1MGSA

The solution structure of melanoma growth stimulating activity
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of melanoma growth stimulating activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine(growth factor)
molecule keywords HUMAN MELANOMA GROWTH STIMULATORY ACTIVITY
total genus 9
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1mgsA00
2RA4A 1PFBA 4OIJA 1U4RA 1HRJA 1ILQA 3P7JA 1Q3LA 2MPMA 3H91A 4ZLTF 3F2UA 1BBXC 1E0BA 1VMCA 2L1BA 4MHEA 5EJWA 1J8IA 5CMDA 2B2YC 5EPKA 1B53A 1DOKA 1NR2A 4HSVA 2B2VA 2X6LA 1EL0A 4MN3A 1B4OA 2KUMA 2X69A 4U68A 1PLFA 2JP1A 2L12A 1WVLA 1C8CA 2K03A 1WTOA 1MI2A 1NR4A 1PFNA 4DN4M 3KBXA 2CVRA 3LWEA 1XX8A 2Q8TA 1WTRA 1BNZA 1IKMA 2Q8RE 3ONAB 2JYOA 5D14A 2HUGA 5T1IA 4X3UA 4ZKBB 4OIKA 2DY8A 4LMQD 2B2UA 4R8IA 2B2WA 4IUPA 5CORA 3N52A 1GUWA 1G2SA 2M2LA 2R3ZA 1DOMA 2B2TC 2RSOA 4IUTA 1EOTA 2FJ2A 3FPUB 1QNKA 1RHPA 2MGSA 5EPJA 3TN2A 1HFGA 1DOLA 1A15A 2L4NA 2HDLA 1F9SA 1NAPA 2B2VC 2KOLA 4IUVA 5CBEE 2H1EA 5JJZA 2SDFA 1ILPA 2NYZD 1LV9A 2HCCA 3I8ZA 5E4WC 4HAEA 1ZXTA 2K01A 1KNEA 2B2YA 1DONA 4QUCA 2FMMA 2KECA 1WD1A 1X3PA 1MSGA 1VMPA 1F9QA 5CBAE 1TVXA 4IUQA 1MGSA 1HA6A 2VXWA 1O7ZA 1QG7A 5T1GA 4X3TA 2KEDA 4XT3B 1EIHA 2B2UC 1PDQA 4CJ0B 2KVMA 5D65A 1WTXA 2B2TA 1QE6A 2DY7A 1F9RA 1AZQA 1NCVA 1G91A 2FINB 1WTWA 1RODA 2K05A 3FDTA 2XIWA 3I90A 3SVMA 3MTSA 1RJTA 4HCSA 2HDMA 1CA5A 1M8AA 1SSOA 2HCIA 4RAUC 1F9PA 4X3KA 2K04A 1RTNA 3QO2A 2NWGA 1HUNA 4CJ1B 2N88A 1HFNA 1B3AA 1S4ZA 1U4MA 1O80A 1SAPA 1KNAA 1G2TA 2RSNA 1WTVA 1WTPA 4O42A 2X6GA 3GV3A 4IURA 1JICA 1DZ1A 3DM1A 1ICWA 1HUMA 1ESRA 4QUFA 1WD0A 3DEOA 2FHTA 1CA6A 1JE4A 2N55A 4XDXA 1BO0A 1X3QA 2B2WC 4UAIA 1AZPA 1AP0A 1EQTA 3HP3A 3KUPA 5DNFA 3UI2A 2KEEA 1IKLA 1IL8A 1X32A 2L9HA 3MWYW 4HEDA 3I3CA 4ZAIA 1BF4A 4NW2A 2D9UA 1PFMA 3G7LA 3D6WA 2K28A 4RWSC 4XT1B 4X3SA 1B50A 1G6ZA 1SDFA 3IFDA 5AFWA 1EIGA 1ML0D 1O7YA 5EQ0A 1U4PA 3TZDA 2L11A 1MSHA 1J9OA 2MJ8A 2EE1A 2NZ1D 3Q6SA 1B2TA 2EPBA 2K1BA 1WTQA 4IUUA 2J7ZA 4RA8A 1F2LA 1U4LA 2FFKB 2MP1A 3R93A 2RVLA 4R9WA 3I91A 5EKIA 4ZKCB 1XYIA 2EOTA 4ZK9B 2IL8A 5E4XA 3GV6A 4CJ2C 1HHVA 3DEPA 5EPLA 1RTOA 2BDNA 1CM9A 5COYA 3IL8A
chains in the Genus database with same CATH superfamily
3NQTA 1I4RA 5CR3A 1EUJA 1Q3LA 2EYJA 2TSSA 2IY5B 1JJ2A 4JBJA 2KJXA 5C6AA 1Z6HA 2E8GA 5KNCA 1Q86C 4K14A 2L12A 1WCMG 4JI2L 1JOKA 1CTMA 2F3WA 1IKMA 1SBBB 1TR5A 2CVRA 4A93B 4LF9Q 3ZYYX 3W1BA 3QIAA 2JA6B 1HNWQ 3A8JE 4EQNA 4C1NI 2R3ZA 1L0XB 4B9WA 1YNJC 2F0WA 2F0KA 1ILPA 4JI1L 3HOWG 3JAME 4LF8Q 1CQVA 5IYCH 3RN5A 1DONA 2A19A 1T9HA 4UDUC 2UUAQ 1Z9FA 1LACA 1SYBA 1FL0A 2BA1A 2D5DA 2Y0SB 2UU9Q 3HOYH 2KVMA 2UUBL 3HGBA 4KJOA 1XXGA 2R92H 2Q2HA 1HR0L 4DR7Q 1LT6D 1Q1BA 1PH4A 3PF5A 3FDTA 1V1QA 2B3GA 5CV9A 3GDEA 2B63B 1OTCA 4K8JA 3HZXA 1SE8A 2HDMA 5I2XA 3QO2A 4KHPL 3T13A 4F8MA 5J22A 1UUPA 2IJ0A 2E2JB 3DWQA 1NBWA 1K3RA 3NPPA 2R7FA 1MKHA 2CW0D 5IT9c 4OWWB 4EQPA 1VQIA 3U9OA 1JWSD 3S24A 1AN8A 1OXUA 4JI8Q 2IX3A 3RMHA 4GOPC 1NNXA 1UAPA 1YHQA 2RDFA 4H44C 4OXPA 5EKKA 3S1NB 4GLAC 2J7ZA 1E2ZA 5JPMC 1EZ8A 3V96A 3R93A 1FR3A 4JI6L 1XMOL 2JA5H 3BZDB 5M5WB 2AWOA 1RTOA 3MXNB 5M5WH 4LFBL 5COYA 4YCVA 4NP5A 5C3WA 4ZYSA 4WFN3 4CKCA 4LUVA 1BBXC 2KHSA 1NJIC 1J8IA 1HR0W 3KF8B 2LFNA 1DOKA 5BR8L 2JK8A 4JK1C 3PMFA 3J7YW 1WVLA 4PMCA 1WCMH 1JB7A 3ND8A 1JR0D 1SRUA 1SXTA 2Q8RE 3H15A 2UUCL 4DNIA 3FEWX 5LMNW 3D3RA 2NVXB 2ZJRA 2DGYA 4M8AA 1S5DD 2OXPA 2ZM6L 4HMJA 5EPJA 1TXYA 1HFGA 2E2JH 1LM0A 3J81j 3RN2A 1S5BD 1PYSB 5IT9L 4IQZA 3H09A 1EIYB 3KBGA 3G71A 1Z47A 1XNQL 3CMAA 5FLMH 3DWAA 1K83B 1SEBD 4DR6L 4J1MA 1G91A 4PQXA 4DR1L 4DR2L 5E7NA 1DD2A 1H9MA 2E2IH 1EFWA 1TWAH 4IALA 5D3DA 1JORA 4NDXA 4C1NK 3GTLB 1WOCA 1V8QA 1Y1VB 1WYDA 2NWGA 2D2CC 1HFNA 1B3AA 4TVAB 1SAPA 1O7IA 3S17B 5C3EH 4YWKA 2VUMG 2R93G 1ESRA 4XYOA 5EKLA 1PTOF 4Q0FA 4NMZA 1L2FA 4XDXA 1Q46A 4A3MG 3R2TA 3PO2H 4H0LC 2E74C 2KEEA 4HEDA 4BA1I 4ZAIA 1HQMC 2PPBC 4YWMA 2WB1E 1A8VA 1AW7A 5EQ0A 3A55A 1J9OA 1Y1VH 3N6RA 4ILWA 2PZWA 4A75A 1EYCA 2EYLA 3UDXA 2CHBD 1PV4A 2PQAA 2V4DA 4L5RC 2JXMB 4FXKC 2IL8A 1UE1A 5AJ3L 1IBLL 3DEPA 4WJ4A 4O2DA 4ODGA 1CM9A 1TIID 4WORA 4S3SA 2UXCL 3URYA 2OQKA 2JA8G 1LUZA 2MPMA 5E1FA 4A3GG 4B3ML 1CZGA 2CWPA 3F2UA 3PUYA 3PV0A 5I4DA 1YJWA 4A3GH 1RIPA 3K58A 5FJ8H 5KEEA 1AE3A 3LWUA 1EL0A 1CKNB 4R8NA 1B4OA 2KUMA 1NTGA 5EBDA 2G9HD 5FK9C 1NR4A 2J4XA 1SNMA 2Q8TA 1FGBD 5JAVA 2XSCA 2O5IC 2RHQB 4OIKA 4A3JB 2LXJA 4PZ8A 3T16A 1W6KA 4MTNA 1DOMA 3RNUA 4DV5L 1DCZA 3P20A 3OTOQ 3X3NA 3I4MB 4DV3L 2XWJB 4HTHA 1YIJA 1X56A 3TP7A 2PMZB 4IJLA 2B2YA 3TMEA 1MSGA 1D5MC 1F9QA 1N36Q 4CBVA 5C4HA 2R93H 4KY5A 2VS1A 4R4CA 1VQCA 1RL2A 2V1CC 1PYWD 4DV7Q 2DY7A 1F9RA 5GROA 3F1ZA 4DU9A 2EXZA 4G7ZC 4TKOB 1I3QH 4TSSA 3H3VI 1EY9A 2AUJD 2KHJA 3STBD 4A3IB 4OX9Q 5M3MH 4Y7NH 4JYAL 1PRTD 4K0KL 1WI5A 2CQOA 5CV8A 1UWVA 5C5LA 2SNSA 3ULPA 2J0TD 3J80E 4JBMA 3GTMH 4HR7B 2F0NA 3NTKA 3I4LA 3BDCA 4ME3A 1L0YB 2CWAA 4HIDA 1DZ1A 4A3FG 3DM1A 3D8GA 1SFOH 1WD0A 3DEOA 4Z9CB 5C4XH 5KNBA 4DGZA 1NY4A 3Q22A 2EQSA 3AMUA 1AZPA 2YTYA 1TS3A 1N34Q 3AU7A 3KUPA 3F2DA 1IL8A 1YJNA 4LF4L 2QEXA 3WOEA 5DM73 1PHJA 4ZUIA 3GTKB 3DUZA 4E6IA 1S5FD 1Q7YC 4PG3A 2Q2IA 3RZDH 4P72A 2B8FA 4DK6C 1Y8OB 2RDGA 1D2BA 1F2LA 4DXFA 1UNSA 4LJZC 5GAHC 3EBEA 2A68C 3K7AH 3AFQA 3I7FA 1JWMD 1VQJA 2BDNA 2ENBA 4QY7A 2VB2X 4XYQA 3CHBD 4OWTB 3HOVB 4C3IG 2F0UA 5CGKA 4UPAA 1K28A 1VQGA 4M1UB 3VR3A 2P5ZX 4U68A 1A62A 1PLFA 2JP1A 3S1RB 3KLWA 3J81E 1K8OA 1TWCB 1HZ9A 5JPNC 1VF7A 3GTOH 3MEFA 3WOFA 4A3IG 2UXBL 2BDOA 1MJCA 5DM63 4C3HH 4K5XA 2Z9HA 2M2LA 4OHJA 5FLXc 2TMPA 3OHXC 1QNKA 2A73B 2EY2A 1IZ6A 1DYQA 3BG3A 1LV9A 2CH4W 3E9IA 4YY3Q 3HOXH 3MEHA 1WD1A 1BQQT 2NN6I 4X65Q 1Q8KA 5T1GA 4EQ5A 2KEDA 4CJ0B 3OIQA 3U4VA 1QVCA 2EY1A 3NQIA 4B08A 2MUYA 3E9HA 1V1PA 4JI3L 1I6VC 2XIWA 4PZ7A 5HGQA 2YV5A 4GS3A 4GLXA 1EYGA 3S15H 3U4ZA 3OMGA 4X66L 1ZYRD 3WDNA 1F77A 2EJMA 3Q24A 3E0JA 4DUZL 1OO9B 4DR3Q 4POFA 1EQRA 2A1AA 1C0AA 3SGIA 1CFMA 1A0IA 1J6QA 1GHJA 3T1HL 4MIUA 4N8FA 1LTBD 5LL6X 4UAIA 4DV0Q 1HZAA 3HOWH 2F0DA 3BYTB 3K57A 4UP8A 1STEA 5I9OA 2PZTA 1LTRD 3H0GH 3MXPA 1L1OA 3CC2A 1RD9D 2VUMB 1SDFA 3NWTA 4DPGA 1T5XD 4GKJL 1QJOA 2F1MA 4RMFA 4GNXC 3CCVA 3EFXD 2PI2A 5KIXA 1AEXA 1N9WA 2EVBA 2XGTA 5IYBH 3J81L 2HQLA 1E24A 4A3IH 4A3LG 4HJ9A 1PH9A 1KDCA 4AYBB 4A3KH 3GTJB 3I4NH 3OW7A 5C4JH 2LS01 3FHWA 1Y1WH 1X55A 1T5EA 4OO1G 4PZ6A 1BBWA 3T1YL 2F0JA 1FNWA 3HOUB 1QZGA 4HMIA 2L1BA 5EJWA 1GO3E 1HNXL 1HH2P 1B53A 2F0QA 1YI2A 4G7OC 2F0VA 1OXVA 1TY2A 1C8CA 3L0OA 3QG1A 3TP8A 4KHPQ 1AE2A 2A5HA 2QDLA 4A3KG 2I07B 3GO5A 1L0WA 3GTGB 3VYRA 3E5SA 2K7VA 5IYBG 3UDIA 2DY8A 1U9RA 4LMQD 4RCOA 4R8IA 2H4OA 4FXGC 1KC8C 1EY4A 1SMYC 1RHPA 5FOBB 2F3IA 1QVGA 2EIFA 5IWAQ 5CC4A 2JA7G 1HR0Q 4QMGA 2NVYH 4IPCA 1NE3A 2FMMA 1JT8A 2E5LL 5C4XG 4DR7L 1TWFB 2VXWA 1U5KA 1JC7A 2EYOA 2D0OA 2F0MA 2F0IA 4XQNA 1S5ED 1HZBA 2K05A 3KK7A 5HY6A 1XNRL 4JV5Q 5GAGC 1Q82C 1I50H 2ZT9C 2VZAA 5ELEA 4ME5A 5CV5A 3CCLA 2R7ZG 3A56A 1SYFA 4MZ9A 4DAYA 2NVQB 3UE1A 2AHOB 1R4QB 2MO1A 1VQ9A 1PVOA 3CRKC 3P1HA 1FJGL 1E1TA 3BVGA 1TWGH 1LLRD 2RCFA 3PO2B 3HOZG 3EA6A 1JJGA 1IBKQ 1A2TA 3KLSX 2A69D 4EQOA 1CKMA 2Z0SA 1PMRA 1I4QA 1BF4A 1YNJD 1ENAA 4A3BH 2N78A 3NENA 4CDFC 1Q81C 1C48A 2F0SA 3GTLH 4C3HG 3A7LA 4OGQC 4WJWA 3M7GA 1Y8PB 1VQPA 4K0KQ 3CCRA 3FKIH 3H6MA 2RVLA 1EY5A 1ENFA 1TWGB 3I91A 3W3AA 1FGUA 3MXGA 4HN7A 4ZK9B 4ZKCB 3JAMi 2KCNA 5EPLA 4V0BA 2Q8IB 1PFBA 4OIJA 3S1RH 3W1GA 2R7DA 3P7JA 5NUCA 4FVMA 3CXCA 4DR2Q 3L2PA 1K8AC 3NBIA 3S1MB 3AQQA 2QA4A 2E75C 4RFBA 1NR2A 4JI4L 2XTIA 3RR5A 2O4XA 2Y0SE 1SN8A 3DHQA 1UE6A 3LWEA 4RHSA 2F0LA 4BS9A 5IGEA 2EYMA 1HNZL 2SOBA 4U673 1D6EC 1U0LA 4P73A 4I65A 5ELOA 1EY8A 2R7ZB 4G4KA 1LTTD 4RGNA 1TS4A 2B2TC 1I4XA 1UE5A 3FKIB 3SK8A 4GN3B 2O5JC 3B6YA 3RZDB 5CBEE 1NAPA 5JJZA 5JJIA 4B3TL 4MTKA 1GUSA 4A3MH 1VDZA 3RLFA 1H9KA 4KLKA 2Z4HA 3I56A 1QOHA 2Z6KA 1QG7A 5FLXE 1W6JA 5J39A 4LF5Q 5IODA 5D65A 4TRDA 1N33Q 3D0FA 4RGOS 1STGA 1I4PA 5E3FA 3M85A 4DAPA 1BKBA 4BBRH 1D1IA 3C1EA 4OEMB 3PIP3 3L7ZC 1SYDA 3S1NH 1LTLA 4RG1A 4BBRG 2OQ0A 2HCIA 1FNUA 2VL6A 5KNDA 2K5NA 3QOLA 5JVH3 3PO3H 4FF1A 3NBHA 3L9AX 1VQHA 3E6ZX 4DUYQ 1HQRD 1ICWA 5FKAC 3TSSA 1I50B 1P16A 2N55A 1EQTA 4BA2I 3UI2A 3J81i 3K7AB 4AQYL 4G7HC 4H02A 3KF8A 1E2WA 2D9UA 1J5EL 2CW0C 1SE3A 1QILA 3KJPA 5AJ3Q 2NVYB 1IBLQ 1B2TA 3I72A 2EDGA 1TKWB 3W5OA 4JV5L 1WTHA 1U4LA 4DKAC 3D4DA 4DV2Q 4R4TA 1VQKA 2JN4A 4A3EH 4EX5A 1XYIA 3KLSA 1HHVA 4LUOA 5FJ8G 1SFOB 2XN9C 4L5QA 4AYBG 5IGCA 1IYVA 4LW1A 4DV4Q 4JI0L 2ICIA 1CUKA 1PH1A 1S72A 1F2MA 1XX8A 1TWHH 