1MGRA

Crystal structure of rnase sa3,cytotoxic microbial ribonuclease
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
97
structure length
97
Chain Sequence
b'VKAVGRVCYSALPSQAHDTLDLIDEGGPFPYSQDGVVFQNREGLLPAHSTGYYHEYTVITPGSPTRGARRIITGQQWQEDYYTADHYASFRRVDFAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa3
publication title Links X-ray Structure of Two Crystalline Forms of a Streptomycete Ribonuclease with Cytotoxic Activity
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 19
structure length 97
sequence length 97
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1mgrA00
4J5KA 1RGAA 1I0VA 9RNTA 1FZUA 1I3FA 1X1UA 1TRPA 1B2XA 2C4BA 2F4YA 1BRSA 1BAOA 2AAEA 3D5IA 3WHOA 1GSPA 3A5EA 4BU4A 1LOWA 1I2EA 4GSPA 1BRKA 2BIRA 1GMQA 2HOHA 1B2ZA 3D4AA 1BSBA 1MGWA 1Q9EA 1I2FA 1BNFA 1DE3A 3AGOA 1GMRA 1UCJA 1BSCA 1LOVA 1RGFA 3AGNA 7RNTA 2KAAA 1BU4A 1LNIA 1BUJA 1MGRA 4GHOA 3BIRA 3AHWA 1G02A 1T2IA 1X1WA 1JBTA 1BNIA 1RGGA 1B2SA 1B2UA 1AY7A 3URPA 1BRJA 3KCHA 1I2GA 1RCLA 1BSDA 1ZGXA 3WR2A 1UCKA 1CH0A 3HOHA 1BRIA 1FW7A 1BGSA 1C54A 2F56A 1TRQA 2BU4A 1RTUA 1T2HA 1R4YA 1X1YA 2ZA4A 5BIRA 1BRGA 1DETA 1RN4A 5BU4A 1TTOA 1AQZA 1B2MA 1IYYA 3AHSA 1PY3A 1YNVX 3BU4A 8RNTA 1LOYA 4RNTA 1JBSA 2RBIA 1BNEA 1RMSA 1I8VA 3SYUA 1JBRA 1BSAA 1BNGA 2KF4A 2SARA 1BANA 2F5WA 4HAAA 4HOHA 1BNJA 2GSPA 1BRNL 1BNSA 5GSPA 1RSNA 1B21A 1I70A 1RNTA 6RNTA 5RNTA 1SARA 3RNTA 1PYLA 3DGYA 2KF3A 4BIRA 1B3SA 1FYSA 1RGCA 1RGKA 2RNTA 1UCLA 1BIRA 4J5GA 1GOYA 3GSPA 1RNBA 1BNRA 5HOHA 1B20A 2KF5A 1BRHA 1HZ1A 7GSPA 3Q3FA 1BSEA 1FUTA 2KF6A 1YVSA 2F5MA 1B27A 1YGWA 1GOUA 1LRAA 1RLSA 1RN1A 3D5GA 1RCKA 1RHLA 1BOXA 1FUSA 6GSPA 1GMPA 1BVIA 3DH2A 1RGLA 1GOVA 1I3IA 1X1XA 1UCIA 1RGEA 1RDSA 2AADA 1RGHA 1A2PA 1I0XA 1HYFA
chains in the Genus database with same CATH superfamily
1I0VA 2L1SA 2SBLA 3MG3A 3ZG0A 1Q40B 1I3FA 2BNGA 1OCVA 5AIHA 5FGOA 3WA2X 1OF5A 2YFLB 2C4BA 1SQWA 1UUGB 1BAOA 1VQ43 1ISKA 1IQYA 2ML6A 4MMZB 5ELUA 2CWUA 3WHOA 3A5EA 3JUPA 1QJGA 4KT3B 1I2EA 1KWIA 1OHPA 3K63A 1SPUA 1UDII 1IT7A 1B2ZA 4HZ9B 4KFFA 3BNEA 2OTJ3 1Q9EA 3ALAA 3CNXA 1O7HB 1T5YA 1UCJA 3EQQB 3DY5A 4HM3B 2H0IA 1TP6A 3AGNA 1GY6A 4WFOA 1EG9B 3X3ZA 1MWRA 4FR9A 2UX0A 4ORLA 5AYRB 1SIIA 3T0UA 1L5GB 4N6OB 1JBTA 5IEOA 2OOVA 5STDA 4EBGA 3H3HA 1SIHA 5AIGA 3GRDA 1EUIC 1BRJA 1I2GA 1IQXA 2CFKA 4OK0A 5JPUA 3CC23 3MKIA 4MMXB 1FGOA 5CF2A 1M9GA 2C10A 1BGSA 3MYTA 1MWTA 2D1WA 3FZWA 1U8CB 4ZM8A 3D9RA 2RSXA 1YJN3 3S29A 3MPHA 3KE7A 3VF1A 2ZA4A 3GZRA 3CME3 1RN4A 3OV4A 5BU4A 3G6E3 2XFSA 1IV7A 2OWPA 4HVNA 1KSIA 4RNYA 2CFDA 1AQZA 4R1KA 1IK3A 3UB1A 1VQK3 3F40A 1IVWA 1EKMA 3ZG5A 3QRDA 2XGNA 2CHCA 1GY7A 3FSDA 5LC6A 2K0MA 5M19A 1DMMA 8RNTA 5FW5A 1JBSA 2RCDA 3LMLA 4H61A 1RMSA 3SXXA 3EN8A 3NM7A 3PCSA 1BSAA 4HAAA 1CEWI 1N5HA 2F5WA 4HOHA 2Q07A 2W56A 1CQSA 4LYLB 1BNJA 1W6CA 