1MH1A

Small g-protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
183
Chain Sequence
GSPQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVSLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human rac1, a member of the rho-family complexed with a GTP analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding
molecule keywords RAC1
total genus 60
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 1997-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mh1A00
5CDFE 4NZYA 1YRAA 4C9BA 4HB2A 2O0JA 1PUJA 1G20E 2V4ZA 2ZSEA 3EWAA 5EP3A 4M0LA 1S9DA 1U8YA 1D9ZA 3V4FA 1Q44A 5CK5A 2L0XA 5KOYA 1CS4C 2RGGA 2CJWB 4A2QA 3OAAD 1NF3A 2JEOA 3B7GA 1ZIPA 5EE3A 4BZPA 3U60B 3WP1B 1EK0A 2OBMA 3FFBA 1T8TA 3VR6A 1DAIA 3VX4A 3K09C 4UNNA 2NG1A 4XWAA 3VU9B 1G64A 1UFQA 1FP6A 1YVDA 3ICQB 1AKEA 3A36A 2XNDD 1W2HA 4MYUA 1E1RD 3CR7A 1XRJA 1Z83A 1MOZA 2VIIA 4FCWA 1CJVC 4D26A 1DS6A 2RKOA 2ZQ5A 3PEUA 1N0VC 1RRFA 4B47A 3Q5DA 5DLQC 2WOJA 3RS2A 1T0HB 3AH8A 3FMOB 4HB4A 1SHKA 4W5WA 3QXHA 3EZ2A 4Q21A 3H86A 1I2DA 4RVCA 3EC2A 2ZEJA 4R2IA 2H17A 5FBQB 2JLUA 1Q12A 2A78A 5FPSA 1TAGA 2IYYA 1GAJA 5HTKA 3WNBA 2J1LA 1VCIA 1TF7A 1SVOA 3IEUA 4JBXA 5KUTA 4LV8B 5JSZA 2JLZA 5IK2A 5HZHA 3LQQA 3LLMA 2IK8A 4N0EA 1VHLA 2KB0A 5DGXA 2OE2A 3AB3A 1XTJA 4A0HA 3X1WA 1XEFA 1CLUA 2D3WA 1FNNA 3T15A 5AJZA 1JAIA 1SXJD 2DPXA 1Z6YA 4E5UA 4PPFA 3R8FA 4GDFA 1OE0A 4F92B 4MA4A 3KUDA 2C9CA 4Q66C 4UNSA 5JHHB 3FTQA 4X8MA 4MGYR 3CB4A 3CF2A 1NKTA 2BCJQ 2CL6X 4RJLA 1BMFA 3W3AA 2FE4A 2J0UB 5AR1A 3TUZC 3HR8A 3W5IA 3FE2A 1N6HA 1ZC3A 1V5WA 1ZM2A 1T4GA 2ZRAA 2IS4A 4KJZA 4M4SA 4PR0A 5FUWA 2YHSA 3LXXA 5FR1A 1G5PA 1U9IA 4B43A 2JATA 4I81A 4RFVA 1R5OA 1MKYA 