3KOJA 4C2MB 5K36G 1VS0A 5KGUA 5LMUQ 1Y1VG 1KLUD 5CORA 2VQFL 1AH9A 2HHHQ 3NXWA 5IGBA 1I94L 4K2KA 1Y1WG 1A15A 2K14A 2R93B 2L0CA 3ERSX 4NXMQ 3J80L 4A3BB 2ICEC 4JI6Q 4AIMA 3PUVA 5KYIA 3HOZH 4FF3A 2JJQA 4C3JH 5FO7B 4K2LA 4OX9L 4F88A 2HIVA 1QZHA 1PDQA 4LFCL 2BH8A 2KA7A 3HOWB 4DR5L 5C3EB 4DR6Q 2GVBA 5M3FB 3SVMA 5IIFA 1LTSD 4B3MQ 3MA2B 1CA5A 4ULLA 5IT9E 1GVPA 3HOVH 4B3RL 1BUVT 5I6WA 1SROA 1L1OC 3CCQA 1OXXK 3ICEA 1O80A 3TQYA 1KNAA 5M5YB 4O42A 1HZCA 4X64L 1GOZA 1QWYA 5BN3A 2B63G 1X54A 3S15B 1KIXA 3MHBA 1BO0A 2JA7H 1FYCA 1Z7TA 2ATWA 1C7YA 1H9SA 3K5MA 1VQ7A 4L63B 4JBWA 4X3SA 1SNPA 1PH2A 1CHQD 3FPPA 1XPOA 3RLNA 3GTKH 3TZDA 4K5VA 2MJ8A 5I9PA 1BR9A 4KJNA 1G8ZD 2MQHA 1IW7C 1KLGD 5D3IB 4R9WA 2QW7A 4R4QA 4YCWA 4RKBA 3E3XA 1E3PA 5M5XB 3S2HB 5JEAJ 2D62A 2EYPA 3CCMA 1I5FA 4JI3Q 4YCUA 4MHEA 1K0SA 3GTOB 5CMDA 3KDFB 2QCPX 1KXLA 4DUYL 2NZOA 3H3VH 3ERQA 1VQNA 1S40A 2B2VA 3I73A 3MFYA 4HJ5A 2AMCB 2F4IA 1N8RC 5C4JB 2CCZA 4P75A 3GD7A 4DR3L 1TWAB 4WJ3M 4ZKBB 3RZOH 4FF4A 2B2UA 1XTCD 4AYBE 3SDZA 5BN4A 3TREA 2ES2A 1G2SA 2ZTEA 3VR2A 1LT4D 2ZM6Q 1O78A 1EOTA 3FPUB 4R4OA 3MFGA 2K5QA 3S16H 2KOLA 2O2LD 3VA7A 2KCTA 1TWFH 4A3EG 2DNCA 5I6YA 1ET6A 1VMPA 4IPHA 5A35A 3F2CA 1SR3A 2EJGC 1N36L 1SLJA 3VYTA 2PO4A 4IN3A 5BR8Q 1CKOA 1WTXA 1Q12A 3SHLA 3BU2A 1K8GA 1WTWA 4JI0Q 3CF5A 3VYUA 2JE6I 3LX0A 2MO0A 2KCCA 3DMUA 1MIUA 4IOAA 1B7YB 2BA0A 2WINB 4H7BA 1DXMA 2OF1A 2B63H 1GUOA 4JI2Q 3S2DH 3QJYA 1PZJD 3VYSA 1H9JA 3BVMA 4EGVA 1SNOA 1YHAA 4N8X1 2Z1CA 3S1QB 3HOVG 1IXRA 2OTJA 2EJFC 3IFTA 4BBRB 2R61A 3GTQB 3QWNA 4LF7Q 1BXTA 2RHSB 3PF4A 3OWEB 5IP7G 1N34L 4DV1Q 4LF4Q 2F0FA 3H94A 1EIGA 1UEAB 2ZTDA 1U4PA 4BY1H 2K75A 3BDLA 3C2PA 4C3JG 4CDDC 1GHKA 3OYYA 1KAWA 1YBYA 2RDHA 2CFMA 1ASYA 4DXGA 1S5CD 1X3FA 3M7NA 2K5VA 3GP7A 1BCPF 4A76A 1XTDA 2I46A 1K73C 5FO9B 2KENA 4F87A 1HNXQ 3VDYA 3A5ZB 3IL8A 5CV4A 2G9DA 4IO9A 4A3JH 2WIIB 1PH3A 1D5XC 1E0BA 5EPKA 2M00A 1I4HA 1C4QA 4JC0A 2Z4IA 3K5OA 3A54A 2X69A 3KF6B 1UEBA 1WTOA 3K81C 1MI2A 1PFNA 4DN4M 2K4KA 3I4OA 3NELA 1BNZA 2JA8B 1MBYA 4A3GB 2ZJPA 5T1IA 4KD3A 1X6OA 1R4PB 1KDBA 4KKUA 3SXHA 4IUPA 2UXDL 1UE7A 1TU2B 4IUTA 1ENCA 4DV3Q 1RKNA 1IYJB 4IUVA 5C0XI 1EIFA 4LF9L 2BH2A 3TRZA 3BZCA 3QR8A 2OT2A 1HNWL 2K01A 3SR1A 1G291 1HA6A 4KMUC 1CSQA 3H3VC 5EGTA 4A3BG 3CPFA 4C3JB 2ALYB 4I7AA 2FMCA 3KDFA 1PH7A 2WAQB 2ZXRA 3CCJA 2KBNA 1SSOA 4RAUC 2VB3X 4A93H 2IX0A 2F52A 3OIPA 2A8VA 4QIWE 2NVQH 2UUBQ 2K5DA 3LNNA 1IYUA 5LMNL 2LMCB 5C3EG 1W3SA 1VQOA 1STBA 1LT5D 3PCOB 3PIO3 3I4NB 4KV6A 4N9TA 3Q23A 4A3DH 4G57A 4IJHA 3GTJH 4KN7C 3VR5A 1VQ6A 2Z8LA 1CKNA 5HURA 4OO1I 4X62L 5DNFA 2NBFA 2SEBD 1SNCA 2JEBI 1GJXA 1PFMA 1TY0A 4CHTB 4RWSC 2KHIA 2EZVA 3MC0B 4LFBQ 5JOBA 3NK9A 3R8BA 2LXKA 2EPBA 5JEAH 1B3QA 1R9TB 2PNHA 1I4GA 3U58A 5LHY1 1EEID 1D8LA 4HIOA 1VQFA 4O1NA 5E4XA 5IGFA 1ICFB 5BN5A 2FHTA 3C1FA 4L5SA 4J15A 1A3TA 4IPDA 3CPWA 1GUGA 3CP0A 3S16B 2K6AA 4A3CH 1KAAA 3S14H 3K5NA 2K03A 1KQSA 1WTRA 4ZQ3A 2I0QA 3PIPA 1BCPB 4WRDA 2NVTB 5D14A 2WAQG 3HS0C 3A0JA 4KN4C 5IYDH 2LY7A 2NN6G 4EVOA 3OTOL 3U9SA 4A3DB 4HJ7A 1LYLA 5JVG3 1CA6A 4FYDA 1DOLA 1N33L 4P2CB 5KRUA 3I4NG 4K6LA 3PO2G 3UDFA 3V05A 4DR1Q 5C3XA 1NMGA 3CQZB 4A3LH 4LF8L 3IRBA 4BXXG 1H9RA 1SYGA 1O7ZA 2JQOA 4X65L 3J7AV 3CMEA 4KKTA 4DV2L 2YTXA 4HIMA 1VQ5A 1L1OB 4DAYB 2N8NA 3L3OC 4XIGS 2F4VQ 5L37A 4DNTB 1RJTA 4XQQA 1SJED 1LT3D 2AQ3B 1ET9A 4RH6A 4X3KA 3GTPB 3DM3A 3AEVA 5G3LF 3TBIB 1U4MA 2DJFC 4AQYQ 2YTVA 1SYEA 5FLMG 1X65A 1EZ6A 4HJ8A 2UUCQ 1X3GA 4XTCS 2R7ZH 1OXSC 5IY0A 1ZEQX 1CHPD 5FO8B 3ITPA 4HJAA 5EAYA 3HP3A 4IFDI 4JI7Q 4Q5VA 2F0PA 3NTIA 2Z6KC 2XVSA 3D6WA 3K6OA 1D1KA 3X3MA 3CAMA 3JAMc 3UE0A 5GQOA 5DEHA 4KHZA 3A74A 4JI7L 3HOYG 2WB1G 1SNDA 1HA5A 1YNXA 1VCIA 1Q90A 4IUUA 2PW7A 3S9WA 3UDGA 4P74A 1XPUA 3PUWA 5EKIA 2BCOA 4JI5L 1XMQL 4B3SQ 2NTTA 4JI1Q 3IAYA 4QQBX 1II3A 3I2ZA 1FNVA 5TSSA 4JW0A 1Y69U 3GTMB 4ZCKA 3S17H 1SNQA 1EY7A 1KTKA 3CQZH 4DAVA 4LUZA 5C44H 1Q1EA 4UP9A 2BOSA 2JA5G 4H13C 3NSWA 3NBHB 1IW7D 2E2HH 4PV1C 3D4RA 3E0EA 1I6HH 4I7ZC 1LTID 3OWFA 1BVSA 4YIJA 2F0TA 4GLVB 3GTQH 1B1ZA 4AH6A 1LTAD 2IW3A 4JVZA 5M9OA 4NXNL 3C46A 2FJ2A 2PI2E 4OO1H 1B9MA 1B50A 1F9SA 2RQXA 2SNMA 2H1EA 2SDFA 4GZYC 4LF6L 2XNAC 2WAQE 1KNEA 2E5LQ 2KECA 5GAEC 4DK1A 1PH8A 4IUQA 1E1OA 5C0XH 1VQBA 1B9NA 2PQAB 2F0HA 1PZKD 4LF5L 3G6JB 3JAML 4B3RQ 1PH6A 1AZQA 1NCVA 4FF2A 2FINB 1TS2A 3K0YA 1D5ZC 5C4XB 1BBUA 3MTSA 3JC66 1JJCB 2HT1A 3VR6A 1PRTF 3MZ5A 4HCSA 1VQLA 1F9PA 4FNFA 1AFPA 2G5DA 2UXDQ 1XMOQ 1STYA 2XWBB 1VF5C 2N49A 2X6GA 4Y7NB 1NMFA 2MNAA 2NTSA 4FDBA 2K33A 1PTOD 4DR4Q 4GKKL 5IP9H 1QUQB 2B39A 2EY5A 5KYLA 1AP0A 5LMUL 3SK4A 4APVA 3M3YB 2JA5B 1SE4A 2L15A 3I3CA 4JI8L 1C9OA 2E2HB 3KJOA 3J7ZC 4QL5A 4UP7A 2VY3A 5F2DA 2DNEA 3RLOA 1G6ZA 2F0EA 1DGSA 2C35B 1PA6A 1A3VA 1SMYD 2BE5C 4JCVE 1GXDC 4RA8A 3HOXG 4NKLA 2AQ2B 4LK1C 2PW5A 4GN4B 1K8MA 2EOTA 4FO2A 3S2HH 5LMNQ 1M1KC 4IPGA 1QB5D 1V1OA 2ZXPA 1V1PB 1ILQA 4JYAQ 1LTGD 1YNNC 2PNRC 4Y52H 1PH5A 3NWSA 3O13A 5ELBA 3CD6A 1A3UA 2K50A 1IBKL 3M4OH 3MVVA 2VW9A 5ISRA 4F7XA 4R1JA 5M3FG 1QNUA 1RDPD 2A6HD 3D6CA 4RHRA 1MD2D 3T51B 3SK6A 1XPRA 4RGTA 2B2WA 1YNND 2GVAA 3N52A 2JA8H 2RSOA 4ID6A 3HKZB 1SJHD 5M5YH 3TN2A 2F0OA 2L4NA 2B2VC 4L5TA 3A8KE 2UUAL 2DUDA 3FVQA 1LABA 3M4PA 3K0XA 2UU9L 4A3DG 1H95A 2K52A 3NUCA 2HQEA 3DLLA 3T4AC 2Q2TA 3KYHC 5LL6S 4KK7A 1WCMB 1GKHA 4A93G 1YITA 2YU9H 3QB3A 3CCEA 3HOXB 1JOQA 3GQBA 2QEJC 4NB3A 3SK5A 2K04A 4BY1B 4A3FH 1SMXA 3PQIA 3CCUA 2I5LX 3OW2A 4HIKA 1F2ZA 1JMCA 4IURA 3PO3G 4UHVA 1HUMA 4OL7A 4QUFA 3TP6A 2E2IB 2I5MX 3G4SA 4LF6Q 3A7AB 3CRLC 3W2DA 1IKLA 1X32A 2M9VA 3EQLC 4QF4A 1O7LA 3TDQA 5CV6A 2A74C 2NB0A 3S2DB 3BS1A 3K5LA 1TQOA 4HCEA 1ML0D 2VNUD 4IFDH 4OONA 1KHIA 1STNA 2C9OA 2NZHA 4FXDA 4DK3C 3HKZG 2DN8A 4ZUJA 3SEBA 2PMZE 3BVZA 2AKWB 1PRTC 3M4QA 1JE5A 4LAAA 3VR4A 4NPSA 4RKLA 1CK1A 3BZKA 4A3JG 4DV6Q 4L8JA 4HSVA 4BBSH 3HKSA 4GKKQ 4MN3A 1BCPC 2EYFA 4DUZQ 3RUZA 1A2UA 3KBXA 3I4MG 1HPCA 2JYOA 3AB9A 2HUGA 1GM5A 4KTAA 2UXBQ 4BY1G 2K32A 2LKVA 2HHHL 2LSSA 1K3BC 4DV5Q 2RBMA 1JB3A 4TQUS 2HDLA 1Y8NB 5IP7H 4O0AA 1B70B 4PNYA 1ZXTA 3F8TA 4ZRZA 1G51A 5C44B 1PTOC 1V43A 5IP9G 3CU7A 5H1SE 1YHBA 1MGSA 4X3TA 1EFID 2WP8J 1Y1WB 1VQDA 3HG9A 1XWEA 1ZKOA 1WJJA 3T1YQ 4DR5Q 1EU3A 1STAA 3A8IE 2EYHA 4PMWA 3STBC 3R3OA 5JJKA 2ID0A 3ULLA 1Y14B 2IPKD 3BJUA 1RTNA 2ZXOA 4KI0A 2VUMH 3T56B 4POGA 2RSNA 5FLXL 3AYHB 3OMCA 1JICA 5C0XG 3EJIA 2ZTCA 4MNOA 1JE4A 2QKIC 5DLQE 2FXQA 2L9HA 3MWYW 2VQEQ 1EYAA 1IHZA 3OOCA 1DM0B 3TS2A 4C56C 3IFDA 3FRPB 3BYYB 3QOJA 1O7YA 4LFAQ 2L11A 3HEJA 3CW2C 1G6PA 2YYZA 2EE1A 4YHHL 2VQEL 1KDAA 2GA4B 2K1BA 4L6TB 5A2QL 3SE0A 1YEZA 3I70A 1PRTB 5M3FH 3ULJA 4LFAL 2B29A 1EQQA 4KY7A 4YHHQ 1VQ4A 1HTPA 2IT1A 5C44G 1U4RA 2JA6H 3M4YA 3EIVA 3H91A 1VMCA 2F0GA 1ONLA 3WWVA 3CC4A 3J7A5 2HD3A 4LWCA 3MAQA 3MXNA 2OCEA 2DJGC 4BY7B 1CI3M 2A6EC 4B3TQ 3ONAB 3M9BA 4LNQA 3BDOA 2GN5A 4X3UA 4GOPB 2E76C 5I2YA 2AQ1B 3J80i 1M4VA 2WACA 4C2MH 3DWPA 1JOOA 1KL9A 3PUZA 3J81c 3PUXA 2NVTH 3OSOA 1X3EA 5IGGA 5JJLA 1H9SB 3CC7A 2B8GA 2HCCA 3I8ZA 5E4WC 4K5WA 4HAEA 5IWAL 1HCZA 1PZID 2PQEA 2A6ED 5ELFA 4QUCA 4XXEA 3KFUA 2OTLA 2N3SA 3PSIA 2ZJQA 4XT3B 4DA2A 2IX1A 1YZ6A 3NP8A 4QJFA 1QE6A 1IL2A 4A3EB 3TZUA 4DV6L 1K0RA 5ELNA 4QIWB 1RODA 1KABA 3H0GG 4HSPA 5DAUA 3I90A 1PTOB 1D7QA 2QGQA 4BBSB 2JSOA 2JA9A 4ALPA 1R9TH 1OXTA 3T53B 1SE2A 4CDEC 4OWXB 4J6HA 4K8IA 1ZYRC 1NUCA 2N88A 1PTOH 3K7UC 4P71A 2IHFA 1G2TA 4CDCC 3ER0A 1QUQA 1WTVA 1WTPA 2QILA 3TP5A 1HNZQ 2AUKA 5A2QE 3GV3A 1CSPA 5HGTA 2MFIA 2NVXH 2HIXA 4IZ8A 1VQEA 1E2VA 3EROA 4LF7L 3J7AF 4YWLA 3TS0A 3TEHB 4BY7G 4NW2A 1JQYD 3PO3B 2R92G 4GNXB 4RCNA 1Q8IA 1HTLD 3C3LA 1XJVA 4GKJQ 3Q0AA 2PYKA 2XRSD 3AFPA 5IYDG 3U50C 3P75A 4B3SL 3Q6SA 1TT2A 3HOUG 4KY6A 1WTQA 5K36H 3ND9A 1K9MC 5IYCG 2OEOA 3NTHA 5ELCA 2E2DC 3OPOA 3GV6A 4A3CG 5CYUA 1I6HB 3EN2A 5G3LD 3PIOA 1DJRD 2MHVA 4A3KB 1WFQA 4ZLTF 4A3FB 1IBML 4RGMA 1QVFA 4OELB 1E22A 4CKBA 2JA6G 2B2YC 3HRZC 5IOCA 3I4MH 1MHWC 3RD4A 3H0GB 5GADC 1STHA 4UY8C 2QDBA 4X64Q 3IKJA 4X66Q 2A69C 4DV1L 4BBSG 1EWHA 4IOCA 2R6GA 1ESFA 4KKSA 5JEAG 5IE8A 4V190 4DV4L 4C3IH 1KD1C 1GUWA 1CZWA 2I5HA 3F2BA 3K8AA 1J5EQ 4XQJA 2Y0SG 2MGSA 3MXUA 1PXUA 1FJGQ 4YY3L 5CBAE 2A6HC 5C5MA 1B44D 3EVQA 3I55A 3Q8DA 2VQFQ 4N9PA 3S1MH 3G48A 1SYCA 4C3IB 5EBCA 1EIHA 2R92B 2B2TA 4CGYB 2WV6D 2KQ3A 4NXML 2UXCQ 2PZUA 2WB1B 3FMCA 1RCVD 3M4OB 4GNXA 4IFDJ 4GOPA 2L5TA 3HOZB 1M8AA 4R4IA 4DV7L 4DR4L 1E7ZA 4KHVA 4CJ1B 1S4ZA 4ABNA 1EWIA 1GD7A 1N32L 4JBKA 1V9PA 2YU9B 1YJ9A 4DNRB 4BXXH 5M3MG 1B8AA 1LO5D 1PFSA 4C3HB 4X62Q 1JWUD 3PGZA 1N32Q 4X6AH 2WKCA 3S1QH 1S3OA 3R2IA 1EEFD 4NXNQ 1TWHB 1VQAA 1TWCH 2K28A 5K5PA 3K59A 5IGDA 1F2YA 3NHHA 1EWCA 2NN6H 1EY6A 1MSHA 2K5HA 4IUNA 1YVCA 3ZJYC 3M3YH 2NZ1D 3D31A 3HKZE 2PCFB 3G6EA 2FFKB 4JPBW 1A63A 2MP1A 4FP5D 4JOIC 1JCKB 3VA5A 4LFCQ 1CT1D 1K83H 4CJ2C 2CQAA 2KCMA 2RA4A 1BDOA 3S14B 1EOVA 4QCLA 1HRJA 2H5XA 3V2TA 1XNQQ 1FD7D 5C0XJ 1XNRQ 2X6LA 2NUCA 2Q2UA 3GTPH 3FP9A 3DXJC 3FKIG 4DAMA 4CKEA 3T1HQ 4DF7A 5J3BA 3K80C 2ASBA 4DV0L 3CCSA 3RZOB 4IFDG 2Z6BA 4DFAA 3GTGH 2IWHA 1X9NA 1GUTA 3NE5B 1EU4A 1I94Q 5ELDA 2NYZD 1BCPD 1XMQQ 4B9XA 3D4WA 2CH4A 1CQFA 2EXDA 5M3MB 4JI5Q 1P8LA 1HJPA 1X3PA 2C5CA 1TVXA 3HOUH 4QGUA 1I3QB 1MJEA 2B2UC 1EQVA 1TS5A 1VQMA 2F3VA 2XRQD 1IBMQ 1KRTA 4KD4A 5CV7A 5M5XH 2L55A 2F4VL 1M90C 2RF4A 2JEAI 4BY7H 3CKIB 1ASZA 4QB4A 2K5WA 2AWNA 3LGJA 1VQ8A 5J1ZA 1NSNS 1HUNA 4A3MB 1BOSA 2EY6A 3A5UA 1FVIA 2F03A 2IHEA 1EYDA 1HXYD 4JI4Q 5C4ZA 2JA7B 4K6DA 4JOIA 3J80c 4J8QA 2D0PA 2OWOA 1X3QA 4PMBA 2B2WC 2A68D 3NEMA 1PYBA 2QF7A 2WFWA 1QCBD 3KLRA 4GN5A 3G7LA 4XT1B 5AFWA 1A6XA 3HFZB 2WKDA 2RKSA 2CKZB 1EY0A 4A4IA 4DK0A 1KRSA 1RF2D 1GUNA 2BE5D 1W2BA 3KF6A 4JG2A 2RCNA 4BWGB 3HOYB
