1MGSA

The solution structure of melanoma growth stimulating activity
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MELANOMA GROWTH STIMULATORY ACTIVITY
publication title The solution structure of melanoma growth stimulating activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine(growth factor)
total genus 9
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1mgsA00
2B2UC 1X3QA 2X6GA 1LV9A 2B2YA 4IUPA 3KUPA 1B53A 3P7JA 1WVLA 4OIKA 4ZKCB 1G6ZA 1HFNA 3ONAB 4MN3A 2EE1A 1IL8A 3IL8A 2M2LA 4NW2A 4X3SA 1WTOA 2L11A 1Q3LA 1WD0A 3LWEA 2FJ2A 4ZKBB 1WTQA 1HRJA 1SSOA 1HHVA 1CA6A 1MGSA 1B3AA 4XT3B 1ESRA 2K03A 1U4MA 1ZXTA 4X3KA 1U4LA 2CVRA 2RVLA 4CJ2C 1HFGA 1O7YA 2B2WA 2MJ8A 1MSHA 2X6LA 1BNZA 2HUGA 1BF4A 1C8CA 1B4OA 4U68A 5E4WC 1F9SA 3I91A 3R93A 4X3UA 4MHEA 2BDNA 1WTRA 1B2TA 2NYZD 1VMCA 1KNEA 1ILPA 1J9OA 2KEDA 1B50A 1DOMA 1E0BA 3HP3A 1AZQA 1CA5A 4O42A 1GUWA 1A15A 2MPMA 3KBXA 3DM1A 4CJ1B 1HA6A 1QG7A 2N55A 1ICWA 2B2VC 1PFBA 2RSOA 1DONA 4R9WA 4IUTA 5EJWA 1WTWA 4QUCA 1SDFA 2KECA 1WD1A 2RA4A 4IUUA 4OIJA 1HUNA 2J7ZA 2JYOA 5T1IA 1O80A 4ZK9B 5JJZA 1ILQA 2FMMA 1G91A 1PLFA 4RWSC 2IL8A 2L12A 1JICA 1U4RA 4XDXA 1CM9A 2NZ1D 2KOLA 3Q6SA 2B2UA 3H91A 3DEOA 1O7ZA 1PFNA 1KNAA 5E4XA 1DOLA 4QUFA 1X32A 1NR2A 2EPBA 2JP1A 2K28A 2L9HA 2NWGA 3GV3A 3QO2A 1WTVA 1DZ1A 2MP1A 2X69A 1RHPA 4HCSA 3IFDA 1DOKA 5EPKA 1EL0A 2FINB 5D65A 1NAPA 2K05A 2K04A 1TVXA 3GV6A 1ML0D 5T1GA 1J8IA 1G2SA 2VXWA 4UAIA 1QNKA 1QE6A 3I8ZA 1JE4A 1BBXC 1S4ZA 1RODA 2D9UA 2KEEA 4ZLTF 4XT1B 2B2YC 2KVMA 5EPLA 3I90A 4IUQA 2RSNA 4HAEA 3MTSA 1EIGA 4ZAIA 2FFKB 1RTOA 2N88A 1NCVA 1SAPA 4R8IA 2R3ZA 4X3TA 2DY8A 5COYA 4IURA 2KUMA 3UI2A 1VMPA 1M8AA 1X3PA 3TZDA 3I3CA 1IKMA 3MWYW 2B2VA 1WTPA 2HDLA 2K1BA 1EIHA 1XYIA 3DEPA 3D6WA 1F2LA 2SDFA 1EQTA 4RAUC 2EOTA 2HCIA 4HSVA 5EPJA 1U4PA 1F9RA 1BO0A 2B2TC 1G2TA 5CMDA 2Q8TA 2FHTA 2Q8RE 4LMQD 5EQ0A 5EKIA 1NR4A 4RA8A 1PFMA 2L4NA 5CORA 1RJTA 2K01A 1F9QA 4IUVA 1MI2A 5CBEE 1AZPA 1HUMA 2MGSA 1AP0A 2H1EA 5D14A 4CJ0B 1EOTA 3F2UA 3TN2A 5CBAE 1XX8A 2HDMA 1PDQA 3N52A 3FDTA 2B2TA 1RTNA 4DN4M 1WTXA 1F9PA 5AFWA 2XIWA 3FPUB 4HEDA 1IKLA 1MSGA 3G7LA 2HCCA 2DY7A 3SVMA 5DNFA 2B2WC 2L1BA
chains in the Genus database with same CATH superfamily
1H9JA 3KLSX 4C3IH 4OIKA 5C3EB 4LFCQ 1V1PB 1YNXA 4DR2Q 1PA6A 1C48A 2PCFB 2J4XA 1KXLA 1NUCA 2R92H 4IJHA 2F0KA 1HNXL 1Y1VH 1PH4A 3RLOA 4JI4Q 1XTDA 2DNCA 5M3FB 2MHVA 4HIKA 3S15B 4DR1Q 2NVXB 4S3SA 4C3HG 1E0BA 2K4KA 3HP3A 1AZQA 3M3YH 2OQKA 1PMRA 2B2VC 1PFBA 4R9WA 4GN5A 2UXBQ 4QUCA 4JI0L 3HOXH 1TT2A 3SK5A 3CHBD 2JA6H 5F2DA 1ILQA 1DM0B 2OTJA 3MC0B 1PLFA 1QCBD 1OXUA 4UY8C 4LF8L 3H3VI 2O2LD 3CCMA 2B2UA 4RCOA 2F0QA 1EY0A 5M3MH 2JA7H 3KBGA 4HCSA 4PZ6A 1SE3A 2A19A 3CC7A 1F77A 2XSCA 5LHY1 4LF9L 3MEHA 4R4IA 1PZKD 4OELB 5C4ZA 4A3JH 4WORA 3F2CA 2A68C 3MTSA 1AE2A 1L1OC 1ESFA 4A3DH 4P73A 1M8AA 2ZT9C 4GOPB 4HN7A 3B6YA 2Y0SG 3D6WA 4HSVA 1DJRD 2QDLA 3TBIB 3DUZA 5EQ0A 1B8AA 2LS01 1I94L 5IODA 5CORA 1HZAA 1YIJA 4TVAB 2R7DA 1HUMA 4HIMA 3CKIB 1U9RA 2M00A 4JI2L 4WJ3M 2NVTH 1M1KC 3PIO3 1CSPA 4LFBL 1LM0A 4JI8L 1QVFA 3GTPH 3HGBA 3HOVB 1WTXA 4ABNA 2JK8A 2E5LL 1GOZA 1LT4D 3WWVA 1VQIA 5IGBA 1IKLA 1X9NA 2B2WC 4DK0A 4IUPA 1SNCA 2QGQA 3RZOH 3A0JA 4K0KQ 2RCNA 1CKMA 1LT6D 2A68D 3T1YL 4LW1A 3PF5A 1ESRA 2CW0D 1FGBD 4UP8A 3GTMB 4H13C 3L2PA 1VQOA 1K8GA 3I91A 5JEAG 4MHEA 2Z4HA 5DLQE 3PIOA 1JORA 4QY7A 1ET9A 1PYBA 2F0MA 3KBXA 4CKCA 3I4NH 2Y0SE 4LF4L 5EJWA 2WAQG 1WTWA 1SDFA 1LYLA 5FLXc 3I2ZA 4C3IB 5CV7A 2LXJA 1Y1WB 3H09A 5LMNW 2KOLA 1ENCA 3J81c 3S24A 1A6XA 1NNXA 1A2TA 1II3A 1WTVA 2MP1A 3P20A 1MBYA 4CGYB 3PO2H 1LABA 4R1JA 2K5WA 4DV4L 4GZYC 4LF6L 4JYAQ 1L0YB 2YYZA 2F0NA 2NZOA 2F0JA 2K5VA 4NKLA 1VQ5A 4IN3A 3BVMA 4ZLTF 3J7YW 1IBKQ 2KVMA 3D4WA 1BR9A 2WB1B 4IUQA 2VL6A 1ONLA 2RSNA 1KC8C 2A8VA 1CQVA 1XPUA 1JOKA 4EX5A 1ZKOA 3HOXB 4IALA 4AIMA 1TR5A 4FF4A 2O5IC 3A56A 3VR5A 3HOWG 4BBSG 4RAUC 4TSSA 3E3XA 2E2HH 3I4OA 5M3MB 4DR7L 1PFMA 3A8IE 3D8GA 1OO9B 1MI2A 5AJ3Q 1EWIA 5IP7H 1C9OA 1AP0A 1BCPB 2WAQE 3H0GG 1KIXA 5ELNA 5LMUL 5JJIA 4A3FH 3T56B 3Q22A 2BOSA 1TWAB 3Q0AA 3NHHA 1UEBA 1D6EC 2DJGC 2A69D 5JEAJ 1YJNA 2B2UC 4DV5Q 5CV9A 1XMQL 1PTOH 4A3DB 1TS4A 3S2DB 1FL0A 1WD0A 4DR6L 1G8ZD 2Z6BA 3BVGA 3CRLC 3FMCA 2L5TA 3NTHA 1B3AA 3BZCA 3SEBA 1XJVA 4HSPA 4GKJQ 4K14A 1RD9D 3G71A 4GLXA 1BF4A 4K5VA 3R93A 4BY7G 2NTTA 4QGUA 4LF7Q 4P75A 1LLRD 1B2TA 1YHAA 1F2YA 4AYBB 1A0IA 1B50A 4BXXG 2CH4W 4K2KA 1EY9A 4FXKC 1N33Q 1T9HA 5C4XH 3FP9A 2J7ZA 2F0DA 3PIP3 4DV6Q 3AMUA 1U0LA 1EY5A 2LMCB 4XXEA 4A3LG 1EY6A 3MXUA 4P72A 3DEOA 4NDXA 5ELCA 2R61A 4GN3B 5JVG3 1IBLQ 2L9HA 1EFWA 1WFQA 1C7YA 1KLUD 1H9SB 4XYOA 4A3EG 5FLXL 4BBRG 4ZQ3A 1NAPA 5T1GA 2PPBC 3NBHB 1D8LA 3J81L 2WV6D 2QW7A 3HRZC 5C5MA 1BBXC 2KEEA 3MA2B 4YWLA 1Z6HA 2EYPA 1EIGA 2CQAA 3I56A 4RGTA 4NXML 5KYLA 1EIFA 4GOPC 1EYDA 3NQIA 4IURA 3ER0A 5HGQA 1SE4A 3PIPA 1YI2A 1WTPA 2HDLA 1EIHA 1HNWL 5D3DA 1X56A 5DM63 5A2QL 1G2TA 3IFTA 4MNOA 1D2BA 2PQEA 2AKWB 1IXRA 2QF7A 4IUVA 3I73A 3S9WA 2PMZE 3M7GA 5HURA 4DUYL 3PUYA 4AQYL 1SBBB 5HY6A 1ZEQX 1BUVT 2EJGC 3DWPA 4H0LC 1RTNA 3SDZA 1BBWA 3CCJA 4A3GB 4B3SL 5IGGA 1MSGA 4C2MH 4CBVA 4JI7L 1JB3A 3M85A 4A3MG 2IWHA 4WJWA 4A3IG 1A3VA 3E0JA 3ONAB 5J22A 2M2LA 3VR6A 3TP8A 3HKZB 3D6CA 2FJ2A 2KA7A 4A93H 1CUKA 3T4AC 4HIDA 3PUVA 3CCQA 4JI6Q 3JAMi 3OMCA 4JCVE 1FJGQ 2UXCL 1VF7A 3NSWA 2XGTA 2GN5A 4KLKA 4DFAA 1TS3A 1B4OA 2GA4B 4A76A 2O4XA 3S14B 4RHRA 1VQ4A 4B3RL 1IBMQ 4A3FB 1J6QA 2A6EC 1MD2D 4ME3A 1L2FA 4O42A 5TSSA 3AU7A 1E1OA 4GNXB 1YNND 3HOWH 5IGEA 1N36L 4ZRZA 1ET6A 2ZTEA 2JA5G 1AEXA 3PV0A 2VB3X 2SOBA 3I72A 5M5YB 2VQEQ 1CI3M 3H94A 2YTXA 3H0GH 3N6RA 2PI2A 4C56C 5KNBA 1FD7D 1EU3A 4DR4L 1K8MA 1STHA 2CWPA 5I9OA 4CKBA 3EJIA 1PYSB 3GO5A 5DAUA 5KNCA 4LUVA 1OXXK 3C3LA 1O7IA 4FDBA 3CW2C 1VQDA 2XRSD 1JJ2A 5ISRA 1SXTA 2WP8J 4MTKA 1I3QB 2V4DA 1YVCA 3BVZA 4DV3Q 1TWGH 4DV1L 1STGA 3VYSA 4GNXA 2WIIB 3GTJH 3W1GA 5C4XB 2KUMA 1VMPA 1JR0D 4L5QA 2A6ED 3D4RA 4OONA 1QWYA 1Z7TA 2TSSA 2MQHA 4DA2A 4FF1A 1HZ9A 4LMQD 4DV2Q 1BCPC 5L37A 4BXXH 1UE1A 4HCEA 1F2ZA 2UXDL 1Q1EA 1BOSA 4DAYA 4FO2A 3K5NA 2QCPX 1YJ9A 3L7ZC 4O2DA 3O13A 1IHZA 4N8FA 3PGZA 5AFWA 1VQNA 4A3LH 1D7QA 4HEDA 1HNZQ 2IHFA 3GTKH 1XPRA 2VY3A 3G48A 5LMNQ 2PZUA 4CHTB 4G7ZC 1OTCA 2NVQH 5A35A 4BBRH 1YNJD 3IL8A 3I4MB 1GVPA 3JAME 4B3TQ 1MGSA 2QA4A 1J5EQ 1U4MA 2SNMA 3Q24A 3C1FA 1MSHA 3VYUA 1D1KA 1C8CA 4U68A 5LL6X 5CV6A 5CC4A 3PO3G 2NZHA 1SRUA 2UUAL 4K6DA 1CA5A 3M7NA 1BCPD 2ZM6L 2F4VQ 2N55A 3CD6A 2F0OA 4CDEC 1IYUA 3HOZB 4N9TA 1STYA 1HUNA 4IUUA 1V1OA 2F0VA 4KHVA 5M5WH 1XNRQ 1RCVD 4BY1H 4MZ9A 4XDXA 2E75C 5C4JB 2A5HA 1YJWA 1CM9A 4DUZL 1WCMH 4KD3A 1YBYA 3I70A 2AWNA 3AQQA 2RDHA 2OCEA 4DAMA 1GJXA 2BCOA 1TWCH 1NJIC 3FRPB 4OL7A 3RZDH 2FINB 3PCOB 2K05A 2K04A 1SJED 1N32Q 4XYQA 1NTGA 4A3MH 4A3IH 3NK9A 1EY4A 1K28A 1R4QB 1S4ZA 2K5QA 3MAQA 3PQIA 1SNPA 3U4ZA 2PW7A 4R8IA 3HOUH 4K5XA 2DY8A 4NMZA 1I50H 2Z1CA 5I2YA 3MWYW 3T1HQ 1Z9FA 3U58A 1DCZA 3MXGA 1IL2A 1U4PA 4KI0A 4YIJA 4IFDG 5DM73 3VR4A 1PRTB 2K5HA 3WOFA 1AZPA 1XNQL 1S5ED 2EYFA 1PH5A 3GTLB 1B9NA 5GROA 2Q2HA 3TN2A 1LTBD 2JA5H 2JJQA 2BE5C 1XX8A 1PDQA 3N52A 3M4YA 4DV7Q 1T5EA 4Q0FA 2R7ZB 2UU9L 4DR5Q 2KBNA 2EY5A 2WKDA 2RDGA 1VQGA 5G3LD 3D4DA 1B70B 3BZKA 4ULLA 3OIQA 4X62Q 1KAWA 2VQFQ 1CA6A 3T53B 4LJZC 2K03A 1PZJD 4RGNA 4C3JG 3PF4A 4LFCL 2F0TA 3AYHB 3E5SA 2F3VA 4DR2L 3CC2A 4GNXC 3NWSA 4I65A 1MJCA 1EYAA 3S1MB 2JA8H 1HA5A 4JI4L 4X65Q 2F03A 4QJFA 2JYOA 2WFWA 4HR7B 3GTKB 3W5OA 4DR1L 4RWSC 2IX1A 2L15A 2B63H 5IE8A 4QUFA 1DOLA 4LWCA 2UXBL 4PMCA 1KTKA 3A74A 2RCFA 3U9SA 1DOKA 2OTLA 3BJUA 4FXGC 3UDFA 3GD7A 2K52A 1SMXA 1TY2A 1W6JA 3I8ZA 1JE4A 4LUOA 2DNEA 4DPGA 3MVVA 4IFDJ 1SLJA 3I90A 2K14A 4IFDI 1HZBA 3DMUA 1B7YB 5C6AA 1TIID 1Q8IA 3PUXA 5EGTA 4CDCC 2KCNA 3F2BA 3STBC 4DKAC 1EQQA 1LTID 1XYIA 1B1ZA 3K6OA 1SN8A 3AB9A 2IPKD 5EPJA 4JBJA 3FKIH 3V96A 4GKKQ 1CKOA 1V8QA 2Q8RE 3ICEA 1JE5A 3NUCA 1E1TA 1TWCB 1SFOH 1RJTA 1VQAA 2KHJA 3RUZA 3KF8B 2JXMB 4FP5D 4KY5A 4YCUA 2H1EA 4J1MA 4LNQA 5EBCA 2YTVA 4V190 2EXZA 3U50C 5FJ8G 4JI0Q 5ELDA 1GD7A 4A3KG 3FPUB 1MKHA 2I5HA 1G51A 1HXYD 1TWFH 1LV9A 1LTTD 1D5MC 2Z4IA 1K9MC 1I50B 2N78A 1IL8A 1HPCA 4DK1A 2A74C 3E0EA 1HTLD 1B9MA 4RMFA 1T5XD 2CVRA 2K75A 1R9TB 4LF9Q 3OSOA 2Z0SA 1RIPA 2XN9C 3STBD 3MFYA 4POGA 3TMEA 2BA1A 2HUGA 1VF5C 1Y69U 3KF8A 4K0KL 2K5DA 4KY7A 2E2JH 4I7ZC 1SNDA 1FR3A 1DOMA 2BA0A 1KQSA 3S1NB 5GADC 2E2IH 5C44B 3U4VA 2NBFA 1QJOA 5IYDG 2RDFA 1JOQA 4OHJA 1JOOA 4ZCKA 4DNTB 5ELEA 4IFDH 4PMWA 2PW5A 1O80A 5JJZA 2K32A 1G291 3H3VH 3PUWA 2NZ1D 