1MGRA

Crystal structure of rnase sa3,cytotoxic microbial ribonuclease
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
97
structure length
97
Chain Sequence
VKAVGRVCYSALPSQAHDTLDLIDEGGPFPYSQDGVVFQNREGLLPAHSTGYYHEYTVITPGSPTRGARRIITGQQWQEDYYTADHYASFRRVDFAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Links X-ray Structure of Two Crystalline Forms of a Streptomycete Ribonuclease with Cytotoxic Activity
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa3
total genus 19
structure length 97
sequence length 97
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1mgrA00
2HOHA 1HYFA 1SARA 1TTOA 1I70A 3AHWA 1B3SA 1BGSA 1I2EA 1YNVX 3HOHA 1BNGA 1LOWA 1BNJA 7GSPA 1BNRA 1TRQA 3WHOA 2KAAA 2F5WA 1DETA 1BSCA 2SARA 1I8VA 3Q3FA 4HOHA 1BANA 1BNSA 2BU4A 1BUJA 1RGAA 1I3IA 1GSPA 4BU4A 4GSPA 1PY3A 1IYYA 1X1XA 2RNTA 1RGCA 1B2ZA 1B2UA 5RNTA 1BNFA 1RGGA 3BU4A 5BU4A 9RNTA 1B2MA 2BIRA 1I2FA 1MGWA 2C4BA 1DE3A 1RHLA 4J5KA 1FUSA 2F56A 1RGEA 1UCJA 1B2XA 3SYUA 1I3FA 1FYSA 8RNTA 1T2HA 4HAAA 3D5GA 1BSDA 1BAOA 1LOVA 2KF5A 1RCLA 2F4YA 1UCIA 1BRSA 5BIRA 1BIRA 1RTUA 1A2PA 1BRKA 3D4AA 1LOYA 1I0XA 6GSPA 1RSNA 3AGOA 1FW7A 1B21A 2RBIA 1LRAA 4J5GA 4BIRA 1BRHA 3DH2A 1TRPA 3WR2A 1RGHA 3KCHA 1X1UA 2GSPA 5GSPA 1BVIA 1BSAA 1R4YA 5HOHA 1FZUA 3DGYA 6RNTA 1BRJA 1X1YA 1GMPA 1AQZA 2F5MA 2ZA4A 1RLSA 2KF3A 1ZGXA 1LNIA 3BIRA 1BOXA 1JBSA 1Q9EA 2KF4A 1C54A 1YGWA 7RNTA 1RGKA 3D5IA 1B27A 1RNTA 1RGFA 4GHOA 1BSBA 1GOVA 3RNTA 3A5EA 1BRGA 1I0VA 3AGNA 1B20A 1MGRA 1BNEA 1BRNL 1B2SA 1RMSA 1AY7A 1RN1A 1UCLA 1I2GA 3URPA 1GOUA 1G02A 1HZ1A 1RCKA 1YVSA 1JBTA 1RNBA 2AADA 1BU4A 1GMRA 3AHSA 1GOYA 1UCKA 3GSPA 1PYLA 1RN4A 1RDSA 1JBRA 1CH0A 1FUTA 1GMQA 1BSEA 4RNTA 2AAEA 1X1WA 2KF6A 1BNIA 1T2IA 1BRIA 1RGLA
chains in the Genus database with same CATH superfamily
1VQM3 1LVNA 1JKGB 1RJOA 3FCSB 1SARA 4KFDA 3KIIA 5LC7A 1D6UA 1YNVX 3LTCA 3EC9A 4R9LA 2CX1A 4GB5A 3FH1A 1BNJA 5IEPA 1TRQA 1ZO2A 4N3VA 4L8OA 1NWWA 1DETA 4KFFA 3ZFZA 3CME3 1BSCA 3MG1A 2BO9B 2K3DA 3Q3FA 4HOHA 3KZTA 2CK3H 3NM2A 1N9JA 2QGUA 3G6E3 3UL5A 1KC84 3CPOA 4HM6B 4BU4A 2A15A 3FKAA 4GSPA 3VF1A 3WOFB 1X1XA 2LYXA 2RNTA 2WOFA 2XF3A 1RGCA 3EN8A 2R41A 1B2UA 5RNTA 3WODG 1BNFA 3KE7A 1Q7HA 1RGGA 3BU4A 5BU4A 3UNLA 5IENA 2C11A 1HU9A 4XDWA 1G96A 3MKIA 3CC43 1QJGA 1MGWA 1UW1A 1A2VA 3B8LA 3BNBA 2H0GA 1DYUA 4GL6A 1FUSA 1ZS7A 1UCJA 2OCTA 3SYUA 3LTDA 3S29A 1FGTA 4Q53A 1IK3A 1T2HA 3H51A 4HAAA 5BXQA 2KF5A 3B4PA 4EV2A 2ML6A 2F4YA 1UCIA 4OUQA 1UGHI 1YVBI 2BMQB 4FMDA 5BIRA 2HMNB 1DMNA 1FGRA 3EHCA 3H3HA 3I553 1A2PA 1OUNA 4EBGA 5IG4A 1LNHA 1WNHA 3D4AA 4LMIA 2W0QA 1SPUA 1OHOA 3AMOA 1TIJA 2W56A 5AEUB 2Z6BA 1FW7A 1B21A 4BTYA 1LRAA 4BIRA 3EF8A 4N6MA 5M19A 1EEJA 2CKFB 1IV7A 3KCHA 5G2GA 3NQZA 1JN5B 1LOXA 3IJEB 4WHAA 1AV4A 3FZWA 3DGYA 2Y74A 3FSDA 6RNTA 1BRJA 1IVUA 3GAXA 1N9EA 