chains in the Genus database with same CATH topology
3NQTA 1I4RA 5CR3A 1Q3LA 2EYJA 2TSSA 2KJXA 5C6AA 1Z6HA 5KNCA 4K14A 2L12A 1JOKA 1CTMA 2F3WA 1IKMA 1SBBB 1TR5A 2CVRA 4A93B 3ZYYX 3QIAA 2JA6B 3A8JE 4EQNA 4C1NI 2R3ZA 1L0XB 4B9WA 1YNJC 2F0WA 2F0KA 1ILPA 3JAME 1CQVA 1DONA 4UDUC 1LACA 1SYBA 2BA1A 2D5DA 2Y0SB 2KVMA 3HGBA 4KJOA 1XXGA 1LT6D 1Q1BA 3FDTA 5CV9A 2B63B 4K8JA 3HZXA 2HDMA 5I2XA 3QO2A 3T13A 4F8MA 5J22A 1UUPA 2IJ0A 2E2JB 3DWQA 3NPPA 2CW0D 4EQPA 3U9OA 1JWSD 1AN8A 1OXUA 2IX3A 3RMHA 1UAPA 2RDFA 4H44C 5EKKA 3S1NB 2J7ZA 1E2ZA 5JPMC 1EZ8A 3V96A 3R93A 1FR3A 3BZDB 5M5WB 2AWOA 1RTOA 5COYA 4NP5A 5C3WA 4ZYSA 4WFN3 4CKCA 1BBXC 2KHSA 1J8IA 2LFNA 1DOKA 4JK1C 3PMFA 3J7YW 1WVLA 4PMCA 3ND8A 1JR0D 1SXTA 2Q8RE 3FEWX 3D3RA 2NVXB 4M8AA 1S5DD 2OXPA 4HMJA 5EPJA 1HFGA 1S5BD 5IT9L 4IQZA 3H09A 3KBGA 1Z47A 3DWAA 1K83B 1SEBD 4J1MA 1G91A 4PQXA 1DD2A 1H9MA 4IALA 5D3DA 1JORA 4NDXA 4C1NK 3GTLB 1V8QA 1Y1VB 2NWGA 2D2CC 1HFNA 1B3AA 1SAPA 3S17B 1ESRA 4XYOA 5EKLA 1PTOF 4Q0FA 4NMZA 4XDXA 3R2TA 4H0LC 2E74C 2KEEA 4HEDA 4BA1I 4ZAIA 1HQMC 2PPBC 1AW7A 5EQ0A 3A55A 1J9OA 3N6RA 4ILWA 2PZWA 1EYCA 2EYLA 2CHBD 2V4DA 2JXMB 4FXKC 2IL8A 3DEPA 4ODGA 1CM9A 1TIID 4WORA 4S3SA 3URYA 2MPMA 5E1FA 1CZGA 3F2UA 3PUYA 3PV0A 5I4DA 3K58A 5KEEA 3LWUA 1EL0A 4R8NA 1B4OA 2KUMA 5EBDA 2G9HD 5FK9C 1NR4A 2J4XA 1SNMA 2Q8TA 1FGBD 5JAVA 2XSCA 2O5IC 4OIKA 4A3JB 3T16A 1W6KA 1DOMA 1DCZA 3P20A 3X3NA 3I4MB 2XWJB 4HTHA 3TP7A 2PMZB 2B2YA 3TMEA 1MSGA 1D5MC 1F9QA 4CBVA 5C4HA 4KY5A 1PYWD 2DY7A 1F9RA 4DU9A 2EXZA 4G7ZC 4TKOB 4TSSA 1EY9A 2AUJD 4A3IB 1PRTD 5CV8A 5C5LA 2SNSA 2J0TD 3J80E 4HR7B 2F0NA 3NTKA 3I4LA 3BDCA 1L0YB 1DZ1A 3DM1A 3D8GA 1WD0A 3DEOA 4Z9CB 5KNBA 4DGZA 3Q22A 3AMUA 1AZPA 1TS3A 3AU7A 3KUPA 1IL8A 3WOEA 5DM73 4ZUIA 3GTKB 3DUZA 4E6IA 1S5FD 2B8FA 1Y8OB 2RDGA 1D2BA 1F2LA 4DXFA 1UNSA 4LJZC 2A68C 1JWMD 2BDNA 2ENBA 2VB2X 4XYQA 3CHBD 3HOVB 4C3IG 2F0UA 5CGKA 4M1UB 3VR3A 4U68A 1PLFA 2JP1A 3S1RB 3J81E 1K8OA 1TWCB 5JPNC 1VF7A 3WOFA 2BDOA 5DM63 4K5XA 2M2LA 4OHJA 2TMPA 3OHXC 1QNKA 2A73B 2EY2A 1DYQA 3BG3A 1LV9A 3MEHA 1WD1A 1BQQT 2NN6I 5T1GA 2KEDA 4CJ0B 3OIQA 2EY1A 3NQIA 4B08A 2MUYA 1V1PA 1I6VC 2XIWA 3OMGA 1ZYRD 3WDNA 1F77A 2EJMA 3Q24A 3E0JA 1OO9B 1CFMA 1GHJA 4MIUA 1LTBD 5LL6X 4UAIA 2F0DA 3BYTB 3K57A 1STEA 5I9OA 2PZTA 1LTRD 3MXPA 1RD9D 2VUMB 1SDFA 3NWTA 1T5XD 1QJOA 2F1MA 3EFXD 5KIXA 1AEXA 2EVBA 3J81L 1KDCA 4AYBB 3GTJB 3OW7A 2LS01 1T5EA 4OO1G 2F0JA 1FNWA 3HOUB 4HMIA 2L1BA 5EJWA 1B53A 2F0QA 4G7OC 2F0VA 1OXVA 1TY2A 1C8CA 3QG1A 3TP8A 2A5HA 2I07B 3GO5A 3GTGB 3VYRA 3E5SA 2K7VA 2DY8A 1U9RA 4LMQD 4RCOA 4R8IA 2H4OA 4FXGC 1EY4A 1SMYC 1RHPA 5FOBB 5CC4A 4QMGA 2FMMA 1TWFB 2VXWA 1JC7A 2EYOA 2F0MA 2F0IA 4XQNA 1S5ED 2K05A 3KK7A 2ZT9C 5ELEA 4ME5A 5CV5A 3A56A 1SYFA 4DAYA 2NVQB 1R4QB 3CRKC 3P1HA 3BVGA 1LLRD 3PO2B 3EA6A 1A2TA 3KLSX 2A69D 4EQOA 1BF4A 1PMRA 1I4QA 1YNJD 1ENAA 1C48A 2F0SA 4C3HG 3A7LA 4OGQC 4WJWA 3M7GA 1Y8PB 3H6MA 2RVLA 1EY5A 1ENFA 1TWGB 3I91A 3W3AA 3MXGA 4ZK9B 4HN7A 4ZKCB 2KCNA 5EPLA 4V0BA 2Q8IB 1PFBA 4OIJA 3P7JA 5NUCA 4FVMA 3NBIA 3S1MB 2E75C 4RFBA 1NR2A 2O4XA 3DHQA 3LWEA 4RHSA 2F0LA 4BS9A 5IGEA 2EYMA 2SOBA 4U673 1D6EC 4I65A 1EY8A 2R7ZB 4G4KA 1LTTD 4RGNA 1TS4A 2B2TC 1I4XA 3SK8A 3FKIB 2O5JC 3RZDB 5CBEE 1NAPA 5JJZA 1GUSA 1VDZA 3RLFA 1H9KA 2Z4HA 1QOHA 1QG7A 5FLXE 1W6JA 5J39A 5IODA 5D65A 4TRDA 4RGOS 1STGA 1I4PA 5E3FA 3M85A 4DAPA 1D1IA 3C1EA 3PIP3 3L7ZC 1SYDA 2HCIA 1FNUA 5KNDA 3QOLA 5JVH3 4FF1A 3NBHA 3L9AX 3E6ZX 1HQRD 1ICWA 5FKAC 3TSSA 1I50B 2N55A 1EQTA 4BA2I 3UI2A 3K7AB 4G7HC 3KF8A 1E2WA 2D9UA 2CW0C 1SE3A 1QILA 2NVYB 1B2TA 3I72A 2EDGA 1TKWB 1U4LA 3D4DA 1XYIA 3KLSA 1HHVA 1SFOB 2XN9C 5IGCA 1IYVA 2ICIA 1F2MA 1XX8A 4C2MB 5K36G 5KGUA 1KLUD 5CORA 3NXWA 5IGBA 4K2KA 1A15A 2R93B 2L0CA 3J80L 4A3BB 2ICEC 3PUVA 5KYIA 4FF3A 5FO7B 4K2LA 4F88A 1PDQA 2KA7A 3HOWB 5C3EB 5M3FB 3SVMA 5IIFA 1LTSD 3MA2B 1CA5A 4ULLA 5IT9E 1BUVT 5I6WA 1OXXK 1O80A 5M5YB 1KNAA 4O42A 1GOZA 1QWYA 5BN3A 3S15B 3MHBA 1BO0A 1FYCA 1Z7TA 1H9SA 3K5MA 4L63B 4JBWA 4X3SA 1SNPA 1CHQD 3FPPA 3TZDA 4K5VA 2MJ8A 5I9PA 1BR9A 4KJNA 1G8ZD 1IW7C 5D3IB 1KLGD 4R9WA 4RKBA 5M5XB 3S2HB 5JEAJ 2D62A 2EYPA 4MHEA 3GTOB 5CMDA 2QCPX 3ERQA 2B2VA 3I73A 3MFYA 2F4IA 5C4JB 3GD7A 1TWAB 4ZKBB 4FF4A 2B2UA 1XTCD 3SDZA 5BN4A 1G2SA 3VR2A 1LT4D 1O78A 1EOTA 3FPUB 3MFGA 2K5QA 2KOLA 2O2LD 3VA7A 2DNCA 5I6YA 1ET6A 1VMPA 5A35A 2EJGC 3VYTA 2PO4A 4IN3A 1WTXA 1Q12A 3SHLA 1WTWA 3VYUA 2JE6I 3LX0A 2KCCA 3DMUA 2BA0A 2WINB 4H7BA 1DXMA 2OF1A 1GUOA 3QJYA 1PZJD 3VYSA 1H9JA 3BVMA 4EGVA 1SNOA 2Z1CA 3S1QB 2EJFC 3IFTA 4BBRB 2R61A 3GTQB 3QWNA 1BXTA 3OWEB 2F0FA 3H94A 1EIGA 1UEAB 1U4PA 3BDLA 3C2PA 4C3JG 1GHKA 2RDHA 4DXGA 1S5CD 3M7NA 3GP7A 1BCPF 2I46A 5FO9B 4F87A 3IL8A 5CV4A 2G9DA 2WIIB 1D5XC 1E0BA 5EPKA 2M00A 1I4HA 1C4QA 2Z4IA 3K5OA 3A54A 2X69A 1WTOA 1MI2A 1PFNA 4DN4M 1BNZA 2JA8B 1MBYA 4A3GB 5T1IA 4KD3A 1R4PB 1KDBA 4KKUA 3SXHA 4IUPA 1TU2B 4IUTA 1ENCA 1RKNA 4IUVA 5C0XI 2OT2A 2K01A 3SR1A 1G291 1HA6A 4KMUC 3H3VC 5EGTA 4C3JB 2FMCA 2WAQB 2ZXRA 1SSOA 4RAUC 2VB3X 2IX0A 3OIPA 2K5DA 3LNNA 1IYUA 2LMCB 1STBA 1LT5D 3PIO3 3I4NB 4KV6A 4N9TA 3Q23A 4G57A 4KN7C 3VR5A 2Z8LA 4OO1I 5HURA 5DNFA 2NBFA 2SEBD 1SNCA 2JEBI 1GJXA 1PFMA 1TY0A 4CHTB 4RWSC 2EZVA 3MC0B 5JOBA 3NK9A 3R8BA 2EPBA 5JEAH 1R9TB 1I4GA 5LHY1 1EEID 5E4XA 4O1NA 5IGFA 5BN5A 2FHTA 3C1FA 1A3TA 1GUGA 3S16B 2K6AA 1KAAA 3K5NA 2K03A 1WTRA 4ZQ3A 1BCPB 4WRDA 2NVTB 5D14A 3HS0C 4KN4C 2LY7A 2NN6G 4EVOA 3U9SA 4A3DB 5JVG3 1CA6A 4FYDA 1DOLA 4P2CB 5KRUA 4K6LA 3V05A 5C3XA 3CQZB 1H9RA 1SYGA 1O7ZA 3J7AV 4KKTA 3L3OC 4XIGS 4DNTB 1RJTA 4XQQA 1SJED 1LT3D 2AQ3B 1ET9A 4RH6A 4X3KA 3GTPB 5G3LF 3TBIB 1U4MA 1SYEA 1EZ6A 4XTCS 1OXSC 1ZEQX 1CHPD 5FO8B 3ITPA 3HP3A 4IFDI 4Q5VA 2F0PA 3NTIA 2XVSA 3D6WA 3K6OA 1D1KA 3X3MA 5DEHA 4KHZA 1SNDA 1HA5A 1VCIA 1Q90A 4IUUA 2PW7A 3S9WA 3PUWA 5EKIA 2BCOA 2NTTA 3IAYA 1II3A 1FNVA 5TSSA 1Y69U 3GTMB 1SNQA 1EY7A 1KTKA 4DAVA 1Q1EA 2BOSA 3NSWA 4H13C 1IW7D 4PV1C 3D4RA 4I7ZC 1LTID 3OWFA 4YIJA 2F0TA 1B1ZA 1LTAD 2IW3A 5M9OA 3C46A 2FJ2A 4OO1H 1B9MA 1B50A 1F9SA 2RQXA 2SNMA 2H1EA 2SDFA 4GZYC 2XNAC 1KNEA 2KECA 4DK1A 4IUQA 5C0XH 1B9NA 2F0HA 1PZKD 3G6JB 3JAML 1AZQA 1NCVA 4FF2A 2FINB 1TS2A 3K0YA 1D5ZC 5C4XB 3MTSA 3VR6A 1PRTF 3MZ5A 4HCSA 1F9PA 4FNFA 1AFPA 1STYA 2XWBB 1VF5C 2X6GA 4Y7NB 2NTSA 2K33A 1PTOD 2B39A 2EY5A 5KYLA 1AP0A 3SK4A 3M3YB 2JA5B 1SE4A 3I3CA 2E2HB 1G6ZA 5F2DA 2DNEA 2F0EA 1A3VA 1SMYD 2BE5C 1GXDC 4RA8A 4NKLA 2AQ2B 2PW5A 4LK1C 1K8MA 2EOTA 4FO2A 1QB5D 1V1OA 2ZXPA 1V1PB 1ILQA 1LTGD 1YNNC 2PNRC 3NWSA 3O13A 5ELBA 1A3UA 3MVVA 5ISRA 4F7XA 1QNUA 1RDPD 2A6HD 3D6CA 4RHRA 1MD2D 3T51B 3SK6A 4RGTA 2B2WA 1YNND 3N52A 2RSOA 4ID6A 3HKZB 1SJHD 3TN2A 2F0OA 2L4NA 2B2VC 3A8KE 1LABA 3FVQA 3NUCA 2HQEA 3T4AC 5LL6S 4KK7A 1WCMB 3QB3A 3HOXB 1JOQA 3GQBA 2QEJC 3SK5A 2K04A 4BY1B 1F2ZA 4IURA 1HUMA 4OL7A 4QUFA 3TP6A 2E2IB 3A7AB 3CRLC 3W2DA 1IKLA 1X32A 2M9VA 3EQLC 4QF4A 1O7LA 3TDQA 5CV6A 2A74C 2NB0A 3S2DB 3BS1A 3K5LA 1TQOA 4HCEA 1ML0D 2VNUD 4IFDH 1STNA 2C9OA 4FXDA 2DN8A 4ZUJA 3SEBA 3BVZA 1PRTC 4LAAA 3VR4A 4RKLA 1CK1A 4L8JA 4HSVA 4MN3A 1BCPC 2EYFA 3RUZA 1A2UA 3KBXA 1HPCA 2JYOA 3AB9A 2HUGA 4KTAA 2K32A 2LKVA 2RBMA 1JB3A 4TQUS 2HDLA 1Y8NB 4PNYA 1ZXTA 4ZRZA 5C44B 1PTOC 1V43A 3CU7A 1MGSA 4X3TA 1EFID 2WP8J 1Y1WB 3HG9A 1XWEA 1ZKOA 1EU3A 1STAA 3A8IE 2EYHA 4PMWA 3R3OA 2ID0A 2IPKD 1RTNA 2ZXOA 4KI0A 3T56B 2RSNA 