4IPGA 1SNQA 4B3ML 3DWQA 4CKEA 5E1FA 3URYA 5IY0A 1FYCA 1JMCA 3FVQA 1VQ9A 2N8NA 2NWGA 4JI2Q 4EQOA 1ASZA 3W2DA 5EPKA 2R7FA 1JWSD 2EYMA 1KDBA 1TVXA 3MXNA 3TZUA 4PNYA 2F0FA 5GAGC 2E5LQ 1K73C 1J8IA 1XWEA 4K6LA 2VUMB 5FO9B 4YY3L 1GUOA 4JV5L 1Q46A 2LSSA 4DAVA 5CV4A 3I4MG 1JWMD 2FFKB 1RTOA 4LK1C 4MTNA 4JYAL 3WDNA 2JA8B 3CPWA 3NWTA 5GAHC 2CH4A 3HOYG 1IBKL 3PMFA 2R92B 1PRTC 3QWNA 4RKBA 3DLLA 2Q8TA 1Y1VB 4G4KA 1EEID 3E9HA 4RA8A 1X55A 4QB4A 1CTMA 4X66Q 3NE5B 4O0AA 2ZTCA 3M3YB 2AQ1B 2F0GA 2CKZB 2QKIC 4K8JA 4KN4C 4FNFA 4IJLA 4WJ4A 2YU9H 4AH6A 2JA6B 1PH8A 5AJ3L 3G7LA 4RCNA 2ATWA 3HEJA 1AE3A 4JI3L 1PVOA 2ZXPA 1I6VC 1NMGA 4APVA 4C3HH 1JQYD 2JA7B 1TS5A 2EYHA 1SSOA 3J80c 1TKWB 3K7AH 3FKIB 1GUGA 2MJ8A 4DV5L 1HQMC 4JG2A 4FXDA 3OYYA 4KJOA 4Z9CB 3NBIA 4RGMA 1F9SA 2JE6I 4A3JB 2IT1A 1GUSA 1S72A 1TS2A 4QIWB 3I7FA 1PRTD 2NB0A 2NVYH 4GKJL 4H02A 1A2UA 3GTGH 1HH2P 1DYQA 2D0PA 2L0CA 4NPSA 1EQVA 4A3BG 4LF7L 2R93G 1K3BC 3K5OA 3KOJA 2N3SA 1U4RA 2KENA 3SHLA 4ID6A 1EWHA 1N33L 2EY1A 3S16H 4N8X1 2KQ3A 5A2QE 2X69A 1RHPA 5FJ8H 3IAYA 2NVTB 5D65A 5LL6S 4DV6L 2KHSA 4A3KH 4CDFC 2F52A 4LAAA 3HS0C 4YCWA 4M1UB 3GTPB 4J15A 3M9BA 3BDLA 1IBLL 3OOCA 4IPHA 1A3TA 2F0HA 3FHWA 2EY2A 2OQ0A 2G9DA 5IWAQ 1MHWC 4R4TA 3RZOB 1SYCA 2R3ZA 5M5XH 2SNSA 2KCTA 4RG1A 5H1SE 1X3PA 1VS0A 4Q5VA 2B39A 4TQUS 2AUJD 2L55A 5JOBA 3ULLA 1L0XB 3ZJYC 1PH6A 4JOIA 1Q1BA 3OW7A 4NXNQ 2MO1A 2SDFA 1B3QA 1SNOA 1EQTA 5KNDA 2RKSA 1QUQB 2FHTA 5IYCG 1NR4A 4R4QA 3OPOA 4BA2I 2K01A 1F9QA 1UEAB 4DV0Q 4JI1Q 2OXPA 5C3EG 5D14A 5EKLA 1A8VA 3LNNA 5E7NA 1ICFB 2F0WA 3KLRA 3I4NB 1GHJA 1WTHA 3QJYA 3QOLA 1Y14B 3CCSA 2B2TA 4DN4M 1E7ZA 4QF4A 4R4OA 2OF1A 3J7AV 3TEHB 1W2BA 3UE0A 3UE1A 1EYGA 1X3QA 5JEAH 1B53A 1WVLA 4RGOS 4G57A 5M3FG 1JC7A 4X6AH 2I07B 3DWAA 4ZKBB 1WTQA 2ZTDA 3PO2B 4P71A 4UHVA 3LX0A 3GDEA 5IT9c 3K80C 2PQAA 5CGKA 1LACA 1QUQA 2HHHQ 4B9WA 4OX9Q 2D0OA 3L0OA 1NMFA 2K5NA 3G6EA 1SYBA 3U9OA 3BDCA 1F2MA 3VYTA 3S2HH 3J80L 1VMCA 2KEDA 1Q81C 2EY6A 2E8GA 1GUWA 3HOYH 1S5FD 1DONA 1FJGL 1I4QA 4UP7A 3KLSA 4WFN3 2XVSA 1LT3D 5KYIA 1VQHA 3NP8A 3A55A 4GS3A 1IBML 3NTIA 2L12A 3QG1A 3D0FA 4K8IA 2IX0A 3Q6SA 2E2HB 4P2CB 2DGYA 5K5PA 4DUYQ 4AQYQ 2EJMA 3TQYA 1KABA 2P5ZX 1S40A 4XQJA 5JPNC 2EQSA 4RFBA 3NENA 3SXHA 4BBSH 1Y8PB 1LO5D 5ELFA 1EY7A 2KJXA 1EIYB 2JA9A 5M9OA 1VQLA 3BS1A 1PTOB 1NCVA 1BCPF 3VR2A 3S1RH 4H44C 2D5DA 2EJFC 1IKMA 5JAVA 3I3CA 2F0SA 1LT5D 5EKKA 3HOVG 1EWCA 1PXUA 2UXCQ 2IX3A 3PUZA 4DV3L 4DAYB 1QOHA 4QCLA 3FEWX 3S16B 2PNHA 3TP6A 4HJ9A 2EIFA 2MGSA 5I6WA 1I6HH 1OXTA 4OEMB 3F2UA 3ULPA 4A3BH 4DGZA 1N36Q 2Y0SB 3RN2A 2R93H 2VNUD 2EZVA 1F9PA 3I55A 3RLNA 4DV2L 2AWOA 1TXYA 5ELOA 3OTOQ 3JAMc 3J7A5 5DNFA 4BY7H 2EYJA 3TS0A 1Z47A 1GM5A 1K0SA 1EOVA 1WOCA 4DR3Q 4YHHQ 1A62A 2IW3A 1STEA 5BN5A 4X64Q 3SK4A 1HHVA 2E74C 4IUNA 4HJAA 1HNZL 1JT8A 3S17H 2UUCQ 5LMNL 1QZGA 3CRKC 4UPAA 1TWHH 3K8AA 1HR0Q 4C3IG 1G6PA 3CXCA 1Y1WG 3BU2A 4B3TL 1EU4A 1ILPA 1J5EL 3EQLC 4OWWB 1VQFA 4Y52H 1I4GA 2GVAA 1I4RA 2IJ0A 5IT9L 4CJ1B 3PSIA 3SGIA 2RSOA 4A3EH 4IUTA 4C1NI 4L63B 5JVH3 3AFQA 2PZWA 1M4VA 1G91A 4A3CG 3QOJA 4PZ7A 1N34Q 1XTCD 1HJPA 3TDQA 5C3EH 2HT1A 1K8OA 2F4VL 2WB1G 3GV3A 1XMOQ 1PH3A 2H5XA 1STBA 1X65A 2WAQB 3H15A 5C3XA 3HOXG 3GV6A 4KJNA 3LWUA 4PV1C 1G2SA 3BG3A 3EVQA 4UAIA 5NUCA 3S2HB 5M3FH 1K0RA 1X54A 1EFID 3R2IA 4C2MB 5GQOA 4HAEA 2A73B 5M3MG 2ASBA 3ND8A 1P16A 3EFXD 2VZAA 1EUJA 1N32L 3H3VC 1CK1A 1OXSC 4A93B 4KHPL 4V0BA 4KN7C 1I4HA 4A3JG 1S5BD 1E22A 2VS1A 2Z6KA 1CQFA 1EY8A 3DHQA 3T1HL 4A3DG 4DNIA 2ZJRA 1X3FA 3G6JB 4DU9A 1UNSA 4CJ0B 1FNUA 3HOWB 2B8GA 4BBSB 1EYCA 2XWBB 3RN5A 4IPDA 4Y7NH 1FVIA 3KFUA 2WB1E 4I7AA 5EBDA 3C46A 1VQ6A 1NE3A 5J3BA 4BS9A 2B2YA 3ZYYX 3P7JA 3KLWA 3KF6B 3H0GB 4TRDA 3K0YA 2UUBQ 1LTAD 1K83H 4X3SA 1Q3LA 4AYBG 4DK3C 4E6IA 1VQCA 2HD3A 4DR5L 4X3KA 1U4LA 1Q82C 1O7YA 2B2WA 1H95A 4ODGA 5KRUA 2Q2UA 2IY5B 2DN8A 3NTKA 2AQ2B 2VQFL 3RR5A 1TWGB 4LF5Q 4B9XA 3NPPA 1QZHA 1QNUA 1VQKA 3GTJB 2J0TD 3M4PA 2JN4A 1ICWA 1PYWD 3HOVH 2PZTA 1NBWA 2Z9HA 3W3AA 2MFIA 4LFAQ 1DXMA 4PQXA 1CKNA 1Q7YC 4BY7B 1GKHA 3KF6A 4F8MA 1FNVA 3F1ZA 3TREA 3ULJA 3QO2A 4IO9A 1STNA 2H4OA 2PMZB 3IFDA 2OWOA 4X65L 1EZ6A 3A8KE 4A75A 3GTMH 1FNWA 5J1ZA 2ICEC 4DNRB 1QE6A 2UU9Q 1O7LA 5IGCA 4EQNA 1GHKA 4A4IA 1PTOC 2D9UA 2E76C 5CYUA 1S5DD 3MEFA 4AYBE 4EQ5A 4XTCS 1TY0A 3K81C 1I4XA 3K0XA 2BE5D 2NVQB 1LTRD 4BBRB 1KRTA 2QDBA 2ENBA 3PO2G 3G4SA 3UI2A 4JVZA 1SYGA 2HIVA 1RDPD 2JSOA 3IRBA 1Y8OB 4EVOA 3NXWA 5EAYA 4KKTA 2F0IA 1VCIA 1WJJA 4A3GG 1Y1WH 5CMDA 1ENAA 3CU7A 1CFMA 5BR8Q 2FXQA 1E2ZA 4JI5Q 3OWFA 3SK8A 1NSNS 3CMAA 1I4PA 1AH9A 3FPPA 3HKZG 2I46A 4GKKL 2HDMA 4JC0A 3OWEB 4A3CH 2VB2X 5M5WB 4FVMA 5FLMG 1CZGA 1QB5D 3EROA 2L4NA 4BY1B 3C2PA 2I5MX 1AN8A 3KYHC 1HNXQ 5IP7G 2AHOB 1WCMB 2EDGA 2F3WA 3OHXC 4MN3A 3PO3H 1WYDA 1QILA 1PTOD 4A3FG 1SE8A 2PYKA 1P8LA 5IIFA 3RZDB 4ILWA 3DM3A 3A8JE 1IYJB 4GLVB 1KRSA 1ENFA 1LUZA 1V1PA 5D3IB 4A3MB 4A3IB 2BDNA 2F0PA 2F3IA 3CP0A 1GUNA 1X3GA 1J9OA 2G9HD 4LF8Q 1VQBA 3HOUB 5HGTA 1SMYC 3CMEA 3TP7A 1M90C 4L5TA 2WINB 1TWAH 4Y7NB 4KHZA 3CQZH 5T1IA 2RF4A 1PZID 1TU2B 3CPFA 4NB3A 2CW0C 3T51B 2Z6KC 1K83B 2AMCB 1ZYRC 3M4QA 3MXNB 3M4OH 1PFNA 2CHBD 4RKLA 3S2DH 3HKZE 2PI2E 2JEAI 4JW0A 1EL0A 5C4XG 1A63A 2JA5B 4RHSA 1LTGD 5GAEC 1JJCB 1VQPA 3X3MA 3J81i 2DJFC 1N9WA 1CZWA 3OMGA 2B2YC 4XT1B 1QVGA 1VDZA 3P75A 5JJLA 1PRTF 4H7BA 4HIOA 1PH7A 3OIPA 4JBWA 2ICIA 1I94Q 3A5ZB 1E2WA 2F1MA 4OO1G 4R8NA 3L9AX 5IOCA 4LFBQ 1SMYD 4JI8Q 3W1BA 4GOPA 3J81j 1HR0W 2DUDA 5FK9C 3I4LA 2F0UA 4F7XA 1UAPA 3K59A 1B44D 4ZYSA 3RNUA 1KLGD 3UDIA 1Q86C 1ZYRD 3MXPA 3T16A 2ZJQA 3OW2A 2VW9A 3T1YQ 1DD2A 4MIUA 1C0AA 4X66L 4K5WA 4C3JH 5KEEA 3J80i 1K3RA 2L1BA 2QILA 2X6GA 4B3MQ 1XXGA 2B63B 1HFNA 3VYRA 5IGDA 1X6OA 1UE7A 2L11A 4PMBA 3LWEA 1PH2A 2IHEA 1C4QA 4QQBX 3SR1A 3JC66 3ERSX 2LXKA 1IZ6A 3HOZG 3GP7A 1BNZA 4LF4Q 1TQOA 4WRDA 1UWVA 4YY3Q 4X3UA 4JV5Q 1EZ8A 1WTRA 4KD4A 2EYLA 1RL2A 1RF2D 2A69C 3SE0A 2HQLA 3VDYA 5FO8B 2M9VA 1A15A 3TSSA 4A93G 3NQTA 1V43A 5BN3A 4B08A 4DF7A 2KECA 4J8QA 2RA4A 1WD1A 4A3GH 4KKUA 1HQRD 3BYTB 1AW7A 5CV5A 4DV4Q 2ID0A 4LF6Q 3PO3B 1YZ6A 3VA5A 2Q2TA 2OEOA 3HKSA 1VQJA 2LFNA 4UP9A 3V2TA 1SFOB 4PZ8A 5FLXE 3SK6A 4IOCA 1HZCA 5IYBG 1V1QA 1BXTA 3J81E 5KIXA 5FLMH 2ALYB 4OO1I 2VXWA 1V9PA 1UUPA 3S14H 1XPOA 2C9OA 1TWFB 4JI3Q 1Q8KA 2C35B 4JBKA 1BKBA 1SAPA 5I2XA 4DR7Q 3CQZB 1O78A 1YEZA 4F88A 2CCZA 4IOAA 4YWKA 3AEVA 1KD1C 4BA1I 2BH8A 3CC4A 5LMUQ 1F2LA 1W6KA 3ITPA 4G7OC 5M5YH 3CCLA 5IWAL 2R7ZG 1BO0A 3M4OB 4G7HC 4KMUC 2QEXA 2E2JB 2ZXRA 2RQXA 1IW7C 2LKVA 1U5KA 1XMQQ 1EOTA 4NXNL 1MJEA 2E2IB 1SYEA 3DXJC 4DR6Q 5I6YA 3FDTA 3J80E 2XIWA 1I3QH 4DV0L 1KL9A 4JI1L 3J7ZC 3R3OA 1D5ZC 3GTQH 4QMGA 1HTPA 3KUPA 1G6ZA 4HJ5A 2PQAB 3F2DA 2EE1A 2XRQD 3EN2A 5CR3A 4J6HA 5C5LA 1OXVA 1VQMA 2PNRC 2K6AA 4ZUIA 5IYDH 2RVLA 1HCZA 3MHBA 4HMJA 2X6LA 2OT2A 5JPMC 5E4WC 2WKCA 4HMIA 2MNAA 2G5DA 2NN6G 4KKSA 1SROA 3WOEA 1KNEA 3IKJA 4OO1H 4C1NK 3VR3A 2JQOA 2HHHL 4JPBW 4OX9L 3HG9A 1IW7D 4C3JB 1SNMA 3CCVA 3BDOA 3EIVA 4DK6C 2RHSB 1PHJA 3R2TA 3S1QH 1H9MA 1JICA 2F4IA 4KTAA 3H91A 4XQNA 4IPCA 3K7UC 1DGSA 1LTLA 1X32A 2JP1A 3I4MH 1DZ1A 3EBEA 1UE6A 3TS2A 2RHQB 4NXMQ 2FMCA 1KDAA 2K50A 4HTHA 5J39A 1SR3A 4JI6L 1YNNC 1VQ7A 1QNKA 4BY1G 2R6GA 2LY7A 1H9SA 1FGUA 2YU9B 1HNWQ 4RH6A 5E3FA 1WCMG 2ES2A 5BN4A 3NBHA 1H9RA 3QIAA 5COYA 4GN4B 2K33A 4OWTB 1ASYA 4C3HB 3TZDA 3HOZH 2KCMA 3ERQA 3K7AB 2A6HC 1IYVA 2HCIA 1Y8NB 1BVSA 5C4JH 1D5XC 3MFGA 2VQEL 4HJ8A 4B3SQ 3GQBA 1CSQA 2F0LA 5CBEE 3HOUG 4M8AA 4JI7Q 5C0XG 3KJOA 4L5RC 1SYFA 4FF3A 2NVYB 3HZXA 2V1CC 5FO7B 5FOBB 3K58A 5JJKA 3P1HA 3GTOH 3A54A 1PH9A 3GTGB 5K36G 2HIXA 4GLAC 5IT9E 1SYDA 3CCEA 3SVMA 3D31A 2O5JC 3E6ZX 5CV8A 3EA6A 1SE2A 1VQ8A 5IYBH 2NN6I 3BYYB 4NW2A 1WI5A 1K8AC 1JJGA 2MUYA 4U673 3RLFA 4IQZA 4B3RQ 4L8JA 1HRJA 4YCVA 5C44G 3OTOL 4A3KB 1ZXTA 4CJ2C 3MZ5A 1HFGA 1BBUA 1GUTA 2QEJC 1PH1A 4KV6A 4YHHL 4DR3L 2C5CA 2A6HD 4X64L 4ME5A 5IP9G 3GTLH 1X3EA 5DEHA 3Q8DA 4R4CA 1HA6A 1JWUD 5M5XB 2UUCL 1YNJC 4POFA 4YWMA 2R7ZH 4DR4Q 4OIJA 1HR0L 3TP5A 2RBMA 4ZK9B 3GTQB 2FMMA 3A7LA 2F0EA 1VQEA 2VUMG 1S5CD 1D1IA 1CHPD 1O7ZA 1KNAA 3F8TA 2BDOA 2AQ3B 1NR2A 2EPBA 2K28A 2YV5A 4L6TB 4EQPA 1EEFD 1S3OA 4DV1Q 4FF2A 3CF5A 1CHQD 1Q12A 2JA8G 4CDDC 1ML0D 2E2DC 2XWJB 1N34L 2A1AA 3K57A 4JOIC 1YITA 1RODA 2R92G 2B63G 1XMOL 1Y1VG 5IYCH 1QVCA 3QR8A 3TRZA 4ZAIA 3NEMA 2Q8IB 2N88A 5C0XJ 5G3LF 5IGFA 4X3TA 1W3SA 2WACA 2BH2A 5C0XI 3S1MH 1KDCA 1L1OB 2UXDQ 2ZJPA 2B2VA 2K1BA 3Q23A 3K5MA 3S1QB 1BDOA 1MIUA 1XNRL 3KK7A 1F9RA 2NN6H 4QL5A 2B2TC 2JA6G 3K5LA 3C1EA 2TMPA 3E9IA 3A7AB 1L0WA 1E2VA 3S15H 2NVXH 3HOYB 4N9PA 2JA7G 3X3NA 4PG3A 3J7AF 1BQQT 5C3WA 3FKIG 2JEBI 3V05A 4BWGB 2HCCA 2MO0A 2N49A 3R8BA 1JB7A 4ZKCB 1L1OA 2B8FA 2NUCA 2B3GA 1RKNA 3QB3A 1WTOA 4KY6A 2Q2IA 2HQEA 4OXPA 2UUAQ 4OGQC 4XT3B 4P74A 3ND9A 3NELA 2ZM6Q 1PFSA 2EXDA 2UUBL 2Z8LA 4EGVA 1JCKB 2AUKA 3L3OC 2NYZD 3T13A 2I0QA 3GTOB 4LUZA 1YHQA 1CKNB 4DUZQ 2MPMA 3DM1A 1YHBA 1R4PB 1QG7A 1LTSD 3S1RB 2XNAC 2CQOA 2EVBA 4JBMA 4KHPQ 1H9KA 2PO4A 2XTIA 2KCCA 3AFPA 4DV7L 3LGJA 4LF5L 4F87A 3JAML 2IL8A 2KHIA 1GXDC 5C0XH 3RD4A 1E3PA 2YTYA 5E4XA 1PTOF 4XIGS 1GO3E 2GVBA 4O1NA 4LFAL 4X62L 1I6HB 4DAPA 5I4DA 3CCUA 5K36H 4A3BB 1R9TH 1STAA 4KK7A 2B29A 2R93B 3KDFB 5I9PA 3D3RA 2K7VA 2I5LX 4DXGA 4NP5A 4K2LA 4QIWE 5EPLA 3CAMA 4OWXB 2EYOA 3S1NH 2D62A 5C44H 1SEBD 5FKAC 4JK1C 1XNQQ 2SEBD 2CWAA 1CT1D 1SJHD 1E24A 3DEPA 3BZDB 1KHIA 3RMHA 4XQQA 3I4NG 3CCRA 1UE5A 3VA7A 2EOTA 4UDUC 1NY4A 4IZ8A 3UDGA 1PV4A 1N8RC 3S17B 2D2CC 2CFMA 4ALPA 5ELBA 5IP9H 5EKIA 1AFPA 1A3UA 1TWHB 1EQRA 2NTSA 4DXFA 4L5SA 4TKOB 3H6MA 5KGUA 5CBAE 3KDFA 3HFZB 4A3EB 1Q90A 4FYDA 2VUMH 5BR8L 2ZXOA 1I5FA 4JI5L 5C4HA 3KJPA 1KAAA 2DY7A 3A5UA 4HJ7A 4ZUJA 3UDXA