5AYSC 3STDA 9RNTA 3EE1A 2K54A 1AVKA 3F14A 5RNTA 3BB9A 3D3LA 2INXA 2YFJB 3RNTA 2WGQA 1VQQA 2KF3A 1IV9A 2O3OA 2YFIB 5AEUB 2CFGA 5EQLA 1Q864 1JKGA 3WMDA 1RGCA 3EC9A 1UCLA 1JB2A 3ZFZA 1OGXA 3B4PA 1BIRA 1JZOA 2E2TA 2KF5A 1JNQA 3N54B 1U5OA 1W7CA 1VQP3 2IA7A 7GSPA 2Z76A 1TU5A 2BMQB 4WHAA 1YGWA 1GOUA 5JBSA 3D5GA 3HI7A 4K1VA 1IDPA 1RCKA 2XFTA 4EC6A 2UUGC 1BOXA 4O3VA 4R9KA 6GSPA 1GMPA 3Q2PA 4FCJA 4EXRA 2QGUA 3KKGA 1DVDA 1TFOA 2IUJA 3NBBA 3NQZA 5AIIA 3LTDA 2XSHB 3NBRA 2AADA 2CFWA 5BXQA 3FH1A 1YIT3 2OQEA 1US1A 4J5KA 3LTCA 5CXOA 3M8CA 3VGNA 2OCTA 4AKYA 3CPW2 1X1UA 1E3RA 1TRPA 2CX1A 3T8UA 5EEOA 1B2XA 3WA3A 3CXC2 3HIIA 1D6YA 1BRSA 4WP5A 2AAEA 3CCR3 3N8BA 1IVXA 4N6TA 7STDA 1GSPA 4IIAA 4BU4A 1LOWA 1K8A4 1AVLA 4LEHA 1BRKA 1GMQA 1Q42A 3D4AA 1BSBA 3F9SA 5G2GA 1WMNA 3KN4A 3JVCA 3BNCA 1BNFA 2E2VA 4HKVB 4HYZA 1BSCA 2A15A 5IF6A 1NU3A 1LOVA 2W03A 1RGFA 2FXTA 7RNTA 1W02A 2KAAA 2CIUA 2CWVA 1LOXA 1FGTA 5DREA 1W01A 3DZLA 1CYUA 1YHQ3 1FGRA 3RGRA 1G02A 1WNHA 3PS8A 1T2IA 1X1WA 1YVBI 1K28A 3IMAB 4MMYB 4BL2A 1W6GA 2MC8A 1KD14 3O8YA 1LQGC 1Z1SA 2BHMA 2XSOB 3FG4A 4H3UA 1ZO2A 1STDA 1NB3I 1ULJB 2Y74A 3KCHA 4LZIA 1STFI 1RCLA 4XBTA 1ZGXA 3F7SA 3BNDA 4OVMA 1UCKA 1QMAA 3K5TA 3PCRA 3CD63 3GZYB 3CU3A 2CG1A 1BRIA 3SLUA 1FW7A 2HMOB 1FGMA 2WOHA 2P09A 3F8XA 2ZDJA 2ZHXB 2F56A 1M1K4 1JB4A 3GAXA 1RRLA 1V74A 1QALA 1R4YA 1LVNA 5BIRA 1RN7A 4MEIA 1BRGA 1DETA 1ZX2A 3G16A 4MJDA 3UJMA 3CPOA 3E99A 5G1KA 1B2MA 1O7GB 1OH0A 2B24B 2JDIH 4N6MA 3BNBA 4HM4B 4XB5A 3B7CA 3AMOA 1BNEA 1ZS7A 3NV0A 3SOYA 3S5CA 1I8VA 2CX0A 2MF7A 1JBRA 5BVBA 1A67A 1VQ73 4KZ1A 5A0OB 1N9JA 2W56B 2GSPA 3S28A 3HX8A 3CCE3 5GSPA 3NX0A 1RSNA 6RNTA 2KRTA 3S67A 2GEXA 3A76A 4XDVA 5CF1A 4IPBA 1PYLA 2BMRB 3F8HA 1FUWA 3DGNA 4NREA 1NWWA 3JUOA 1V57A 3NHXA 1E3VA 2RNTA 3OWSA 3PZWA 2Z7AA 2J8XB 3EBYA 1Q40A 2OOVC 3NBJA 1T3BA 3OWYA 1RNBA 4IT7A 4LGQA 4AEQA 2HMNB 3Q3FA 1BSEA 1FUTA 2W0QA 1B27A 1YI23 1K9M4 4HM6B 2STDA 1E97A 1ULIB 2GBXB 2WGOA 3DM8A 5CK6A 1Y4KA 3X3YA 8CHOA 2CK3H 5IG4A 3UL6A 3CCM3 4N3VA 1LXEA 4RZMA 1PU4A 5KP1A 3MWZA 1NNVA 3GWRA 3DH2A 1MOLA 3FF2A 4R9LA 1TUHA 3WDGB 1VQN3 3J7Yd 1RGLA 1FA3A 4FCZA 2W2CA 2XRXB 1S5AA 1UCIA 4K61A 1RGEA 4N6NB 1RDSA 1O7PB 1D6UA 4J8TA 1A2PA 5D83A 1I0XA 1HYFA 1GY5A 1GYBA 1FUSA 1ASKA 1O7NB 2R4IA 3HZPA 3LT8A 3LT9A 3FG3A 3PXMA 1A2KA 3DGOA 1TIJA 2XR8B 4STDA 3WOEB 4U13A 4HM2B 1G96A 4N6V0 2IMJA 3WOFB 2F98A 4WYKA 2CWTA 3GZXB 2M7OA 3D5IA 5DRVA 4GSPA 2JQ5A 3LTBA 2HOHA 4FMBA 1QAFA 4JRFA 3WODG 3X41A 2CFLA 1G0TA 1MGWA 1I2FA 2F99A 2GU3A 2E2UA 4GB5A 4Q53A 3KSED 1DE3A 2XEPA 1NDOB 2L4VA 4FMAA 1Q814 2B1XB 2ZL8A 4HBRA 3OWUA 3CCU3 3UNLA 3UL5A 4GHOA 3DGLA 4J9AA 1JJ22 3FF0A 3BIRA 1BUJA 1WMPA 1R4CA 4OUQA 1RGGA 1B2SA 4NPBA 1B2UA 1AY7A 3F7XA 3IPTA 1TJDA 3B8LA 3URPA 3H51A 3IJEB 1OF5B 5IG5A 3RGAA 3LH4A 1BSDA 2Y73A 1MWSA 5EVHA 2CW9A 1OGZA 2BMOB 1D6ZA 