5FLXL 3OMCA 1JICA 5C0XG 3EJIA 1JE4A 2QKIC 2L9HA 3MWYW 1EYAA 1IHZA 3OOCA 1DM0B 4C56C 3IFDA 3FRPB 3BYYB 3QOJA 1O7YA 2L11A 3HEJA 2YYZA 2EE1A 1KDAA 2GA4B 2K1BA 4L6TB 5A2QL 3SE0A 3I70A 1PRTB 4KY7A 1HTPA 2IT1A 1U4RA 3M4YA 3H91A 1VMCA 2F0GA 1ONLA 3MAQA 3MXNA 4BY7B 1CI3M 2A6EC 3ONAB 3BDOA 4X3UA 2E76C 5I2YA 2AQ1B 1M4VA 2WACA 3DWPA 1JOOA 3PUZA 3PUXA 3OSOA 5IGGA 1H9SB 2B8GA 2HCCA 3I8ZA 5E4WC 4K5WA 4HAEA 1HCZA 1PZID 2PQEA 2A6ED 5ELFA 4QUCA 4XXEA 4XT3B 4DA2A 2IX1A 3NP8A 1QE6A 4A3EB 3TZUA 4QIWB 1RODA 1KABA 4HSPA 5DAUA 3I90A 1PTOB 4BBSB 2JSOA 1OXTA 3T53B 1SE2A 4J6HA 4K8IA 1ZYRC 1NUCA 2N88A 1PTOH 1G2TA 1WTVA 1WTPA 2QILA 3TP5A 2AUKA 5A2QE 3GV3A 5HGTA 4IZ8A 1E2VA 3EROA 3J7AF 4NW2A 1JQYD 3PO3B 4RCNA 1Q8IA 1HTLD 3C3LA 3Q0AA 2PYKA 2XRSD 3P75A 3Q6SA 1TT2A 4KY6A 1WTQA 5K36H 3ND9A 2OEOA 3NTHA 5ELCA 2E2DC 3OPOA 3GV6A 5CYUA 1I6HB 5G3LD 1DJRD 2MHVA 4A3KB 4A3FB 4ZLTF 4RGMA 4CKBA 2B2YC 3HRZC 5IOCA 3RD4A 3H0GB 1STHA 2QDBA 3IKJA 2A69C 1EWHA 2R6GA 1ESFA 4KKSA 5JEAG 4V190 1GUWA 1CZWA 4XQJA 2MGSA 3MXUA 1PXUA 5CBAE 2A6HC 5C5MA 1B44D 3EVQA 4N9PA 1SYCA 4C3IB 5EBCA 1EIHA 2R92B 2B2TA 4CGYB 2WV6D 2KQ3A 2PZUA 2WB1B 3FMCA 1RCVD 3M4OB 4IFDJ 2L5TA 3HOZB 1M8AA 4KHVA 4CJ1B 1S4ZA 4ABNA 2YU9B 4DNRB 1LO5D 4C3HB 1JWUD 2WKCA 3R2IA 1EEFD 1TWHB 2K28A 5K5PA 3K59A 5IGDA 1F2YA 3NHHA 1EWCA 2NN6H 1EY6A 1MSHA 4IUNA 2NZ1D 3D31A 2PCFB 2FFKB 2MP1A 4FP5D 3VA5A 1JCKB 1CT1D 4CJ2C 2CQAA 2RA4A 1BDOA 3S14B 4QCLA 1HRJA 3V2TA 1FD7D 5C0XJ 2X6LA 2NUCA 3DXJC 4CKEA 4DF7A 3RZOB 4IFDG 4DFAA 2IWHA 1GUTA 3NE5B 1EU4A 5ELDA 2NYZD 1BCPD 4B9XA 3D4WA 5M3MB 1CQFA 1X3PA 2C5CA 1TVXA 1I3QB 2B2UC 1EQVA 1TS5A 2F3VA 2XRQD 4KD4A 5CV7A 2L55A 2JEAI 3CKIB 4QB4A 2K5WA 2AWNA 5J1ZA 1NSNS 1HUNA 4A3MB 1BOSA 2EY6A 2F03A 1EYDA 1HXYD 5C4ZA 2JA7B 4K6DA 4J8QA 1X3QA 4PMBA 2B2WC 2A68D 2QF7A 1QCBD 3KLRA 3G7LA 4XT1B 5AFWA 1A6XA 2WKDA 2RKSA 1EY0A 4DK0A 1RF2D 1GUNA 2BE5D 4BWGB 3HOYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RA4 A;  1PFB A;  4OIJ A;  1U4R A;  1HRJ A;  1ILQ A;  3P7J A;  1Q3L A;  2MPM A;  3H91 A;  4ZLT F;  3F2U A;  1BBX C;  1E0B A;  1VMC A;  2L1B A;  4MHE A;  5EJW A;  1J8I A;  5CMD A;  2B2Y C;  5EPK A;  1B53 A;  1DOK A;  1NR2 A;  4HSV A;  2B2V A;  2X6L A;  1EL0 A;  4MN3 A;  1B4O A;  2KUM A;  2X69 A;  4U68 A;  1PLF A;  2JP1 A;  2L12 A;  1WVL A;  1C8C A;  2K03 A;  1WTO A;  1MI2 A;  1NR4 A;  1PFN A;  4DN4 M;  3KBX A;  2CVR A;  3LWE A;  1XX8 A;  2Q8T A;  1WTR A;  1BNZ A;  1IKM A;  2Q8R E;  3ONA B;  2JYO A;  5D14 A;  2HUG A;  5T1I A;  4X3U A;  4ZKB B;  4OIK A;  2DY8 A;  4LMQ D;  2B2U A;  4R8I A;  2B2W A;  4IUP A;  5COR A;  3N52 A;  1GUW A;  1G2S A;  2M2L A;  2R3Z A;  1DOM A;  2B2T C;  2RSO A;  4IUT A;  1EOT A;  2FJ2 A;  3FPU B;  1QNK A;  1RHP A;  2MGS A;  5EPJ A;  3TN2 A;  1HFG A;  1DOL A;  1A15 A;  2L4N A;  2HDL A;  1F9S A;  1NAP A;  2B2V C;  2KOL A;  4IUV A;  5CBE E;  2H1E A;  5JJZ A;  2SDF A;  1ILP A;  2NYZ D;  1LV9 A;  2HCC A;  3I8Z A;  5E4W C;  4HAE A;  1ZXT A;  2K01 A;  1KNE A;  2B2Y A;  1DON A;  4QUC A;  2FMM A;  2KEC A;  1WD1 A;  1X3P A;  1MSG A;  1VMP A;  1F9Q A;  5CBA E;  1TVX A;  4IUQ A;  1MGS A;  1HA6 A;  2VXW A;  1O7Z A;  1QG7 A;  5T1G A;  4X3T A;  2KED A;  4XT3 B;  1EIH A;  2B2U C;  1PDQ A;  4CJ0 B;  2KVM A;  5D65 A;  1WTX A;  2B2T A;  1QE6 A;  2DY7 A;  1F9R A;  1AZQ A;  1NCV A;  1G91 A;  2FIN B;  1WTW A;  1ROD A;  2K05 A;  3FDT A;  2XIW A;  3I90 A;  3SVM A;  3MTS A;  1RJT A;  4HCS A;  2HDM A;  1CA5 A;  1M8A A;  1SSO A;  2HCI A;  4RAU C;  1F9P A;  4X3K A;  2K04 A;  1RTN A;  3QO2 A;  2NWG A;  1HUN A;  4CJ1 B;  2N88 A;  1HFN A;  1B3A A;  1S4Z A;  1U4M A;  1O80 A;  1SAP A;  1KNA A;  1G2T A;  2RSN A;  1WTV A;  1WTP A;  4O42 A;  2X6G A;  3GV3 A;  4IUR A;  1JIC A;  1DZ1 A;  3DM1 A;  1ICW A;  1HUM A;  1ESR A;  4QUF A;  1WD0 A;  3DEO A;  2FHT A;  1CA6 A;  1JE4 A;  2N55 A;  4XDX A;  1BO0 A;  1X3Q A;  2B2W C;  4UAI A;  1AZP A;  1AP0 A;  1EQT A;  3HP3 A;  3KUP A;  5DNF A;  3UI2 A;  2KEE A;  1IKL A;  1IL8 A;  1X32 A;  2L9H A;  3MWY W;  4HED A;  3I3C A;  4ZAI A;  1BF4 A;  4NW2 A;  2D9U A;  1PFM A;  3G7L A;  3D6W A;  2K28 A;  4RWS C;  4XT1 B;  4X3S A;  1B50 A;  1G6Z A;  1SDF A;  3IFD A;  5AFW A;  1EIG A;  1ML0 D;  1O7Y A;  5EQ0 A;  1U4P A;  3TZD A;  2L11 A;  1MSH A;  1J9O A;  2MJ8 A;  2EE1 A;  2NZ1 D;  3Q6S A;  1B2T A;  2EPB A;  2K1B A;  1WTQ A;  4IUU A;  2J7Z A;  4RA8 A;  1F2L A;  1U4L A;  2FFK B;  2MP1 A;  3R93 A;  2RVL A;  4R9W A;  3I91 A;  5EKI A;  4ZKC B;  1XYI A;  2EOT A;  4ZK9 B;  2IL8 A;  5E4X A;  3GV6 A;  4CJ2 C;  1HHV A;  3DEP A;  5EPL A;  1RTO A;  2BDN A;  1CM9 A;  5COY A;  3IL8 A; 
#chains in the Genus database with same CATH topology
 3NQT A;  1I4R A;  5CR3 A;  1EUJ A;  1Q3L A;  2EYJ A;  2TSS A;  2IY5 B;  1JJ2 A;  4JBJ A;  2KJX A;  5C6A A;  1Z6H A;  2E8G A;  5KNC A;  1Q86 C;  4K14 A;  2L12 A;  1WCM G;  4JI2 L;  1JOK A;  1CTM A;  2F3W A;  1IKM A;  1SBB B;  1TR5 A;  2CVR A;  4A93 B;  4LF9 Q;  3ZYY X;  3W1B A;  3QIA A;  2JA6 B;  1HNW Q;  3A8J E;  4EQN A;  4C1N I;  2R3Z A;  1L0X B;  4B9W A;  1YNJ C;  2F0W A;  2F0K A;  1ILP A;  4JI1 L;  3HOW G;  3JAM E;  4LF8 Q;  1CQV A;  5IYC H;  3RN5 A;  1DON A;  2A19 A;  1T9H A;  4UDU C;  2UUA Q;  1Z9F A;  1LAC A;  1SYB A;  1FL0 A;  2BA1 A;  2D5D A;  2Y0S B;  2UU9 Q;  3HOY H;  2KVM A;  2UUB L;  3HGB A;  4KJO A;  1XXG A;  2R92 H;  2Q2H A;  1HR0 L;  4DR7 Q;  1LT6 D;  1Q1B A;  1PH4 A;  3PF5 A;  3FDT A;  1V1Q A;  2B3G A;  5CV9 A;  3GDE A;  2B63 B;  1OTC A;  4K8J A;  3HZX A;  1SE8 A;  2HDM A;  5I2X A;  3QO2 A;  4KHP L;  3T13 A;  4F8M A;  5J22 A;  1UUP A;  2IJ0 A;  2E2J B;  3DWQ A;  1NBW A;  1K3R A;  3NPP A;  2R7F A;  1MKH A;  2CW0 D;  5IT9 c;  4OWW B;  4EQP A;  1VQI A;  3U9O A;  1JWS D;  3S24 A;  1AN8 A;  1OXU A;  4JI8 Q;  2IX3 A;  3RMH A;  4GOP C;  1NNX A;  1UAP A;  1YHQ A;  2RDF A;  4H44 C;  4OXP A;  5EKK A;  3S1N B;  4GLA C;  2J7Z A;  1E2Z A;  5JPM C;  1EZ8 A;  3V96 A;  3R93 A;  1FR3 A;  4JI6 L;  1XMO L;  2JA5 H;  3BZD B;  5M5W B;  2AWO A;  1RTO A;  3MXN B;  5M5W H;  4LFB L;  5COY A;  4YCV A;  4NP5 A;  5C3W A;  4ZYS A;  4WFN 3;  4CKC A;  4LUV A;  1BBX C;  2KHS A;  1NJI C;  1J8I A;  1HR0 W;  3KF8 B;  2LFN A;  1DOK A;  5BR8 L;  2JK8 A;  4JK1 C;  3PMF A;  3J7Y W;  1WVL A;  4PMC A;  1WCM H;  1JB7 A;  3ND8 A;  1JR0 D;  1SRU A;  1SXT A;  2Q8R E;  3H15 A;  2UUC L;  4DNI A;  3FEW X;  5LMN W;  3D3R A;  2NVX B;  2ZJR A;  2DGY A;  4M8A A;  1S5D D;  2OXP A;  2ZM6 L;  4HMJ A;  5EPJ A;  1TXY A;  1HFG A;  2E2J H;  1LM0 A;  3J81 j;  3RN2 A;  1S5B D;  1PYS B;  5IT9 L;  4IQZ A;  3H09 A;  1EIY B;  3KBG A;  3G71 A;  1Z47 A;  1XNQ L;  3CMA A;  5FLM H;  3DWA A;  1K83 B;  1SEB D;  4DR6 L;  4J1M A;  1G91 A;  4PQX A;  4DR1 L;  4DR2 L;  5E7N A;  1DD2 A;  1H9M A;  2E2I H;  1EFW A;  1TWA H;  4IAL A;  5D3D A;  1JOR A;  4NDX A;  4C1N K;  3GTL B;  1WOC A;  1V8Q A;  1Y1V B;  1WYD A;  2NWG A;  2D2C C;  1HFN A;  1B3A A;  4TVA B;  1SAP A;  1O7I A;  3S17 B;  5C3E H;  4YWK A;  2VUM G;  2R93 G;  1ESR A;  4XYO A;  5EKL A;  1PTO F;  4Q0F A;  4NMZ A;  1L2F A;  4XDX A;  1Q46 A;  4A3M G;  3R2T A;  3PO2 H;  4H0L C;  2E74 C;  2KEE A;  4HED A;  4BA1 I;  4ZAI A;  1HQM C;  2PPB C;  4YWM A;  2WB1 E;  1A8V A;  1AW7 A;  5EQ0 A;  3A55 A;  1J9O A;  1Y1V H;  3N6R A;  4ILW A;  2PZW A;  4A75 A;  1EYC A;  2EYL A;  3UDX A;  2CHB D;  1PV4 A;  2PQA A;  2V4D A;  4L5R C;  2JXM B;  4FXK C;  2IL8 A;  1UE1 A;  5AJ3 L;  1IBL L;  3DEP A;  4WJ4 A;  4O2D A;  4ODG A;  1CM9 A;  1TII D;  4WOR A;  4S3S A;  2UXC L;  3URY A;  2OQK A;  2JA8 G;  1LUZ A;  2MPM A;  5E1F A;  4A3G G;  4B3M L;  1CZG A;  2CWP A;  3F2U A;  3PUY A;  3PV0 A;  5I4D A;  1YJW A;  4A3G H;  1RIP A;  3K58 A;  5FJ8 H;  5KEE A;  1AE3 A;  3LWU A;  1EL0 A;  1CKN B;  4R8N A;  1B4O A;  2KUM A;  1NTG A;  5EBD A;  2G9H D;  5FK9 C;  1NR4 A;  2J4X A;  1SNM A;  2Q8T A;  1FGB D;  5JAV A;  2XSC A;  2O5I C;  2RHQ B;  4OIK A;  4A3J B;  2LXJ A;  4PZ8 A;  3T16 A;  1W6K A;  4MTN A;  1DOM A;  3RNU A;  4DV5 L;  1DCZ A;  3P20 A;  3OTO Q;  3X3N A;  3I4M B;  4DV3 L;  2XWJ B;  4HTH A;  1YIJ A;  1X56 A;  3TP7 A;  2PMZ B;  4IJL A;  2B2Y A;  3TME A;  1MSG A;  1D5M C;  1F9Q A;  1N36 Q;  4CBV A;  5C4H A;  2R93 H;  4KY5 A;  2VS1 A;  4R4C A;  1VQC A;  1RL2 A;  2V1C C;  1PYW D;  4DV7 Q;  2DY7 A;  1F9R A;  5GRO A;  3F1Z A;  4DU9 A;  2EXZ A;  4G7Z C;  4TKO B;  1I3Q H;  4TSS A;  3H3V I;  1EY9 A;  2AUJ D;  2KHJ A;  3STB D;  4A3I B;  4OX9 Q;  5M3M H;  