1GMPA 1ISKA 1NB3I 1TJDA 2F5MA 1WMOA 4K1UA 1L5GB 2YFLB 1KWIA 1ZGXA 2KF3A 4N6LA 1FA3A 1LNIA 1M1XB 3JUPA 1NJI4 1YGWA 2XFSA 4KFEA 1B27A 2M7OA 3PZWA 1GS3A 2OOVC 5AIHA 1GOVA 2XSOB 3A5EA 3STDA 2F98A 3DZLA 1N5HA 1N8QA 3J7Yd 1OCVA 2P05A 2CC3A 3I563 5IEOA 2QA43 1B2SA 1O7MB 1EA2A 2R4IA 1I2GA 3K9MC 4O8SA 1W02A 5IG5A 3NM7A 1JBTA 1IV9A 2P0XA 2W9QA 3I0YA 3Q90A 1T3BA 4HYZA 1YHQ3 1GOYA 1UCKA 3GSPA 1PYLA 1JBRA 1RDSA 1FUTA 3CNXA 1K9M4 2RCDA 1QAKA 1X1WA 4LEHA 2MC8A 1WMPA 1BNIA 1DMMA 3Q1CA 1W5ZA 1BRIA 4MMYB 3V98A 1EG9B 3PCSA 1STFI 1TU5A 5AEWB 3RGAA 3CCV3 1I2EA 1BGSA 1IT8A 4O02B 1US1A 1J2BA 3CU3A 1NB5I 2W2CA 3EJVA 3N9HA 7GSPA 4HM8B 3F40A 2Z7AA 1ULIB 3LH4A 3ALAA 2ZL8A 3CCQ3 1JNQA 2K54A 5CK6A 3FG4A 1BANA 1BNSA 2GXFA 2QIYA 4R9KA 3LMLA 5FW5A 3Q2PA 3LXUX 2B1XB 1W00A 1GSPA 3NBBA 1QVF2 1VQQA 1PY3A 3X41A 4ZM8A 3MWZA 5JBSA 3OX9A 3F14A 2KXGA 5EQLA 3WA3A 3UB1A 3D3LA 2XRXB 1B2MA 1V58A 5KP3A 3LZAA 1I2FA 2CHCA 1GD3A 2C4BA 1QMAA 1RHLA 1LXEA 3FG3A 2CFKA 4CCVA 5IG3A 1OF5A 2CG0A 2HMJB 1MOLA 3DXOA 5JPUA 1BSDA 4XM4A 2STDA 1RCLA 1VQ63 1FGMA 3BNEA 3NHXA 3E99A 1ULJB 3PXMA 1VQ93 4NPBA 5AYRB 1RKYA 1RN7A 2ZHXB 3UL6A 2E2TA 4O2HA 4LZIA 1E3VA 3GZRA 4N6NB 1GY7A 5IG0A 3V92A 3CD63 1UDII 4PEJA 4EW5A 4J5GA 3L0RA 4WYKA 5CLKA 5AIGA 1O7WB 2W9PA 2D42A 1BRHA 1E97A 1TRPA 2OQEC 5EEOA 5D82A 1X1UA 3CPW2 3K7CA 1ASKA 1MWSA 2GEXA 3ZG0A 1BSAA 1R4YA 5IF6A 1AVLA 1NU3A 4TX4A 1ROVA 3HX8A 2B24B 2H0IA 3EBTA 3OV4A 1X1YA 4X2OA 4EC6A 1TFKA 3AMOB 2ZA4A 1O7PB 2C10A 2KRTA 2XGNA 3BIRA 1BOXA 3WDGB 1M9GA 2GEYA 2IA7A 4O3VA 2ZDJA 4IPBA 2PZVA 2RGQA 2E2UA 3D5IA 3EB8A 5D81A 3SEDA 1BSBA 7RNTA 3RNTA 3G713 1VQ73 1JB2A 2CWUA 3RGRA 5FGOA 2FGTA 4FMCA 4N6UA 1YJN3 1EQKA 1N8R4 2BNGA 4RBNA 3KKGA 3MG2A 3LTBA 3LYGA 5KP4A 3NXJA 2XFTA 1LQMB 3K5TA 4HM5B 4BTXA 4BTWA 1BNEA 2K0MA 3SX1A 3CCM3 1RMSA 2UGIA 1AY7A 2F86B 5CXOA 2IUJA 4XDVA 1N5PA 4HBRA 3FG1A 1VQ53 4OVMA 1CYUA 4EYCA 1Q864 1MNLA 1GOUA 1HZ1A 4QWTA 1WTHA 5STDA 3S28A 1MWRA 4FCJA 2CW9A 4OK0A 4KT3B 1KQS2 2IY2A 1BU4A 1D6YA 1GMRA 3ER7A 5DREA 1Q40B 3JUQA 1JZOA 1OGXA 2UUGC 2W56B 1Q7Y4 1SQWA 3SOAA 3WA2X 4RNTA 2AAEA 8RNTA 4ORLA 3X3ZA 4ILFA 1GY6A 1HYFA 3EX9A 4N6OB 1UI7A 3VSYA 1I70A 1NNVA 3CCU3 2WO0A 3AHWA 3NUVA 4KVHA 1IVWA 3D79A 4LGQA 1Z1SA 2OTL3 2MF7A 4N6TA 5M18A 1Q814 1JKGA 1R4CA 1RRHA 2KCDA 3CC73 2OTJ3 3ECFA 2D1WA 4HVNA 2HMLB 2KAAA 1GYBA 3JUNA 3IPTA 5AI1A 1EKMA 3DUKA 4R4KA 1FGOA 1DVDA 3QRDA 3B7CA 1BUJA 5A0OB 4R80A 1RGAA 5LC6A 4FMAA 3DY5A 4HZBB 1UUVB 3JUOA 3U97A 2P0MA 2V1LA 1IYYA 2GBWB 1YJW3 2WOHA 4WP5A 1YI23 2UX0A 2Y73A 1A67A 1BUQA 4N6V0 4KZ1A 3LT9A 1U8CB 1DMQA 5AIFA 4AKYA 1O7NB 9RNTA 3HZPA 1KSIA 1OH0A 2BIRA 5KP1A 4L7KA 2P09A 4NREA 4LYLB 4MEIA 1DE3A 3PCRA 1D6ZA 1O7GB 2F56A 2Z77A 3OXAA 1B2XA 3EBYA 5AIIA 3VGNA 2LQVA 1I3FA 3CNMA 3JVCA 5BVBA 1VQ83 3M8CA 4HM3B 1BAOA 4HM0B 3F7XA 3NQYA 3G0KA 4HJLB 3ZG5A 3CCE3 