4A36A 2QSYA 4UJ5A 3VR4A 3IILA 4EPRA 1JNYA 1GOTA 3MWYW 4LC1A 1VPLA 2OM2A 2WMOB 3I61A 1XPOA 1J8YF 5ANRB 5AUOB 3AF4A 1DAGA 3B1XA 5KYKA 5A0FA 2F9LA 4DUGD 3FB4A 5C4GB 2JASA 3NBYC 1OB2A 2A5DA 4MRRA 3GQBA 2XAUA 4LBZA 4A0GA 4H9GA 1A5TA 4BZQA 5TXGA 3GJ3A 3B9QA 1XXHA 2SHKA 2HF9A 1GWNA 2HLDA 2FFBA 4NCIA 3CNOA 2LKCA 4GPTA 1GG2A 4L4UA 3AVOA 1OIWA 1NVVR 3I92A 5KSYA 221PA 2ZE5A 4BLPA 1PLLA 1CJMA 1B0UA 4Q7JB 5AK0A 1OLOA 2GF9A 1WRBA 3EG5A 3W8RA 3KZ1E 3UWKA 4IRUB 3T5DA 4KYUA 1XPUA 2F3RA 4OHWA 1ONBA 5JHGB 1OYWA 4OYHA 5FTNA 3AKCA 2OT3B 2ZANA 3P27A 3CRMA 1E94E 3BFKA 4RZUA 2BKEA 4M1MA 4RD1A 1Z29A 4FIDA 4C0JA 2QG6A 3VTKA 5FPYA 4LHVA 2J5XA 4Z8XA 1LS6A 1P2VA 5B2ZA 1KMQA 3WRYC 2GJAA 2ZVQX 2IYWA 4TLAA 2C95A 3MSXA 3KDSE 2QMHA 4V0LA 2XITA 1R8QA 1OYYA 5DE3A 1MO6A 2O0KA 3DOFA 3LFUA 4KCGA 4KO8A 1KYIA 2IYVA 1G16A 2CK3D 3KJGA 1BH2A 1NL3A 4PFSA 3LVRE 1IN6A 1E1QA 4GZMA 3RSLA 4OKSA 2V3CC 3GLHA 3TH5A 1XWIA 2N46A 4PC6A 3OE7A 3K0SA 1AGRA 3EXAA 2C96A 5LB4A 4F4JA 5BN5A 3C15C 2KE5A 2PZEA 1OXSC 2GDJA 4A6XA 2BV3A 2XSZA 1MRSA 4JVLA 1OH7A 5DYGA 3PQCA 1DAEA 2ZAOA 1P7CA 1TF5A 4TYQA 5E7IA 5B64A 2WVJA 3H84A 4KVGA 3LA6A 5K8LA 1KOFA 5JBQA 3ZVLA 4XVRA 1R2QA 1K8RA 4TTRA 4YQFA 3QPUA 1E1QD 5AJYA 2R62A 1OFIA 2WJGA 4MKGA 1Z06A 2E1RA 2MMCA 1D2EA 3ECCA 5LD2B 3LY5A 4R2HA 4Q1EA 1P60A 3A8TA 4WZ6A 1PUIA 4W9MC 3PEWA 1E32A 1Y3AA 1RW4A 5BQ5A 2AD5A 3QVUA 2ZYUX 4NYJR 1RFLA 1HV8A 4BZXA 2GBLC 4A2WA 2J0QA 1NMZA 3NEJA 3K0AB 3GLGB 1OPXA 4AKIA 1NVXQ 2Q3FA 1J99A 2EFCB 1TUEA 2GWHA 2WAXA 2VH5R 5L3QA 3OF5A 3TW8B 2P5SA 4P4UA 2NIPA 1FTSA 3W90A 2V7QA 5F9HA 3BD9A 1JR3D 2G9NA 2JJ2D 4GBMA 3SE0A 1FNMA 2OCPA 3QF7A 4NHOA 4B35A 2AN9A 6Q21A 1N6PA 2YZ2A 3QBTA 1QHYA 2CXXA 3GPLA 5G3YA 