4Y7N H;  4JYA L;  1PRT D;  4K0K L;  1WI5 A;  2CQO A;  5CV8 A;  1UWV A;  5C5L A;  2SNS A;  3ULP A;  2J0T D;  3J80 E;  4JBM A;  3GTM H;  4HR7 B;  2F0N A;  3NTK A;  3I4L A;  3BDC A;  4ME3 A;  1L0Y B;  2CWA A;  4HID A;  1DZ1 A;  4A3F G;  3DM1 A;  3D8G A;  1SFO H;  1WD0 A;  3DEO A;  4Z9C B;  5C4X H;  5KNB A;  4DGZ A;  1NY4 A;  3Q22 A;  2EQS A;  3AMU A;  1AZP A;  2YTY A;  1TS3 A;  1N34 Q;  3AU7 A;  3KUP A;  3F2D A;  1IL8 A;  1YJN A;  4LF4 L;  2QEX A;  3WOE A;  5DM7 3;  1PHJ A;  4ZUI A;  3GTK B;  3DUZ A;  4E6I A;  1S5F D;  1Q7Y C;  4PG3 A;  2Q2I A;  3RZD H;  4P72 A;  2B8F A;  4DK6 C;  1Y8O B;  2RDG A;  1D2B A;  1F2L A;  4DXF A;  1UNS A;  4LJZ C;  5GAH C;  3EBE A;  2A68 C;  3K7A H;  3AFQ A;  3I7F A;  1JWM D;  1VQJ A;  2BDN A;  2ENB A;  4QY7 A;  2VB2 X;  4XYQ A;  3CHB D;  4OWT B;  3HOV B;  4C3I G;  2F0U A;  5CGK A;  4UPA A;  1K28 A;  1VQG A;  4M1U B;  3VR3 A;  2P5Z X;  4U68 A;  1A62 A;  1PLF A;  2JP1 A;  3S1R B;  3KLW A;  3J81 E;  1K8O A;  1TWC B;  1HZ9 A;  5JPN C;  1VF7 A;  3GTO H;  3MEF A;  3WOF A;  4A3I G;  2UXB L;  2BDO A;  1MJC A;  5DM6 3;  4C3H H;  4K5X A;  2Z9H A;  2M2L A;  4OHJ A;  5FLX c;  2TMP A;  3OHX C;  1QNK A;  2A73 B;  2EY2 A;  1IZ6 A;  1DYQ A;  3BG3 A;  1LV9 A;  2CH4 W;  3E9I A;  4YY3 Q;  3HOX H;  3MEH A;  1WD1 A;  1BQQ T;  2NN6 I;  4X65 Q;  1Q8K A;  5T1G A;  4EQ5 A;  2KED A;  4CJ0 B;  3OIQ A;  3U4V A;  1QVC A;  2EY1 A;  3NQI A;  4B08 A;  2MUY A;  3E9H A;  1V1P A;  4JI3 L;  1I6V C;  2XIW A;  4PZ7 A;  5HGQ A;  2YV5 A;  4GS3 A;  4GLX A;  1EYG A;  3S15 H;  3U4Z A;  3OMG A;  4X66 L;  1ZYR D;  3WDN A;  1F77 A;  2EJM A;  3Q24 A;  3E0J A;  4DUZ L;  1OO9 B;  4DR3 Q;  4POF A;  1EQR A;  2A1A A;  1C0A A;  3SGI A;  1CFM A;  1A0I A;  1J6Q A;  1GHJ A;  3T1H L;  4MIU A;  4N8F A;  1LTB D;  5LL6 X;  4UAI A;  4DV0 Q;  1HZA A;  3HOW H;  2F0D A;  3BYT B;  3K57 A;  4UP8 A;  1STE A;  5I9O A;  2PZT A;  1LTR D;  3H0G H;  3MXP A;  1L1O A;  3CC2 A;  1RD9 D;  2VUM B;  1SDF A;  3NWT A;  4DPG A;  1T5X D;  4GKJ L;  1QJO A;  2F1M A;  4RMF A;  4GNX C;  3CCV A;  3EFX D;  2PI2 A;  5KIX A;  1AEX A;  1N9W A;  2EVB A;  2XGT A;  5IYB H;  3J81 L;  2HQL A;  1E24 A;  4A3I H;  4A3L G;  4HJ9 A;  1PH9 A;  1KDC A;  4AYB B;  4A3K H;  3GTJ B;  3I4N H;  3OW7 A;  5C4J H;  2LS0 1;  3FHW A;  1Y1W H;  1X55 A;  1T5E A;  4OO1 G;  4PZ6 A;  1BBW A;  3T1Y L;  2F0J A;  1FNW A;  3HOU B;  1QZG A;  4HMI A;  2L1B A;  5EJW A;  1GO3 E;  1HNX L;  1HH2 P;  1B53 A;  2F0Q A;  1YI2 A;  4G7O C;  2F0V A;  1OXV A;  1TY2 A;  1C8C A;  3L0O A;  3QG1 A;  3TP8 A;  4KHP Q;  1AE2 A;  2A5H A;  2QDL A;  4A3K G;  2I07 B;  3GO5 A;  1L0W A;  3GTG B;  3VYR A;  3E5S A;  2K7V A;  5IYB G;  3UDI A;  2DY8 A;  1U9R A;  4LMQ D;  4RCO A;  4R8I A;  2H4O A;  4FXG C;  1KC8 C;  1EY4 A;  1SMY C;  1RHP A;  5FOB B;  2F3I A;  1QVG A;  2EIF A;  5IWA Q;  5CC4 A;  2JA7 G;  1HR0 Q;  4QMG A;  2NVY H;  4IPC A;  1NE3 A;  2FMM A;  1JT8 A;  2E5L L;  5C4X G;  4DR7 L;  1TWF B;  2VXW A;  1U5K A;  1JC7 A;  2EYO A;  2D0O A;  2F0M A;  2F0I A;  4XQN A;  1S5E D;  1HZB A;  2K05 A;  3KK7 A;  5HY6 A;  1XNR L;  4JV5 Q;  5GAG C;  1Q82 C;  1I50 H;  2ZT9 C;  2VZA A;  5ELE A;  4ME5 A;  5CV5 A;  3CCL A;  2R7Z G;  3A56 A;  1SYF A;  4MZ9 A;  4DAY A;  2NVQ B;  3UE1 A;  2AHO B;  1R4Q B;  2MO1 A;  1VQ9 A;  1PVO A;  3CRK C;  3P1H A;  1FJG L;  1E1T A;  3BVG A;  1TWG H;  1LLR D;  2RCF A;  3PO2 B;  3HOZ G;  3EA6 A;  1JJG A;  1IBK Q;  1A2T A;  3KLS X;  2A69 D;  4EQO A;  1CKM A;  2Z0S A;  1PMR A;  1I4Q A;  1BF4 A;  1YNJ D;  1ENA A;  4A3B H;  2N78 A;  3NEN A;  4CDF C;  1Q81 C;  1C48 A;  2F0S A;  3GTL H;  4C3H G;  3A7L A;  4OGQ C;  4WJW A;  3M7G A;  1Y8P B;  1VQP A;  4K0K Q;  3CCR A;  3FKI H;  3H6M A;  2RVL A;  1EY5 A;  1ENF A;  1TWG B;  3I91 A;  3W3A A;  1FGU A;  3MXG A;  4HN7 A;  4ZK9 B;  4ZKC B;  3JAM i;  2KCN A;  5EPL A;  4V0B A;  2Q8I B;  1PFB A;  4OIJ A;  3S1R H;  3W1G A;  2R7D A;  3P7J A;  5NUC A;  4FVM A;  3CXC A;  4DR2 Q;  3L2P A;  1K8A C;  3NBI A;  3S1M B;  3AQQ A;  2QA4 A;  2E75 C;  4RFB A;  1NR2 A;  4JI4 L;  2XTI A;  3RR5 A;  2O4X A;  2Y0S E;  1SN8 A;  3DHQ A;  1UE6 A;  3LWE A;  4RHS A;  2F0L A;  4BS9 A;  5IGE A;  2EYM A;  1HNZ L;  2SOB A;  4U67 3;  1D6E C;  1U0L A;  4P73 A;  4I65 A;  5ELO A;  1EY8 A;  2R7Z B;  4G4K A;  1LTT D;  4RGN A;  1TS4 A;  2B2T C;  1I4X A;  1UE5 A;  3FKI B;  3SK8 A;  4GN3 B;  2O5J C;  3B6Y A;  3RZD B;  5CBE E;  1NAP A;  5JJZ A;  5JJI A;  4B3T L;  4MTK A;  1GUS A;  4A3M H;  1VDZ A;  3RLF A;  1H9K A;  4KLK A;  2Z4H A;  3I56 A;  1QOH A;  2Z6K A;  1QG7 A;  5FLX E;  1W6J A;  5J39 A;  4LF5 Q;  5IOD A;  5D65 A;  4TRD A;  1N33 Q;  3D0F A;  4RGO S;  1STG A;  1I4P A;  5E3F A;  3M85 A;  4DAP A;  1BKB A;  4BBR H;  1D1I A;  3C1E A;  4OEM B;  3PIP 3;  3L7Z C;  1SYD A;  3S1N H;  1LTL A;  4RG1 A;  4BBR G;  2OQ0 A;  2HCI A;  1FNU A;  2VL6 A;  5KND A;  2K5N A;  3QOL A;  5JVH 3;  3PO3 H;  4FF1 A;  3NBH A;  3L9A X;  1VQH A;  3E6Z X;  4DUY Q;  1HQR D;  1ICW A;  5FKA C;  3TSS A;  1I50 B;  1P16 A;  2N55 A;  1EQT A;  4BA2 I;  3UI2 A;  3J81 i;  3K7A B;  4AQY L;  4G7H C;  4H02 A;  3KF8 A;  1E2W A;  2D9U A;  1J5E L;  2CW0 C;  1SE3 A;  1QIL A;  3KJP A;  5AJ3 Q;  2NVY B;  1IBL Q;  1B2T A;  3I72 A;  2EDG A;  1TKW B;  3W5O A;  4JV5 L;  1WTH A;  1U4L A;  4DKA C;  3D4D A;  4DV2 Q;  4R4T A;  1VQK A;  2JN4 A;  4A3E H;  4EX5 A;  1XYI A;  3KLS A;  1HHV A;  4LUO A;  5FJ8 G;  1SFO B;  2XN9 C;  4L5Q A;  4AYB G;  5IGC A;  1IYV A;  4LW1 A;  4DV4 Q;  4JI0 L;  2ICI A;  1CUK A;  1PH1 A;  1S72 A;  1F2M A;  1XX8 A;  1TWH H;  3KOJ A;  4C2M B;  5K36 G;  1VS0 A;  5KGU A;  5LMU Q;  1Y1V G;  1KLU D;  5COR A;  2VQF L;  1AH9 A;  2HHH Q;  3NXW A;  5IGB A;  1I94 L;  4K2K A;  1Y1W G;  1A15 A;  2K14 A;  2R93 B;  2L0C A;  3ERS X;  4NXM Q;  3J80 L;  4A3B B;  2ICE C;  4JI6 Q;  4AIM A;  3PUV A;  5KYI A;  3HOZ H;  4FF3 A;  2JJQ A;  4C3J H;  5FO7 B;  4K2L A;  4OX9 L;  4F88 A;  2HIV A;  1QZH A;  1PDQ A;  4LFC L;  2BH8 A;  2KA7 A;  3HOW B;  4DR5 L;  5C3E B;  4DR6 Q;  2GVB A;  5M3F B;  3SVM A;  5IIF A;  1LTS D;  4B3M Q;  3MA2 B;  1CA5 A;  4ULL A;  5IT9 E;  1GVP A;  3HOV H;  4B3R L;  1BUV T;  5I6W A;  1SRO A;  1L1O C;  3CCQ A;  1OXX K;  3ICE A;  1O80 A;  3TQY A;  1KNA A;  5M5Y B;  4O42 A;  1HZC A;  4X64 L;  1GOZ A;  1QWY A;  5BN3 A;  2B63 G;  1X54 A;  3S15 B;  1KIX A;  3MHB A;  1BO0 A;  2JA7 H;  1FYC A;  1Z7T A;  2ATW A;  1C7Y A;  1H9S A;  3K5M A;  1VQ7 A;  4L63 B;  4JBW A;  4X3S A;  1SNP A;  1PH2 A;  1CHQ D;  3FPP A;  1XPO A;  3RLN A;  3GTK H;  3TZD A;  4K5V A;  2MJ8 A;  5I9P A;  1BR9 A;  4KJN A;  1G8Z D;  2MQH A;  1IW7 C;  1KLG D;  5D3I B;  4R9W A;  2QW7 A;  4R4Q A;  4YCW A;  4RKB A;  3E3X A;  1E3P A;  5M5X B;  3S2H B;  5JEA J;  2D62 A;  2EYP A;  3CCM A;  1I5F A;  4JI3 Q;  4YCU A;  4MHE A;  1K0S A;  3GTO B;  5CMD A;  3KDF B;  2QCP X;  1KXL A;  4DUY L;  2NZO A;  3H3V H;  3ERQ A;  1VQN A;  1S40 A;  2B2V A;  3I73 A;  3MFY A;  4HJ5 A;  2AMC B;  2F4I A;  1N8R C;  5C4J B;  2CCZ A;  4P75 A;  3GD7 A;  4DR3 L;  1TWA B;  4WJ3 M;  4ZKB B;  3RZO H;  4FF4 A;  2B2U A;  1XTC D;  4AYB E;  3SDZ A;  5BN4 A;  3TRE A;  2ES2 A;  1G2S A;  2ZTE A;  3VR2 A;  1LT4 D;  2ZM6 Q;  1O78 A;  1EOT A;  3FPU B;  4R4O A;  3MFG A;  2K5Q A;  3S16 H;  2KOL A;  2O2L D;  3VA7 A;  2KCT A;  1TWF H;  4A3E G;  2DNC A;  5I6Y A;  1ET6 A;  1VMP A;  4IPH A;  5A35 A;  3F2C A;  1SR3 A;  2EJG C;  1N36 L;  1SLJ A;  3VYT A;  2PO4 A;  4IN3 A;  5BR8 Q;  1CKO A;  1WTX A;  1Q12 A;  3SHL A;  3BU2 A;  1K8G A;  1WTW A;  4JI0 Q;  3CF5 A;  3VYU A;  2JE6 I;  3LX0 A;  2MO0 A;  2KCC A;  3DMU A;  1MIU A;  4IOA A;  1B7Y B;  2BA0 A;  2WIN B;  4H7B A;  1DXM A;  2OF1 A;  2B63 H;  1GUO A;  4JI2 Q;  3S2D H;  3QJY A;  1PZJ D;  3VYS A;  1H9J A;  3BVM A;  4EGV A;  1SNO A;  1YHA A;  4N8X 1;  2Z1C A;  3S1Q B;  3HOV G;  1IXR A;  2OTJ A;  2EJF C;  3IFT A;  4BBR B;  2R61 A;  3GTQ B;  3QWN A;  4LF7 Q;  1BXT A;  2RHS B;  3PF4 A;  3OWE B;  5IP7 G;  1N34 L;  4DV1 Q;  4LF4 Q;  2F0F A;  3H94 A;  1EIG A;  1UEA B;  2ZTD A;  1U4P A;  4BY1 H;  2K75 A;  3BDL A;  3C2P A;  4C3J G;  4CDD C;  1GHK A;  3OYY A;  1KAW A;  1YBY A;  2RDH A;  2CFM A;  1ASY A;  4DXG A;  1S5C D;  1X3F A;  3M7N A;  2K5V A;  3GP7 A;  1BCP F;  4A76 A;  1XTD A;  2I46 A;  1K73 C;  5FO9 B;  2KEN A;  4F87 A;  1HNX Q;  3VDY A;  3A5Z B;  3IL8 A;  5CV4 A;  2G9D A;  4IO9 A;  4A3J H;  2WII B;  1PH3 A;  1D5X C;  1E0B A;  5EPK A;  2M00 A;  1I4H A;  1C4Q