chains in the Genus database with same CATH topology
1H9JA 3KLSX 4OIKA 5C3EB 1V1PB 1C48A 2PCFB 2J4XA 1NUCA 2F0KA 2DNCA 5M3FB 2MHVA 3S15B 2NVXB 4S3SA 4C3HG 1E0BA 3HP3A 1AZQA 1PMRA 2B2VC 1PFBA 4R9WA 4QUCA 1TT2A 3SK5A 3CHBD 5F2DA 1ILQA 1DM0B 3MC0B 1PLFA 1QCBD 1OXUA 2O2LD 2B2UA 4RCOA 2F0QA 1EY0A 3KBGA 4HCSA 1SE3A 1F77A 2XSCA 5LHY1 3MEHA 1PZKD 5C4ZA 4WORA 2A68C 3MTSA 1ESFA 1M8AA 2ZT9C 4HN7A 3D6WA 4HSVA 1DJRD 3TBIB 3DUZA 5EQ0A 2LS01 5IODA 5CORA 1HUMA 3CKIB 1U9RA 2M00A 3PIO3 3HGBA 3HOVB 1WTXA 4ABNA 1GOZA 1LT4D 5IGBA 1IKLA 2B2WC 4DK0A 4IUPA 1SNCA 1LT6D 2A68D 1ESRA 2CW0D 1FGBD 3GTMB 4H13C 3I91A 5JEAG 4MHEA 2Z4HA 1JORA 1ET9A 2F0MA 3KBXA 4CKCA 5EJWA 1WTWA 1SDFA 4C3IB 5CV7A 1Y1WB 3H09A 2KOLA 1ENCA 1A6XA 1A2TA 1II3A 1WTVA 2MP1A 3P20A 1MBYA 4CGYB 1LABA 2K5WA 4GZYC 1L0YB 2YYZA 2F0NA 2F0JA 4NKLA 4IN3A 3BVMA 4ZLTF 3J7YW 2KVMA 3D4WA 1BR9A 2WB1B 4IUQA 1ONLA 2RSNA 1CQVA 1JOKA 1ZKOA 3HOXB 4IALA 1TR5A 4FF4A 2O5IC 3A56A 3VR5A 4RAUC 4TSSA 5M3MB 1PFMA 3A8IE 3D8GA 1OO9B 1MI2A 1AP0A 1BCPB 3T56B 3Q22A 2BOSA 1TWAB 3Q0AA 3NHHA 1D6EC 2A69D 5JEAJ 2B2UC 5CV9A 1PTOH 4A3DB 1TS4A 3S2DB 1WD0A 1G8ZD 3BVGA 3CRLC 3FMCA 2L5TA 3NTHA 1B3AA 3SEBA 4HSPA 4K14A 1RD9D 1BF4A 4K5VA 3R93A 2NTTA 1LLRD 1B2TA 1F2YA 4AYBB 1B50A 4K2KA 1EY9A 4FXKC 2J7ZA 2F0DA 3PIP3 3AMUA 1EY5A 2LMCB 4XXEA 1EY6A 3MXUA 3DEOA 4NDXA 5ELCA 2R61A 5JVG3 2L9HA 1KLUD 1H9SB 4XYOA 5FLXL 4ZQ3A 1NAPA 5T1GA 2PPBC 3J81L 2WV6D 3HRZC 5C5MA 1BBXC 2KEEA 3MA2B 1Z6HA 2EYPA 1EIGA 2CQAA 4RGTA 5KYLA 1EYDA 3NQIA 4IURA 1SE4A 1WTPA 2HDLA 1EIHA 5D3DA 5DM63 5A2QL 1G2TA 3IFTA 1D2BA 2PQEA 2QF7A 4IUVA 3I73A 3S9WA 3M7GA 5HURA 3PUYA 1SBBB 1ZEQX 1BUVT 2EJGC 3DWPA 4H0LC 1RTNA 3SDZA 4A3GB 5IGGA 1MSGA 4CBVA 1JB3A 3M85A 2IWHA 4WJWA 1A3VA 3E0JA 3ONAB 5J22A 2M2LA 3VR6A 3TP8A 3HKZB 3D6CA 2FJ2A 2KA7A 3T4AC 3PUVA 3OMCA 1VF7A 3NSWA 4DFAA 1TS3A 1B4OA 2GA4B 2O4XA 3S14B 4RHRA 4A3FB 2A6EC 1MD2D 4O42A 5TSSA 3AU7A 1YNND 5IGEA 4ZRZA 1ET6A 1AEXA 3PV0A 2VB3X 2SOBA 3I72A 5M5YB 1CI3M 3H94A 3N6RA 4C56C 5KNBA 1FD7D 1EU3A 1K8MA 1STHA 5I9OA 4CKBA 3EJIA 3GO5A 5DAUA 5KNCA 3C3LA 1OXXK 2XRSD 5ISRA 1SXTA 2WP8J 1I3QB 2V4DA 3BVZA 1STGA 3VYSA 2WIIB 5C4XB 2KUMA 1VMPA 1JR0D 2A6ED 3D4RA 1QWYA 1Z7TA 2TSSA 4DA2A 4FF1A 4LMQD 1BCPC 4HCEA 1F2ZA 1Q1EA 1BOSA 4DAYA 4FO2A 3K5NA 2QCPX 3L7ZC 3O13A 1IHZA 5AFWA 4HEDA 2PZUA 4CHTB 4G7ZC 5A35A 1YNJD 3IL8A 3I4MB 3JAME 1MGSA 1U4MA 2SNMA 3Q24A 3C1FA 1MSHA 3VYUA 1D1KA 1C8CA 4U68A 5LL6X 5CV6A 5CC4A 4K6DA 1CA5A 3M7NA 1BCPD 2N55A 2F0OA 1IYUA 3HOZB 4N9TA 1STYA 1HUNA 4IUUA 1V1OA 2F0VA 4KHVA 1RCVD 4XDXA 2E75C 5C4JB 2A5HA 1CM9A 4KD3A 3I70A 2AWNA 2RDHA 1GJXA 2BCOA 3FRPB 4OL7A 2FINB 2K05A 2K04A 1SJED 4XYQA 3NK9A 1EY4A 1S4ZA 1R4QB 2K5QA 3MAQA 1SNPA 2PW7A 4R8IA 4K5XA 2DY8A 4NMZA 2Z1CA 5I2YA 3MWYW 1DCZA 3MXGA 1U4PA 4KI0A 4YIJA 4IFDG 5DM73 3VR4A 1PRTB 3WOFA 1AZPA 1S5ED 2EYFA 3GTLB 1B9NA 3TN2A 1LTBD 2BE5C 1XX8A 1PDQA 3N52A 3M4YA 1T5EA 4Q0FA 2R7ZB 2EY5A 2WKDA 2RDGA 5G3LD 3D4DA 4ULLA 3OIQA 1CA6A 3T53B 4LJZC 2K03A 1PZJD 4RGNA 4C3JG 2F0TA 3E5SA 2F3VA 3NWSA 4I65A 1EYAA 3S1MB 1HA5A 2F03A 2JYOA 4HR7B 3GTKB 4RWSC 2IX1A 4QUFA 1DOLA 4PMCA 1KTKA 3U9SA 1DOKA 4FXGC 3GD7A 1TY2A 1W6JA 3I8ZA 1JE4A 2DNEA 3MVVA 4IFDJ 3I90A 4IFDI 3DMUA 5C6AA 1TIID 1Q8IA 3PUXA 5EGTA 2KCNA 1LTID 1XYIA 1B1ZA 3K6OA 3AB9A 2IPKD 5EPJA 3V96A 1V8QA 2Q8RE 3NUCA 1TWCB 1RJTA 3RUZA 4FP5D 2JXMB 4KY5A 2H1EA 4J1MA 5EBCA 4V190 2EXZA 5ELDA 3FPUB 1HXYD 1LV9A 1LTTD 1D5MC 2Z4IA 1I50B 1IL8A 1HPCA 4DK1A 2A74C 1HTLD 1B9MA 1T5XD 2CVRA 1R9TB 3OSOA 2XN9C 3MFYA 3TMEA 2BA1A 2HUGA 1VF5C 1Y69U 3KF8A 2K5DA 4KY7A 4I7ZC 1SNDA 1FR3A 1DOMA 2BA0A 3S1NB 5C44B 2NBFA 1QJOA 2RDFA 1JOQA 4OHJA 1JOOA 4DNTB 5ELEA 4IFDH 4PMWA 2PW5A 1O80A 5JJZA 2K32A 1G291 3PUWA 2NZ1D 1SNQA 4CKEA 3DWQA 5E1FA 3URYA 1FYCA 3FVQA 2NWGA 4EQOA 3W2DA 5EPKA 1JWSD 2EYMA 1KDBA 1TVXA 3MXNA 3TZUA 4PNYA 2F0FA 1J8IA 1XWEA 4K6LA 2VUMB 5FO9B 1GUOA 4DAVA 5CV4A 1JWMD 2FFKB 1RTOA 4LK1C 3WDNA 2JA8B 3NWTA 3PMFA 2R92B 1PRTC 3QWNA 4RKBA 2Q8TA 1Y1VB 4G4KA 1EEID 4RA8A 4QB4A 1CTMA 3NE5B 3M3YB 2AQ1B 2F0GA 2QKIC 4K8JA 4KN4C 4FNFA 2JA6B 3G7LA 4RCNA 3HEJA 2ZXPA 1I6VC 1JQYD 2JA7B 1TS5A 2EYHA 1SSOA 1TKWB 3FKIB 1GUGA 2MJ8A 1HQMC 4FXDA 4KJOA 4Z9CB 3NBIA 4RGMA 1F9SA 2JE6I 4A3JB 2IT1A 1GUSA 1TS2A 4QIWB 1PRTD 2NB0A 1A2UA 1DYQA 2L0CA 1EQVA 3K5OA 1U4RA 3SHLA 4ID6A 1EWHA 2EY1A 2KQ3A 5A2QE 2X69A 1RHPA 3IAYA 2NVTB 5D65A 5LL6S 2KHSA 4LAAA 3HS0C 3GTPB 4M1UB 3BDLA 3OOCA 1A3TA 2F0HA 2EY2A 2G9DA 3RZOB 1SYCA 2R3ZA 2SNSA 1X3PA 4Q5VA 2B39A 4TQUS 2AUJD 2L55A 5JOBA 1L0XB 1Q1BA 3OW7A 2SDFA 1SNOA 1EQTA 5KNDA 2RKSA 2FHTA 1NR4A 3OPOA 4BA2I 2K01A 1F9QA 1UEAB 2OXPA 5D14A 5EKLA 3LNNA 2F0WA 3KLRA 3I4NB 1GHJA 3QJYA 3QOLA 2B2TA 4DN4M 4QF4A 2OF1A 3J7AV 1X3QA 5JEAH 1B53A 1WVLA 4RGOS 4G57A 1JC7A 2I07B 3DWAA 4ZKBB 1WTQA 3PO2B 3LX0A 5CGKA 1LACA 4B9WA 1SYBA 3U9OA 3BDCA 1F2MA 3VYTA 3J80L 1VMCA 2KEDA 2EY6A 1GUWA 1S5FD 1DONA 1I4QA 3KLSA 4WFN3 2XVSA 1LT3D 5KYIA 3NP8A 3A55A 3NTIA 2L12A 3QG1A 4K8IA 2IX0A 3Q6SA 2E2HB 4P2CB 5K5PA 2EJMA 1KABA 4XQJA 5JPNC 4RFBA 3SXHA 1Y8PB 1LO5D 5ELFA 1EY7A 2KJXA 5M9OA 3BS1A 1PTOB 1NCVA 1BCPF 3VR2A 4H44C 2D5DA 2EJFC 1IKMA 5JAVA 3I3CA 2F0SA 1LT5D 5EKKA 1EWCA 1PXUA 2IX3A 3PUZA 1QOHA 4QCLA 3FEWX 3S16B 3TP6A 2MGSA 5I6WA 1OXTA 3F2UA 4DGZA 2Y0SB 2VNUD 2EZVA 1F9PA 2AWOA 5DNFA 2EYJA 1Z47A 2IW3A 1STEA 5BN5A 3SK4A 1HHVA 2E74C 4IUNA 3CRKC 4C3IG 1EU4A 1ILPA 3EQLC 1I4GA 1I4RA 2IJ0A 5IT9L 4CJ1B 2RSOA 4IUTA 4C1NI 4L63B 5JVH3 2PZWA 1M4VA 1G91A 3QOJA 1XTCD 3TDQA 1K8OA 3GV3A 1STBA 2WAQB 5C3XA 3GV6A 4KJNA 3LWUA 4PV1C 1G2SA 3BG3A 3EVQA 4UAIA 5NUCA 3S2HB 1EFID 3R2IA 4C2MB 4HAEA 2A73B 3ND8A 3EFXD 3H3VC 1CK1A 1OXSC 4A93B 4V0BA 4KN7C 1I4HA 1S5BD 1CQFA 1EY8A 3DHQA 3G6JB 4DU9A 1UNSA 4CJ0B 1FNUA 3HOWB 2B8GA 4BBSB 1EYCA 2XWBB 5EBDA 3C46A 4BS9A 2B2YA 3ZYYX 3P7JA 3H0GB 4TRDA 3K0YA 1LTAD 4X3SA 1Q3LA 4E6IA 4X3KA 1U4LA 1O7YA 2B2WA 4ODGA 5KRUA 2DN8A 3NTKA 2AQ2B 1TWGB 4B9XA 3NPPA 1QNUA 3GTJB 2J0TD 1ICWA 1PYWD 2PZTA 3W3AA 1DXMA 4PQXA 4BY7B 4F8MA 1FNVA 3QO2A 1STNA 2H4OA 2PMZB 3IFDA 1EZ6A 3A8KE 4DNRB 1FNWA 2ICEC 5J1ZA 1QE6A 1GHKA 1O7LA 5IGCA 4EQNA 1PTOC 2D9UA 2E76C 5CYUA 1S5DD 4XTCS 1TY0A 1I4XA 2NVQB 2BE5D 1LTRD 4BBRB 2QDBA 2ENBA 3UI2A 1SYGA 1RDPD 2JSOA 1Y8OB 4EVOA 3NXWA 4KKTA 2F0IA 1VCIA 5CMDA 1ENAA 3CU7A 1CFMA 1E2ZA 3OWFA 3SK8A 1NSNS 1I4PA 3FPPA 2I46A 2HDMA 3OWEB 2VB2X 5M5WB 4FVMA 1CZGA 1QB5D 3EROA 2L4NA 4BY1B 3C2PA 1AN8A 1WCMB 2EDGA 2F3WA 3OHXC 4MN3A 1QILA 1PTOD 2PYKA 5IIFA 3RZDB 4ILWA 3A8JE 1ENFA 1V1PA 5D3IB 4A3MB 4A3IB 2BDNA 2F0PA 1GUNA 1J9OA 2G9HD 3HOUB 5HGTA 1SMYC 3TP7A 2WINB 4Y7NB 4KHZA 5T1IA 1PZID 1TU2B 2CW0C 3T51B 1K83B 1ZYRC 1PFNA 2CHBD 4RKLA 2JEAI 1EL0A 2JA5B 4RHSA 1LTGD 3X3MA 1CZWA 3OMGA 2B2YC 4XT1B 1VDZA 3P75A 1PRTF 4H7BA 3OIPA 4JBWA 2ICIA 1E2WA 2F1MA 4OO1G 4R8NA 3L9AX 5IOCA 1SMYD 5FK9C 3I4LA 2F0UA 4F7XA 1UAPA 3K59A 1B44D 4ZYSA 1KLGD 1ZYRD 3MXPA 3T16A 1DD2A 4MIUA 4K5WA 5KEEA 2L1BA 2QILA 2X6GA 1XXGA 2B63B 1HFNA 3VYRA 5IGDA 2L11A 4PMBA 3LWEA 1C4QA 3SR1A 3GP7A 1BNZA 1TQOA 4WRDA 4X3UA 1EZ8A 1WTRA 4KD4A 2EYLA 1RF2D 2A69C 3SE0A 5FO8B 2M9VA 1A15A 3TSSA 3NQTA 1V43A 5BN3A 4B08A 4DF7A 2KECA 4J8QA 2RA4A 1WD1A 4KKUA 1HQRD 3BYTB 1AW7A 5CV5A 2ID0A 3PO3B 3VA5A 2OEOA 2LFNA 3V2TA 1SFOB 5FLXE 3SK6A 1BXTA 3J81E 5KIXA 4OO1I 2VXWA 1UUPA 2C9OA 1TWFB 1SAPA 5I2XA 3CQZB 1O78A 4F88A 4BA1I 1F2LA 