4D4KA 1GM5A 2ODEA 2XNSA 2ZS9A 3A1VA 3L8ZA 2WKRA 4FMBB 2QE7D 2ZSAA 4QGFA 5M04A 2IS6A 4JJKA 1GL6A 3SFVA 4IFEA 1RZ3A 2FPMA 3QI2A 4MRVA 4Q47A 4TT3A 5FBVB 2IYTA 4QGHA 1NIJA 3K9LA 1HA3A 4DIDA 5FTMA 4WZBE 2N1BA 1UF9A 2HCJB 5K8TA 3P20A 4AYWA 1FUKA 3LX5A 3RABA 4DLVA 1KO5A 3MJRA 1Q20A 1RJ9A 4B71A 2HCBA 1NBME 2WKQA 3KFXA 5LD2C 3EIQA 4IOKA 1XD9A 2IC5A 3H2YA 1E2IA 2KJQA 4HZUA 4K8OA 3QKTA 3IO3A 2GRJA 2NGRA 1E9DA 4GI7A 3WBKA 3REFA 2ZJBA 3LD9A 1G7SA 2VLIA 2KBEA 4US2R 3TIFA 4Q9IA 4FWTA 2GETA 4D25A 1NN3A 2IYSA 5LBIA 4DSUA 1N6LA 4QJ5A 3DMNA 3CRVA 1W36C 5FBRB 1B23P 5JRJA 1XXHB 2PMKA 4PX9A 2XNDA 2ZE8A 3CH5A 3K53A 3KFVA 3GMTA 2ZUCA 2ONKA 4TSFA 4HUQB 3ZVMA 1G8HA 1G1MA 1QVAA 5D3QA 2HJVA 1IHUA 4PZLA 1CJKC 4TTQA 3LV8A 1VYUA 3I8XA 4A6PA 4ACAA 1TUIA 4G5RA 3SDZA 1XD2A 3VAAA 1W4BA 1ZNXA 3IUYA 2J41A 2CE2X 3K0CA 4LBWA 4B33A 4FXPA 4IFBA 4ZIRB 3GJ5A 2J0VA 2DR3A 2ZS7A 1TTTA 4PHFA 1W4RA 5DHAA 4DCNA 1M7GA 1L2TA 1ETUA 1Z0DA 4FCVA 4HAYA 3ZVRA 4Q00A 1Q0UA 2R65A 4GT1A 4DRZA 2YWFA 3KKOA 4LYFA 2OV2A 3UIEA 1OXTA 5J4HA 2Q9AA 1SVMA 3KTAB 4LV6A 5E7JA 1GRRA 2WWGA 3R20A 2GXAA 1KAOA 1NY6A 3P1JA 1NIPA 4LY6A 2J7PD 3LBHA 2XTNA 2G83A 5GJCA 4FN5A 4ZDIA 2OXCA 4OHXA 1XEXB 2CLCX 3IEVA 4CIDA 3EPHA 2Q9CA 4Q1AA 1HT2E 1WB9A 3IQXA 2VRWA 5EE5B 2I1VB 4AKHA 1T3LA 3X1XA 4BLSA 4Q7LA 1G7TA 3NHAA 2NPFA 1YHNA 4JKIA 1U8ZA 1M8PA 1JALA 3WMEA 3RYTC 4EPYA 3CM0A 3VNUA 3GJ7A 1AGPA 5EE9A 3GEEA 3QXXA 4N1AA 3TGPA 3HYTA 4M21A 5SZHB 3NWJA 3QVVA 4PZZA 4LHYA 1QZXA 3X2SA 4FWIB 2IS2A 2PEYA 2W58A 3QF4B 2CNWD 2IYXA 4QHSA 3SJZA 3MLEA 2ZVPX 3PEVA 4XWKA 4MGZR 2ZIAA 5AJWA 5DO9A 1BS1A 4IXMA 3ZZUA 3DM5A 3TKLA 4TMVA 3V00A 4RZXA 4DLUA 2Q0HA 1CR2A 3W9YA 2JJ2A 3NHBA 3OFNA 2BKUA 1Z8FA 