2FNQA 2QIYA 3LZAA 4HM7B 4K90B 4LMIA 5ELJA 3CC43 1FGQA 3K9MC 1UI8A 5KP3A 1M1XB 1W2B2 2BO9B 3CCQ3 3I553 1RTUA 1OACA 1T2HA 3OW22 1X1YA 2XH9A 4R4KA 4CCVA 4NHFA 1DVCA 5G1LA 4I5QA 1UGHI 2GBWB 2OQEC 1NB5I 1IYYA 2CC3A 1IVUA 1PY3A 4EV5A 1NJI4 2CKFB 1WTHA 3MG1A 4EW5A 3BU4A 3Q1CA 4LSOA 4TX4A 1LOYA 2W9PA 3EBTA 4RNTA 3FCSB 2RBIA 3SVAA 2LYXA 1QVG2 3AMOB 1UGIA 4CPKA 1AV4A 3V99A 1N5PA 1N9EA 2KF4A 3X3XA 3X42A 4L8OA 1ROVA 1BRNL 1BNSA 3OX9A 1B21A 1O7MB 1RNTA 3Q90A 6STDA 3KIIA 4L8PA 1SARA 4HM0B 3KFQC 2RGQA 5AIFA 2P38A 1Q7HA 4G1MB 3I563 1FYSA 2IY2A 4X2HA 1RGKA 4XM4A 3LTAA 1BNRA 2Z6BA 1HZ1A 3KZTA 3DUKA 4BTXA 1IU7A 3NQYA 1JRQA 4X2OA 2KF6A 3PGBA 1YVSA 1PFPA 2CH9A 2XGLA 2P05A 1VQ63 5IG0A 1W00A 1JB5A 2FGTA 1RLSA 3DXOA 3EB8A 3K0ZA 3X40A 1DYUA 1YGEA 1UW1A 4XBXA 1RHLA 1QVF2 5KP4A 3U1WA 4KVHA 4K1UA 2KXGA 1BVIA 1JN5A 4L7KA 1NO3A 3ER7A 2H0HA 3N9HA 3VSYA 1GOVA 1IVVA 1I3IA 1X1XA 1TFKA 5D81A 3S27A 3G4S3 4N6LA 1KC84 5AEWB 5IW9A 1EQKA 1JKGB 2LQVA 1HKXA 1RGAA 2WO0A 3G0KA 3RDEA 2P0XA 2GXFA 1FZUA 3EF8A 3JUQA 4HZBB 3T8NA 3NM2A 2GEYA 2D42A 1OPYA 1HU9A 3KSPA 2F4YA 2IYJA 4WYKB 1VZZA 3MHEA 3V92A 3JUMA 4CDLA 1Q824 1F8NA 3JUNA 1DMQA 1RRHA 2Z77A 4WWUC 5JPPA 5M18A 2BIRA 3SEDA 1RJOA 2HMMB 2W6JH 5I97A 3BLZA 3MG2A 1MNLA 1Q7Y4 3AGOA 3EN1B 4FMDA 1GMRA 2V1LA 2GU1A 1W6YA 2UGIA 3FKAA 1YIJ3 3CCJ3 1BU4A 1LNIA 4O02B 1MGRA 4RBNA 3DMCA 2QA43 4BL3A 1AR0A 3AHWA 4CJNA 1S723 3GZBA 2KCDA 5D82A 1BNIA 2I9WA 5IENA 3D79A 3NXJA 1C7HA 3CCS3 2WOFA 1N8R4 1VQ83 1IQ8A 4R80A 1M904 3FLJA 4EYCA 1KQS2 4O2HA 4XDWA 3G713 1LNHA 2YX9A 2BT3A 1CH0A 1CYVA 3HOHA 1J2BA 1DMNA 4BTWA 2QEX3 1O7WB 1C54A 4HM1B 1TRQA 2BU4A 4QWTA 2HMLB 3CMA3 2OTL3 3QK9A 3TDGA 2K3DA 5TGNA 4KFEA 4XBYA 4HM8B 1TTOA 1V58A 4KFDA 3ROBA 1ROAA 1W4NA 1BUQA 4FCMA 1N8QA 1GS3A 4O8SA 3L0RA 1VQL3 2ML5A 2HMKB 3AHSA 4I4KA 1YNVX 3V98A 1GD3A 3G8ZA 2F86B 4HJLB 5IEPA 2O9UX 2C11A 1OHOA 2RFRA 4GL6A 4JF8A 5HGRA 5LC7A 3K7CA 5IG3A 2PZVA 3SYUA 1K734 2R41A 2W04A 1BNGA 5IERA 1OUNA 1MWUA 2SARA 1BANA 3HIGA 3ECFA 2W9QA 1I70A 1QAKA 3U97A 3HK4A 4ILFA 1YJW3 1JZDA 3DGYA 2PNCA 3LYGA 4BIRA 2XF3A 1B3SA 4PEJA 3CNMA 4EV2A 3CC73 2H0GA 1IT8A 3NUVA 1OHSA 4J5GA 1GOYA 3GSPA 1YJ93 5HOHA 1B20A 2CG0A 1BRHA 4DKIA 5M1AA 3SX1A 4HM5B 3PYJA 3LXUX 3CCL3 1WQLB 3LOYA 3WR2A 1VQM3 1LQMB 4RNZA 1A90A 1SJWA 2F5MA 1VQ93 1LRAA 1RN1A 1GD4A 3B4OA 1WMOA 3NV0B 3SOAA 1EA2A 1RKYA 1VQ53 3I0YA 1UI7A 2HMJB 3EJVA 4N6UA 1K41A 3CCV3 3FGYA 1W5ZA 4AKZA 1JN5B 1JV2B 3DGMA 5CLKA 1VQO3 1UUVB 5AI1A 4BTYA 2IUKA 2P0MA 3OXAA 3EX9A 1EEJA 3MSOA 1UUWB 1RGHA 1W2ZA 3FG1A 1A2VA 4FMCA 3EHCA
chains in the Genus database with same CATH topology