1W6KA 3ITPA 4G7OC 3M4OB 1BO0A 4G7HC 4KMUC 2E2JB 2ZXRA 2RQXA 1IW7C 2LKVA 1EOTA 2E2IB 1SYEA 3DXJC 5I6YA 3FDTA 3J80E 2XIWA 3R3OA 1D5ZC 4QMGA 1HTPA 3KUPA 1G6ZA 2EE1A 2XRQD 5CR3A 4J6HA 5C5LA 1OXVA 2PNRC 2K6AA 4ZUIA 2RVLA 1HCZA 3MHBA 4HMJA 2X6LA 2OT2A 5JPMC 5E4WC 2WKCA 4HMIA 2NN6G 4KKSA 3WOEA 1KNEA 3IKJA 4OO1H 4C1NK 3VR3A 3HG9A 1IW7D 4C3JB 1SNMA 3BDOA 3R2TA 1H9MA 1JICA 2F4IA 4KTAA 3H91A 4XQNA 1X32A 2JP1A 1DZ1A 2FMCA 1KDAA 4HTHA 5J39A 1YNNC 1QNKA 2R6GA 2LY7A 1H9SA 2YU9B 4RH6A 5E3FA 5BN4A 3NBHA 1H9RA 3QIAA 5COYA 2K33A 4C3HB 3TZDA 3ERQA 3K7AB 2A6HC 1IYVA 2HCIA 1Y8NB 1D5XC 3MFGA 3GQBA 5CBEE 2F0LA 4M8AA 5C0XG 1SYFA 4FF3A 2NVYB 3HZXA 5FOBB 5FO7B 3K58A 3P1HA 3A54A 3GTGB 5K36G 5IT9E 1SYDA 3SVMA 3D31A 2O5JC 3E6ZX 5CV8A 3EA6A 1SE2A 2NN6I 3BYYB 4NW2A 2MUYA 4U673 3RLFA 4IQZA 4L8JA 1HRJA 4A3KB 1ZXTA 4CJ2C 1HFGA 3MZ5A 1GUTA 2QEJC 4KV6A 2C5CA 2A6HD 4ME5A 5DEHA 1HA6A 1JWUD 5M5XB 1YNJC 4OIJA 3TP5A 2RBMA 4ZK9B 3GTQB 2FMMA 3A7LA 2F0EA 1S5CD 1D1IA 1CHPD 1O7ZA 1KNAA 2BDOA 2AQ3B 1NR2A 2EPBA 2K28A 4L6TB 4EQPA 1EEFD 4FF2A 1CHQD 1Q12A 1ML0D 2E2DC 2XWJB 3K57A 1RODA 4ZAIA 2Q8IB 2N88A 5C0XJ 5G3LF 5IGFA 4X3TA 2WACA 5C0XI 1KDCA 2B2VA 2K1BA 3Q23A 3K5MA 3S1QB 1BDOA 3KK7A 1F9RA 2NN6H 2B2TC 3K5LA 3C1EA 2TMPA 3A7AB 1E2VA 3HOYB 4N9PA 3X3NA 3J7AF 1BQQT 5C3WA 2JEBI 3V05A 4BWGB 2HCCA 3R8BA 4ZKCB 2B8FA 2NUCA 1WTOA 1RKNA 3QB3A 4KY6A 2HQEA 4OGQC 4XT3B 3ND9A 2Z8LA 4EGVA 1JCKB 2AUKA 3L3OC 2NYZD 3T13A 3GTOB 2MPMA 3DM1A 1R4PB 1QG7A 1LTSD 3S1RB 2XNAC 2EVBA 1H9KA 2PO4A 2KCCA 4F87A 3JAML 2IL8A 1GXDC 5C0XH 3RD4A 5E4XA 1PTOF 4XIGS 4O1NA 1I6HB 4DAPA 5I4DA 5K36H 4A3BB 1STAA 4KK7A 2R93B 5I9PA 3D3RA 2K7VA 4DXGA 4NP5A 4K2LA 5EPLA 2EYOA 2D62A 1SEBD 5FKAC 4JK1C 2SEBD 1CT1D 1SJHD 3DEPA 3BZDB 3RMHA 4XQQA 3VA7A 2EOTA 4UDUC 4IZ8A 3S17B 2D2CC 5ELBA 5EKIA 1AFPA 1A3UA 1TWHB 2NTSA 4DXFA 4TKOB 3H6MA 5KGUA 5CBAE 4A3EB 1Q90A 4FYDA 2ZXOA 5C4HA 1KAAA 2DY7A 4ZUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2U C;  1X3Q A;  2X6G A;  1LV9 A;  2B2Y A;  4IUP A;  3KUP A;  1B53 A;  3P7J A;  1WVL A;  4OIK A;  4ZKC B;  1G6Z A;  1HFN A;  3ONA B;  4MN3 A;  2EE1 A;  1IL8 A;  3IL8 A;  2M2L A;  4NW2 A;  4X3S A;  1WTO A;  2L11 A;  1Q3L A;  1WD0 A;  3LWE A;  2FJ2 A;  4ZKB B;  1WTQ A;  1HRJ A;  1SSO A;  1HHV A;  1CA6 A;  1MGS A;  1B3A A;  4XT3 B;  1ESR A;  2K03 A;  1U4M A;  1ZXT A;  4X3K A;  1U4L A;  2CVR A;  2RVL A;  4CJ2 C;  1HFG A;  1O7Y A;  2B2W A;  2MJ8 A;  1MSH A;  2X6L A;  1BNZ A;  2HUG A;  1BF4 A;  1C8C A;  1B4O A;  4U68 A;  5E4W C;  1F9S A;  3I91 A;  3R93 A;  4X3U A;  4MHE A;  2BDN A;  1WTR A;  1B2T A;  2NYZ D;  1VMC A;  1KNE A;  1ILP A;  1J9O A;  2KED A;  1B50 A;  1DOM A;  1E0B A;  3HP3 A;  1AZQ A;  1CA5 A;  4O42 A;  1GUW A;  1A15 A;  2MPM A;  3KBX A;  3DM1 A;  4CJ1 B;  1HA6 A;  1QG7 A;  2N55 A;  1ICW A;  2B2V C;  1PFB A;  2RSO A;  1DON A;  4R9W A;  4IUT A;  5EJW A;  1WTW A;  4QUC A;  1SDF A;  2KEC A;  1WD1 A;  2RA4 A;  4IUU A;  4OIJ A;  1HUN A;  2J7Z A;  2JYO A;  5T1I A;  1O80 A;  4ZK9 B;  5JJZ A;  1ILQ A;  2FMM A;  1G91 A;  1PLF A;  4RWS C;  2IL8 A;  2L12 A;  1JIC A;  1U4R A;  4XDX A;  1CM9 A;  2NZ1 D;  2KOL A;  3Q6S A;  2B2U A;  3H91 A;  3DEO A;  1O7Z A;  1PFN A;  1KNA A;  5E4X A;  1DOL A;  4QUF A;  1X32 A;  1NR2 A;  2EPB A;  2JP1 A;  2K28 A;  2L9H A;  2NWG A;  3GV3 A;  3QO2 A;  1WTV A;  1DZ1 A;  2MP1 A;  2X69 A;  1RHP A;  4HCS A;  3IFD A;  1DOK A;  5EPK A;  1EL0 A;  2FIN B;  5D65 A;  1NAP A;  2K05 A;  2K04 A;  1TVX A;  3GV6 A;  1ML0 D;  5T1G A;  1J8I A;  1G2S A;  2VXW A;  4UAI A;  1QNK A;  1QE6 A;  3I8Z A;  1JE4 A;  1BBX C;  1S4Z A;  1ROD A;  2D9U A;  2KEE A;  4ZLT F;  4XT1 B;  2B2Y C;  2KVM A;  5EPL A;  3I90 A;  4IUQ A;  2RSN A;  4HAE A;  3MTS A;  1EIG A;  4ZAI A;  2FFK B;  1RTO A;  2N88 A;  1NCV A;  1SAP A;  4R8I A;  2R3Z A;  4X3T A;  2DY8 A;  5COY A;  4IUR A;  2KUM A;  3UI2 A;  1VMP A;  1M8A A;  1X3P A;  3TZD A;  3I3C A;  1IKM A;  3MWY W;  2B2V A;  1WTP A;  2HDL A;  2K1B A;  1EIH A;  1XYI A;  3DEP A;  3D6W A;  1F2L A;  2SDF A;  1EQT A;  4RAU C;  2EOT A;  2HCI A;  4HSV A;  5EPJ A;  1U4P A;  1F9R A;  1BO0 A;  2B2T C;  1G2T A;  5CMD A;  2Q8T A;  2FHT A;  2Q8R E;  4LMQ D;  5EQ0 A;  5EKI A;  1NR4 A;  4RA8 A;  1PFM A;  2L4N A;  5COR A;  1RJT A;  2K01 A;  1F9Q A;  4IUV A;  1MI2 A;  5CBE E;  1AZP A;  1HUM A;  2MGS A;  1AP0 A;  2H1E A;  5D14 A;  4CJ0 B;  1EOT A;  3F2U A;  3TN2 A;  5CBA E;  1XX8 A;  2HDM A;  1PDQ A;  3N52 A;  3FDT A;  2B2T A;  1RTN A;  4DN4 M;  1WTX A;  1F9P A;  5AFW A;  2XIW A;  3FPU B;  4HED A;  1IKL A;  1MSG A;  3G7L A;  2HCC A;  2DY7 A;  3SVM A;  5DNF A;  2B2W C;  2L1B A; 
#chains in the Genus database with same CATH topology
 1H9J A;  3KLS X;  4C3I H;  4OIK A;  5C3E B;  4LFC Q;  1V1P B;  1YNX A;  4DR2 Q;  1PA6 A;  1C48 A;  2PCF B;  2J4X A;  1KXL A;  1NUC A;  2R92 H;  4IJH A;  2F0K A;  1HNX L;  1Y1V H;  1PH4 A;  3RLO A;  4JI4 Q;  1XTD A;  2DNC A;  5M3F B;  2MHV A;  4HIK A;  3S15 B;  4DR1 Q;  2NVX B;  4S3S A;  4C3H G;  1E0B A;  2K4K A;  3HP3 A;  1AZQ A;  3M3Y H;  2OQK A;  1PMR A;  2B2V C;  1PFB A;  4R9W A;  4GN5 A;  2UXB Q;  4QUC A;  4JI0 L;  3HOX H;  1TT2 A;  3SK5 A;  3CHB D;  2JA6 H;  5F2D A;  1ILQ A;  1DM0 B;  2OTJ A;  3MC0 B;  1PLF A;  1QCB D;  1OXU A;  4UY8 C;  4LF8 L;  3H3V I;  2O2L D;  3CCM A;  2B2U A;  4RCO A;  2F0Q A;  1EY0 A;  5M3M H;  2JA7 H;  3KBG A;  4HCS A;  4PZ6 A;  1SE3 A;  2A19 A;  3CC7 A;  1F77 A;  2XSC A;  5LHY 1;  4LF9 L;  3MEH A;  4R4I A;  1PZK D;  4OEL B;  5C4Z A;  4A3J H;  4WOR A;  3F2C A;  2A68 C;  3MTS A;  1AE2 A;  1L1O C;  1ESF A;  4A3D H;  4P73 A;  1M8A A;  2ZT9 C;  4GOP B;  4HN7 A;  3B6Y A;  2Y0S G;  3D6W A;  4HSV A;  1DJR D;  2QDL A;  3TBI B;  3DUZ A;  5EQ0 A;  1B8A A;  2LS0 1;  1I94 L;  5IOD A;  5COR A;  1HZA A;  1YIJ A;  4TVA B;  2R7D A;  1HUM A;  4HIM A;  3CKI B;  1U9R A;  2M00 A;  4JI2 L;  4WJ3 M;  2NVT H;  1M1K C;  3PIO 3;  1CSP A;  4LFB L;  1LM0 A;  4JI8 L;  1QVF A;  3GTP H;  3HGB A;  3HOV B;  1WTX A;  4ABN A;  2JK8 A;  2E5L L;  1GOZ A;  1LT4 D;  3WWV A;  1VQI A;  5IGB A;  1IKL A;  1X9N A;  2B2W C;  4DK0 A;  4IUP A;  1SNC A;  2QGQ A;  3RZO H;  3A0J A;  4K0K Q;  2RCN A;  1CKM A;  1LT6 D;  2A68 D;  3T1Y L;  4LW1 A;  3PF5 A;  1ESR A;  2CW0 D;  1FGB D;  4UP8 A;  3GTM B;  4H13 C;  3L2P A;  1VQO A;  1K8G A;  3I91 A;  5JEA G;  4MHE A;  2Z4H A;  5DLQ E;  3PIO A;  1JOR A;  4QY7 A;  1ET9 A;  1PYB A;  2F0M A;  3KBX A;  4CKC A;  3I4N H;  2Y0S E;  4LF4 L;  5EJW A;  2WAQ G;  1WTW A;  1SDF A;  1LYL A;  5FLX c;  3I2Z A;  4C3I B;  5CV7 A;  2LXJ A;  1Y1W B;  3H09 A;  5LMN W;  2KOL A;  1ENC A;  3J81 c;  3S24 A;  1A6X A;  1NNX A;  1A2T A;  1II3 A;  1WTV A;  2MP1 A;  3P20 A;  1MBY A;  4CGY B;  3PO2 H;  1LAB A;  4R1J A;  2K5W A;  4DV4 L;  4GZY C;  4LF6 L;  4JYA Q;  1L0Y B;  2YYZ A;  2F0N A;  2NZO A;  2F0J A;  2K5V A;  4NKL A;  1VQ5 A;  4IN3 A;  3BVM A;  4ZLT F;  3J7Y W;  1IBK Q;  2KVM A;  3D4W A;  1BR9 A;  2WB1 B;  4IUQ A;  2VL6 A;  1ONL A;  2RSN A;  1KC8 C;  2A8V A;  1CQV A;  1XPU A;  1JOK A;  4EX5 A;  1ZKO A;  3HOX B;  4IAL A;  4AIM A;  1TR5 A;  4FF4 A;  2O5I C;  3A56 A;  3VR5 A;  3HOW G;  4BBS G;  4RAU C;  4TSS A;  3E3X A;  2E2H H;  3I4O A;  5M3M B;  4DR7 L;  1PFM A;  3A8I E;  3D8G A;  1OO9 B;  1MI2 A;  5AJ3 Q;  1EWI A;  5IP7 H;  1C9O A;  1AP0 A;  1BCP B;  2WAQ E;  3H0G G;  1KIX A;  5ELN A;  5LMU L;  5JJI A;  4A3F H;  3T56 B;  3Q22 A;  2BOS A;  1TWA B;  3Q0A A;  3NHH A;  1UEB A;  1D6E C;  2DJG C;  2A69 D;  5JEA J;  1YJN A;  2B2U C;  4DV5 Q;  5CV9 A;  1XMQ L;  1PTO H;  4A3D B;  1TS4 A;  3S2D B;  1FL0 A;  1WD0 A;  4DR6 L;  1G8Z D;  2Z6B A;  3BVG A;  3CRL C;  3FMC A;  2L5T A;  3NTH A;  1B3A A;  3BZC A;  3SEB A;  1XJV A;  4HSP A;  4GKJ Q;  4K14 A;  1RD9 D;  3G71 A;  4GLX A;  1BF4 A;  4K5V A;  3R93 A;  4BY7 G;  2NTT A;  4QGU A;  4LF7 Q;  4P75 A;  1LLR D;  1B2T A;  1YHA A;  1F2Y A;  4AYB B;  1A0I A;  1B50 A;  4BXX G;  2CH4 W;  4K2K A;  1EY9 A;  4FXK C;  1N33 Q;  1T9H A;  5C4X H;  3FP9 A;  2J7Z A;  2F0D A;  3PIP 3;  4DV6 Q;  3AMU A;  1U0L A;  1EY5 A;  2LMC B;  4XXE A;  4A3L G;  1EY6 A;  3MXU A;  4P72 A;  3DEO A;  4NDX A;  5ELC A;  2R61 A;  4GN3 B;  5JVG 3;  1IBL Q;  2L9H A;  1EFW A;  1WFQ A;  1C7Y A;  1KLU D;  1H9S B;  4XYO A;  4A3E G;  5FLX L;  4BBR G;  4ZQ3 A;  1NAP A;  5T1G A;  2PPB C;  3NBH B;  1D8L A;  3J81 L;  2WV6 D;  2QW7 A;  3HRZ C;  5C5M A;  1BBX C;  2KEE A;  3MA2 B;  4YWL A;  1Z6H A;  2EYP A;  1EIG A;  2CQA