1MABA 4A8JA 2PT5A 1JXMA 1XCPA 3GFOA 1N5KA 4TL6A 4RKEA 1KI9A 1ZW6A 2MSCB 5EP1A 4D80A 4E03A 3CPEA 3TK1A 2RGBA 4CEIB 4JLMA 1BIFA 2FGJA 5SZJA 1CBUA 4GP7A 4DIEA 3FDIA 1SZPA 1VECA 3ZQ6A 2F1JA 3AGPA 1P3JA 4B3CA 1XFAA 1NLZA 2ODNA 2RHDA 2NZJA 2VQSA 3A1UA 4CYMA 2YWGA 2JIZD 1N3BA 3NBXX 3B5JA 3I3SR 3T06B 1NNEA 2IEZA 1C4OA 3TSOA 3QXSA 1ZU5A 2EFGA 4HDCA 2R6CA 3MAAC 1Z63A 3FHTA 2CCGA 1YZTA 1ZD8A 3IDQA 4KU4A 4NMMA 2RB4A 1E2PA 2X1VA 3CX7A 4D4LA 4L16A 2JLYA 2JIZA 2PH1A 1KK1A 4DZZA 2BMDA 1UADA 3A4LA 3BS4A 4GL2A 1Z0IA 3K0AA 1H8ED 2EYQA 1E98A 1HUQA 2F55A 3G5UA 1XCMA 2VL7A 3N2EA 1HE8B 1FPMA 1XJCA 2OZEA 2O8BB 2GZDA 2WWWA 4NBSA 5BYKA 3A1WA 5JWOA 3U44A 5JI2E 3QXCA 3PFIA 3R9IA 4YMVA 1NLYA 1ZM3A 2RGXA 3FHOA 4BEJA 1KSGA 1Z5ZA 2BEJA 2GJKA 4BQSA 3BH7A 3DVLA 3ZZ0A 4CT5A 2RAPA 4HAZA 3ZGXA 1NBMA 3LWNA 4TQUS 2XB2A 1KI7A 4UNPA 3ZLJA 2O8EA 1W5TA 4KFSA 3KKQA 2GEUA 1W4AA 2VHCA 2IL1A 1LS1A 4D4MA 1XXHE 2J7KA 3NC0C 1WBDA 1E9FA 3PXGA 2A5YB 1QVRA 3RDPA 1D5CA 1N6IA 2ASEA 3L0PA 3DHWC 4EPVA 2BBSA 2H5EA 2WHXA 2XOKD 2ZREA 3P4YA 3BWDD 4TZ6A 3LH5A 3UPUA 4PANA 1UKZA 821PA 1R6BX 2P6NA 4A8JC 2VHJA 3U7HB 5FOVA 5F9FA 2AHOA 1YZGA 1CTQA 3L0SA 1TQDA 1MO4A 4A4DA 2D74A 2GCPA 1NSFA 1OFHA 1S2MA 4YLGA 1TQ2A 3U3MA 5EUQB 1VCNA 3NKVA 2W6IA 4IKEA 4MYCA 1KIMA 1IXRC 1RRPA 3FMFA 5KNDA 3EZFA 4V0MA 3W34A 2CHQA 1JJ7A 3QKSA 1EWQA 2CCJA 3EA0A 4M9ZA 1FX0A 4URVR 1OFTA 3G82C 4B2LA 1S3GA 4OI0A 2QNRA 4UXHA 2RH5A 4LJ6A 4LUCA 2ZRHA 2C9OA 3AVPA 3H1TA 3WYFA 1SVWA 3IBGA 1EX7A 3RANA 5KDOA 2O8FA 1E9BA 4AC9A 2ZRPA 1DE0A 1D9XA 1DAMA 2C9YA 1EFUA 4ZCLA 3GJ0A 4YDSA 4OK5A 2KI5A 4WVFA 1W2GA 5CJ2A 2IA5A 5GADl 2F3TA 4EJSB 4QM7A 1OW3B 4W5JA 4M53A 3SQXA 1U98A 4A15A 3WMGA 4KAXA 4PC2A 