4J5KA 1RGAA 1I0VA 9RNTA 1FZUA 1I3FA 1X1UA 1TRPA 1B2XA 2C4BA 2F4YA 1BRSA 1BAOA 2AAEA 3D5IA 3WHOA 1GSPA 3A5EA 4BU4A 1LOWA 1I2EA 4GSPA 1BRKA 2BIRA 1GMQA 2HOHA 1B2ZA 3D4AA 1BSBA 1MGWA 1Q9EA 1I2FA 1BNFA 1DE3A 3AGOA 1GMRA 1UCJA 1BSCA 1LOVA 1RGFA 3AGNA 7RNTA 2KAAA 1BU4A 1LNIA 1BUJA 1MGRA 4GHOA 3BIRA 3AHWA 1G02A 1T2IA 1X1WA 1JBTA 1BNIA 1RGGA 1B2SA 1B2UA 1AY7A 3URPA 1BRJA 3KCHA 1I2GA 1RCLA 1BSDA 1ZGXA 3WR2A 1UCKA 1CH0A 3HOHA 1BRIA 1FW7A 1BGSA 1C54A 2F56A 1TRQA 2BU4A 1RTUA 1T2HA 1R4YA 1X1YA 2ZA4A 5BIRA 1BRGA 1DETA 1RN4A 5BU4A 1TTOA 1AQZA 1B2MA 1IYYA 3AHSA 1PY3A 1YNVX 3BU4A 8RNTA 1LOYA 4RNTA 1JBSA 2RBIA 1BNEA 1RMSA 1I8VA 3SYUA 1JBRA 1BSAA 1BNGA 2KF4A 2SARA 1BANA 2F5WA 4HAAA 4HOHA 1BNJA 2GSPA 1BRNL 1BNSA 5GSPA 1RSNA 1B21A 1I70A 1RNTA 6RNTA 5RNTA 1SARA 3RNTA 1PYLA 3DGYA 2KF3A 4BIRA 1B3SA 1FYSA 1RGCA 1RGKA 2RNTA 1UCLA 1BIRA 4J5GA 1GOYA 3GSPA 1RNBA 1BNRA 5HOHA 1B20A 2KF5A 1BRHA 1HZ1A 7GSPA 3Q3FA 1BSEA 1FUTA 2KF6A 1YVSA 2F5MA 1B27A 1YGWA 1GOUA 1LRAA 1RLSA 1RN1A 3D5GA 1RCKA 1RHLA 1BOXA 1FUSA 6GSPA 1GMPA 1BVIA 3DH2A 1RGLA 1GOVA 1I3IA 1X1XA 1UCIA 1RGEA 1RDSA 2AADA 1RGHA 1A2PA 1I0XA 1HYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5K A;  1RGA A;  1I0V A;  9RNT A;  1FZU A;  1I3F A;  1X1U A;  1TRP A;  1B2X A;  2C4B A;  2F4Y A;  1BRS A;  1BAO A;  2AAE A;  3D5I A;  3WHO A;  1GSP A;  3A5E A;  4BU4 A;  1LOW A;  1I2E A;  4GSP A;  1BRK A;  2BIR A;  1GMQ A;  2HOH A;  1B2Z A;  3D4A A;  1BSB A;  1MGW A;  1Q9E A;  1I2F A;  1BNF A;  1DE3 A;  3AGO A;  1GMR A;  1UCJ A;  1BSC A;  1LOV A;  1RGF A;  3AGN A;  7RNT A;  2KAA A;  1BU4 A;  1LNI A;  1BUJ A;  1MGR A;  4GHO A;  3BIR A;  3AHW A;  1G02 A;  1T2I A;  1X1W A;  1JBT A;  1BNI A;  1RGG A;  1B2S A;  1B2U A;  1AY7 A;  3URP A;  1BRJ A;  3KCH A;  1I2G A;  1RCL A;  1BSD A;  1ZGX A;  3WR2 A;  1UCK A;  1CH0 A;  3HOH A;  1BRI A;  1FW7 A;  1BGS A;  1C54 A;  2F56 A;  1TRQ A;  2BU4 A;  1RTU A;  1T2H A;  1R4Y A;  1X1Y A;  2ZA4 A;  5BIR A;  1BRG A;  1DET A;  1RN4 A;  5BU4 A;  1TTO A;  1AQZ A;  1B2M A;  1IYY A;  3AHS A;  1PY3 A;  1YNV X;  3BU4 A;  8RNT A;  1LOY A;  4RNT A;  1JBS A;  2RBI A;  1BNE A;  1RMS A;  1I8V A;  3SYU A;  1JBR A;  1BSA A;  1BNG A;  2KF4 A;  2SAR A;  1BAN A;  2F5W A;  4HAA A;  4HOH A;  1BNJ A;  2GSP A;  1BRN L;  1BNS A;  5GSP A;  1RSN A;  1B21 A;  1I70 A;  1RNT A;  6RNT A;  5RNT A;  1SAR A;  3RNT A;  1PYL A;  3DGY A;  2KF3 A;  4BIR A;  1B3S A;  1FYS A;  1RGC A;  1RGK A;  2RNT A;  1UCL A;  1BIR A;  4J5G A;  1GOY A;  3GSP A;  1RNB A;  1BNR A;  5HOH A;  1B20 A;  2KF5 A;  1BRH A;  1HZ1 A;  7GSP A;  3Q3F A;  1BSE A;  1FUT A;  2KF6 A;  1YVS A;  2F5M A;  1B27 A;  1YGW A;  1GOU A;  1LRA A;  1RLS A;  1RN1 A;  3D5G A;  1RCK A;  1RHL A;  1BOX A;  1FUS A;  6GSP A;  1GMP A;  1BVI A;  3DH2 A;  1RGL A;  1GOV A;  1I3I A;  1X1X A;  1UCI A;  1RGE A;  1RDS A;  2AAD A;  1RGH A;  1A2P A;  1I0X A;  1HYF A; 
#chains in the Genus database with same CATH topology