1IQ8A 1BIRA 4X2HA 4BL3A 3CCL3 3CCR3 1OHPA 2JQ5A 4H61A 3ROBA 1W7CA 3G8ZA 1I0XA 4EXRA 4BL2A 1KD14 6GSPA 1W6CA 4AEQA 3AGOA 3OWYA 1OACA 2RBIA 4WWUC 2XR8B 2WGQA 1WMNA 3N8BA 1GD4A 3WR2A 1W2ZA 3NV0B 3DGOA 2Q07A 2JDIH 5GSPA 2XGLA 3MYTA 3S67A 3EQQB 5M1AA 1UGIA 2INXA 1FZUA 3DGNA 1TFOA 3LOYA 1QAFA 5AYSC 1V74A 1VQN3 1T5YA 4STDA 4CJNA 2O9UX 1W2B2 1AQZA 5ELUA 2WGOA 3G16A 1RLSA 1JBSA 1JRQA 5D83A 1Q9EA 4K61A 3PYJA 4FCZA 3F9SA 5DRVA 4H3UA 3SLUA 1VQ43 1PFPA 4GHOA 1YIT3 4WYKB 5G1KA 3MHEA 1I0VA 7STDA 1WQLB 3MG3A 4LSOA 2IMJA 3AGNA 3KFQC 2RSXA 3F8HA 3D9RA 4RNYA 1JN5A 3GWRA 2E2VA 4XBXA 1BRNL 1RN1A 1UCLA 1W6GA 6STDA 2HMKB 4HZ9B 1Q42A 1IQXA 1STDA 1DVCA 1W4NA 1OPYA 1LQGC 1IU7A 3U1WA 1IVVA 2IUKA 2RFRA 1YVSA 1RCKA 3F8XA 1TP6A 4G1MB 4K90B 2BMOB 2SBLA 1QVG2 2QEX3 3V99A 3TDGA 8CHOA 3AHSA 3MPHA 1VQK3 3B4OA 2HMMB 1RN4A 2CFLA 2W04A 3SVAA 2CIUA 2O3OA 1JB4A 1GMQA 1AR0A 4HM7B 1YIJ3 1U5OA 2OOVA 1VZZA 2KF6A 1T2IA 3X3XA 3PGBA 4MJDA 4HKVB 1RGLA 4CPKA 2HOHA 1FUWA 2BHMA 2XEPA 1TTOA 3PS8A 1A90A 1VQP3 2YFIB 4XB5A 1JB5A 4IIAA 3CC23 1B3SA 3X3YA 3HOHA 1A2KA 4XBYA 4HM4B 1BNGA 3K0ZA 3WMDA 1LOWA 3X40A 1M904 1TUHA 1BNRA 1RRLA 1OGZA 1S5AA 1UUGB 2OWPA 2P38A 3S5CA 3WHOA 2FNQA 1G0TA 1M1K4 2F5WA 3BB9A 1Q40A 3KSED 2GBXB 2SARA 1I8VA 3S27A 3OWUA 3O8YA 2BU4A 2H0HA 3T8NA 3HK4A 2ML5A 1W6YA 5ELJA 1I3IA 1V57A 4K1VA 2CWTA 4JF8A 2FXTA 3DGMA 2CFDA 3FF0A 3K63A 1B2ZA 3KSPA 2L4VA 1PU4A 3CXC2 1Q824 1IDPA 5IW9A 3F7SA 3HI7A 1SIIA 1NDOB 2F99A 4HM2B 3OWSA 3QK9A 4CDLA 5IERA 5CF2A 4J5KA 1F8NA 1JZDA 3GZBA 4DKIA 1RGEA 3T0UA 1JJ22 2IYJA 3OW22 3MSOA 1FYSA 5I97A 2BMRB 4WFOA 5JPPA 3D5GA 4R1KA 1Y4KA 1LOVA 5CF1A 2W6JH 4JRFA 4AKZA 3BLZA 3GZYB 2CWVA 3G4S3 3A76A 1BRSA 1EUIC 3N54B 5TGNA 1ROAA 2YX9A 3EN1B 1JV2B 4I5QA 3WOEB 1K41A 1RTUA 2J8XB 1MWUA 1BRKA 3CCS3 1K8A4 1K734 3NBJA 1LOYA 1C7HA 3EE1A 1HKXA 1QALA 4U13A 1RSNA 1UUWB 4RZMA 1GY5A 3SXXA 4HM1B 2YFJB 3IMAB 3KN4A 2CX0A 3DGLA 2GU1A 3DH2A 1IVXA 1RGHA 3LT8A 3NV0A 1K28A 4L8PA 4J9AA 1YGEA 2GSPA 3FF2A 1IT7A 1BVIA 3HIIA 3BNCA 3NBRA 4XBTA 5HOHA 2BT3A 2I9WA 3CCJ3 1S723 2W03A 1UI8A 4MMZB 4RNZA 1IQYA 1CQSA 2HMOB 3CMA3 2GU3A 2OQEA 3NX0A 3T8UA 2KF4A 3LTAA 5HGRA 1C54A 1SIHA 1E3RA 1RGKA 1RNTA 1RGFA 1CEWI 1NO3A 4FR9A 3HIGA 1BRGA 3X42A 4EV5A 3RDEA 3SOYA 1ZX2A 3FGYA 1B20A 1MGRA 1O7HB 1OHSA 2CFWA 1FGQA 2CFGA 4FMBA 2PNCA 1CYVA 2CH9A 1AVKA 3JUMA 4I4KA 1VQO3 4NHFA 3URPA 1SJWA 1VQL3 1G02A 2XSHB 1RNBA 1OF5B 2AADA 2XH9A 2CG1A 5EVHA 3FLJA 2Z76A 3BNDA 4IT7A 3GRDA 1MWTA 1W01A 3UJMA 1CH0A 2L1SA 3GZXB 4MMXB 1BSEA 4J8TA 3DMCA 1YJ93 3DM8A 4FCMA 5G1LA
chains in the Genus database with same CATH topology