2YOGA 1U2RA 1E0KA 4OQFA 3KJIA 5FUYA 5ELXA 1P72A 2ORIA 2ZTSA 1PLKA 1BMFD 2ZPTX 1ZM4A 2W2VA 3T61A 2HEIA 5FOUA 3U3JA 3AP3A 1W7AA 1RJ9B 1A7JA 4YMWA 2GK7A 2G77B 1XJ0A 3AKYA 4PAOA 5LPNA 4B3BA 2OBNA 2ZRCA 4TYWA 1Q1BA 3GJ6A 4S2EA 3ASYA 1KNXA 4OHZA 1RC8A 3I62A 2O8EB 2HXYA 3RRMA 1SQ5A 2OFWA 3LNCA 1JQJC 1VG9B 2JJ1D 3KJHA 3B82A 5FPTA 3TAUA 4Q4JA 1H8EA 1KI4A 1IM2A 2VHUA 2ZRLA 1G8YA 4JVSB 1UBFA 3DKPA 4LJ5A 1ZNZA 4C0KA 1E2FA 3OEED 3OEHD 3LQRA 4M1SA 2ZJOA 4ZKEA 5B58C 4A0RA 4HEJA 4IVPA 4AWXA 1ESNA 3AVVA 2QY9A 2VP4A 2X2EA 2ZJYA 4LYHA 3ZDQA 2IUTA 5JS7A 2GZAA 2I1QA 3QF4A 2J0SA 4B32A 1UEIA 4B73A 2REBA 1KO4A 5FI0B 4DT1B 1AIPA 1XEXA 2DYKA 2B21A 3L0OA 4F38A 1SHZA 2WIBA 1KI2A 3W3ZB 4ACBA 2HT1A 4LV5B 5CYPA 1EWRA 2C8VA 4YXWA 2OBLA 4GOJA 4FMCF 2IHYA 4MYTA 3C5CA 2C2HA 2X2FA 4OQLA 5B57C 1XBTA 4TLCA 5L8VA 3VFDA 3ZYCA 1F48A 1NKSA 3X1YA 4Y0AA 3PR1A 1U0HC 2FSFA 1GKYA 4LYAA 1FTNA 2BWJA 4JT4A 1ZNWA 3SFZA 1P9RA 2WOOA 3BOSA 3WYGA 4PAMA 1JR3E 1FL9A 1X8KA 1T3HA 2WWYA 2E9SA 3U4QB 3JZAA 4P33A 3ASZA 3NH6A 2JAQA 3Q7QA 3BGWA 1C9KA 3U44B 4QBIA 4WAUA 3UK6A 3RWMB 1AJEA 1Z2AA 5H68A 2QMOA 4U5XA 2QMEA 3SJAA 1KSJA 2AKAB 4LYJA 4NE2A 3QSYA 1TNDA 2ZRDA 4PO1A 2H57A 5KDDA 2FX3A 5FPHA 1E2QA 2ZJZA 4IW3B 4JLBA 1WP9A 4KFUA 4AYTA 3AVQA 2W83A 4M1YA 5KPDA 5GVRA 1IOZA 1Z07A 4PTLA 3RS7A 2VO1A 4CVNA 3KKNA 1GNRA 1KY2A 3KL4A 4LOAA 4XIGS 4IOMA 4Z1MD 1PJRA 4IOLA 2IYRA 5BXQC 4ILEA 1TMKA 2XJ9A 4TMZA 5FL7D 2O8DA 1XDBA 4OI2A 3TQCA 4ZV4A 3EASA 4TMWA 3H4MA 1IN7A 1AS3A 3K1JA 4MRNA 4W7SA 4D6PA 1QHHA 3TJZA 1FX0B 4QM6A 3NH9A 1VYVA 4YMSA 5HCNA 2ATVA 2V54A 3KQLA 2PJZA 5G41A 1MV5A 1KMHA 2WWIA 3LBIA 5DN6D 2XSZD 2BCGY 4JLNA 1A2BA 3D8BA 3EIHA 4P4SA 4QNMA 2VP6A 2NO0A 5FBWB 