A;  4JC0 A;  2Z4I A;  3K5O A;  3A54 A;  2X69 A;  3KF6 B;  1UEB A;  1WTO A;  3K81 C;  1MI2 A;  1PFN A;  4DN4 M;  2K4K A;  3I4O A;  3NEL A;  1BNZ A;  2JA8 B;  1MBY A;  4A3G B;  2ZJP A;  5T1I A;  4KD3 A;  1X6O A;  1R4P B;  1KDB A;  4KKU A;  3SXH A;  4IUP A;  2UXD L;  1UE7 A;  1TU2 B;  4IUT A;  1ENC A;  4DV3 Q;  1RKN A;  1IYJ B;  4IUV A;  5C0X I;  1EIF A;  4LF9 L;  2BH2 A;  3TRZ A;  3BZC A;  3QR8 A;  2OT2 A;  1HNW L;  2K01 A;  3SR1 A;  1G29 1;  1HA6 A;  4KMU C;  1CSQ A;  3H3V C;  5EGT A;  4A3B G;  3CPF A;  4C3J B;  2ALY B;  4I7A A;  2FMC A;  3KDF A;  1PH7 A;  2WAQ B;  2ZXR A;  3CCJ A;  2KBN A;  1SSO A;  4RAU C;  2VB3 X;  4A93 H;  2IX0 A;  2F52 A;  3OIP A;  2A8V A;  4QIW E;  2NVQ H;  2UUB Q;  2K5D A;  3LNN A;  1IYU A;  5LMN L;  2LMC B;  5C3E G;  1W3S A;  1VQO A;  1STB A;  1LT5 D;  3PCO B;  3PIO 3;  3I4N B;  4KV6 A;  4N9T A;  3Q23 A;  4A3D H;  4G57 A;  4IJH A;  3GTJ H;  4KN7 C;  3VR5 A;  1VQ6 A;  2Z8L A;  1CKN A;  5HUR A;  4OO1 I;  4X62 L;  5DNF A;  2NBF A;  2SEB D;  1SNC A;  2JEB I;  1GJX A;  1PFM A;  1TY0 A;  4CHT B;  4RWS C;  2KHI A;  2EZV A;  3MC0 B;  4LFB Q;  5JOB A;  3NK9 A;  3R8B A;  2LXK A;  2EPB A;  5JEA H;  1B3Q A;  1R9T B;  2PNH A;  1I4G A;  3U58 A;  5LHY 1;  1EEI D;  1D8L A;  4HIO A;  1VQF A;  4O1N A;  5E4X A;  5IGF A;  1ICF B;  5BN5 A;  2FHT A;  3C1F A;  4L5S A;  4J15 A;  1A3T A;  4IPD A;  3CPW A;  1GUG A;  3CP0 A;  3S16 B;  2K6A A;  4A3C H;  1KAA A;  3S14 H;  3K5N A;  2K03 A;  1KQS A;  1WTR A;  4ZQ3 A;  2I0Q A;  3PIP A;  1BCP B;  4WRD A;  2NVT B;  5D14 A;  2WAQ G;  3HS0 C;  3A0J A;  4KN4 C;  5IYD H;  2LY7 A;  2NN6 G;  4EVO A;  3OTO L;  3U9S A;  4A3D B;  4HJ7 A;  1LYL A;  5JVG 3;  1CA6 A;  4FYD A;  1DOL A;  1N33 L;  4P2C B;  5KRU A;  3I4N G;  4K6L A;  3PO2 G;  3UDF A;  3V05 A;  4DR1 Q;  5C3X A;  1NMG A;  3CQZ B;  4A3L H;  4LF8 L;  3IRB A;  4BXX G;  1H9R A;  1SYG A;  1O7Z A;  2JQO A;  4X65 L;  3J7A V;  3CME A;  4KKT A;  4DV2 L;  2YTX A;  4HIM A;  1VQ5 A;  1L1O B;  4DAY B;  2N8N A;  3L3O C;  4XIG S;  2F4V Q;  5L37 A;  4DNT B;  1RJT A;  4XQQ A;  1SJE D;  1LT3 D;  2AQ3 B;  1ET9 A;  4RH6 A;  4X3K A;  3GTP B;  3DM3 A;  3AEV A;  5G3L F;  3TBI B;  1U4M A;  2DJF C;  4AQY Q;  2YTV A;  1SYE A;  5FLM G;  1X65 A;  1EZ6 A;  4HJ8 A;  2UUC Q;  1X3G A;  4XTC S;  2R7Z H;  1OXS C;  5IY0 A;  1ZEQ X;  1CHP D;  5FO8 B;  3ITP A;  4HJA A;  5EAY A;  3HP3 A;  4IFD I;  4JI7 Q;  4Q5V A;  2F0P A;  3NTI A;  2Z6K C;  2XVS A;  3D6W A;  3K6O A;  1D1K A;  3X3M A;  3CAM A;  3JAM c;  3UE0 A;  5GQO A;  5DEH A;  4KHZ A;  3A74 A;  4JI7 L;  3HOY G;  2WB1 G;  1SND A;  1HA5 A;  1YNX A;  1VCI A;  1Q90 A;  4IUU A;  2PW7 A;  3S9W A;  3UDG A;  4P74 A;  1XPU A;  3PUW A;  5EKI A;  2BCO A;  4JI5 L;  1XMQ L;  4B3S Q;  2NTT A;  4JI1 Q;  3IAY A;  4QQB X;  1II3 A;  3I2Z A;  1FNV A;  5TSS A;  4JW0 A;  1Y69 U;  3GTM B;  4ZCK A;  3S17 H;  1SNQ A;  1EY7 A;  1KTK A;  3CQZ H;  4DAV A;  4LUZ A;  5C44 H;  1Q1E A;  4UP9 A;  2BOS A;  2JA5 G;  4H13 C;  3NSW A;  3NBH B;  1IW7 D;  2E2H H;  4PV1 C;  3D4R A;  3E0E A;  1I6H H;  4I7Z C;  1LTI D;  3OWF A;  1BVS A;  4YIJ A;  2F0T A;  4GLV B;  3GTQ H;  1B1Z A;  4AH6 A;  1LTA D;  2IW3 A;  4JVZ A;  5M9O A;  4NXN L;  3C46 A;  2FJ2 A;  2PI2 E;  4OO1 H;  1B9M A;  1B50 A;  1F9S A;  2RQX A;  2SNM A;  2H1E A;  2SDF A;  4GZY C;  4LF6 L;  2XNA C;  2WAQ E;  1KNE A;  2E5L Q;  2KEC A;  5GAE C;  4DK1 A;  1PH8 A;  4IUQ A;  1E1O A;  5C0X H;  1VQB A;  1B9N A;  2PQA B;  2F0H A;  1PZK D;  4LF5 L;  3G6J B;  3JAM L;  4B3R Q;  1PH6 A;  1AZQ A;  1NCV A;  4FF2 A;  2FIN B;  1TS2 A;  3K0Y A;  1D5Z C;  5C4X B;  1BBU A;  3MTS A;  3JC6 6;  1JJC B;  2HT1 A;  3VR6 A;  1PRT F;  3MZ5 A;  4HCS A;  1VQL A;  1F9P A;  4FNF A;  1AFP A;  2G5D A;  2UXD Q;  1XMO Q;  1STY A;  2XWB B;  1VF5 C;  2N49 A;  2X6G A;  4Y7N B;  1NMF A;  2MNA A;  2NTS A;  4FDB A;  2K33 A;  1PTO D;  4DR4 Q;  4GKK L;  5IP9 H;  1QUQ B;  2B39 A;  2EY5 A;  5KYL A;  1AP0 A;  5LMU L;  3SK4 A;  4APV A;  3M3Y B;  2JA5 B;  1SE4 A;  2L15 A;  3I3C A;  4JI8 L;  1C9O A;  2E2H B;  3KJO A;  3J7Z C;  4QL5 A;  4UP7 A;  2VY3 A;  5F2D A;  2DNE A;  3RLO A;  1G6Z A;  2F0E A;  1DGS A;  2C35 B;  1PA6 A;  1A3V A;  1SMY D;  2BE5 C;  4JCV E;  1GXD C;  4RA8 A;  3HOX G;  4NKL A;  2AQ2 B;  4LK1 C;  2PW5 A;  4GN4 B;  1K8M A;  2EOT A;  4FO2 A;  3S2H H;  5LMN Q;  1M1K C;  4IPG A;  1QB5 D;  1V1O A;  2ZXP A;  1V1P B;  1ILQ A;  4JYA Q;  1LTG D;  1YNN C;  2PNR C;  4Y52 H;  1PH5 A;  3NWS A;  3O13 A;  5ELB A;  3CD6 A;  1A3U A;  2K50 A;  1IBK L;  3M4O H;  3MVV A;  2VW9 A;  5ISR A;  4F7X A;  4R1J A;  5M3F G;  1QNU A;  1RDP D;  2A6H D;  3D6C A;  4RHR A;  1MD2 D;  3T51 B;  3SK6 A;  1XPR A;  4RGT A;  2B2W A;  1YNN D;  2GVA A;  3N52 A;  2JA8 H;  2RSO A;  4ID6 A;  3HKZ B;  1SJH D;  5M5Y H;  3TN2 A;  2F0O A;  2L4N A;  2B2V C;  4L5T A;  3A8K E;  2UUA L;  2DUD A;  3FVQ A;  1LAB A;  3M4P A;  3K0X A;  2UU9 L;  4A3D G;  1H95 A;  2K52 A;  3NUC A;  2HQE A;  3DLL A;  3T4A C;  2Q2T A;  3KYH C;  5LL6 S;  4KK7 A;  1WCM B;  1GKH A;  4A93 G;  1YIT A;  2YU9 H;  3QB3 A;  3CCE A;  3HOX B;  1JOQ A;  3GQB A;  2QEJ C;  4NB3 A;  3SK5 A;  2K04 A;  4BY1 B;  4A3F H;  1SMX A;  3PQI A;  3CCU A;  2I5L X;  3OW2 A;  4HIK A;  1F2Z A;  1JMC A;  4IUR A;  3PO3 G;  4UHV A;  1HUM A;  4OL7 A;  4QUF A;  3TP6 A;  2E2I B;  2I5M X;  3G4S A;  4LF6 Q;  3A7A B;  3CRL C;  3W2D A;  1IKL A;  1X32 A;  2M9V A;  3EQL C;  4QF4 A;  1O7L A;  3TDQ A;  5CV6 A;  2A74 C;  2NB0 A;  3S2D B;  3BS1 A;  3K5L A;  1TQO A;  4HCE A;  1ML0 D;  2VNU D;  4IFD H;  4OON A;  1KHI A;  1STN A;  2C9O A;  2NZH A;  4FXD A;  4DK3 C;  3HKZ G;  2DN8 A;  4ZUJ A;  3SEB A;  2PMZ E;  3BVZ A;  2AKW B;  1PRT C;  3M4Q A;  1JE5 A;  4LAA A;  3VR4 A;  4NPS A;  4RKL A;  1CK1 A;  3BZK A;  4A3J G;  4DV6 Q;  4L8J A;  4HSV A;  4BBS H;  3HKS A;  4GKK Q;  4MN3 A;  1BCP C;  2EYF A;  4DUZ Q;  3RUZ A;  1A2U A;  3KBX A;  3I4M G;  1HPC A;  2JYO A;  3AB9 A;  2HUG A;  1GM5 A;  4KTA A;  2UXB Q;  4BY1 G;  2K32 A;  2LKV A;  2HHH L;  2LSS A;  1K3B C;  4DV5 Q;  2RBM A;  1JB3 A;  4TQU S;  2HDL A;  1Y8N B;  5IP7 H;  4O0A A;  1B70 B;  4PNY A;  1ZXT A;  3F8T A;  4ZRZ A;  1G51 A;  5C44 B;  1PTO C;  1V43 A;  5IP9 G;  3CU7 A;  5H1S E;  1YHB A;  1MGS A;  4X3T A;  1EFI D;  2WP8 J;  1Y1W B;  1VQD A;  3HG9 A;  1XWE A;  1ZKO A;  1WJJ A;  3T1Y Q;  4DR5 Q;  1EU3 A;  1STA A;  3A8I E;  2EYH A;  4PMW A;  3STB C;  3R3O A;  5JJK A;  2ID0 A;  3ULL A;  1Y14 B;  2IPK D;  3BJU A;  1RTN A;  2ZXO A;  4KI0 A;  2VUM H;  3T56 B;  4POG A;  2RSN A;  5FLX L;  3AYH B;  3OMC A;  1JIC A;  5C0X G;  3EJI A;  2ZTC A;  4MNO A;  1JE4 A;  2QKI C;  5DLQ E;  2FXQ A;  2L9H A;  3MWY W;  2VQE Q;  1EYA A;  1IHZ A;  3OOC A;  1DM0 B;  3TS2 A;  4C56 C;  3IFD A;  3FRP B;  3BYY B;  3QOJ A;  1O7Y A;  4LFA Q;  2L11 A;  3HEJ A;  3CW2 C;  1G6P A;  2YYZ A;  2EE1 A;  4YHH L;  2VQE L;  1KDA A;  2GA4 B;  2K1B A;  4L6T B;  5A2Q L;  3SE0 A;  1YEZ A;  3I70 A;  1PRT B;  5M3F H;  3ULJ A;  4LFA L;  2B29 A;  1EQQ A;  4KY7 A;  4YHH Q;  1VQ4 A;  1HTP A;  2IT1 A;  5C44 G;  1U4R A;  2JA6 H;  3M4Y A;  3EIV A;  3H91 A;  1VMC A;  2F0G A;  1ONL A;  3WWV A;  3CC4 A;  3J7A 5;  2HD3 A;  4LWC A;  3MAQ A;  3MXN A;  2OCE A;  2DJG C;  4BY7 B;  1CI3 M;  2A6E C;  4B3T Q;  3ONA B;  3M9B A;  4LNQ A;  3BDO A;  2GN5 A;  4X3U A;  4GOP B;  2E76 C;  5I2Y A;  2AQ1 B;  3J80 i;  1M4V A;  2WAC A;  4C2M H;  3DWP A;  1JOO A;  1KL9 A;  3PUZ A;  3J81 c;  3PUX A;  2NVT H;  3OSO A;  1X3E A;  5IGG A;  5JJL A;  1H9S B;  3CC7 A;  2B8G A;  2HCC A;  3I8Z A;  5E4W C;  4K5W A;  4HAE A;  5IWA L;  1HCZ A;  1PZI D;  2PQE A;  2A6E D;  5ELF A;  4QUC A;  4XXE A;  3KFU A;  2OTL A;  2N3S A;  3PSI A;  2ZJQ A;  4XT3 B;  4DA2 A;  2IX1 A;  1YZ6 A;  3NP8 A;  4QJF A;  1QE6 A;  1IL2 A;  4A3E B;  3TZU A;  4DV6 L;  1K0R A;  5ELN A;  4QIW B;  1ROD A;  1KAB A;  3H0G G;  4HSP A;  5DAU A;  3I90 A;  1PTO B;  1D7Q A;  2QGQ A;  4BBS B;  2JSO A;  2JA9 A;  4ALP A;  1R9T H;  1OXT A;  3T53 B;  1SE2 A;  4CDE C;  4OWX B;  4J6H A;  4K8I A;  1ZYR C;  1NUC A;  2N88 A;  1PTO H;  3K7U C;  4P71 A;  2IHF A;  1G2T A;  4CDC C;  3ER0 A;  1QUQ A;  1WTV A;  1WTP A;  2QIL A;  3TP5 A;  1HNZ Q;  2AUK A;  5A2Q E;  3GV3 A;  1CSP A;  5HGT A;  2MFI A;  2NVX H;  2HIX A;  4IZ8 A;  1VQE A;  1E2V A;  3ERO A;  4LF7 L;  3J7A F;  4YWL A;  3TS0 A;  3TEH B;  4BY7 G;  4NW2 A;  1JQY D;  3PO3 B;  2R92 G;  4GNX B;  4RCN A;  1Q8I A;  1HTL D;  3C3L A;  1XJV A;  