2HOHA 1HYFA 1SARA 1TTOA 1I70A 3AHWA 1B3SA 1BGSA 1I2EA 1YNVX 3HOHA 1BNGA 1LOWA 1BNJA 7GSPA 1BNRA 1TRQA 3WHOA 2KAAA 2F5WA 1DETA 1BSCA 2SARA 1I8VA 3Q3FA 4HOHA 1BANA 1BNSA 2BU4A 1BUJA 1RGAA 1I3IA 1GSPA 4BU4A 4GSPA 1PY3A 1IYYA 1X1XA 2RNTA 1RGCA 1B2ZA 1B2UA 5RNTA 1BNFA 1RGGA 3BU4A 5BU4A 9RNTA 1B2MA 2BIRA 1I2FA 1MGWA 2C4BA 1DE3A 1RHLA 4J5KA 1FUSA 2F56A 1RGEA 1UCJA 1B2XA 3SYUA 1I3FA 1FYSA 8RNTA 1T2HA 4HAAA 3D5GA 1BSDA 1BAOA 1LOVA 2KF5A 1RCLA 2F4YA 1UCIA 1BRSA 5BIRA 1BIRA 1RTUA 1A2PA 1BRKA 3D4AA 1LOYA 1I0XA 6GSPA 1RSNA 3AGOA 1FW7A 1B21A 2RBIA 1LRAA 4J5GA 4BIRA 1BRHA 3DH2A 1TRPA 3WR2A 1RGHA 3KCHA 1X1UA 2GSPA 5GSPA 1BVIA 1BSAA 1R4YA 5HOHA 1FZUA 3DGYA 6RNTA 1BRJA 1X1YA 1GMPA 1AQZA 2F5MA 2ZA4A 1RLSA 2KF3A 1ZGXA 1LNIA 3BIRA 1BOXA 1JBSA 1Q9EA 2KF4A 1C54A 1YGWA 7RNTA 1RGKA 3D5IA 1B27A 1RNTA 1RGFA 4GHOA 1BSBA 1GOVA 3RNTA 3A5EA 1BRGA 1I0VA 3AGNA 1B20A 1MGRA 1BNEA 1BRNL 1B2SA 1RMSA 1AY7A 1RN1A 1UCLA 1I2GA 3URPA 1GOUA 1G02A 1HZ1A 1RCKA 1YVSA 1JBTA 1RNBA 2AADA 1BU4A 1GMRA 3AHSA 1GOYA 1UCKA 3GSPA 1PYLA 1RN4A 1RDSA 1JBRA 1CH0A 1FUTA 1GMQA 1BSEA 4RNTA 2AAEA 1X1WA 2KF6A 1BNIA 1T2IA 1BRIA 1RGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOH A;  1HYF A;  1SAR A;  1TTO A;  1I70 A;  3AHW A;  1B3S A;  1BGS A;  1I2E A;  1YNV X;  3HOH A;  1BNG A;  1LOW A;  1BNJ A;  7GSP A;  1BNR A;  1TRQ A;  3WHO A;  2KAA A;  2F5W A;  1DET A;  1BSC A;  2SAR A;  1I8V A;  3Q3F A;  4HOH A;  1BAN A;  1BNS A;  2BU4 A;  1BUJ A;  1RGA A;  1I3I A;  1GSP A;  4BU4 A;  4GSP A;  1PY3 A;  1IYY A;  1X1X A;  2RNT A;  1RGC A;  1B2Z A;  1B2U A;  5RNT A;  1BNF A;  1RGG A;  3BU4 A;  5BU4 A;  9RNT A;  1B2M A;  2BIR A;  1I2F A;  1MGW A;  2C4B A;  1DE3 A;  1RHL A;  4J5K A;  1FUS A;  2F56 A;  1RGE A;  1UCJ A;  1B2X A;  3SYU A;  1I3F A;  1FYS A;  8RNT A;  1T2H A;  4HAA A;  3D5G A;  1BSD A;  1BAO A;  1LOV A;  2KF5 A;  1RCL A;  2F4Y A;  1UCI A;  1BRS A;  5BIR A;  1BIR A;  1RTU A;  1A2P A;  1BRK A;  3D4A A;  1LOY A;  1I0X A;  6GSP A;  1RSN A;  3AGO A;  1FW7 A;  1B21 A;  2RBI A;  1LRA A;  4J5G A;  4BIR A;  1BRH A;  3DH2 A;  1TRP A;  3WR2 A;  1RGH A;  3KCH A;  1X1U A;  2GSP A;  5GSP A;  1BVI A;  1BSA A;  1R4Y A;  5HOH A;  1FZU A;  3DGY A;  6RNT A;  1BRJ A;  1X1Y A;  1GMP A;  1AQZ A;  2F5M A;  2ZA4 A;  1RLS A;  2KF3 A;  1ZGX A;  1LNI A;  3BIR A;  1BOX A;  1JBS A;  1Q9E A;  2KF4 A;  1C54 A;  1YGW A;  7RNT A;  1RGK A;  3D5I A;  1B27 A;  1RNT A;  1RGF A;  4GHO A;  1BSB A;  1GOV A;  3RNT A;  3A5E A;  1BRG A;  1I0V A;  3AGN A;  1B20 A;  1MGR A;  1BNE A;  1BRN L;  1B2S A;  1RMS A;  1AY7 A;  1RN1 A;  1UCL A;  1I2G A;  3URP A;  1GOU A;  1G02 A;  1HZ1 A;  1RCK A;  1YVS A;  1JBT A;  1RNB A;  2AAD A;  1BU4 A;  1GMR A;  3AHS A;  1GOY A;  1UCK A;  3GSP A;  1PYL A;  1RN4 A;  1RDS A;  1JBR A;  1CH0 A;  1FUT A;  1GMQ A;  1BSE A;  4RNT A;  2AAE A;  1X1W A;  2KF6 A;  1BNI A;  1T2I A;  1BRI A;  1RGL A; 
#chains in the Genus database with same CATH topology