1XZQA 1YRBA 1E9EA 1R0ZA 2GXUA 3L82B 2AFHE 3EAQA 3PUZA 4QRHA 3SZRA 3LW7A 2CL7X 3TNFA 4US1R 3I5YA 3ADDA 5B30A 3AVXA 1HURA 4II7A 1KI3A 4DSNA 2ZJ5A 1ZMXA 1II0A 2ZRKA 2YINC 4B75A 721PA 1P2UA 4R9UC 2PLRA 5IF9A 3S1AB 4LI0A 1F2TA 1UBGA 1U81A 3D7MA 4PAQA 2IWHA 4IDQA 2FN4A 4HAVA 2IF0A 5BW8A 4ASUA 3UKDA 5JWHA 1BYUA 2IF2A 3M6AA 2B8TA 2XEXA 3B9PA 3BH6A 4P31A 4PO8A 2HYDA 2OO7A 1HY3A 1NN0A 3P4XA 4HYYA 2D4HA 4PQFA 4TMKA 4IDNA 4E22A 5JJLA 5TMPA 3AF1A 4MGIR 5DI3B 4Q4HB 2E87A 1ZRHA 4QHYA 3TRFA 1IN4A 4DSOA 1W44A 1G3QA 1DOAA 3AP1A 1UBEA 3VX3A 5JI3E 4LBVA 1NVUQ 5EXTA 3MUFA 4US0R 5DSZA 2G1JA 2FWRA 3DMDA 4ZPXA 4A82A 3LAWA 3WNCA 2GAOA 2QT1A 3NBZC 4MUBA 3WNDA 2WJYA 2RGCA 1TEXA 2F9MA 1G3IA 2RGDA 3UXMA 1G21E 2G0NA 3THOA 1IY0A 4OQMA 2OSBA 3SBDA 1E2KA 3BAFA 3DZ8A 3IIJA 2O8CA 2YWEA 3QBVA 4NPHA 2QM8A 3PG5A 3PV0A 1R0XA 3R9XA 5TB5A 3F3YA 4HLCA 4ABYA 4D82A 1ZJ6A 3QKSB 3FHCB 2EU8A 3GLGA 1EFRD 2FZ4A 3DZDA 1XTKA 2W0MA 2F43B 5TY0A 2DFTA 3GCGA 2JLWA 2QSZA 2WWHA 1H65A 2H18A 3S1AA 1VDZA 4ZDWA 5KSZA 3KTAA 2Z4SA 2XXAB 2YC2C 2FF7A 3RAPR 3CNLA 1AS2A 1U0JA 2R6FA 2J7PA 3GLHB 5D3MB 2WICA 4OJKA 1KZ7B 2CHVA 4QL3A 1P62B 5JEEA 1FMLA 1G291 2ECKA 3CH4B 2QROA 3QEOA 5CYOA 5FUXA 4B76A 1Z22A 2V6JA 2VHTA 2QTVB 2RGEA 1Q3TA 3IHLA 1AN0A 4G3XA 1EG7A 4TMXA 1D6JA 2FMXA 4DWJA 2XTMA 1CEEA 4HDOB 1SXJC 4C7OB 4CGZA 1XZPA 3FPAA 2OXRA 4TN1A 4M8NE 5J40A 1GRQA 5HCIA 4O3MA 1DPFA 1QG2A 5GJVC 5CLLA 1SVIA 4Q9JA 1QHGA 3MWLA 5L3VA 5FL7A 3RC8A 4IHQA 4FCTA 4KSBA 1E79D 3ADBA 1G6OA 1FUUA 2FZLA 2ZR0A 3CZPA 4URZR 2OCAA 1P9WA 3U6BA 3G0HA 5IT5A 3BB3A 1I4TD 2GTPA 3LVQE 3C41J 2GA8A 4Q1DA 2GZHA 3SOPA 3EC1A 4JZKA 3QOFA 3GD7A 2GILA 3EPLA 1E1RA 4EKDA 3KQHA 4XTCS 5FOWA 4E07A 1Z6XA 