 1I0V A;  2L1S A;  2SBL A;  3MG3 A;  3ZG0 A;  1Q40 B;  1I3F A;  2BNG A;  1OCV A;  5AIH A;  5FGO A;  3WA2 X;  1OF5 A;  2YFL B;  2C4B A;  1SQW A;  1UUG B;  1BAO A;  1VQ4 3;  1ISK A;  1IQY A;  2ML6 A;  4MMZ B;  5ELU A;  2CWU A;  3WHO A;  3A5E A;  3JUP A;  1QJG A;  4KT3 B;  1I2E A;  1KWI A;  1OHP A;  3K63 A;  1SPU A;  1UDI I;  1IT7 A;  1B2Z A;  4HZ9 B;  4KFF A;  3BNE A;  2OTJ 3;  1Q9E A;  3ALA A;  3CNX A;  1O7H B;  1T5Y A;  1UCJ A;  3EQQ B;  3DY5 A;  4HM3 B;  2H0I A;  1TP6 A;  3AGN A;  1GY6 A;  4WFO A;  1EG9 B;  3X3Z A;  1MWR A;  4FR9 A;  2UX0 A;  4ORL A;  5AYR B;  1SII A;  3T0U A;  1L5G B;  4N6O B;  1JBT A;  5IEO A;  2OOV A;  5STD A;  4EBG A;  3H3H A;  1SIH A;  5AIG A;  3GRD A;  1EUI C;  1BRJ A;  1I2G A;  1IQX A;  2CFK A;  4OK0 A;  5JPU A;  3CC2 3;  3MKI A;  4MMX B;  1FGO A;  5CF2 A;  1M9G A;  2C10 A;  1BGS A;  3MYT A;  1MWT A;  2D1W A;  3FZW A;  1U8C B;  4ZM8 A;  3D9R A;  2RSX A;  1YJN 3;  3S29 A;  3MPH A;  3KE7 A;  3VF1 A;  2ZA4 A;  3GZR A;  3CME 3;  1RN4 A;  3OV4 A;  5BU4 A;  3G6E 3;  2XFS A;  1IV7 A;  2OWP A;  4HVN A;  1KSI A;  4RNY A;  2CFD A;  1AQZ A;  4R1K A;  1IK3 A;  3UB1 A;  1VQK 3;  3F40 A;  1IVW A;  1EKM A;  3ZG5 A;  3QRD A;  2XGN A;  2CHC A;  1GY7 A;  3FSD A;  5LC6 A;  2K0M A;  5M19 A;  1DMM A;  8RNT A;  5FW5 A;  1JBS A;  2RCD A;  3LML A;  4H61 A;  1RMS A;  3SXX A;  3EN8 A;  3NM7 A;  3PCS A;  1BSA A;  4HAA A;  1CEW I;  1N5H A;  2F5W A;  4HOH A;  2Q07 A;  2W56 A;  1CQS A;  4LYL B;  1BNJ A;  1W6C A;  5AYS C;  3STD A;  9RNT A;  3EE1 A;  2K54 A;  1AVK A;  3F14 A;  5RNT A;  3BB9 A;  3D3L A;  2INX A;  2YFJ B;  3RNT A;  2WGQ A;  1VQQ A;  2KF3 A;  1IV9 A;  2O3O A;  2YFI B;  5AEU B;  2CFG A;  5EQL A;  1Q86 4;  1JKG A;  3WMD A;  1RGC A;  3EC9 A;  1UCL A;  1JB2 A;  3ZFZ A;  1OGX A;  3B4P A;  1BIR A;  1JZO A;  2E2T A;  2KF5 A;  1JNQ A;  3N54 B;  1U5O A;  1W7C A;  1VQP 3;  2IA7 A;  7GSP A;  2Z76 A;  1TU5 A;  2BMQ B;  4WHA A;  1YGW A;  1GOU A;  5JBS A;  3D5G A;  3HI7 A;  4K1V A;  1IDP A;  1RCK A;  2XFT A;  4EC6 A;  2UUG C;  1BOX A;  4O3V A;  4R9K A;  6GSP A;  1GMP A;  3Q2P A;  4FCJ A;  4EXR A;  2QGU A;  3KKG A;  1DVD A;  1TFO A;  2IUJ A;  3NBB A;  3NQZ A;  5AII A;  3LTD A;  2XSH B;  3NBR A;  2AAD A;  2CFW A;  5BXQ A;  3FH1 A;  1YIT 3;  2OQE A;  1US1 A;  4J5K A;  3LTC A;  5CXO A;  3M8C A;  3VGN A;  2OCT A;  4AKY A;  3CPW 2;  1X1U A;  1E3R A;  1TRP A;  2CX1 A;  3T8U A;  5EEO A;  1B2X A;  3WA3 A;  3CXC 2;  3HII A;  1D6Y A;  1BRS A;  4WP5 A;  2AAE A;  3CCR 3;  3N8B A;  1IVX A;  4N6T A;  7STD A;  1GSP A;  4IIA A;  4BU4 A;  1LOW A;  1K8A 4;  1AVL A;  4LEH A;  1BRK A;  1GMQ A;  1Q42 A;  3D4A A;  1BSB A;  3F9S A;  5G2G A;  1WMN A;  3KN4 A;  3JVC A;  3BNC A;  1BNF A;  2E2V A;  4HKV B;  4HYZ A;  1BSC A;  2A15 A;  5IF6 A;  1NU3 A;  1LOV A;  2W03 A;  1RGF A;  2FXT A;  7RNT A;  1W02 A;  2KAA A;  2CIU A;  2CWV A;  1LOX A;  1FGT A;  5DRE A;  1W01 