 1VQM 3;  1LVN A;  1JKG B;  1RJO A;  3FCS B;  1SAR A;  4KFD A;  3KII A;  5LC7 A;  1D6U A;  1YNV X;  3LTC A;  3EC9 A;  4R9L A;  2CX1 A;  4GB5 A;  3FH1 A;  1BNJ A;  5IEP A;  1TRQ A;  1ZO2 A;  4N3V A;  4L8O A;  1NWW A;  1DET A;  4KFF A;  3ZFZ A;  3CME 3;  1BSC A;  3MG1 A;  2BO9 B;  2K3D A;  3Q3F A;  4HOH A;  3KZT A;  2CK3 H;  3NM2 A;  1N9J A;  2QGU A;  3G6E 3;  3UL5 A;  1KC8 4;  3CPO A;  4HM6 B;  4BU4 A;  2A15 A;  3FKA A;  4GSP A;  3VF1 A;  3WOF B;  1X1X A;  2LYX A;  2RNT A;  2WOF A;  2XF3 A;  1RGC A;  3EN8 A;  2R41 A;  1B2U A;  5RNT A;  3WOD G;  1BNF A;  3KE7 A;  1Q7H A;  1RGG A;  3BU4 A;  5BU4 A;  3UNL A;  5IEN A;  2C11 A;  1HU9 A;  4XDW A;  1G96 A;  3MKI A;  3CC4 3;  1QJG A;  1MGW A;  1UW1 A;  1A2V A;  3B8L A;  3BNB A;  2H0G A;  1DYU A;  4GL6 A;  1FUS A;  1ZS7 A;  1UCJ A;  2OCT A;  3SYU A;  3LTD A;  3S29 A;  1FGT A;  4Q53 A;  1IK3 A;  1T2H A;  3H51 A;  4HAA A;  5BXQ A;  2KF5 A;  3B4P A;  4EV2 A;  2ML6 A;  2F4Y A;  1UCI A;  4OUQ A;  1UGH I;  1YVB I;  2BMQ B;  4FMD A;  5BIR A;  2HMN B;  1DMN A;  1FGR A;  3EHC A;  3H3H A;  3I55 3;  1A2P A;  1OUN A;  4EBG A;  5IG4 A;  1LNH A;  1WNH A;  3D4A A;  4LMI A;  2W0Q A;  1SPU A;  1OHO A;  3AMO A;  1TIJ A;  2W56 A;  5AEU B;  2Z6B A;  1FW7 A;  1B21 A;  4BTY A;  1LRA A;  4BIR A;  3EF8 A;  4N6M A;  5M19 A;  1EEJ A;  2CKF B;  1IV7 A;  3KCH A;  5G2G A;  3NQZ A;  1JN5 B;  1LOX A;  3IJE B;  4WHA A;  1AV4 A;  3FZW A;  3DGY A;  2Y74 A;  3FSD A;  6RNT A;  1BRJ A;  1IVU A;  3GAX A;  1N9E A;  1GMP A;  1ISK A;  1NB3 I;  1TJD A;  2F5M A;  1WMO A;  4K1U A;  1L5G B;  2YFL B;  1KWI A;  1ZGX A;  2KF3 A;  4N6L A;  1FA3 A;  1LNI A;  1M1X B;  3JUP A;  1NJI 4;  1YGW A;  2XFS A;  4KFE A;  1B27 A;  2M7O A;  3PZW A;  1GS3 A;  2OOV C;  5AIH A;  1GOV A;  2XSO B;  3A5E A;  3STD A;  2F98 A;  3DZL A;  1N5H A;  1N8Q A;  3J7Y d;  1OCV A;  2P05 A;  2CC3 A;  3I56 3;  5IEO A;  2QA4 3;  1B2S A;  1O7M B;  1EA2 A;  2R4I A;  1I2G A;  3K9M C;  4O8S A;  1W02 A;  5IG5 A;  3NM7 A;  1JBT A;  1IV9 A;  2P0X A;  2W9Q A;  3I0Y A;  3Q90 A;  1T3B A;  4HYZ A;  1YHQ 3;  1GOY A;  1UCK A;  3GSP A;  1PYL A;  1JBR A;  1RDS A;  1FUT A;  3CNX A;  1K9M 4;  2RCD A;  1QAK A;  1X1W A;  4LEH A;  2MC8 A;  1WMP A;  1BNI A;  1DMM A;  3Q1C A;  1W5Z A;  1BRI A;  4MMY B;  3V98 A;  1EG9 B;  3PCS A;  1STF I;  1TU5 A;  5AEW B;  3RGA A;  3CCV 3;  1I2E A;  1BGS A;  1IT8 A;  4O02 B;  1US1 A;  1J2B A;  3CU3 A;  1NB5 I;  2W2C A;  3EJV A;  3N9H A;  7GSP A;  4HM8 B;  3F40 A;  2Z7A A;  1ULI B;  3LH4 A;  3ALA A;  2ZL8 A;  3CCQ 3;  1JNQ A;  2K54 A;  5CK6 A;  3FG4 A;  1BAN A;  1BNS A;  2GXF A;  2QIY A;  4R9K A;  3LML A;  5FW5 A;  3Q2P A;  3LXU X;  2B1X B;  1W00 A;  1GSP A;  3NBB A;  1QVF 2;  1VQQ A;  1PY3 A;  3X41 A;  4ZM8 A;  3MWZ A;  5JBS A;  3OX9 A;  3F14 A;  2KXG A;  5EQL A;  3WA3 A;  3UB1 A;  3D3L A;  2XRX B;  1B2M A;  1V58 A;  5KP3 A;  3LZA A;  1I2F A;  2CHC A;  1GD3 