A;  3I56 A;  4RGT A;  4NXM L;  5KYL A;  1EIF A;  4GOP C;  1EYD A;  3NQI A;  4IUR A;  3ER0 A;  5HGQ A;  1SE4 A;  3PIP A;  1YI2 A;  1WTP A;  2HDL A;  1EIH A;  1HNW L;  5D3D A;  1X56 A;  5DM6 3;  5A2Q L;  1G2T A;  3IFT A;  4MNO A;  1D2B A;  2PQE A;  2AKW B;  1IXR A;  2QF7 A;  4IUV A;  3I73 A;  3S9W A;  2PMZ E;  3M7G A;  5HUR A;  4DUY L;  3PUY A;  4AQY L;  1SBB B;  5HY6 A;  1ZEQ X;  1BUV T;  2EJG C;  3DWP A;  4H0L C;  1RTN A;  3SDZ A;  1BBW A;  3CCJ A;  4A3G B;  4B3S L;  5IGG A;  1MSG A;  4C2M H;  4CBV A;  4JI7 L;  1JB3 A;  3M85 A;  4A3M G;  2IWH A;  4WJW A;  4A3I G;  1A3V A;  3E0J A;  3ONA B;  5J22 A;  2M2L A;  3VR6 A;  3TP8 A;  3HKZ B;  3D6C A;  2FJ2 A;  2KA7 A;  4A93 H;  1CUK A;  3T4A C;  4HID A;  3PUV A;  3CCQ A;  4JI6 Q;  3JAM i;  3OMC A;  4JCV E;  1FJG Q;  2UXC L;  1VF7 A;  3NSW A;  2XGT A;  2GN5 A;  4KLK A;  4DFA A;  1TS3 A;  1B4O A;  2GA4 B;  4A76 A;  2O4X A;  3S14 B;  4RHR A;  1VQ4 A;  4B3R L;  1IBM Q;  4A3F B;  1J6Q A;  2A6E C;  1MD2 D;  4ME3 A;  1L2F A;  4O42 A;  5TSS A;  3AU7 A;  1E1O A;  4GNX B;  1YNN D;  3HOW H;  5IGE A;  1N36 L;  4ZRZ A;  1ET6 A;  2ZTE A;  2JA5 G;  1AEX A;  3PV0 A;  2VB3 X;  2SOB A;  3I72 A;  5M5Y B;  2VQE Q;  1CI3 M;  3H94 A;  2YTX A;  3H0G H;  3N6R A;  2PI2 A;  4C56 C;  5KNB A;  1FD7 D;  1EU3 A;  4DR4 L;  1K8M A;  1STH A;  2CWP A;  5I9O A;  4CKB A;  3EJI A;  1PYS B;  3GO5 A;  5DAU A;  5KNC A;  4LUV A;  1OXX K;  3C3L A;  1O7I A;  4FDB A;  3CW2 C;  1VQD A;  2XRS D;  1JJ2 A;  5ISR A;  1SXT A;  2WP8 J;  4MTK A;  1I3Q B;  2V4D A;  1YVC A;  3BVZ A;  4DV3 Q;  1TWG H;  4DV1 L;  1STG A;  3VYS A;  4GNX A;  2WII B;  3GTJ H;  3W1G A;  5C4X B;  2KUM A;  1VMP A;  1JR0 D;  4L5Q A;  2A6E D;  3D4R A;  4OON A;  1QWY A;  1Z7T A;  2TSS A;  2MQH A;  4DA2 A;  4FF1 A;  1HZ9 A;  4LMQ D;  4DV2 Q;  1BCP C;  5L37 A;  4BXX H;  1UE1 A;  4HCE A;  1F2Z A;  2UXD L;  1Q1E A;  1BOS A;  4DAY A;  4FO2 A;  3K5N A;  2QCP X;  1YJ9 A;  3L7Z C;  4O2D A;  3O13 A;  1IHZ A;  4N8F A;  3PGZ A;  5AFW A;  1VQN A;  4A3L H;  1D7Q A;  4HED A;  1HNZ Q;  2IHF A;  3GTK H;  1XPR A;  2VY3 A;  3G48 A;  5LMN Q;  2PZU A;  4CHT B;  4G7Z C;  1OTC A;  2NVQ H;  5A35 A;  4BBR H;  1YNJ D;  3IL8 A;  3I4M B;  1GVP A;  3JAM E;  4B3T Q;  1MGS A;  2QA4 A;  1J5E Q;  1U4M A;  2SNM A;  3Q24 A;  3C1F A;  1MSH A;  3VYU A;  1D1K A;  1C8C A;  4U68 A;  5LL6 X;  5CV6 A;  5CC4 A;  3PO3 G;  2NZH A;  1SRU A;  2UUA L;  4K6D A;  1CA5 A;  3M7N A;  1BCP D;  2ZM6 L;  2F4V Q;  2N55 A;  3CD6 A;  2F0O A;  4CDE C;  1IYU A;  3HOZ B;  4N9T A;  1STY A;  1HUN A;  4IUU A;  1V1O A;  2F0V A;  4KHV A;  5M5W H;  1XNR Q;  1RCV D;  4BY1 H;  4MZ9 A;  4XDX A;  2E75 C;  5C4J B;  2A5H A;  1YJW A;  1CM9 A;  4DUZ L;  1WCM H;  4KD3 A;  1YBY A;  3I70 A;  2AWN A;  3AQQ A;  2RDH A;  2OCE A;  4DAM A;  1GJX A;  2BCO A;  1TWC H;  1NJI C;  3FRP B;  4OL7 A;  3RZD H;  2FIN B;  3PCO B;  2K05 A;  2K04 A;  1SJE D;  1N32 Q;  4XYQ A;  1NTG A;  4A3M H;  4A3I H;  3NK9 A;  1EY4 A;  1K28 A;  1R4Q B;  1S4Z A;  2K5Q A;  3MAQ A;  3PQI A;  1SNP A;  3U4Z A;  2PW7 A;  4R8I A;  3HOU H;  4K5X A;  2DY8 A;  4NMZ A;  1I50 H;  2Z1C A;  5I2Y A;  3MWY W;  3T1H Q;  1Z9F A;  3U58 A;  1DCZ A;  3MXG A;  1IL2 A;  1U4P A;  4KI0 A;  4YIJ A;  4IFD G;  5DM7 3;  3VR4 A;  1PRT B;  2K5H A;  3WOF A;  1AZP A;  1XNQ L;  1S5E D;  2EYF A;  1PH5 A;  3GTL B;  1B9N A;  5GRO A;  2Q2H A;  3TN2 A;  1LTB D;  2JA5 H;  2JJQ A;  2BE5 C;  1XX8 A;  1PDQ A;  3N52 A;  3M4Y A;  4DV7 Q;  1T5E A;  4Q0F A;  2R7Z B;  2UU9 L;  4DR5 Q;  2KBN A;  2EY5 A;  2WKD A;  2RDG A;  1VQG A;  5G3L D;  3D4D A;  1B70 B;  3BZK A;  4ULL A;  3OIQ A;  4X62 Q;  1KAW A;  2VQF Q;  1CA6 A;  3T53 B;  4LJZ C;  2K03 A;  1PZJ D;  4RGN A;  4C3J G;  3PF4 A;  4LFC L;  2F0T A;  3AYH B;  3E5S A;  2F3V A;  4DR2 L;  3CC2 A;  4GNX C;  3NWS A;  4I65 A;  1MJC A;  1EYA A;  3S1M B;  2JA8 H;  1HA5 A;  4JI4 L;  4X65 Q;  2F03 A;  4QJF A;  2JYO A;  2WFW A;  4HR7 B;  3GTK B;  3W5O A;  4DR1 L;  4RWS C;  2IX1 A;  2L15 A;  2B63 H;  5IE8 A;  4QUF A;  1DOL A;  4LWC A;  2UXB L;  4PMC A;  1KTK A;  3A74 A;  2RCF A;  3U9S A;  1DOK A;  2OTL A;  3BJU A;  4FXG C;  3UDF A;  3GD7 A;  2K52 A;  1SMX A;  1TY2 A;  1W6J A;  3I8Z A;  1JE4 A;  4LUO A;  2DNE A;  4DPG A;  3MVV A;  4IFD J;  1SLJ A;  3I90 A;  2K14 A;  4IFD I;  1HZB A;  3DMU A;  1B7Y B;  5C6A A;  1TII D;  1Q8I A;  3PUX A;  5EGT A;  4CDC C;  2KCN A;  3F2B A;  3STB C;  4DKA C;  1EQQ A;  1LTI D;  1XYI A;  1B1Z A;  3K6O A;  1SN8 A;  3AB9 A;  2IPK D;  5EPJ A;  4JBJ A;  3FKI H;  3V96 A;  4GKK Q;  1CKO A;  1V8Q A;  2Q8R E;  3ICE A;  1JE5 A;  3NUC A;  1E1T A;  1TWC B;  1SFO H;  1RJT A;  1VQA A;  2KHJ A;  3RUZ A;  3KF8 B;  2JXM B;  4FP5 D;  4KY5 A;  4YCU A;  2H1E A;  4J1M A;  4LNQ A;  5EBC A;  2YTV A;  4V19 0;  2EXZ A;  3U50 C;  5FJ8 G;  4JI0 Q;  5ELD A;  1GD7 A;  4A3K G;  3FPU B;  1MKH A;  2I5H A;  1G51 A;  1HXY D;  1TWF H;  1LV9 A;  1LTT D;  1D5M C;  2Z4I A;  1K9M C;  1I50 B;  2N78 A;  1IL8 A;  1HPC A;  4DK1 A;  2A74 C;  3E0E A;  1HTL D;  1B9M A;  4RMF A;  1T5X D;  2CVR A;  2K75 A;  1R9T B;  4LF9 Q;  3OSO A;  2Z0S A;  1RIP A;  2XN9 C;  3STB D;  3MFY A;  4POG A;  3TME A;  2BA1 A;  2HUG A;  1VF5 C;  1Y69 U;  3KF8 A;  4K0K L;  2K5D A;  4KY7 A;  2E2J H;  4I7Z C;  1SND A;  1FR3 A;  1DOM A;  2BA0 A;  1KQS A;  3S1N B;  5GAD C;  2E2I H;  5C44 B;  3U4V A;  2NBF A;  1QJO A;  5IYD G;  2RDF A;  1JOQ A;  4OHJ A;  1JOO A;  4ZCK A;  4DNT B;  5ELE A;  4IFD H;  4PMW A;  2PW5 A;  1O80 A;  5JJZ A;  2K32 A;  1G29 1;  3H3V H;  3PUW A;  2NZ1 D;  4IPG A;  1SNQ A;  4B3M L;  3DWQ A;  4CKE A;  5E1F A;  3URY A;  5IY0 A;  1FYC A;  1JMC A;  3FVQ A;  1VQ9 A;  2N8N A;  2NWG A;  4JI2 Q;  4EQO A;  1ASZ A;  3W2D A;  5EPK A;  2R7F A;  1JWS D;  2EYM A;  1KDB A;  1TVX A;  3MXN A;  3TZU A;  4PNY A;  2F0F A;  5GAG C;  2E5L Q;  1K73 C;  1J8I A;  1XWE A;  4K6L A;  2VUM B;  5FO9 B;  4YY3 L;  1GUO A;  4JV5 L;  1Q46 A;  2LSS A;  4DAV A;  5CV4 A;  3I4M G;  1JWM D;  2FFK B;  1RTO A;  4LK1 C;  4MTN A;  4JYA L;  3WDN A;  2JA8 B;  3CPW A;  3NWT A;  5GAH C;  2CH4 A;  3HOY G;  1IBK L;  3PMF A;  2R92 B;  1PRT C;  3QWN A;  4RKB A;  3DLL A;  2Q8T A;  1Y1V B;  4G4K A;  1EEI D;  3E9H A;  4RA8 A;  1X55 A;  4QB4 A;  1CTM A;  4X66 Q;  3NE5 B;  4O0A A;  2ZTC A;  3M3Y B;  2AQ1 B;  2F0G A;  2CKZ B;  2QKI C;  4K8J A;  4KN4 C;  4FNF A;  4IJL A;  4WJ4 A;  2YU9 H;  4AH6 A;  2JA6 B;  1PH8 A;  5AJ3 L;  3G7L A;  4RCN A;  2ATW A;  3HEJ A;  1AE3 A;  4JI3 L;  1PVO A;  2ZXP A;  1I6V C;  1NMG A;  4APV A;  4C3H H;  1JQY D;  2JA7 B;  1TS5 A;  2EYH A;  1SSO A;  3J80 c;  1TKW B;  3K7A H;  3FKI B;  1GUG A;  2MJ8 A;  4DV5 L;  1HQM C;  4JG2 A;  4FXD A;  3OYY A;  4KJO A;  4Z9C B;  3NBI A;  4RGM A;  1F9S A;  2JE6 I;  4A3J B;  2IT1 A;  1GUS A;  1S72 A;  1TS2 A;  4QIW B;  3I7F A;  1PRT D;  2NB0 A;  2NVY H;  4GKJ L;  4H02 A;  1A2U A;  3GTG H;  1HH2 P;  1DYQ A;  2D0P A;  2L0C A;  4NPS A;  1EQV A;  4A3B G;  4LF7 L;  2R93 G;  1K3B C;  3K5O A;  3KOJ A;  2N3S A;  1U4R A;  2KEN A;  3SHL A;  4ID6 A;  1EWH A;  1N33 L;  2EY1 A;  3S16 H;  4N8X 1;  2KQ3 A;  5A2Q E;  2X69 A;  1RHP A;  5FJ8 H;  3IAY A;  2NVT B;  5D65 A;  5LL6 S;  4DV6 L;  2KHS A;  4A3K H;  4CDF C;  2F52 A;  4LAA A;  3HS0 C;  4YCW A;  4M1U B;  3GTP B;  4J15 A;  3M9B A;  3BDL A;  1IBL L;  3OOC A;  4IPH A;  1A3T A;  2F0H A;  3FHW A;  2EY2 A;  2OQ0 A;  2G9D A;  5IWA Q;  1MHW C;  4R4T A;  3RZO B;  1SYC A;  2R3Z A;  5M5X H;  2SNS A;  2KCT A;  4RG1 A;  5H1S E;  1X3P A;  1VS0 A;  4Q5V A;  2B39 A;  4TQU S;  2AUJ D;  2L55 A;  5JOB A;  3ULL A;  1L0X B;  3ZJY C;  1PH6 A;  4JOI A;  1Q1B A;  3OW7 A;  4NXN Q;  2MO1 A;  2SDF A;  1B3Q A;  1SNO A;  1EQT A;  5KND A;  2RKS A;  1QUQ B;  2FHT A;  5IYC G;  1NR4 A;  4R4Q A;  3OPO A;  4BA2 I;  2K01 A;  1F9Q A;  1UEA B;  4DV0 Q;  4JI1 Q;  2OXP A;  5C3E G;  5D14 A;  5EKL A;  1A8V A;  3LNN A;  5E7N A;  1ICF B;  2F0W A;  3KLR A;  3I4N B;  1GHJ A;  1WTH A;  3QJY A;  3QOL A;  1Y14 B;  3CCS A;  2B2T A;  4DN4 M;  1E7Z A;  4QF4 A;  4R4O A;  2OF1 A;  3J7A V;  3TEH B;  1W2B A;  3UE0 A;  3UE1 A;  1EYG A;  1X3Q A;  5JEA H;  1B53 A;  1WVL A;  4RGO S;  4G57 A;  5M3F G;  1JC7 A;  4X6A H;  2I07 B;  3DWA A;  4ZKB B;  1WTQ A;  2ZTD A;  3PO2 B;  4P71 A;  4UHV A;  3LX0 A;  3GDE A;  5IT9 c;  3K80 C;  2PQA A;  5CGK A;  1LAC A;  1QUQ A;  2HHH Q;  4B9W A;  4OX9 Q;  2D0O A;  3L0O A;  1NMF A;  2K5N A;  3G6E A;  1SYB A;  3U9O A;  3BDC A;  1F2M A;  