4GKJ Q;  3Q0A A;  2PYK A;  2XRS D;  3AFP A;  5IYD G;  3U50 C;  3P75 A;  4B3S L;  3Q6S A;  1TT2 A;  3HOU G;  4KY6 A;  1WTQ A;  5K36 H;  3ND9 A;  1K9M C;  5IYC G;  2OEO A;  3NTH A;  5ELC A;  2E2D C;  3OPO A;  3GV6 A;  4A3C G;  5CYU A;  1I6H B;  3EN2 A;  5G3L D;  3PIO A;  1DJR D;  2MHV A;  4A3K B;  1WFQ A;  4ZLT F;  4A3F B;  1IBM L;  4RGM A;  1QVF A;  4OEL B;  1E22 A;  4CKB A;  2JA6 G;  2B2Y C;  3HRZ C;  5IOC A;  3I4M H;  1MHW C;  3RD4 A;  3H0G B;  5GAD C;  1STH A;  4UY8 C;  2QDB A;  4X64 Q;  3IKJ A;  4X66 Q;  2A69 C;  4DV1 L;  4BBS G;  1EWH A;  4IOC A;  2R6G A;  1ESF A;  4KKS A;  5JEA G;  5IE8 A;  4V19 0;  4DV4 L;  4C3I H;  1KD1 C;  1GUW A;  1CZW A;  2I5H A;  3F2B A;  3K8A A;  1J5E Q;  4XQJ A;  2Y0S G;  2MGS A;  3MXU A;  1PXU A;  1FJG Q;  4YY3 L;  5CBA E;  2A6H C;  5C5M A;  1B44 D;  3EVQ A;  3I55 A;  3Q8D A;  2VQF Q;  4N9P A;  3S1M H;  3G48 A;  1SYC A;  4C3I B;  5EBC A;  1EIH A;  2R92 B;  2B2T A;  4CGY B;  2WV6 D;  2KQ3 A;  4NXM L;  2UXC Q;  2PZU A;  2WB1 B;  3FMC A;  1RCV D;  3M4O B;  4GNX A;  4IFD J;  4GOP A;  2L5T A;  3HOZ B;  1M8A A;  4R4I A;  4DV7 L;  4DR4 L;  1E7Z A;  4KHV A;  4CJ1 B;  1S4Z A;  4ABN A;  1EWI A;  1GD7 A;  1N32 L;  4JBK A;  1V9P A;  2YU9 B;  1YJ9 A;  4DNR B;  4BXX H;  5M3M G;  1B8A A;  1LO5 D;  1PFS A;  4C3H B;  4X62 Q;  1JWU D;  3PGZ A;  1N32 Q;  4X6A H;  2WKC A;  3S1Q H;  1S3O A;  3R2I A;  1EEF D;  4NXN Q;  1TWH B;  1VQA A;  1TWC H;  2K28 A;  5K5P A;  3K59 A;  5IGD A;  1F2Y A;  3NHH A;  1EWC A;  2NN6 H;  1EY6 A;  1MSH A;  2K5H A;  4IUN A;  1YVC A;  3ZJY C;  3M3Y H;  2NZ1 D;  3D31 A;  3HKZ E;  2PCF B;  3G6E A;  2FFK B;  4JPB W;  1A63 A;  2MP1 A;  4FP5 D;  4JOI C;  1JCK B;  3VA5 A;  4LFC Q;  1CT1 D;  1K83 H;  4CJ2 C;  2CQA A;  2KCM A;  2RA4 A;  1BDO A;  3S14 B;  1EOV A;  4QCL A;  1HRJ A;  2H5X A;  3V2T A;  1XNQ Q;  1FD7 D;  5C0X J;  1XNR Q;  2X6L A;  2NUC A;  2Q2U A;  3GTP H;  3FP9 A;  3DXJ C;  3FKI G;  4DAM A;  4CKE A;  3T1H Q;  4DF7 A;  5J3B A;  3K80 C;  2ASB A;  4DV0 L;  3CCS A;  3RZO B;  4IFD G;  2Z6B A;  4DFA A;  3GTG H;  2IWH A;  1X9N A;  1GUT A;  3NE5 B;  1EU4 A;  1I94 Q;  5ELD A;  2NYZ D;  1BCP D;  1XMQ Q;  4B9X A;  3D4W A;  2CH4 A;  1CQF A;  2EXD A;  5M3M B;  4JI5 Q;  1P8L A;  1HJP A;  1X3P A;  2C5C A;  1TVX A;  3HOU H;  4QGU A;  1I3Q B;  1MJE A;  2B2U C;  1EQV A;  1TS5 A;  1VQM A;  2F3V A;  2XRQ D;  1IBM Q;  1KRT A;  4KD4 A;  5CV7 A;  5M5X H;  2L55 A;  2F4V L;  1M90 C;  2RF4 A;  2JEA I;  4BY7 H;  3CKI B;  1ASZ A;  4QB4 A;  2K5W A;  2AWN A;  3LGJ A;  1VQ8 A;  5J1Z A;  1NSN S;  1HUN A;  4A3M B;  1BOS A;  2EY6 A;  3A5U A;  1FVI A;  2F03 A;  2IHE A;  1EYD A;  1HXY D;  4JI4 Q;  5C4Z A;  2JA7 B;  4K6D A;  4JOI A;  3J80 c;  4J8Q A;  2D0P A;  2OWO A;  1X3Q A;  4PMB A;  2B2W C;  2A68 D;  3NEM A;  1PYB A;  2QF7 A;  2WFW A;  1QCB D;  3KLR A;  4GN5 A;  3G7L A;  4XT1 B;  5AFW A;  1A6X A;  3HFZ B;  2WKD A;  2RKS A;  2CKZ B;  1EY0 A;  4A4I A;  4DK0 A;  1KRS A;  1RF2 D;  1GUN A;  2BE5 D;  1W2B A;  3KF6 A;  4JG2 A;  2RCN A;  4BWG B;  3HOY B; 
#chains in the Genus database with same CATH homology
 3NQT A;  1I4R A;  5CR3 A;  1Q3L A;  2EYJ A;  2TSS A;  2KJX A;  5C6A A;  1Z6H A;  5KNC A;  4K14 A;  2L12 A;  1JOK A;  1CTM A;  2F3W A;  1IKM A;  1SBB B;  1TR5 A;  2CVR A;  4A93 B;  3ZYY X;  3QIA A;  2JA6 B;  3A8J E;  4EQN A;  4C1N I;  2R3Z A;  1L0X B;  4B9W A;  1YNJ C;  2F0W A;  2F0K A;  1ILP A;  3JAM E;  1CQV A;  1DON A;  4UDU C;  1LAC A;  1SYB A;  2BA1 A;  2D5D A;  2Y0S B;  2KVM A;  3HGB A;  4KJO A;  1XXG A;  1LT6 D;  1Q1B A;  3FDT A;  5CV9 A;  2B63 B;  4K8J A;  3HZX A;  2HDM A;  5I2X A;  3QO2 A;  3T13 A;  4F8M A;  5J22 A;  1UUP A;  2IJ0 A;  2E2J B;  3DWQ A;  3NPP A;  2CW0 D;  4EQP A;  3U9O A;  1JWS D;  1AN8 A;  1OXU A;  2IX3 A;  3RMH A;  1UAP A;  2RDF A;  4H44 C;  5EKK A;  3S1N B;  2J7Z A;  1E2Z A;  5JPM C;  1EZ8 A;  3V96 A;  3R93 A;  1FR3 A;  3BZD B;  5M5W B;  2AWO A;  1RTO A;  5COY A;  4NP5 A;  5C3W A;  4ZYS A;  4WFN 3;  4CKC A;  1BBX C;  2KHS A;  1J8I A;  2LFN A;  1DOK A;  4JK1 C;  3PMF A;  3J7Y W;  1WVL A;  4PMC A;  3ND8 A;  1JR0 D;  1SXT A;  2Q8R E;  3FEW X;  3D3R A;  2NVX B;  4M8A A;  1S5D D;  2OXP A;  4HMJ A;  5EPJ A;  1HFG A;  1S5B D;  5IT9 L;  4IQZ A;  3H09 A;  3KBG A;  1Z47 A;  3DWA A;  1K83 B;  1SEB D;  4J1M A;  1G91 A;  4PQX A;  1DD2 A;  1H9M A;  4IAL A;  5D3D A;  1JOR A;  4NDX A;  4C1N K;  3GTL B;  1V8Q A;  1Y1V B;  2NWG A;  2D2C C;  1HFN A;  1B3A A;  1SAP A;  3S17 B;  1ESR A;  4XYO A;  5EKL A;  1PTO F;  4Q0F A;  4NMZ A;  4XDX A;  3R2T A;  4H0L C;  2E74 C;  2KEE A;  4HED A;  4BA1 I;  4ZAI A;  1HQM C;  2PPB C;  1AW7 A;  5EQ0 A;  3A55 A;  1J9O A;  3N6R A;  4ILW A;  2PZW A;  1EYC A;  2EYL A;  2CHB D;  2V4D A;  2JXM B;  4FXK C;  2IL8 A;  3DEP A;  4ODG A;  1CM9 A;  1TII D;  4WOR A;  4S3S A;  3URY A;  2MPM A;  5E1F A;  1CZG A;  3F2U A;  3PUY A;  3PV0 A;  5I4D A;  3K58 A;  5KEE A;  3LWU A;  1EL0 A;  4R8N A;  1B4O A;  2KUM A;  5EBD A;  2G9H D;  5FK9 C;  1NR4 A;  2J4X A;  1SNM A;  2Q8T A;  1FGB D;  5JAV A;  2XSC A;  2O5I C;  4OIK A;  4A3J B;  3T16 A;  1W6K A;  1DOM A;  1DCZ A;  3P20 A;  3X3N A;  3I4M B;  2XWJ B;  4HTH A;  3TP7 A;  2PMZ B;  2B2Y A;  3TME A;  1MSG A;  1D5M C;  1F9Q A;  4CBV A;  5C4H A;  4KY5 A;  1PYW D;  2DY7 A;  1F9R A;  4DU9 A;  2EXZ A;  4G7Z C;  4TKO B;  4TSS A;  1EY9 A;  2AUJ D;  4A3I B;  1PRT D;  5CV8 A;  5C5L A;  2SNS A;  2J0T D;  3J80 E;  4HR7 B;  2F0N A;  3NTK A;  3I4L A;  3BDC A;  1L0Y B;  1DZ1 A;  3DM1 A;  3D8G A;  1WD0 A;  3DEO A;  4Z9C B;  5KNB A;  4DGZ A;  3Q22 A;  3AMU A;  1AZP A;  1TS3 A;  3AU7 A;  3KUP A;  1IL8 A;  3WOE A;  5DM7 3;  4ZUI A;  3GTK B;  3DUZ A;  4E6I A;  1S5F D;  2B8F A;  1Y8O B;  2RDG A;  1D2B A;  1F2L A;  4DXF A;  1UNS A;  4LJZ C;  2A68 C;  1JWM D;  2BDN A;  2ENB A;  2VB2 X;  4XYQ A;  3CHB D;  3HOV B;  4C3I G;  2F0U A;  5CGK A;  4M1U B;  3VR3 A;  4U68 A;  1PLF A;  2JP1 A;  3S1R B;  3J81 E;  1K8O A;  1TWC B;  5JPN C;  1VF7 A;  3WOF A;  2BDO A;  5DM6 3;  4K5X A;  2M2L A;  4OHJ A;  2TMP A;  3OHX C;  1QNK A;  2A73 B;  2EY2 A;  1DYQ A;  3BG3 A;  1LV9 A;  3MEH A;  1WD1 A;  1BQQ T;  2NN6 I;  5T1G A;  2KED A;  4CJ0 B;  3OIQ A;  2EY1 A;  3NQI A;  4B08 A;  2MUY A;  1V1P A;  1I6V C;  2XIW A;  3OMG A;  1ZYR D;  3WDN A;  1F77 A;  2EJM A;  3Q24 A;  3E0J A;  1OO9 B;  1CFM A;  1GHJ A;  4MIU A;  1LTB D;  5LL6 X;  4UAI A;  2F0D A;  3BYT B;  3K57 A;  1STE A;  5I9O A;  2PZT A;  1LTR D;  3MXP A;  1RD9 D;  2VUM B;  1SDF A;  3NWT A;  1T5X D;  1QJO A;  2F1M A;  3EFX D;  5KIX A;  1AEX A;  2EVB A;  3J81 L;  1KDC A;  4AYB B;  3GTJ B;  3OW7 A;  2LS0 1;  1T5E A;  4OO1 G;  2F0J A;  1FNW A;  3HOU B;  4HMI A;  2L1B A;  5EJW A;  1B53 A;  2F0Q A;  4G7O C;  2F0V A;  1OXV A;  1TY2 A;  1C8C A;  3QG1 A;  3TP8 A;  2A5H A;  2I07 B;  3GO5 A;  3GTG B;  3VYR A;  3E5S A;  2K7V A;  2DY8 A;  1U9R A;  4LMQ D;  4RCO A;  4R8I A;  2H4O A;  4FXG C;  1EY4 A;  1SMY C;  1RHP A;  5FOB B;  5CC4 A;  4QMG A;  2FMM A;  1TWF B;  2VXW A;  1JC7 A;  2EYO A;  2F0M A;  2F0I A;  4XQN A;  1S5E D;  2K05 A;  3KK7 A;  2ZT9 C;  5ELE A;  4ME5 A;  5CV5 A;  3A56 A;  1SYF A;  4DAY A;  2NVQ B;  1R4Q B;  3CRK C;  3P1H A;  3BVG A;  1LLR D;  3PO2 B;  3EA6 A;  1A2T A;  3KLS X;  2A69 D;  4EQO A;  1BF4 A;  1PMR A;  1I4Q A;  1YNJ D;  1ENA A;  1C48 A;  2F0S A;  4C3H G;  3A7L A;  4OGQ C;  4WJW A;  3M7G A;  1Y8P B;  3H6M A;  2RVL A;  1EY5 A;  1ENF A;  1TWG B;  3I91 A;  3W3A A;  3MXG A;  4ZK9 B;  4HN7 A;  4ZKC B;  2KCN A;  5EPL A;  4V0B A;  2Q8I B;  1PFB A;  4OIJ A;  3P7J A;  5NUC A;  4FVM A;  3NBI A;  3S1M B;  2E75 C;  4RFB A;  1NR2 A;  2O4X A;  3DHQ A;  3LWE A;  4RHS A;  2F0L A;  4BS9 A;  5IGE A;  2EYM A;  2SOB A;  4U67 3;  1D6E C;  4I65 A;  1EY8 A;  2R7Z B;  4G4K A;  1LTT D;  4RGN A;  1TS4 A;  2B2T C;  1I4X A;  3SK8 A;  3FKI B;  2O5J C;  3RZD B;  5CBE E;  1NAP A;  5JJZ A;  1GUS A;  1VDZ A;  3RLF A;  1H9K A;  2Z4H A;  1QOH A;  1QG7 A;  5FLX E;  1W6J A;  5J39 A;  5IOD A;  5D65 A;  4TRD A;  4RGO S;  1STG A;  1I4P A;  5E3F A;  3M85 A;  4DAP A;  1D1I A;  3C1E A;  3PIP 3;  3L7Z C;  1SYD A;  2HCI A;  1FNU A;  5KND A;  3QOL A;  5JVH 3;  4FF1 A;  3NBH A;  3L9A X;  3E6Z X;  1HQR D;  1ICW A;  5FKA C;  3TSS A;  1I50 B;  2N55 A;  1EQT A;  4BA2 I;  3UI2 A;  3K7A B;  4G7H C;  3KF8 A;  1E2W A;  2D9U A;  2CW0 C;  1SE3 A;  1QIL A;  2NVY B;  1B2T A;  3I72 A;  2EDG A;  1TKW B;  1U4L A;  3D4D A;  1XYI A;  3KLS