A;  3DZL A;  1CYU A;  1YHQ 3;  1FGR A;  3RGR A;  1G02 A;  1WNH A;  3PS8 A;  1T2I A;  1X1W A;  1YVB I;  1K28 A;  3IMA B;  4MMY B;  4BL2 A;  1W6G A;  2MC8 A;  1KD1 4;  3O8Y A;  1LQG C;  1Z1S A;  2BHM A;  2XSO B;  3FG4 A;  4H3U A;  1ZO2 A;  1STD A;  1NB3 I;  1ULJ B;  2Y74 A;  3KCH A;  4LZI A;  1STF I;  1RCL A;  4XBT A;  1ZGX A;  3F7S A;  3BND A;  4OVM A;  1UCK A;  1QMA A;  3K5T A;  3PCR A;  3CD6 3;  3GZY B;  3CU3 A;  2CG1 A;  1BRI A;  3SLU A;  1FW7 A;  2HMO B;  1FGM A;  2WOH A;  2P09 A;  3F8X A;  2ZDJ A;  2ZHX B;  2F56 A;  1M1K 4;  1JB4 A;  3GAX A;  1RRL A;  1V74 A;  1QAL A;  1R4Y A;  1LVN A;  5BIR A;  1RN7 A;  4MEI A;  1BRG A;  1DET A;  1ZX2 A;  3G16 A;  4MJD A;  3UJM A;  3CPO A;  3E99 A;  5G1K A;  1B2M A;  1O7G B;  1OH0 A;  2B24 B;  2JDI H;  4N6M A;  3BNB A;  4HM4 B;  4XB5 A;  3B7C A;  3AMO A;  1BNE A;  1ZS7 A;  3NV0 A;  3SOY A;  3S5C A;  1I8V A;  2CX0 A;  2MF7 A;  1JBR A;  5BVB A;  1A67 A;  1VQ7 3;  4KZ1 A;  5A0O B;  1N9J A;  2W56 B;  2GSP A;  3S28 A;  3HX8 A;  3CCE 3;  5GSP A;  3NX0 A;  1RSN A;  6RNT A;  2KRT A;  3S67 A;  2GEX A;  3A76 A;  4XDV A;  5CF1 A;  4IPB A;  1PYL A;  2BMR B;  3F8H A;  1FUW A;  3DGN A;  4NRE A;  1NWW A;  3JUO A;  1V57 A;  3NHX A;  1E3V A;  2RNT A;  3OWS A;  3PZW A;  2Z7A A;  2J8X B;  3EBY A;  1Q40 A;  2OOV C;  3NBJ A;  1T3B A;  3OWY A;  1RNB A;  4IT7 A;  4LGQ A;  4AEQ A;  2HMN B;  3Q3F A;  1BSE A;  1FUT A;  2W0Q A;  1B27 A;  1YI2 3;  1K9M 4;  4HM6 B;  2STD A;  1E97 A;  1ULI B;  2GBX B;  2WGO A;  3DM8 A;  5CK6 A;  1Y4K A;  3X3Y A;  8CHO A;  2CK3 H;  5IG4 A;  3UL6 A;  3CCM 3;  4N3V A;  1LXE A;  4RZM A;  1PU4 A;  5KP1 A;  3MWZ A;  1NNV A;  3GWR A;  3DH2 A;  1MOL A;  3FF2 A;  4R9L A;  1TUH A;  3WDG B;  1VQN 3;  3J7Y d;  1RGL A;  1FA3 A;  4FCZ A;  2W2C A;  2XRX B;  1S5A A;  1UCI A;  4K61 A;  1RGE A;  4N6N B;  1RDS A;  1O7P B;  1D6U A;  4J8T A;  1A2P A;  5D83 A;  1I0X A;  1HYF A;  1GY5 A;  1GYB A;  1FUS A;  1ASK A;  1O7N B;  2R4I A;  3HZP A;  3LT8 A;  3LT9 A;  3FG3 A;  3PXM A;  1A2K A;  3DGO A;  1TIJ A;  2XR8 B;  4STD A;  3WOE B;  4U13 A;  4HM2 B;  1G96 A;  4N6V 0;  2IMJ A;  3WOF B;  2F98 A;  4WYK A;  2CWT A;  3GZX B;  2M7O A;  3D5I A;  5DRV A;  4GSP A;  2JQ5 A;  3LTB A;  2HOH A;  4FMB A;  1QAF A;  4JRF A;  3WOD G;  3X41 A;  2CFL A;  1G0T A;  1MGW A;  1I2F A;  2F99 A;  2GU3 A;  2E2U A;  4GB5 A;  4Q53 A;  3KSE D;  1DE3 A;  2XEP A;  1NDO B;  2L4V A;  4FMA A;  1Q81 4;  2B1X B;  2ZL8 A;  4HBR A;  3OWU A;  3CCU 3;  3UNL A;  3UL5 A;  4GHO A;  3DGL A;  4J9A A;  1JJ2 2;  3FF0 A;  3BIR A;  1BUJ A;  1WMP A;  1R4C A;  4OUQ A;  1RGG A;  1B2S A;  4NPB A;  1B2U A;  1AY7 A;  3F7X A;  3IPT A;  1TJD A;  3B8L A;  3URP A;  3H51 A;  3IJE B;  1OF5 B;  5IG5 A;  3RGA A;  3LH4 A;  1BSD A;  2Y73 A;  1MWS A;  5EVH A;  2CW9 A;  1OGZ A;  2BMO B;  1D6Z