3VYT A;  3S2H H;  3J80 L;  1VMC A;  2KED A;  1Q81 C;  2EY6 A;  2E8G A;  1GUW A;  3HOY H;  1S5F D;  1DON A;  1FJG L;  1I4Q A;  4UP7 A;  3KLS A;  4WFN 3;  2XVS A;  1LT3 D;  5KYI A;  1VQH A;  3NP8 A;  3A55 A;  4GS3 A;  1IBM L;  3NTI A;  2L12 A;  3QG1 A;  3D0F A;  4K8I A;  2IX0 A;  3Q6S A;  2E2H B;  4P2C B;  2DGY A;  5K5P A;  4DUY Q;  4AQY Q;  2EJM A;  3TQY A;  1KAB A;  2P5Z X;  1S40 A;  4XQJ A;  5JPN C;  2EQS A;  4RFB A;  3NEN A;  3SXH A;  4BBS H;  1Y8P B;  1LO5 D;  5ELF A;  1EY7 A;  2KJX A;  1EIY B;  2JA9 A;  5M9O A;  1VQL A;  3BS1 A;  1PTO B;  1NCV A;  1BCP F;  3VR2 A;  3S1R H;  4H44 C;  2D5D A;  2EJF C;  1IKM A;  5JAV A;  3I3C A;  2F0S A;  1LT5 D;  5EKK A;  3HOV G;  1EWC A;  1PXU A;  2UXC Q;  2IX3 A;  3PUZ A;  4DV3 L;  4DAY B;  1QOH A;  4QCL A;  3FEW X;  3S16 B;  2PNH A;  3TP6 A;  4HJ9 A;  2EIF A;  2MGS A;  5I6W A;  1I6H H;  1OXT A;  4OEM B;  3F2U A;  3ULP A;  4A3B H;  4DGZ A;  1N36 Q;  2Y0S B;  3RN2 A;  2R93 H;  2VNU D;  2EZV A;  1F9P A;  3I55 A;  3RLN A;  4DV2 L;  2AWO A;  1TXY A;  5ELO A;  3OTO Q;  3JAM c;  3J7A 5;  5DNF A;  4BY7 H;  2EYJ A;  3TS0 A;  1Z47 A;  1GM5 A;  1K0S A;  1EOV A;  1WOC A;  4DR3 Q;  4YHH Q;  1A62 A;  2IW3 A;  1STE A;  5BN5 A;  4X64 Q;  3SK4 A;  1HHV A;  2E74 C;  4IUN A;  4HJA A;  1HNZ L;  1JT8 A;  3S17 H;  2UUC Q;  5LMN L;  1QZG A;  3CRK C;  4UPA A;  1TWH H;  3K8A A;  1HR0 Q;  4C3I G;  1G6P A;  3CXC A;  1Y1W G;  3BU2 A;  4B3T L;  1EU4 A;  1ILP A;  1J5E L;  3EQL C;  4OWW B;  1VQF A;  4Y52 H;  1I4G A;  2GVA A;  1I4R A;  2IJ0 A;  5IT9 L;  4CJ1 B;  3PSI A;  3SGI A;  2RSO A;  4A3E H;  4IUT A;  4C1N I;  4L63 B;  5JVH 3;  3AFQ A;  2PZW A;  1M4V A;  1G91 A;  4A3C G;  3QOJ A;  4PZ7 A;  1N34 Q;  1XTC D;  1HJP A;  3TDQ A;  5C3E H;  2HT1 A;  1K8O A;  2F4V L;  2WB1 G;  3GV3 A;  1XMO Q;  1PH3 A;  2H5X A;  1STB A;  1X65 A;  2WAQ B;  3H15 A;  5C3X A;  3HOX G;  3GV6 A;  4KJN A;  3LWU A;  4PV1 C;  1G2S A;  3BG3 A;  3EVQ A;  4UAI A;  5NUC A;  3S2H B;  5M3F H;  1K0R A;  1X54 A;  1EFI D;  3R2I A;  4C2M B;  5GQO A;  4HAE A;  2A73 B;  5M3M G;  2ASB A;  3ND8 A;  1P16 A;  3EFX D;  2VZA A;  1EUJ A;  1N32 L;  3H3V C;  1CK1 A;  1OXS C;  4A93 B;  4KHP L;  4V0B A;  4KN7 C;  1I4H A;  4A3J G;  1S5B D;  1E22 A;  2VS1 A;  2Z6K A;  1CQF A;  1EY8 A;  3DHQ A;  3T1H L;  4A3D G;  4DNI A;  2ZJR A;  1X3F A;  3G6J B;  4DU9 A;  1UNS A;  4CJ0 B;  1FNU A;  3HOW B;  2B8G A;  4BBS B;  1EYC A;  2XWB B;  3RN5 A;  4IPD A;  4Y7N H;  1FVI A;  3KFU A;  2WB1 E;  4I7A A;  5EBD A;  3C46 A;  1VQ6 A;  1NE3 A;  5J3B A;  4BS9 A;  2B2Y A;  3ZYY X;  3P7J A;  3KLW A;  3KF6 B;  3H0G B;  4TRD A;  3K0Y A;  2UUB Q;  1LTA D;  1K83 H;  4X3S A;  1Q3L A;  4AYB G;  4DK3 C;  4E6I A;  1VQC A;  2HD3 A;  4DR5 L;  4X3K A;  1U4L A;  1Q82 C;  1O7Y A;  2B2W A;  1H95 A;  4ODG A;  5KRU A;  2Q2U A;  2IY5 B;  2DN8 A;  3NTK A;  2AQ2 B;  2VQF L;  3RR5 A;  1TWG B;  4LF5 Q;  4B9X A;  3NPP A;  1QZH A;  1QNU A;  1VQK A;  3GTJ B;  2J0T D;  3M4P A;  2JN4 A;  1ICW A;  1PYW D;  3HOV H;  2PZT A;  1NBW A;  2Z9H A;  3W3A A;  2MFI A;  4LFA Q;  1DXM A;  4PQX A;  1CKN A;  1Q7Y C;  4BY7 B;  1GKH A;  3KF6 A;  4F8M A;  1FNV A;  3F1Z A;  3TRE A;  3ULJ A;  3QO2 A;  4IO9 A;  1STN A;  2H4O A;  2PMZ B;  3IFD A;  2OWO A;  4X65 L;  1EZ6 A;  3A8K E;  4A75 A;  3GTM H;  1FNW A;  5J1Z A;  2ICE C;  4DNR B;  1QE6 A;  2UU9 Q;  1O7L A;  5IGC A;  4EQN A;  1GHK A;  4A4I A;  1PTO C;  2D9U A;  2E76 C;  5CYU A;  1S5D D;  3MEF A;  4AYB E;  4EQ5 A;  4XTC S;  1TY0 A;  3K81 C;  1I4X A;  3K0X A;  2BE5 D;  2NVQ B;  1LTR D;  4BBR B;  1KRT A;  2QDB A;  2ENB A;  3PO2 G;  3G4S A;  3UI2 A;  4JVZ A;  1SYG A;  2HIV A;  1RDP D;  2JSO A;  3IRB A;  1Y8O B;  4EVO A;  3NXW A;  5EAY A;  4KKT A;  2F0I A;  1VCI A;  1WJJ A;  4A3G G;  1Y1W H;  5CMD A;  1ENA A;  3CU7 A;  1CFM A;  5BR8 Q;  2FXQ A;  1E2Z A;  4JI5 Q;  3OWF A;  3SK8 A;  1NSN S;  3CMA A;  1I4P A;  1AH9 A;  3FPP A;  3HKZ G;  2I46 A;  4GKK L;  2HDM A;  4JC0 A;  3OWE B;  4A3C H;  2VB2 X;  5M5W B;  4FVM A;  5FLM G;  1CZG A;  1QB5 D;  3ERO A;  2L4N A;  4BY1 B;  3C2P A;  2I5M X;  1AN8 A;  3KYH C;  1HNX Q;  5IP7 G;  2AHO B;  1WCM B;  2EDG A;  2F3W A;  3OHX C;  4MN3 A;  3PO3 H;  1WYD A;  1QIL A;  1PTO D;  4A3F G;  1SE8 A;  2PYK A;  1P8L A;  5IIF A;  3RZD B;  4ILW A;  3DM3 A;  3A8J E;  1IYJ B;  4GLV B;  1KRS A;  1ENF A;  1LUZ A;  1V1P A;  5D3I B;  4A3M B;  4A3I B;  2BDN A;  2F0P A;  2F3I A;  3CP0 A;  1GUN A;  1X3G A;  1J9O A;  2G9H D;  4LF8 Q;  1VQB A;  3HOU B;  5HGT A;  1SMY C;  3CME A;  3TP7 A;  1M90 C;  4L5T A;  2WIN B;  1TWA H;  4Y7N B;  4KHZ A;  3CQZ H;  5T1I A;  2RF4 A;  1PZI D;  1TU2 B;  3CPF A;  4NB3 A;  2CW0 C;  3T51 B;  2Z6K C;  1K83 B;  2AMC B;  1ZYR C;  3M4Q A;  3MXN B;  3M4O H;  1PFN A;  2CHB D;  4RKL A;  3S2D H;  3HKZ E;  2PI2 E;  2JEA I;  4JW0 A;  1EL0 A;  5C4X G;  1A63 A;  2JA5 B;  4RHS A;  1LTG D;  5GAE C;  1JJC B;  1VQP A;  3X3M A;  3J81 i;  2DJF C;  1N9W A;  1CZW A;  3OMG A;  2B2Y C;  4XT1 B;  1QVG A;  1VDZ A;  3P75 A;  5JJL A;  1PRT F;  4H7B A;  4HIO A;  1PH7 A;  3OIP A;  4JBW A;  2ICI A;  1I94 Q;  3A5Z B;  1E2W A;  2F1M A;  4OO1 G;  4R8N A;  3L9A X;  5IOC A;  4LFB Q;  1SMY D;  4JI8 Q;  3W1B A;  4GOP A;  3J81 j;  1HR0 W;  2DUD A;  5FK9 C;  3I4L A;  2F0U A;  4F7X A;  1UAP A;  3K59 A;  1B44 D;  4ZYS A;  3RNU A;  1KLG D;  3UDI A;  1Q86 C;  1ZYR D;  3MXP A;  3T16 A;  2ZJQ A;  3OW2 A;  2VW9 A;  3T1Y Q;  1DD2 A;  4MIU A;  1C0A A;  4X66 L;  4K5W A;  4C3J H;  5KEE A;  3J80 i;  1K3R A;  2L1B A;  2QIL A;  2X6G A;  4B3M Q;  1XXG A;  2B63 B;  1HFN A;  3VYR A;  5IGD A;  1X6O A;  1UE7 A;  2L11 A;  4PMB A;  3LWE A;  1PH2 A;  2IHE A;  1C4Q A;  4QQB X;  3SR1 A;  3JC6 6;  3ERS X;  2LXK A;  1IZ6 A;  3HOZ G;  3GP7 A;  1BNZ A;  4LF4 Q;  1TQO A;  4WRD A;  1UWV A;  4YY3 Q;  4X3U A;  4JV5 Q;  1EZ8 A;  1WTR A;  4KD4 A;  2EYL A;  1RL2 A;  1RF2 D;  2A69 C;  3SE0 A;  2HQL A;  3VDY A;  5FO8 B;  2M9V A;  1A15 A;  3TSS A;  4A93 G;  3NQT A;  1V43 A;  5BN3 A;  4B08 A;  4DF7 A;  2KEC A;  4J8Q A;  2RA4 A;  1WD1 A;  4A3G H;  4KKU A;  1HQR D;  3BYT B;  1AW7 A;  5CV5 A;  4DV4 Q;  2ID0 A;  4LF6 Q;  3PO3 B;  1YZ6 A;  3VA5 A;  2Q2T A;  2OEO A;  3HKS A;  1VQJ A;  2LFN A;  4UP9 A;  3V2T A;  1SFO B;  4PZ8 A;  5FLX E;  3SK6 A;  4IOC A;  1HZC A;  5IYB G;  1V1Q A;  1BXT A;  3J81 E;  5KIX A;  5FLM H;  2ALY B;  4OO1 I;  2VXW A;  1V9P A;  1UUP A;  3S14 H;  1XPO A;  2C9O A;  1TWF B;  4JI3 Q;  1Q8K A;  2C35 B;  4JBK A;  1BKB A;  1SAP A;  5I2X A;  4DR7 Q;  3CQZ B;  1O78 A;  1YEZ A;  4F88 A;  2CCZ A;  4IOA A;  4YWK A;  3AEV A;  1KD1 C;  4BA1 I;  2BH8 A;  3CC4 A;  5LMU Q;  1F2L A;  1W6K A;  3ITP A;  4G7O C;  5M5Y H;  3CCL A;  5IWA L;  2R7Z G;  1BO0 A;  3M4O B;  4G7H C;  4KMU C;  2QEX A;  2E2J B;  2ZXR A;  2RQX A;  1IW7 C;  2LKV A;  1U5K A;  1XMQ Q;  1EOT A;  4NXN L;  1MJE A;  2E2I B;  1SYE A;  3DXJ C;  4DR6 Q;  5I6Y A;  3FDT A;  3J80 E;  2XIW A;  1I3Q H;  4DV0 L;  1KL9 A;  4JI1 L;  3J7Z C;  3R3O A;  1D5Z C;  3GTQ H;  4QMG A;  1HTP A;  3KUP A;  1G6Z A;  4HJ5 A;  2PQA B;  3F2D A;  2EE1 A;  2XRQ D;  3EN2 A;  5CR3 A;  4J6H A;  5C5L A;  1OXV A;  1VQM A;  2PNR C;  2K6A A;  4ZUI A;  5IYD H;  2RVL A;  1HCZ A;  3MHB A;  4HMJ A;  2X6L A;  2OT2 A;  5JPM C;  5E4W C;  2WKC A;  4HMI A;  2MNA A;  2G5D A;  2NN6 G;  4KKS A;  1SRO A;  3WOE A;  1KNE A;  3IKJ A;  4OO1 H;  4C1N K;  3VR3 A;  2JQO A;  2HHH L;  4JPB W;  4OX9 L;  3HG9 A;  1IW7 D;  4C3J B;  1SNM A;  3CCV A;  3BDO A;  3EIV A;  4DK6 C;  2RHS B;  1PHJ A;  3R2T A;  3S1Q H;  1H9M A;  1JIC A;  2F4I A;  4KTA A;  3H91 A;  4XQN A;  4IPC A;  3K7U C;  1DGS A;  1LTL A;  1X32 A;  2JP1 A;  3I4M H;  1DZ1 A;  3EBE A;  1UE6 A;  3TS2 A;  2RHQ B;  4NXM Q;  2FMC A;  1KDA A;  2K50 A;  4HTH A;  5J39 A;  1SR3 A;  4JI6 L;  1YNN C;  1VQ7 A;  1QNK A;  4BY1 G;  2R6G A;  2LY7 A;  1H9S A;  1FGU A;  2YU9 B;  1HNW Q;  4RH6 A;  5E3F A;  1WCM G;  2ES2 A;  5BN4 A;  3NBH A;  1H9R A;  3QIA A;  5COY A;  4GN4 B;  2K33 A;  4OWT B;  1ASY A;  4C3H B;  3TZD A;  3HOZ H;  2KCM A;  3ERQ A;  3K7A B;  2A6H C;  1IYV A;  2HCI A;  1Y8N B;  1BVS A;  5C4J H;  1D5X C;  3MFG A;  2VQE L;  4HJ8 A;  4B3S Q;  3GQB A;  1CSQ A;  2F0L A;  5CBE E;  3HOU G;  4M8A A;  4JI7 Q;  5C0X G;  3KJO A;  4L5R C;  1SYF A;  4FF3 A;  2NVY B;  3HZX A;  2V1C C;  5FO7 B;  5FOB B;  3K58 A;  5JJK A;  3P1H A;  3GTO H;  3A54 A;  1PH9 A;  3GTG B;  5K36 G;  2HIX A;  4GLA C;  5IT9 E;  1SYD A;  3CCE A;  3SVM