A;  1E8Y A;  2LUE A;  3A1Q B;  4TQ0 A;  3ZLZ A;  3ZUN A;  5AEK B;  1GUA B;  2M0X A;  2GBR A;  4GOC A;  2L0F A;  3VUY A;  4EKU A;  1P3Q U;  2LGY A;  3JSV A;  4HPL B;  3UGB B;  4MSQ B;  2EKE C;  3KUD B;  1WGR A;  3ZO5 B;  2MCN B;  2B3A A;  2KMA A;  2MP2 A;  2IO3 B;  1WJU A;  1YQB A;  5AZG A;  2DYB A;  2RSU A;  2AL3 A;  2BWE S;  2IO1 B;  4A3O A;  1KJT A;  3WAN A;  3W1S C;  4CO7 A;  2XK5 B;  4BVU C;  4BBN F;  4GSW A;  2GBN A;  3WIM A;  1FXT B;  3AUL A;  3QC8 B;  2DAJ A;  1WXV A;  1YX5 B;  2I1J A;  1EF1 A;  2KTR B;  4IW0 A;  1LXD A;  3W1Y A;  3DQV A;  4K7W A;  4TUU A;  2MBH A;  3A33 B;  3R3M A;  5DPS A;  1Z2M A;  4EFO A;  4MGK E;  2NPT A;  4LCD E;  2BYE A;  3MJW A;  2ZNV C;  3OJ4 B;  4G11 A;  2ZVO A;  3ZNG C;  3UQB A;  1H4R A;  3VFK A;  4KZ0 A;  1GG3 A;  2C9W B;  2PE6 B;  4HK2 A;  2L00 B;  3APC A;  1ZW7 A;  4ZDV A;  2LRW A;  3DOW A;  3N3K B;  1J8C A;  1HE8 A;  2KOX A;  2DEN B;  2C7H A;  2ZPN A;  2MSE D;  2UYZ B;  3DBH I;  5D94 A;  3R66 C;  2KWV B;  4XC2 A;  3H7S A;  2KFK B;  2L3Z A;  2LXA A;  4HCN B;  1XT9 B;  3CMM B;  3M95 A;  1WH3 A;  2KNB A;  2HJ8 A;  2WYQ A;  3KVF B;  5IA7 A;  3SDL C;  3QQ8 B;  3QAR A;  1UBI A;  2O6V A;  3A9J A;  1RRB A;  5FR6 A;  2KJR A;  3DBL I;  3V61 A;  2N9E B;  3KW5 B;  3VDZ A;  4B9K A;  4GMV A;  5HKH A;  1P1A A;  2FNJ B;  4RMA A;  3EFU A;  3H7P B;  1OGW A;  1SE9 A;  2IO0 B;  3M62 B;  3Q3F A;  2D07 B;  2KD0 A;  4HXD A;  4II2 B;  2V3S A;  4IM0 A;  3MTN B;  1X1M A;  2BWF A;  2KDI A;  2HTH A;  5EDS A;  3K9O B;  1OEY A;  2JZ3 B;  5DCN A;  3V60 A;  2ZCB A;  2L0T A;  3ZDT A;  2V4L A;  3A9K A;  5JHA A;  2L7R A;  4IG7 B;  4XZ4 A;  4MH0 E;  2C5L C;  2IYD B;  2OJR A;  2O2V A;  4ANV A;  1EUV B;  3LDZ E;  3UIN B;  1WYW B;  3KUC B;  5L95 C;  4FHK A;  3L08 A;  3VHT C;  1WZ0 A;  2FCM A;  3DVG X;  3APF A;  3AXC A;  3C0R B;  1I42 A;  4WWN A;  4XX5 A;  1P9D U;  5G2N A;  2FAZ A;  3L10 B;  5J2R A;  2J7Q B;  4A3P A;  2JZZ A;  2L05 A;  1A5R A;  4GIV A;  1OEY J;  2PEA A;  1TTN A;  1WM3 A;  2K25 A;  2KFJ A;  3JYU A;  4ZYN A;  5LLI A;  3ZNZ B;  4W9F A;  3W1S A;  4GU2 A;  3DVG Y;  3WA0 A;  2LGD A;  3QX1 A;  1G6J A;  3H9D A;  4PS3 A;  4DDG D;  5KHQ A;  4FJV B;  2JUO A;  5E6O A;  4HDQ A;  5JH5 C;  3TIX A;  3BY4 B;  2N7D A;  3ZKJ C;  1UD7 A;  4MGZ E;  2NR2 A;  1P98 A;  3NOB A;  2Z59 B;  2ZEQ A;  3RZF A;  3PRP B;  2KX0 A;  1Q0W B;  3QAQ A;  2CHW A;  3PRM B;  4BOS C;  4OVU A;  2WWZ A;  1WMH B;  4HCP B;  4PYU A;  3ZDM C;  2JXX A;  4NJ7 A;  2W9N A;  4KIK A;  2N1V A;  1WXA A;  2IZV B;  4K7U A;  4NAW B;  5DPR A;  3OAW A;  2L76 A;  2D2Q A;  2NVU I;  3TJP A;  1WXM A;  5CHF A;  2RPQ A;  2KTF A;  2KFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...