A;  2C4B A;  1QMA A;  1RHL A;  1LXE A;  3FG3 A;  2CFK A;  4CCV A;  5IG3 A;  1OF5 A;  2CG0 A;  2HMJ B;  1MOL A;  3DXO A;  5JPU A;  1BSD A;  4XM4 A;  2STD A;  1RCL A;  1VQ6 3;  1FGM A;  3BNE A;  3NHX A;  3E99 A;  1ULJ B;  3PXM A;  1VQ9 3;  4NPB A;  5AYR B;  1RKY A;  1RN7 A;  2ZHX B;  3UL6 A;  2E2T A;  4O2H A;  4LZI A;  1E3V A;  3GZR A;  4N6N B;  1GY7 A;  5IG0 A;  3V92 A;  3CD6 3;  1UDI I;  4PEJ A;  4EW5 A;  4J5G A;  3L0R A;  4WYK A;  5CLK A;  5AIG A;  1O7W B;  2W9P A;  2D42 A;  1BRH A;  1E97 A;  1TRP A;  2OQE C;  5EEO A;  5D82 A;  1X1U A;  3CPW 2;  3K7C A;  1ASK A;  1MWS A;  2GEX A;  3ZG0 A;  1BSA A;  1R4Y A;  5IF6 A;  1AVL A;  1NU3 A;  4TX4 A;  1ROV A;  3HX8 A;  2B24 B;  2H0I A;  3EBT A;  3OV4 A;  1X1Y A;  4X2O A;  4EC6 A;  1TFK A;  3AMO B;  2ZA4 A;  1O7P B;  2C10 A;  2KRT A;  2XGN A;  3BIR A;  1BOX A;  3WDG B;  1M9G A;  2GEY A;  2IA7 A;  4O3V A;  2ZDJ A;  4IPB A;  2PZV A;  2RGQ A;  2E2U A;  3D5I A;  3EB8 A;  5D81 A;  3SED A;  1BSB A;  7RNT A;  3RNT A;  3G71 3;  1VQ7 3;  1JB2 A;  2CWU A;  3RGR A;  5FGO A;  2FGT A;  4FMC A;  4N6U A;  1YJN 3;  1EQK A;  1N8R 4;  2BNG A;  4RBN A;  3KKG A;  3MG2 A;  3LTB A;  3LYG A;  5KP4 A;  3NXJ A;  2XFT A;  1LQM B;  3K5T A;  4HM5 B;  4BTX A;  4BTW A;  1BNE A;  2K0M A;  3SX1 A;  3CCM 3;  1RMS A;  2UGI A;  1AY7 A;  2F86 B;  5CXO A;  2IUJ A;  4XDV A;  1N5P A;  4HBR A;  3FG1 A;  1VQ5 3;  4OVM A;  1CYU A;  4EYC A;  1Q86 4;  1MNL A;  1GOU A;  1HZ1 A;  4QWT A;  1WTH A;  5STD A;  3S28 A;  1MWR A;  4FCJ A;  2CW9 A;  4OK0 A;  4KT3 B;  1KQS 2;  2IY2 A;  1BU4 A;  1D6Y A;  1GMR A;  3ER7 A;  5DRE A;  1Q40 B;  3JUQ A;  1JZO A;  1OGX A;  2UUG C;  2W56 B;  1Q7Y 4;  1SQW A;  3SOA A;  3WA2 X;  4RNT A;  2AAE A;  8RNT A;  4ORL A;  3X3Z A;  4ILF A;  1GY6 A;  1HYF A;  3EX9 A;  4N6O B;  1UI7 A;  3VSY A;  1I70 A;  1NNV A;  3CCU 3;  2WO0 A;  3AHW A;  3NUV A;  4KVH A;  1IVW A;  3D79 A;  4LGQ A;  1Z1S A;  2OTL 3;  2MF7 A;  4N6T A;  5M18 A;  1Q81 4;  1JKG A;  1R4C A;  1RRH A;  2KCD A;  3CC7 3;  2OTJ 3;  3ECF A;  2D1W A;  4HVN A;  2HML B;  2KAA A;  1GYB A;  3JUN A;  3IPT A;  5AI1 A;  1EKM A;  3DUK A;  4R4K A;  1FGO A;  1DVD A;  3QRD A;  3B7C A;  1BUJ A;  5A0O B;  4R80 A;  1RGA A;  5LC6 A;  4FMA A;  3DY5 A;  4HZB B;  1UUV B;  3JUO A;  3U97 A;  2P0M A;  2V1L A;  1IYY A;  2GBW B;  1YJW 3;  2WOH A;  4WP5 A;  1YI2 3;  2UX0 A;  2Y73 A;  1A67 A;  1BUQ A;  4N6V 0;  4KZ1 A;  3LT9 A;  1U8C B;  1DMQ A;  5AIF A;  4AKY A;  1O7N B;  9RNT A;  3HZP A;  1KSI A;  1OH0 A;  2BIR A;  5KP1 A;  4L7K A;  2P09 A;  4NRE A;  4LYL B;  4MEI A;  1DE3 A;  3PCR A;  1D6Z A;  1O7G B;  2F56 A;  2Z77 A;  3OXA A;  1B2X A;  3EBY A;  5AII A;  3VGN A;  2LQV A;  1I3F A;  3CNM A;  3JVC A;  5BVB A;  1VQ8 3;  3M8C A;  4HM3 B;  1BAO A;  4HM0 B;  3F7X A;  3NQY A;  3G0K A;  4HJL B;  3ZG5 