A;  3D31 A;  2O5J C;  3E6Z X;  5CV8 A;  3EA6 A;  1SE2 A;  1VQ8 A;  5IYB H;  2NN6 I;  3BYY B;  4NW2 A;  1WI5 A;  1K8A C;  1JJG A;  2MUY A;  4U67 3;  3RLF A;  4IQZ A;  4B3R Q;  4L8J A;  1HRJ A;  4YCV A;  5C44 G;  3OTO L;  4A3K B;  1ZXT A;  4CJ2 C;  3MZ5 A;  1HFG A;  1BBU A;  1GUT A;  2QEJ C;  1PH1 A;  4KV6 A;  4YHH L;  4DR3 L;  2C5C A;  2A6H D;  4X64 L;  4ME5 A;  5IP9 G;  3GTL H;  1X3E A;  5DEH A;  3Q8D A;  4R4C A;  1HA6 A;  1JWU D;  5M5X B;  2UUC L;  1YNJ C;  4POF A;  4YWM A;  2R7Z H;  4DR4 Q;  4OIJ A;  1HR0 L;  3TP5 A;  2RBM A;  4ZK9 B;  3GTQ B;  2FMM A;  3A7L A;  2F0E A;  1VQE A;  2VUM G;  1S5C D;  1D1I A;  1CHP D;  1O7Z A;  1KNA A;  3F8T A;  2BDO A;  2AQ3 B;  1NR2 A;  2EPB A;  2K28 A;  2YV5 A;  4L6T B;  4EQP A;  1EEF D;  1S3O A;  4DV1 Q;  4FF2 A;  3CF5 A;  1CHQ D;  1Q12 A;  2JA8 G;  4CDD C;  1ML0 D;  2E2D C;  2XWJ B;  1N34 L;  2A1A A;  3K57 A;  4JOI C;  1YIT A;  1ROD A;  2R92 G;  2B63 G;  1XMO L;  1Y1V G;  5IYC H;  1QVC A;  3QR8 A;  3TRZ A;  4ZAI A;  3NEM A;  2Q8I B;  2N88 A;  5C0X J;  5G3L F;  5IGF A;  4X3T A;  1W3S A;  2WAC A;  2BH2 A;  5C0X I;  3S1M H;  1KDC A;  1L1O B;  2UXD Q;  2ZJP A;  2B2V A;  2K1B A;  3Q23 A;  3K5M A;  3S1Q B;  1BDO A;  1MIU A;  1XNR L;  3KK7 A;  1F9R A;  2NN6 H;  4QL5 A;  2B2T C;  2JA6 G;  3K5L A;  3C1E A;  2TMP A;  3E9I A;  3A7A B;  1L0W A;  1E2V A;  3S15 H;  2NVX H;  3HOY B;  4N9P A;  2JA7 G;  3X3N A;  4PG3 A;  3J7A F;  1BQQ T;  5C3W A;  3FKI G;  2JEB I;  3V05 A;  4BWG B;  2HCC A;  2MO0 A;  2N49 A;  3R8B A;  1JB7 A;  4ZKC B;  1L1O A;  2B8F A;  2NUC A;  2B3G A;  1RKN A;  3QB3 A;  1WTO A;  4KY6 A;  2Q2I A;  2HQE A;  4OXP A;  2UUA Q;  4OGQ C;  4XT3 B;  4P74 A;  3ND9 A;  3NEL A;  2ZM6 Q;  1PFS A;  2EXD A;  2UUB L;  2Z8L A;  4EGV A;  1JCK B;  2AUK A;  3L3O C;  2NYZ D;  3T13 A;  2I0Q A;  3GTO B;  4LUZ A;  1YHQ A;  1CKN B;  4DUZ Q;  2MPM A;  3DM1 A;  1YHB A;  1R4P B;  1QG7 A;  1LTS D;  3S1R B;  2XNA C;  2CQO A;  2EVB A;  4JBM A;  4KHP Q;  1H9K A;  2PO4 A;  2XTI A;  2KCC A;  3AFP A;  4DV7 L;  3LGJ A;  4LF5 L;  4F87 A;  3JAM L;  2IL8 A;  2KHI A;  1GXD C;  5C0X H;  3RD4 A;  1E3P A;  2YTY A;  5E4X A;  1PTO F;  4XIG S;  1GO3 E;  2GVB A;  4O1N A;  4LFA L;  4X62 L;  1I6H B;  4DAP A;  5I4D A;  3CCU A;  5K36 H;  4A3B B;  1R9T H;  1STA A;  4KK7 A;  2B29 A;  2R93 B;  3KDF B;  5I9P A;  3D3R A;  2K7V A;  2I5L X;  4DXG A;  4NP5 A;  4K2L A;  4QIW E;  5EPL A;  3CAM A;  4OWX B;  2EYO A;  3S1N H;  2D62 A;  5C44 H;  1SEB D;  5FKA C;  4JK1 C;  1XNQ Q;  2SEB D;  2CWA A;  1CT1 D;  1SJH D;  1E24 A;  3DEP A;  3BZD B;  1KHI A;  3RMH A;  4XQQ A;  3I4N G;  3CCR A;  1UE5 A;  3VA7 A;  2EOT A;  4UDU C;  1NY4 A;  4IZ8 A;  3UDG A;  1PV4 A;  1N8R C;  3S17 B;  2D2C C;  2CFM A;  4ALP A;  5ELB A;  5IP9 H;  5EKI A;  1AFP A;  1A3U A;  1TWH B;  1EQR A;  2NTS A;  4DXF A;  4L5S A;  4TKO B;  3H6M A;  5KGU A;  5CBA E;  3KDF A;  3HFZ B;  4A3E B;  1Q90 A;  4FYD A;  2VUM H;  5BR8 L;  2ZXO A;  1I5F A;  4JI5 L;  5C4H A;  3KJP A;  1KAA A;  2DY7 A;  3A5U A;  4HJ7 A;  4ZUJ A;  3UDX A; 
#chains in the Genus database with same CATH homology
 1H9J A;  3KLS X;  4OIK A;  5C3E B;  1V1P B;  1C48 A;  2PCF B;  2J4X A;  1NUC A;  2F0K A;  2DNC A;  5M3F B;  2MHV A;  3S15 B;  2NVX B;  4S3S A;  4C3H G;  1E0B A;  3HP3 A;  1AZQ A;  1PMR A;  2B2V C;  1PFB A;  4R9W A;  4QUC A;  1TT2 A;  3SK5 A;  3CHB D;  5F2D A;  1ILQ A;  1DM0 B;  3MC0 B;  1PLF A;  1QCB D;  1OXU A;  2O2L D;  2B2U A;  4RCO A;  2F0Q A;  1EY0 A;  3KBG A;  4HCS A;  1SE3 A;  1F77 A;  2XSC A;  5LHY 1;  3MEH A;  1PZK D;  5C4Z A;  4WOR A;  2A68 C;  3MTS A;  1ESF A;  1M8A A;  2ZT9 C;  4HN7 A;  3D6W A;  4HSV A;  1DJR D;  3TBI B;  3DUZ A;  5EQ0 A;  2LS0 1;  5IOD A;  5COR A;  1HUM A;  3CKI B;  1U9R A;  2M00 A;  3PIO 3;  3HGB A;  3HOV B;  1WTX A;  4ABN A;  1GOZ A;  1LT4 D;  5IGB A;  1IKL A;  2B2W C;  4DK0 A;  4IUP A;  1SNC A;  1LT6 D;  2A68 D;  1ESR A;  2CW0 D;  1FGB D;  3GTM B;  4H13 C;  3I91 A;  5JEA G;  4MHE A;  2Z4H A;  1JOR A;  1ET9 A;  2F0M A;  3KBX A;  4CKC A;  5EJW A;  1WTW A;  1SDF A;  4C3I B;  5CV7 A;  1Y1W B;  3H09 A;  2KOL A;  1ENC A;  1A6X A;  1A2T A;  1II3 A;  1WTV A;  2MP1 A;  3P20 A;  1MBY A;  4CGY B;  1LAB A;  2K5W A;  4GZY C;  1L0Y B;  2YYZ A;  2F0N A;  2F0J A;  4NKL A;  4IN3 A;  3BVM A;  4ZLT F;  3J7Y W;  2KVM A;  3D4W A;  1BR9 A;  2WB1 B;  4IUQ A;  1ONL A;  2RSN A;  1CQV A;  1JOK A;  1ZKO A;  3HOX B;  4IAL A;  1TR5 A;  4FF4 A;  2O5I C;  3A56 A;  3VR5 A;  4RAU C;  4TSS A;  5M3M B;  1PFM A;  3A8I E;  3D8G A;  1OO9 B;  1MI2 A;  1AP0 A;  1BCP B;  3T56 B;  3Q22 A;  2BOS A;  1TWA B;  3Q0A A;  3NHH A;  1D6E C;  2A69 D;  5JEA J;  2B2U C;  5CV9 A;  1PTO H;  4A3D B;  1TS4 A;  3S2D B;  1WD0 A;  1G8Z D;  3BVG A;  3CRL C;  3FMC A;  2L5T A;  3NTH A;  1B3A A;  3SEB A;  4HSP A;  4K14 A;  1RD9 D;  1BF4 A;  4K5V A;  3R93 A;  2NTT A;  1LLR D;  1B2T A;  1F2Y A;  4AYB B;  1B50 A;  4K2K A;  1EY9 A;  4FXK C;  2J7Z A;  2F0D A;  3PIP 3;  3AMU A;  1EY5 A;  2LMC B;  4XXE A;  1EY6 A;  3MXU A;  3DEO A;  4NDX A;  5ELC A;  2R61 A;  5JVG 3;  2L9H A;  1KLU D;  1H9S B;  4XYO A;  5FLX L;  4ZQ3 A;  1NAP A;  5T1G A;  2PPB C;  3J81 L;  2WV6 D;  3HRZ C;  5C5M A;  1BBX C;  2KEE A;  3MA2 B;  1Z6H A;  2EYP A;  1EIG A;  2CQA A;  4RGT A;  5KYL A;  1EYD A;  3NQI A;  4IUR A;  1SE4 A;  1WTP A;  2HDL A;  1EIH A;  5D3D A;  5DM6 3;  5A2Q L;  1G2T A;  3IFT A;  1D2B A;  2PQE A;  2QF7 A;  4IUV A;  3I73 A;  3S9W A;  3M7G A;  5HUR A;  3PUY A;  1SBB B;  1ZEQ X;  1BUV T;  2EJG C;  3DWP A;  4H0L C;  1RTN A;  3SDZ A;  4A3G B;  5IGG A;  1MSG A;  4CBV A;  1JB3 A;  3M85 A;  2IWH A;  4WJW A;  1A3V A;  3E0J A;  3ONA B;  5J22 A;  2M2L A;  3VR6 A;  3TP8 A;  3HKZ B;  3D6C A;  2FJ2 A;  2KA7 A;  3T4A C;  3PUV A;  3OMC A;  1VF7 A;  3NSW A;  4DFA A;  1TS3 A;  1B4O A;  2GA4 B;  2O4X A;  3S14 B;  4RHR A;  4A3F B;  2A6E C;  1MD2 D;  4O42 A;  5TSS A;  3AU7 A;  1YNN D;  5IGE A;  4ZRZ A;  1ET6 A;  1AEX A;  3PV0 A;  2VB3 X;  2SOB A;  3I72 A;  5M5Y B;  1CI3 M;  3H94 A;  3N6R A;  4C56 C;  5KNB A;  1FD7 D;  1EU3 A;  1K8M A;  1STH A;  5I9O A;  4CKB A;  3EJI A;  3GO5 A;  5DAU A;  5KNC A;  3C3L A;  1OXX K;  2XRS D;  5ISR A;  1SXT A;  2WP8 J;  1I3Q B;  2V4D A;  3BVZ A;  1STG A;  3VYS A;  2WII B;  5C4X B;  2KUM A;  1VMP A;  1JR0 D;  2A6E D;  3D4R A;  1QWY A;  1Z7T A;  2TSS A;  4DA2 A;  4FF1 A;  4LMQ D;  1BCP C;  4HCE A;  1F2Z A;  1Q1E A;  1BOS A;  4DAY A;  4FO2 A;  3K5N A;  2QCP X;  3L7Z C;  3O13 A;  1IHZ A;  5AFW A;  4HED A;  2PZU A;  4CHT B;  4G7Z C;  5A35 A;  1YNJ D;  3IL8 A;  3I4M B;  3JAM E;  1MGS A;  1U4M A;  2SNM A;  3Q24 A;  3C1F A;  1MSH A;  3VYU A;  1D1K A;  1C8C A;  4U68 A;  5LL6 X;  5CV6 A;  5CC4 A;  4K6D A;  1CA5 A;  3M7N A;  1BCP D;  2N55 A;  2F0O A;  1IYU A;  3HOZ B;  4N9T A;  1STY A;  1HUN A;  4IUU A;  1V1O A;  2F0V A;  4KHV A;  1RCV D;  4XDX A;  2E75 C;  5C4J B;  2A5H A;  1CM9 A;  4KD3 A;  3I70 A;  2AWN A;  2RDH A;  1GJX A;  2BCO A;  3FRP B;  4OL7 A;  2FIN B;  2K05 A;  2K04 A;  1SJE D;  4XYQ A;  3NK9 A;  1EY4 A;  1S4Z A;  1R4Q B;  2K5Q A;  3MAQ A;  1SNP A;  2PW7 A;  4R8I A;  4K5X A;  2DY8 A;  4NMZ A;  2Z1C A;  5I2Y A;  3MWY W;  1DCZ A;  3MXG A;  1U4P A;  4KI0 A;  4YIJ A;  4IFD G;  5DM7 3;  3VR4 A;  1PRT B;  3WOF A;  1AZP A;  1S5E D;  2EYF A;  3GTL B;  1B9N A;  3TN2 A;  1LTB D;  2BE5 C;  1XX8 A;  1PDQ A;  3N52 A;  3M4Y A;  1T5E A;  4Q0F A;  2R7Z B;  2EY5 A;  2WKD A;  2RDG A;  5G3L D;  3D4D A;  4ULL A;  3OIQ A;  1CA6 A;  3T53 B;  4LJZ C;  2K03 A;  1PZJ D;  4RGN A;  4C3J G;  2F0T A;  3E5S A;  2F3V A;  3NWS A;  4I65 A;  1EYA A;  3S1M B;  1HA5 A;  2F03 A;  2JYO A;  4HR7 B;  3GTK B;  4RWS C;  2IX1 A;  4QUF A;  1DOL A;  4PMC A;  1KTK A;  3U9S A;  1DOK A;  4FXG C;  3GD7 A;  1TY2 A;  1W6J A;  3I8Z A;  1JE4 A;  2DNE A;  3MVV A;  4IFD J;  3I90 A;  4IFD I;  3DMU A;  5C6A A;  1TII D;  1Q8I A;  3PUX A;  5EGT A;  2KCN A;  1LTI D;  1XYI A;  1B1Z A;  3K6O A;  3AB9 A;  2IPK D;  5EPJ A;  3V96 A;  1V8Q A;  2Q8R E;  3NUC A;  1TWC B;  1RJT A;  3RUZ A;  4FP5 D;  2JXM B;  4KY5 A;  2H1E A;  4J1M A;  5EBC A;  4V19 0;  2EXZ A;  5ELD A;  3FPU B;  1HXY D;  1LV9 A;  1LTT D;  1D5M C;  2Z4I A;  1I50 B;  1IL8 A;  1HPC A;  4DK1 A;  2A74 C;  1HTL D;  1B9M A;  1T5X D;  2CVR A;  1R9T B;  3OSO A;  2XN9 C;  3MFY A;  3TME A;  2BA1 A;  2HUG A;  1VF5 C;  1Y69 U;  3KF8 A;  2K5D A;  4KY7 A;  4I7Z C;  1SND A;  1FR3 A;  1DOM A;  2BA0 A;  3S1N B;  