A;  2FNQ A;  2QIY A;  3LZA A;  4HM7 B;  4K90 B;  4LMI A;  5ELJ A;  3CC4 3;  1FGQ A;  3K9M C;  1UI8 A;  5KP3 A;  1M1X B;  1W2B 2;  2BO9 B;  3CCQ 3;  3I55 3;  1RTU A;  1OAC A;  1T2H A;  3OW2 2;  1X1Y A;  2XH9 A;  4R4K A;  4CCV A;  4NHF A;  1DVC A;  5G1L A;  4I5Q A;  1UGH I;  2GBW B;  2OQE C;  1NB5 I;  1IYY A;  2CC3 A;  1IVU A;  1PY3 A;  4EV5 A;  1NJI 4;  2CKF B;  1WTH A;  3MG1 A;  4EW5 A;  3BU4 A;  3Q1C A;  4LSO A;  4TX4 A;  1LOY A;  2W9P A;  3EBT A;  4RNT A;  3FCS B;  2RBI A;  3SVA A;  2LYX A;  1QVG 2;  3AMO B;  1UGI A;  4CPK A;  1AV4 A;  3V99 A;  1N5P A;  1N9E A;  2KF4 A;  3X3X A;  3X42 A;  4L8O A;  1ROV A;  1BRN L;  1BNS A;  3OX9 A;  1B21 A;  1O7M B;  1RNT A;  3Q90 A;  6STD A;  3KII A;  4L8P A;  1SAR A;  4HM0 B;  3KFQ C;  2RGQ A;  5AIF A;  2P38 A;  1Q7H A;  4G1M B;  3I56 3;  1FYS A;  2IY2 A;  4X2H A;  1RGK A;  4XM4 A;  3LTA A;  1BNR A;  2Z6B A;  1HZ1 A;  3KZT A;  3DUK A;  4BTX A;  1IU7 A;  3NQY A;  1JRQ A;  4X2O A;  2KF6 A;  3PGB A;  1YVS A;  1PFP A;  2CH9 A;  2XGL A;  2P05 A;  1VQ6 3;  5IG0 A;  1W00 A;  1JB5 A;  2FGT A;  1RLS A;  3DXO A;  3EB8 A;  3K0Z A;  3X40 A;  1DYU A;  1YGE A;  1UW1 A;  4XBX A;  1RHL A;  1QVF 2;  5KP4 A;  3U1W A;  4KVH A;  4K1U A;  2KXG A;  1BVI A;  1JN5 A;  4L7K A;  1NO3 A;  3ER7 A;  2H0H A;  3N9H A;  3VSY A;  1GOV A;  1IVV A;  1I3I A;  1X1X A;  1TFK A;  5D81 A;  3S27 A;  3G4S 3;  4N6L A;  1KC8 4;  5AEW B;  5IW9 A;  1EQK A;  1JKG B;  2LQV A;  1HKX A;  1RGA A;  2WO0 A;  3G0K A;  3RDE A;  2P0X A;  2GXF A;  1FZU A;  3EF8 A;  3JUQ A;  4HZB B;  3T8N A;  3NM2 A;  2GEY A;  2D42 A;  1OPY A;  1HU9 A;  3KSP A;  2F4Y A;  2IYJ A;  4WYK B;  1VZZ A;  3MHE A;  3V92 A;  3JUM A;  4CDL A;  1Q82 4;  1F8N A;  3JUN A;  1DMQ A;  1RRH A;  2Z77 A;  4WWU C;  5JPP A;  5M18 A;  2BIR A;  3SED A;  1RJO A;  2HMM B;  2W6J H;  5I97 A;  3BLZ A;  3MG2 A;  1MNL A;  1Q7Y 4;  3AGO A;  3EN1 B;  4FMD A;  1GMR A;  2V1L A;  2GU1 A;  1W6Y A;  2UGI A;  3FKA A;  1YIJ 3;  3CCJ 3;  1BU4 A;  1LNI A;  4O02 B;  1MGR A;  4RBN A;  3DMC A;  2QA4 3;  4BL3 A;  1AR0 A;  3AHW A;  4CJN A;  1S72 3;  3GZB A;  2KCD A;  5D82 A;  1BNI A;  2I9W A;  5IEN A;  3D79 A;  3NXJ A;  1C7H A;  3CCS 3;  2WOF A;  1N8R 4;  1VQ8 3;  1IQ8 A;  4R80 A;  1M90 4;  3FLJ A;  4EYC A;  1KQS 2;  4O2H A;  4XDW A;  3G71 3;  1LNH A;  2YX9 A;  2BT3 A;  1CH0 A;  1CYV A;  3HOH A;  1J2B A;  1DMN A;  4BTW A;  2QEX 3;  1O7W B;  1C54 A;  4HM1 B;  1TRQ A;  2BU4 A;  4QWT A;  2HML B;  3CMA 3;  2OTL 3;  3QK9 A;  3TDG A;  2K3D A;  5TGN A;  4KFE A;  4XBY A;  4HM8 B;  1TTO A;  1V58 A;  4KFD A;  3ROB A;  1ROA A;  1W4N A;  1BUQ A;  4FCM A;  1N8Q A;  1GS3 A;  4O8S A;  3L0R A;  1VQL 3;  2ML5 A;  2HMK B;  3AHS A;  4I4K A;  1YNV X;  3V98 A;  1GD3 A;  3G8Z A;  2F86 B;  4HJL B;  5IEP A;  2O9U X;  2C11 A;  1OHO A;  2RFR A;  4GL6 