A;  3CCE 3;  1IQ8 A;  1BIR A;  4X2H A;  4BL3 A;  3CCL 3;  3CCR 3;  1OHP A;  2JQ5 A;  4H61 A;  3ROB A;  1W7C A;  3G8Z A;  1I0X A;  4EXR A;  4BL2 A;  1KD1 4;  6GSP A;  1W6C A;  4AEQ A;  3AGO A;  3OWY A;  1OAC A;  2RBI A;  4WWU C;  2XR8 B;  2WGQ A;  1WMN A;  3N8B A;  1GD4 A;  3WR2 A;  1W2Z A;  3NV0 B;  3DGO A;  2Q07 A;  2JDI H;  5GSP A;  2XGL A;  3MYT A;  3S67 A;  3EQQ B;  5M1A A;  1UGI A;  2INX A;  1FZU A;  3DGN A;  1TFO A;  3LOY A;  1QAF A;  5AYS C;  1V74 A;  1VQN 3;  1T5Y A;  4STD A;  4CJN A;  2O9U X;  1W2B 2;  1AQZ A;  5ELU A;  2WGO A;  3G16 A;  1RLS A;  1JBS A;  1JRQ A;  5D83 A;  1Q9E A;  4K61 A;  3PYJ A;  4FCZ A;  3F9S A;  5DRV A;  4H3U A;  3SLU A;  1VQ4 3;  1PFP A;  4GHO A;  1YIT 3;  4WYK B;  5G1K A;  3MHE A;  1I0V A;  7STD A;  1WQL B;  3MG3 A;  4LSO A;  2IMJ A;  3AGN A;  3KFQ C;  2RSX A;  3F8H A;  3D9R A;  4RNY A;  1JN5 A;  3GWR A;  2E2V A;  4XBX A;  1BRN L;  1RN1 A;  1UCL A;  1W6G A;  6STD A;  2HMK B;  4HZ9 B;  1Q42 A;  1IQX A;  1STD A;  1DVC A;  1W4N A;  1OPY A;  1LQG C;  1IU7 A;  3U1W A;  1IVV A;  2IUK A;  2RFR A;  1YVS A;  1RCK A;  3F8X A;  1TP6 A;  4G1M B;  4K90 B;  2BMO B;  2SBL A;  1QVG 2;  2QEX 3;  3V99 A;  3TDG A;  8CHO A;  3AHS A;  3MPH A;  1VQK 3;  3B4O A;  2HMM B;  1RN4 A;  2CFL A;  2W04 A;  3SVA A;  2CIU A;  2O3O A;  1JB4 A;  1GMQ A;  1AR0 A;  4HM7 B;  1YIJ 3;  1U5O A;  2OOV A;  1VZZ A;  2KF6 A;  1T2I A;  3X3X A;  3PGB A;  4MJD A;  4HKV B;  1RGL A;  4CPK A;  2HOH A;  1FUW A;  2BHM A;  2XEP A;  1TTO A;  3PS8 A;  1A90 A;  1VQP 3;  2YFI B;  4XB5 A;  1JB5 A;  4IIA A;  3CC2 3;  1B3S A;  3X3Y A;  3HOH A;  1A2K A;  4XBY A;  4HM4 B;  1BNG A;  3K0Z A;  3WMD A;  1LOW A;  3X40 A;  1M90 4;  1TUH A;  1BNR A;  1RRL A;  1OGZ A;  1S5A A;  1UUG B;  2OWP A;  2P38 A;  3S5C A;  3WHO A;  2FNQ A;  1G0T A;  1M1K 4;  2F5W A;  3BB9 A;  1Q40 A;  3KSE D;  2GBX B;  2SAR A;  1I8V A;  3S27 A;  3OWU A;  3O8Y A;  2BU4 A;  2H0H A;  3T8N A;  3HK4 A;  2ML5 A;  1W6Y A;  5ELJ A;  1I3I A;  1V57 A;  4K1V A;  2CWT A;  4JF8 A;  2FXT A;  3DGM A;  2CFD A;  3FF0 A;  3K63 A;  1B2Z A;  3KSP A;  2L4V A;  1PU4 A;  3CXC 2;  1Q82 4;  1IDP A;  5IW9 A;  3F7S A;  3HI7 A;  1SII A;  1NDO B;  2F99 A;  4HM2 B;  3OWS A;  3QK9 A;  4CDL A;  5IER A;  5CF2 A;  4J5K A;  1F8N A;  1JZD A;  3GZB A;  4DKI A;  1RGE A;  3T0U A;  1JJ2 2;  2IYJ A;  3OW2 2;  3MSO A;  1FYS A;  5I97 A;  2BMR B;  4WFO A;  5JPP A;  3D5G A;  4R1K A;  1Y4K A;  1LOV A;  5CF1 A;  2W6J H;  4JRF A;  4AKZ A;  3BLZ A;  3GZY B;  2CWV A;  3G4S 3;  3A76 A;  1BRS A;  1EUI C;  3N54 B;  5TGN A;  1ROA A;  2YX9 A;  3EN1 B;  1JV2 B;  4I5Q A;  3WOE B;  1K41 A;  1RTU A;  2J8X B;  1MWU A;  1BRK A;  3CCS 3;  1K8A 4;  1K73 4;  3NBJ A;  1LOY A;  1C7H A;  3EE1 A;  1HKX A;  1QAL A;  4U13 A;  1RSN A;  1UUW B;  4RZM A;  1GY5 A;  3SXX A;  4HM1 