5C44 B;  2NBF A;  1QJO A;  2RDF A;  1JOQ A;  4OHJ A;  1JOO A;  4DNT B;  5ELE A;  4IFD H;  4PMW A;  2PW5 A;  1O80 A;  5JJZ A;  2K32 A;  1G29 1;  3PUW A;  2NZ1 D;  1SNQ A;  4CKE A;  3DWQ A;  5E1F A;  3URY A;  1FYC A;  3FVQ A;  2NWG A;  4EQO A;  3W2D A;  5EPK A;  1JWS D;  2EYM A;  1KDB A;  1TVX A;  3MXN A;  3TZU A;  4PNY A;  2F0F A;  1J8I A;  1XWE A;  4K6L A;  2VUM B;  5FO9 B;  1GUO A;  4DAV A;  5CV4 A;  1JWM D;  2FFK B;  1RTO A;  4LK1 C;  3WDN A;  2JA8 B;  3NWT A;  3PMF A;  2R92 B;  1PRT C;  3QWN A;  4RKB A;  2Q8T A;  1Y1V B;  4G4K A;  1EEI D;  4RA8 A;  4QB4 A;  1CTM A;  3NE5 B;  3M3Y B;  2AQ1 B;  2F0G A;  2QKI C;  4K8J A;  4KN4 C;  4FNF A;  2JA6 B;  3G7L A;  4RCN A;  3HEJ A;  2ZXP A;  1I6V C;  1JQY D;  2JA7 B;  1TS5 A;  2EYH A;  1SSO A;  1TKW B;  3FKI B;  1GUG A;  2MJ8 A;  1HQM C;  4FXD A;  4KJO A;  4Z9C B;  3NBI A;  4RGM A;  1F9S A;  2JE6 I;  4A3J B;  2IT1 A;  1GUS A;  1TS2 A;  4QIW B;  1PRT D;  2NB0 A;  1A2U A;  1DYQ A;  2L0C A;  1EQV A;  3K5O A;  1U4R A;  3SHL A;  4ID6 A;  1EWH A;  2EY1 A;  2KQ3 A;  5A2Q E;  2X69 A;  1RHP A;  3IAY A;  2NVT B;  5D65 A;  5LL6 S;  2KHS A;  4LAA A;  3HS0 C;  3GTP B;  4M1U B;  3BDL A;  3OOC A;  1A3T A;  2F0H A;  2EY2 A;  2G9D A;  3RZO B;  1SYC A;  2R3Z A;  2SNS A;  1X3P A;  4Q5V A;  2B39 A;  4TQU S;  2AUJ D;  2L55 A;  5JOB A;  1L0X B;  1Q1B A;  3OW7 A;  2SDF A;  1SNO A;  1EQT A;  5KND A;  2RKS A;  2FHT A;  1NR4 A;  3OPO A;  4BA2 I;  2K01 A;  1F9Q A;  1UEA B;  2OXP A;  5D14 A;  5EKL A;  3LNN A;  2F0W A;  3KLR A;  3I4N B;  1GHJ A;  3QJY A;  3QOL A;  2B2T A;  4DN4 M;  4QF4 A;  2OF1 A;  3J7A V;  1X3Q A;  5JEA H;  1B53 A;  1WVL A;  4RGO S;  4G57 A;  1JC7 A;  2I07 B;  3DWA A;  4ZKB B;  1WTQ A;  3PO2 B;  3LX0 A;  5CGK A;  1LAC A;  4B9W A;  1SYB A;  3U9O A;  3BDC A;  1F2M A;  3VYT A;  3J80 L;  1VMC A;  2KED A;  2EY6 A;  1GUW A;  1S5F D;  1DON A;  1I4Q A;  3KLS A;  4WFN 3;  2XVS A;  1LT3 D;  5KYI A;  3NP8 A;  3A55 A;  3NTI A;  2L12 A;  3QG1 A;  4K8I A;  2IX0 A;  3Q6S A;  2E2H B;  4P2C B;  5K5P A;  2EJM A;  1KAB A;  4XQJ A;  5JPN C;  4RFB A;  3SXH A;  1Y8P B;  1LO5 D;  5ELF A;  1EY7 A;  2KJX A;  5M9O A;  3BS1 A;  1PTO B;  1NCV A;  1BCP F;  3VR2 A;  4H44 C;  2D5D A;  2EJF C;  1IKM A;  5JAV A;  3I3C A;  2F0S A;  1LT5 D;  5EKK A;  1EWC A;  1PXU A;  2IX3 A;  3PUZ A;  1QOH A;  4QCL A;  3FEW X;  3S16 B;  3TP6 A;  2MGS A;  5I6W A;  1OXT A;  3F2U A;  4DGZ A;  2Y0S B;  2VNU D;  2EZV A;  1F9P A;  2AWO A;  5DNF A;  2EYJ A;  1Z47 A;  2IW3 A;  1STE A;  5BN5 A;  3SK4 A;  1HHV A;  2E74 C;  4IUN A;  3CRK C;  4C3I G;  1EU4 A;  1ILP A;  3EQL C;  1I4G A;  1I4R A;  2IJ0 A;  5IT9 L;  4CJ1 B;  2RSO A;  4IUT A;  4C1N I;  4L63 B;  5JVH 3;  2PZW A;  1M4V A;  1G91 A;  3QOJ A;  1XTC D;  3TDQ A;  1K8O A;  3GV3 A;  1STB A;  2WAQ B;  5C3X A;  3GV6 A;  4KJN A;  3LWU A;  4PV1 C;  1G2S A;  3BG3 A;  3EVQ A;  4UAI A;  5NUC A;  3S2H B;  1EFI D;  3R2I A;  4C2M B;  4HAE A;  2A73 B;  3ND8 A;  3EFX D;  3H3V C;  1CK1 A;  1OXS C;  4A93 B;  4V0B A;  4KN7 C;  1I4H A;  1S5B D;  1CQF A;  1EY8 A;  3DHQ A;  3G6J B;  4DU9 A;  1UNS A;  4CJ0 B;  1FNU A;  3HOW B;  2B8G A;  4BBS B;  1EYC A;  2XWB B;  5EBD A;  3C46 A;  4BS9 A;  2B2Y A;  3ZYY X;  3P7J A;  3H0G B;  4TRD A;  3K0Y A;  1LTA D;  4X3S A;  1Q3L A;  4E6I A;  4X3K A;  1U4L A;  1O7Y A;  2B2W A;  4ODG A;  5KRU A;  2DN8 A;  3NTK A;  2AQ2 B;  1TWG B;  4B9X A;  3NPP A;  1QNU A;  3GTJ B;  2J0T D;  1ICW A;  1PYW D;  2PZT A;  3W3A A;  1DXM A;  4PQX A;  4BY7 B;  4F8M A;  1FNV A;  3QO2 A;  1STN A;  2H4O A;  2PMZ B;  3IFD A;  1EZ6 A;  3A8K E;  4DNR B;  1FNW A;  2ICE C;  5J1Z A;  1QE6 A;  1GHK A;  1O7L A;  5IGC A;  4EQN A;  1PTO C;  2D9U A;  2E76 C;  5CYU A;  1S5D D;  4XTC S;  1TY0 A;  1I4X A;  2NVQ B;  2BE5 D;  1LTR D;  4BBR B;  2QDB A;  2ENB A;  3UI2 A;  1SYG A;  1RDP D;  2JSO A;  1Y8O B;  4EVO A;  3NXW A;  4KKT A;  2F0I A;  1VCI A;  5CMD A;  1ENA A;  3CU7 A;  1CFM A;  1E2Z A;  3OWF A;  3SK8 A;  1NSN S;  1I4P A;  3FPP A;  2I46 A;  2HDM A;  3OWE B;  2VB2 X;  5M5W B;  4FVM A;  1CZG A;  1QB5 D;  3ERO A;  2L4N A;  4BY1 B;  3C2P A;  1AN8 A;  1WCM B;  2EDG A;  2F3W A;  3OHX C;  4MN3 A;  1QIL A;  1PTO D;  2PYK A;  5IIF A;  3RZD B;  4ILW A;  3A8J E;  1ENF A;  1V1P A;  5D3I B;  4A3M B;  4A3I B;  2BDN A;  2F0P A;  1GUN A;  1J9O A;  2G9H D;  3HOU B;  5HGT A;  1SMY C;  3TP7 A;  2WIN B;  4Y7N B;  4KHZ A;  5T1I A;  1PZI D;  1TU2 B;  2CW0 C;  3T51 B;  1K83 B;  1ZYR C;  1PFN A;  2CHB D;  4RKL A;  2JEA I;  1EL0 A;  2JA5 B;  4RHS A;  1LTG D;  3X3M A;  1CZW A;  3OMG A;  2B2Y C;  4XT1 B;  1VDZ A;  3P75 A;  1PRT F;  4H7B A;  3OIP A;  4JBW A;  2ICI A;  1E2W A;  2F1M A;  4OO1 G;  4R8N A;  3L9A X;  5IOC A;  1SMY D;  5FK9 C;  3I4L A;  2F0U A;  4F7X A;  1UAP A;  3K59 A;  1B44 D;  4ZYS A;  1KLG D;  1ZYR D;  3MXP A;  3T16 A;  1DD2 A;  4MIU A;  4K5W A;  5KEE A;  2L1B A;  2QIL A;  2X6G A;  1XXG A;  2B63 B;  1HFN A;  3VYR A;  5IGD A;  2L11 A;  4PMB A;  3LWE A;  1C4Q A;  3SR1 A;  3GP7 A;  1BNZ A;  1TQO A;  4WRD A;  4X3U A;  1EZ8 A;  1WTR A;  4KD4 A;  2EYL A;  1RF2 D;  2A69 C;  3SE0 A;  5FO8 B;  2M9V A;  1A15 A;  3TSS A;  3NQT A;  1V43 A;  5BN3 A;  4B08 A;  4DF7 A;  2KEC A;  4J8Q A;  2RA4 A;  1WD1 A;  4KKU A;  1HQR D;  3BYT B;  1AW7 A;  5CV5 A;  2ID0 A;  3PO3 B;  3VA5 A;  2OEO A;  2LFN A;  3V2T A;  1SFO B;  5FLX E;  3SK6 A;  1BXT A;  3J81 E;  5KIX A;  4OO1 I;  2VXW A;  1UUP A;  2C9O A;  1TWF B;  1SAP A;  5I2X A;  3CQZ B;  1O78 A;  4F88 A;  4BA1 I;  1F2L A;  1W6K A;  3ITP A;  4G7O C;  3M4O B;  1BO0 A;  4G7H C;  4KMU C;  2E2J B;  2ZXR A;  2RQX A;  1IW7 C;  2LKV A;  1EOT A;  2E2I B;  1SYE A;  3DXJ C;  5I6Y A;  3FDT A;  3J80 E;  2XIW A;  3R3O A;  1D5Z C;  4QMG A;  1HTP A;  3KUP A;  1G6Z A;  2EE1 A;  2XRQ D;  5CR3 A;  4J6H A;  5C5L A;  1OXV A;  2PNR C;  2K6A A;  4ZUI A;  2RVL A;  1HCZ A;  3MHB A;  4HMJ A;  2X6L A;  2OT2 A;  5JPM C;  5E4W C;  2WKC A;  4HMI A;  2NN6 G;  4KKS A;  3WOE A;  1KNE A;  3IKJ A;  4OO1 H;  4C1N K;  3VR3 A;  3HG9 A;  1IW7 D;  4C3J B;  1SNM A;  3BDO A;  3R2T A;  1H9M A;  1JIC A;  2F4I A;  4KTA A;  3H91 A;  4XQN A;  1X32 A;  2JP1 A;  1DZ1 A;  2FMC A;  1KDA A;  4HTH A;  5J39 A;  1YNN C;  1QNK A;  2R6G A;  2LY7 A;  1H9S A;  2YU9 B;  4RH6 A;  5E3F A;  5BN4 A;  3NBH A;  1H9R A;  3QIA A;  5COY A;  2K33 A;  4C3H B;  3TZD A;  3ERQ A;  3K7A B;  2A6H C;  1IYV A;  2HCI A;  1Y8N B;  1D5X C;  3MFG A;  3GQB A;  5CBE E;  2F0L A;  4M8A A;  5C0X G;  1SYF A;  4FF3 A;  2NVY B;  3HZX A;  5FOB B;  5FO7 B;  3K58 A;  3P1H A;  3A54 A;  3GTG B;  5K36 G;  5IT9 E;  1SYD A;  3SVM A;  3D31 A;  2O5J C;  3E6Z X;  5CV8 A;  3EA6 A;  1SE2 A;  2NN6 I;  3BYY B;  4NW2 A;  2MUY A;  4U67 3;  3RLF A;  4IQZ A;  4L8J A;  1HRJ A;  4A3K B;  1ZXT A;  4CJ2 C;  1HFG A;  3MZ5 A;  1GUT A;  2QEJ C;  4KV6 A;  2C5C A;  2A6H D;  4ME5 A;  5DEH A;  1HA6 A;  1JWU D;  5M5X B;  1YNJ C;  4OIJ A;  3TP5 A;  2RBM A;  4ZK9 B;  3GTQ B;  2FMM A;  3A7L A;  2F0E A;  1S5C D;  1D1I A;  1CHP D;  1O7Z A;  1KNA A;  2BDO A;  2AQ3 B;  1NR2 A;  2EPB A;  2K28 A;  4L6T B;  4EQP A;  1EEF D;  4FF2 A;  1CHQ D;  1Q12 A;  1ML0 D;  2E2D C;  2XWJ B;  3K57 A;  1ROD A;  4ZAI A;  2Q8I B;  2N88 A;  5C0X J;  5G3L F;  5IGF A;  4X3T A;  2WAC A;  5C0X I;  1KDC A;  2B2V A;  2K1B A;  3Q23 A;  3K5M A;  3S1Q B;  1BDO A;  3KK7 A;  1F9R A;  2NN6 H;  2B2T C;  3K5L A;  3C1E A;  2TMP A;  3A7A B;  1E2V A;  3HOY B;  4N9P A;  3X3N A;  3J7A F;  1BQQ T;  5C3W A;  2JEB I;  3V05 A;  4BWG B;  2HCC A;  3R8B A;  4ZKC B;  2B8F A;  2NUC A;  1WTO A;  1RKN A;  3QB3 A;  4KY6 A;  2HQE A;  4OGQ C;  4XT3 B;  3ND9 A;  2Z8L A;  4EGV A;  1JCK B;  2AUK A;  3L3O C;  2NYZ D;  3T13 A;  3GTO B;  2MPM A;  3DM1 A;  1R4P B;  1QG7 A;  1LTS D;  3S1R B;  2XNA C;  2EVB A;  1H9K A;  2PO4 A;  2KCC A;  4F87 A;  3JAM L;  2IL8 A;  1GXD C;  5C0X H;  3RD4 A;  5E4X A;  1PTO F;  4XIG S;  4O1N A;  1I6H B;  4DAP A;  5I4D A;  5K36 H;  4A3B B;  1STA A;  4KK7 A;  2R93 B;  5I9P A;  3D3R A;  2K7V A;  4DXG A;  4NP5 A;  4K2L A;  5EPL A;  2EYO A;  2D62 A;  1SEB D;  5FKA C;  4JK1 C;  2SEB D;  1CT1 D;  1SJH D;  3DEP A;  3BZD B;  3RMH A;  4XQQ A;  3VA7 A;  2EOT A;  4UDU C;  4IZ8 A;  3S17 B;  2D2C C;  5ELB A;  5EKI A;  1AFP A;  1A3U A;  1TWH B;  2NTS A;  4DXF A;  4TKO B;  3H6M A;  5KGU A;  5CBA E;  4A3E B;  1Q90 A;  4FYD A;  2ZXO A;  5C4H A;  1KAA A;  2DY7 A;  4ZUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...