A;  4JF8 A;  5HGR A;  5LC7 A;  3K7C A;  5IG3 A;  2PZV A;  3SYU A;  1K73 4;  2R41 A;  2W04 A;  1BNG A;  5IER A;  1OUN A;  1MWU A;  2SAR A;  1BAN A;  3HIG A;  3ECF A;  2W9Q A;  1I70 A;  1QAK A;  3U97 A;  3HK4 A;  4ILF A;  1YJW 3;  1JZD A;  3DGY A;  2PNC A;  3LYG A;  4BIR A;  2XF3 A;  1B3S A;  4PEJ A;  3CNM A;  4EV2 A;  3CC7 3;  2H0G A;  1IT8 A;  3NUV A;  1OHS A;  4J5G A;  1GOY A;  3GSP A;  1YJ9 3;  5HOH A;  1B20 A;  2CG0 A;  1BRH A;  4DKI A;  5M1A A;  3SX1 A;  4HM5 B;  3PYJ A;  3LXU X;  3CCL 3;  1WQL B;  3LOY A;  3WR2 A;  1VQM 3;  1LQM B;  4RNZ A;  1A90 A;  1SJW A;  2F5M A;  1VQ9 3;  1LRA A;  1RN1 A;  1GD4 A;  3B4O A;  1WMO A;  3NV0 B;  3SOA A;  1EA2 A;  1RKY A;  1VQ5 3;  3I0Y A;  1UI7 A;  2HMJ B;  3EJV A;  4N6U A;  1K41 A;  3CCV 3;  3FGY A;  1W5Z A;  4AKZ A;  1JN5 B;  1JV2 B;  3DGM A;  5CLK A;  1VQO 3;  1UUV B;  5AI1 A;  4BTY A;  2IUK A;  2P0M A;  3OXA A;  3EX9 A;  1EEJ A;  3MSO A;  1UUW B;  1RGH A;  1W2Z A;  3FG1 A;  1A2V A;  4FMC A;  3EHC A; 
#chains in the Genus database with same CATH homology
 4J5K A;  1RGA A;  1I0V A;  9RNT A;  1FZU A;  1I3F A;  1X1U A;  1TRP A;  1B2X A;  2C4B A;  2F4Y A;  1BRS A;  1BAO A;  2AAE A;  3D5I A;  3WHO A;  1GSP A;  3A5E A;  4BU4 A;  1LOW A;  1I2E A;  4GSP A;  1BRK A;  2BIR A;  1GMQ A;  2HOH A;  1B2Z A;  3D4A A;  1BSB A;  1MGW A;  1Q9E A;  1I2F A;  1BNF A;  1DE3 A;  3AGO A;  1GMR A;  1UCJ A;  1BSC A;  1LOV A;  1RGF A;  3AGN A;  7RNT A;  2KAA A;  1BU4 A;  1LNI A;  1BUJ A;  1MGR A;  4GHO A;  3BIR A;  3AHW A;  1G02 A;  1T2I A;  1X1W A;  1JBT A;  1BNI A;  1RGG A;  1B2S A;  1B2U A;  1AY7 A;  3URP A;  1BRJ A;  3KCH A;  1I2G A;  1RCL A;  1BSD A;  1ZGX A;  3WR2 A;  1UCK A;  1CH0 A;  3HOH A;  1BRI A;  1FW7 A;  1BGS A;  1C54 A;  2F56 A;  1TRQ A;  2BU4 A;  1RTU A;  1T2H A;  1R4Y A;  1X1Y A;  2ZA4 A;  5BIR A;  1BRG A;  1DET A;  1RN4 A;  5BU4 A;  1TTO A;  1AQZ A;  1B2M A;  1IYY A;  3AHS A;  1PY3 A;  1YNV X;  3BU4 A;  8RNT A;  1LOY A;  4RNT A;  1JBS A;  2RBI A;  1BNE A;  1RMS A;  1I8V A;  3SYU A;  1JBR A;  1BSA A;  1BNG A;  2KF4 A;  2SAR A;  1BAN A;  2F5W A;  4HAA A;  4HOH A;  1BNJ A;  2GSP A;  1BRN L;  1BNS A;  5GSP A;  1RSN A;  1B21 A;  1I70 A;  1RNT A;  6RNT A;  5RNT A;  1SAR A;  3RNT A;  1PYL A;  3DGY A;  2KF3 A;  4BIR A;  1B3S A;  1FYS A;  1RGC A;  1RGK A;  2RNT A;  1UCL A;  1BIR A;  4J5G A;  1GOY A;  3GSP A;  1RNB A;  1BNR A;  5HOH A;  1B20 A;  2KF5 A;  1BRH A;  1HZ1 A;  7GSP A;  3Q3F A;  1BSE A;  1FUT A;  2KF6 A;  1YVS A;  2F5M A;  1B27 A;  1YGW A;  1GOU A;  1LRA A;  1RLS A;  1RN1 A;  3D5G A;  1RCK A;  1RHL A;  1BOX A;  1FUS A;  6GSP A;  1GMP A;  1BVI A;  3DH2 A;  1RGL A;  1GOV A;  1I3I A;  1X1X A;  1UCI A;  1RGE A;  1RDS A;  2AAD A;  1RGH A;  1A2P A;  1I0X A;  1HYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...