B;  2YFJ B;  3IMA B;  3KN4 A;  2CX0 A;  3DGL A;  2GU1 A;  3DH2 A;  1IVX A;  1RGH A;  3LT8 A;  3NV0 A;  1K28 A;  4L8P A;  4J9A A;  1YGE A;  2GSP A;  3FF2 A;  1IT7 A;  1BVI A;  3HII A;  3BNC A;  3NBR A;  4XBT A;  5HOH A;  2BT3 A;  2I9W A;  3CCJ 3;  1S72 3;  2W03 A;  1UI8 A;  4MMZ B;  4RNZ A;  1IQY A;  1CQS A;  2HMO B;  3CMA 3;  2GU3 A;  2OQE A;  3NX0 A;  3T8U A;  2KF4 A;  3LTA A;  5HGR A;  1C54 A;  1SIH A;  1E3R A;  1RGK A;  1RNT A;  1RGF A;  1CEW I;  1NO3 A;  4FR9 A;  3HIG A;  1BRG A;  3X42 A;  4EV5 A;  3RDE A;  3SOY A;  1ZX2 A;  3FGY A;  1B20 A;  1MGR A;  1O7H B;  1OHS A;  2CFW A;  1FGQ A;  2CFG A;  4FMB A;  2PNC A;  1CYV A;  2CH9 A;  1AVK A;  3JUM A;  4I4K A;  1VQO 3;  4NHF A;  3URP A;  1SJW A;  1VQL 3;  1G02 A;  2XSH B;  1RNB A;  1OF5 B;  2AAD A;  2XH9 A;  2CG1 A;  5EVH A;  3FLJ A;  2Z76 A;  3BND A;  4IT7 A;  3GRD A;  1MWT A;  1W01 A;  3UJM A;  1CH0 A;  2L1S A;  3GZX B;  4MMX B;  1BSE A;  4J8T A;  3DMC A;  1YJ9 3;  3DM8 A;  4FCM A;  5G1L A; 
#chains in the Genus database with same CATH homology
 2HOH A;  1HYF A;  1SAR A;  1TTO A;  1I70 A;  3AHW A;  1B3S A;  1BGS A;  1I2E A;  1YNV X;  3HOH A;  1BNG A;  1LOW A;  1BNJ A;  7GSP A;  1BNR A;  1TRQ A;  3WHO A;  2KAA A;  2F5W A;  1DET A;  1BSC A;  2SAR A;  1I8V A;  3Q3F A;  4HOH A;  1BAN A;  1BNS A;  2BU4 A;  1BUJ A;  1RGA A;  1I3I A;  1GSP A;  4BU4 A;  4GSP A;  1PY3 A;  1IYY A;  1X1X A;  2RNT A;  1RGC A;  1B2Z A;  1B2U A;  5RNT A;  1BNF A;  1RGG A;  3BU4 A;  5BU4 A;  9RNT A;  1B2M A;  2BIR A;  1I2F A;  1MGW A;  2C4B A;  1DE3 A;  1RHL A;  4J5K A;  1FUS A;  2F56 A;  1RGE A;  1UCJ A;  1B2X A;  3SYU A;  1I3F A;  1FYS A;  8RNT A;  1T2H A;  4HAA A;  3D5G A;  1BSD A;  1BAO A;  1LOV A;  2KF5 A;  1RCL A;  2F4Y A;  1UCI A;  1BRS A;  5BIR A;  1BIR A;  1RTU A;  1A2P A;  1BRK A;  3D4A A;  1LOY A;  1I0X A;  6GSP A;  1RSN A;  3AGO A;  1FW7 A;  1B21 A;  2RBI A;  1LRA A;  4J5G A;  4BIR A;  1BRH A;  3DH2 A;  1TRP A;  3WR2 A;  1RGH A;  3KCH A;  1X1U A;  2GSP A;  5GSP A;  1BVI A;  1BSA A;  1R4Y A;  5HOH A;  1FZU A;  3DGY A;  6RNT A;  1BRJ A;  1X1Y A;  1GMP A;  1AQZ A;  2F5M A;  2ZA4 A;  1RLS A;  2KF3 A;  1ZGX A;  1LNI A;  3BIR A;  1BOX A;  1JBS A;  1Q9E A;  2KF4 A;  1C54 A;  1YGW A;  7RNT A;  1RGK A;  3D5I A;  1B27 A;  1RNT A;  1RGF A;  4GHO A;  1BSB A;  1GOV A;  3RNT A;  3A5E A;  1BRG A;  1I0V A;  3AGN A;  1B20 A;  1MGR A;  1BNE A;  1BRN L;  1B2S A;  1RMS A;  1AY7 A;  1RN1 A;  1UCL A;  1I2G A;  3URP A;  1GOU A;  1G02 A;  1HZ1 A;  1RCK A;  1YVS A;  1JBT A;  1RNB A;  2AAD A;  1BU4 A;  1GMR A;  3AHS A;  1GOY A;  1UCK A;  3GSP A;  1PYL A;  1RN4 A;  1RDS A;  1JBR A;  1CH0 A;  1FUT A;  1GMQ A;  1BSE A;  4RNT A;  2AAE A;  1X1W A;  2KF6 A;  1BNI A;  1T2I A;  1BRI A;  1RGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...