A;  1HHV A;  1SFO B;  2XN9 C;  5IGC A;  1IYV A;  2ICI A;  1F2M A;  1XX8 A;  4C2M B;  5K36 G;  5KGU A;  1KLU D;  5COR A;  3NXW A;  5IGB A;  4K2K A;  1A15 A;  2R93 B;  2L0C A;  3J80 L;  4A3B B;  2ICE C;  3PUV A;  5KYI A;  4FF3 A;  5FO7 B;  4K2L A;  4F88 A;  1PDQ A;  2KA7 A;  3HOW B;  5C3E B;  5M3F B;  3SVM A;  5IIF A;  1LTS D;  3MA2 B;  1CA5 A;  4ULL A;  5IT9 E;  1BUV T;  5I6W A;  1OXX K;  1O80 A;  5M5Y B;  1KNA A;  4O42 A;  1GOZ A;  1QWY A;  5BN3 A;  3S15 B;  3MHB A;  1BO0 A;  1FYC A;  1Z7T A;  1H9S A;  3K5M A;  4L63 B;  4JBW A;  4X3S A;  1SNP A;  1CHQ D;  3FPP A;  3TZD A;  4K5V A;  2MJ8 A;  5I9P A;  1BR9 A;  4KJN A;  1G8Z D;  1IW7 C;  5D3I B;  1KLG D;  4R9W A;  4RKB A;  5M5X B;  3S2H B;  5JEA J;  2D62 A;  2EYP A;  4MHE A;  3GTO B;  5CMD A;  2QCP X;  3ERQ A;  2B2V A;  3I73 A;  3MFY A;  2F4I A;  5C4J B;  3GD7 A;  1TWA B;  4ZKB B;  4FF4 A;  2B2U A;  1XTC D;  3SDZ A;  5BN4 A;  1G2S A;  3VR2 A;  1LT4 D;  1O78 A;  1EOT A;  3FPU B;  3MFG A;  2K5Q A;  2KOL A;  2O2L D;  3VA7 A;  2DNC A;  5I6Y A;  1ET6 A;  1VMP A;  5A35 A;  2EJG C;  3VYT A;  2PO4 A;  4IN3 A;  1WTX A;  1Q12 A;  3SHL A;  1WTW A;  3VYU A;  2JE6 I;  3LX0 A;  2KCC A;  3DMU A;  2BA0 A;  2WIN B;  4H7B A;  1DXM A;  2OF1 A;  1GUO A;  3QJY A;  1PZJ D;  3VYS A;  1H9J A;  3BVM A;  4EGV A;  1SNO A;  2Z1C A;  3S1Q B;  2EJF C;  3IFT A;  4BBR B;  2R61 A;  3GTQ B;  3QWN A;  1BXT A;  3OWE B;  2F0F A;  3H94 A;  1EIG A;  1UEA B;  1U4P A;  3BDL A;  3C2P A;  4C3J G;  1GHK A;  2RDH A;  4DXG A;  1S5C D;  3M7N A;  3GP7 A;  1BCP F;  2I46 A;  5FO9 B;  4F87 A;  3IL8 A;  5CV4 A;  2G9D A;  2WII B;  1D5X C;  1E0B A;  5EPK A;  2M00 A;  1I4H A;  1C4Q A;  2Z4I A;  3K5O A;  3A54 A;  2X69 A;  1WTO A;  1MI2 A;  1PFN A;  4DN4 M;  1BNZ A;  2JA8 B;  1MBY A;  4A3G B;  5T1I A;  4KD3 A;  1R4P B;  1KDB A;  4KKU A;  3SXH A;  4IUP A;  1TU2 B;  4IUT A;  1ENC A;  1RKN A;  4IUV A;  5C0X I;  2OT2 A;  2K01 A;  3SR1 A;  1G29 1;  1HA6 A;  4KMU C;  3H3V C;  5EGT A;  4C3J B;  2FMC A;  2WAQ B;  2ZXR A;  1SSO A;  4RAU C;  2VB3 X;  2IX0 A;  3OIP A;  2K5D A;  3LNN A;  1IYU A;  2LMC B;  1STB A;  1LT5 D;  3PIO 3;  3I4N B;  4KV6 A;  4N9T A;  3Q23 A;  4G57 A;  4KN7 C;  3VR5 A;  2Z8L A;  4OO1 I;  5HUR A;  5DNF A;  2NBF A;  2SEB D;  1SNC A;  2JEB I;  1GJX A;  1PFM A;  1TY0 A;  4CHT B;  4RWS C;  2EZV A;  3MC0 B;  5JOB A;  3NK9 A;  3R8B A;  2EPB A;  5JEA H;  1R9T B;  1I4G A;  5LHY 1;  1EEI D;  5E4X A;  4O1N A;  5IGF A;  5BN5 A;  2FHT A;  3C1F A;  1A3T A;  1GUG A;  3S16 B;  2K6A A;  1KAA A;  3K5N A;  2K03 A;  1WTR A;  4ZQ3 A;  1BCP B;  4WRD A;  2NVT B;  5D14 A;  3HS0 C;  4KN4 C;  2LY7 A;  2NN6 G;  4EVO A;  3U9S A;  4A3D B;  5JVG 3;  1CA6 A;  4FYD A;  1DOL A;  4P2C B;  5KRU A;  4K6L A;  3V05 A;  5C3X A;  3CQZ B;  1H9R A;  1SYG A;  1O7Z A;  3J7A V;  4KKT A;  3L3O C;  4XIG S;  4DNT B;  1RJT A;  4XQQ A;  1SJE D;  1LT3 D;  2AQ3 B;  1ET9 A;  4RH6 A;  4X3K A;  3GTP B;  5G3L F;  3TBI B;  1U4M A;  1SYE A;  1EZ6 A;  4XTC S;  1OXS C;  1ZEQ X;  1CHP D;  5FO8 B;  3ITP A;  3HP3 A;  4IFD I;  4Q5V A;  2F0P A;  3NTI A;  2XVS A;  3D6W A;  3K6O A;  1D1K A;  3X3M A;  5DEH A;  4KHZ A;  1SND A;  1HA5 A;  1VCI A;  1Q90 A;  4IUU A;  2PW7 A;  3S9W A;  3PUW A;  5EKI A;  2BCO A;  2NTT A;  3IAY A;  1II3 A;  1FNV A;  5TSS A;  1Y69 U;  3GTM B;  1SNQ A;  1EY7 A;  1KTK A;  4DAV A;  1Q1E A;  2BOS A;  3NSW A;  4H13 C;  1IW7 D;  4PV1 C;  3D4R A;  4I7Z C;  1LTI D;  3OWF A;  4YIJ A;  2F0T A;  1B1Z A;  1LTA D;  2IW3 A;  5M9O A;  3C46 A;  2FJ2 A;  4OO1 H;  1B9M A;  1B50 A;  1F9S A;  2RQX A;  2SNM A;  2H1E A;  2SDF A;  4GZY C;  2XNA C;  1KNE A;  2KEC A;  4DK1 A;  4IUQ A;  5C0X H;  1B9N A;  2F0H A;  1PZK D;  3G6J B;  3JAM L;  1AZQ A;  1NCV A;  4FF2 A;  2FIN B;  1TS2 A;  3K0Y A;  1D5Z C;  5C4X B;  3MTS A;  3VR6 A;  1PRT F;  3MZ5 A;  4HCS A;  1F9P A;  4FNF A;  1AFP A;  1STY A;  2XWB B;  1VF5 C;  2X6G A;  4Y7N B;  2NTS A;  2K33 A;  1PTO D;  2B39 A;  2EY5 A;  5KYL A;  1AP0 A;  3SK4 A;  3M3Y B;  2JA5 B;  1SE4 A;  3I3C A;  2E2H B;  1G6Z A;  5F2D A;  2DNE A;  2F0E A;  1A3V A;  1SMY D;  2BE5 C;  1GXD C;  4RA8 A;  4NKL A;  2AQ2 B;  2PW5 A;  4LK1 C;  1K8M A;  2EOT A;  4FO2 A;  1QB5 D;  1V1O A;  2ZXP A;  1V1P B;  1ILQ A;  1LTG D;  1YNN C;  2PNR C;  3NWS A;  3O13 A;  5ELB A;  1A3U A;  3MVV A;  5ISR A;  4F7X A;  1QNU A;  1RDP D;  2A6H D;  3D6C A;  4RHR A;  1MD2 D;  3T51 B;  3SK6 A;  4RGT A;  2B2W A;  1YNN D;  3N52 A;  2RSO A;  4ID6 A;  3HKZ B;  1SJH D;  3TN2 A;  2F0O A;  2L4N A;  2B2V C;  3A8K E;  1LAB A;  3FVQ A;  3NUC A;  2HQE A;  3T4A C;  5LL6 S;  4KK7 A;  1WCM B;  3QB3 A;  3HOX B;  1JOQ A;  3GQB A;  2QEJ C;  3SK5 A;  2K04 A;  4BY1 B;  1F2Z A;  4IUR A;  1HUM A;  4OL7 A;  4QUF A;  3TP6 A;  2E2I B;  3A7A B;  3CRL C;  3W2D A;  1IKL A;  1X32 A;  2M9V A;  3EQL C;  4QF4 A;  1O7L A;  3TDQ A;  5CV6 A;  2A74 C;  2NB0 A;  3S2D B;  3BS1 A;  3K5L A;  1TQO A;  4HCE A;  1ML0 D;  2VNU D;  4IFD H;  1STN A;  2C9O A;  4FXD A;  2DN8 A;  4ZUJ A;  3SEB A;  3BVZ A;  1PRT C;  4LAA A;  3VR4 A;  4RKL A;  1CK1 A;  4L8J A;  4HSV A;  4MN3 A;  1BCP C;  2EYF A;  3RUZ A;  1A2U A;  3KBX A;  1HPC A;  2JYO A;  3AB9 A;  2HUG A;  4KTA A;  2K32 A;  2LKV A;  2RBM A;  1JB3 A;  4TQU S;  2HDL A;  1Y8N B;  4PNY A;  1ZXT A;  4ZRZ A;  5C44 B;  1PTO C;  1V43 A;  3CU7 A;  1MGS A;  4X3T A;  1EFI D;  2WP8 J;  1Y1W B;  3HG9 A;  1XWE A;  1ZKO A;  1EU3 A;  1STA A;  3A8I E;  2EYH A;  4PMW A;  3R3O A;  2ID0 A;  2IPK D;  1RTN A;  2ZXO A;  4KI0 A;  3T56 B;  2RSN A;  5FLX L;  3OMC A;  1JIC A;  5C0X G;  3EJI A;  1JE4 A;  2QKI C;  2L9H A;  3MWY W;  1EYA A;  1IHZ A;  3OOC A;  1DM0 B;  4C56 C;  3IFD A;  3FRP B;  3BYY B;  3QOJ A;  1O7Y A;  2L11 A;  3HEJ A;  2YYZ A;  2EE1 A;  1KDA A;  2GA4 B;  2K1B A;  4L6T B;  5A2Q L;  3SE0 A;  3I70 A;  1PRT B;  4KY7 A;  1HTP A;  2IT1 A;  1U4R A;  3M4Y A;  3H91 A;  1VMC A;  2F0G A;  1ONL A;  3MAQ A;  3MXN A;  4BY7 B;  1CI3 M;  2A6E C;  3ONA B;  3BDO A;  4X3U A;  2E76 C;  5I2Y A;  2AQ1 B;  1M4V A;  2WAC A;  3DWP A;  1JOO A;  3PUZ A;  3PUX A;  3OSO A;  5IGG A;  1H9S B;  2B8G A;  2HCC A;  3I8Z A;  5E4W C;  4K5W A;  4HAE A;  1HCZ A;  1PZI D;  2PQE A;  2A6E D;  5ELF A;  4QUC A;  4XXE A;  4XT3 B;  4DA2 A;  2IX1 A;  3NP8 A;  1QE6 A;  4A3E B;  3TZU A;  4QIW B;  1ROD A;  1KAB A;  4HSP A;  5DAU A;  3I90 A;  1PTO B;  4BBS B;  2JSO A;  1OXT A;  3T53 B;  1SE2 A;  4J6H A;  4K8I A;  1ZYR C;  1NUC A;  2N88 A;  1PTO H;  1G2T A;  1WTV A;  1WTP A;  2QIL A;  3TP5 A;  2AUK A;  5A2Q E;  3GV3 A;  5HGT A;  4IZ8 A;  1E2V A;  3ERO A;  3J7A F;  4NW2 A;  1JQY D;  3PO3 B;  4RCN A;  1Q8I A;  1HTL D;  3C3L A;  3Q0A A;  2PYK A;  2XRS D;  3P75 A;  3Q6S A;  1TT2 A;  4KY6 A;  1WTQ A;  5K36 H;  3ND9 A;  2OEO A;  3NTH A;  5ELC A;  2E2D C;  3OPO A;  3GV6 A;  5CYU A;  1I6H B;  5G3L D;  1DJR D;  2MHV A;  4A3K B;  4A3F B;  4ZLT F;  4RGM A;  4CKB A;  2B2Y C;  3HRZ C;  5IOC A;  3RD4 A;  3H0G B;  1STH A;  2QDB A;  3IKJ A;  2A69 C;  1EWH A;  2R6G A;  1ESF A;  4KKS A;  5JEA G;  4V19 0;  1GUW A;  1CZW A;  4XQJ A;  2MGS A;  3MXU A;  1PXU A;  5CBA E;  2A6H C;  5C5M A;  1B44 D;  3EVQ A;  4N9P A;  1SYC A;  4C3I B;  5EBC A;  1EIH A;  2R92 B;  2B2T A;  4CGY B;  2WV6 D;  2KQ3 A;  2PZU A;  2WB1 B;  3FMC A;  1RCV D;  3M4O B;  4IFD J;  2L5T A;  3HOZ B;  1M8A A;  4KHV A;  4CJ1 B;  1S4Z A;  4ABN A;  2YU9 B;  4DNR B;  1LO5 D;  4C3H B;  1JWU D;  2WKC A;  3R2I A;  1EEF D;  1TWH B;  2K28 A;  5K5P A;  3K59 A;  5IGD A;  1F2Y A;  3NHH A;  1EWC A;  2NN6 H;  1EY6 A;  1MSH A;  4IUN A;  2NZ1 D;  3D31 A;  2PCF B;  2FFK B;  2MP1 A;  4FP5 D;  3VA5 A;  1JCK B;  1CT1 D;  4CJ2 C;  2CQA A;  2RA4 A;  1BDO A;  3S14 B;  4QCL A;  1HRJ A;  3V2T A;  1FD7 D;  5C0X J;  2X6L A;  2NUC A;  3DXJ C;  4CKE A;  4DF7 A;  3RZO B;  4IFD G;  4DFA A;  2IWH A;  1GUT A;  3NE5 B;  1EU4 A;  5ELD A;  2NYZ D;  1BCP D;  4B9X A;  3D4W A;  5M3M B;  1CQF A;  1X3P A;  2C5C A;  1TVX A;  1I3Q B;  2B2U C;  1EQV A;  1TS5 A;  2F3V A;  2XRQ D;  4KD4 A;  5CV7 A;  2L55 A;  2JEA I;  3CKI B;  4QB4 A;  2K5W A;  2AWN A;  5J1Z A;  1NSN S;  1HUN A;  4A3M B;  1BOS A;  2EY6 A;  2F03 A;  1EYD A;  1HXY D;  5C4Z A;  2JA7 B;  4K6D A;  4J8Q A;  1X3Q A;  4PMB A;  2B2W C;  2A68 D;  2QF7 A;  1QCB D;  3KLR A;  3G7L A;  4XT1 B;  5AFW A;  1A6X A;  2WKD A;  2RKS A;  1EY0 A;  4DK0 A;  1RF2 D;  1GUN A;  2BE5 D;  4BWG B;  3HOY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...