1FFHA 1W5SA 1GNQA 2CCKA 3FWYA 1IJEA 4TLDA 2H92A 3VKHA 4CT4B 1LB1B 4XWOA 3TSZA 2W0SA 3QKRB 4WA7A 4NU0A 4CF7A 2P5TB 1LF5A 5L3RA 4ZCMA 4JBWA 3B6EA 2HUPA 2IXGA 4QHTA 4OHYA 3U61B 4DT1A 2YC4C 4BFUA 1KSFX 2IUUA 1KDTA 3TAHA 2ONJA 3O8RA 3TVDA 3U3KA 1E9AA 1ELOA 3IPYA 5E3HA 4QKQA 2PMDA 3KQNA 4QBHA 3RLFA 4JYCA 3SJBA 3UMFA 4AI6A 3NVAA 3CF0A 2VP0A 5C46F 4OI4A 3BFVA 3RSOA 3QXJA 4DVGA 2QAJA 3KJEA 1H8HA 2PJRA 3I5XA 5IK2D 4AYXA 1SKYB 3LX8A 3TUJC 2Q9BA 3N70A 2ZM5A 4PHHA 2V6IA 4URYR 1SKQA 3QKUA 4O2RA 2CBZA 5F98A 1NVWQ 1E99A 5FL3A 1Q57A 3P26A 1RIFA 4ZI3A 4MH0R 4DLTA 3AEZA 2ZU0C 1ZM9A 3FMPB 2FA9A 2GJ9A 4C2TA 5KO2A 2BBWA 4Q7KA 1CKEA 1CR1A 2R6GA 4ESVA 5F3WB 4NCHA 1G19A 1UBCA 3QG5A 4N3NA 4BFTA 3CUEF 2GXSA 4HATA 1UKYA 4GP6A 1T8UA 1TF2A 4NL4H 1PVOA 2ZUDA 1P5ZB 1DO0A 2PL3A 1WF3A 2IT1A 3WY9A 5HKKA 1GSIA 2GEDA 3JVVA 2ZSBA 4RFSA 1XEWY 4EDHA 2HF8A 2XB4A 4LRWA 4TMTA 5CB6A 2ZSFA 1Z28A 4V03A 3ZD7A 1DVRA 1KI6A 1WCV1 2DWPA 2DY1A 2Q6TA 5JZVA 4O2LA 1LF0A 3D31A 1G3MA 4EIWA 4RD3A 3O8BA 2D7CA 2DB3A 1M1YE 1XMIA 4C0LA 1A82A 2D62A 1QHHB 3BH0A 2UKDA 1Z0FA 4J0QA 1A4RA 1SXJA 4UXJA 2QTFA 1ZU4A 1CULC 3CKLA 1XB2A 3EARA 2IWRA 4WXRA 2VPPA 2QA5A 3LW8A 1ZIOA 2W2XA 2JCSA 1UDXA 3RRYA 5EZ6B 2FV8A 2GXQA 3PENA 2KBFA 4JMPA 3T1OA 1ZBDA 2FJUA 1YQTA 3X1DA 2C78A 4ON9A 2AD1A 2A5FA 3PUYA 4OK6A 2NO9A 4NCNA 3U3OA 3AM1A 1H8HD 3M4YA 4MYHA 3DO6A 2CHGA 2HYIC 3CIOA 2R44A 1CR4A 2EVWX 3K0FB 1KDPA 2V1XA 3AUYA 1N0WA 3GLHE 1E2JA 1FQKA 1M7HA 3CONA 4JLJA 1EFRA 2PBRA 4YDHB 2Z4RA 3CR8A 3AF2A 4FI3C 4RD0A 5JFGA 2WWFA 2GCOB 4PQYA 1UAAA 3I72A 4O25A 4RZ3A 3ZH9B 3GLGE 1JQLB 2W2TA 1GNPA 2YOHA 4QG7A 3VR5A 5CB8A 2VF7A 2LCFA 2BOVA 3T35A 4YONB 4DLRA 1R5BA 4XD7A 4RKFA 4WZAE 1IONA 1T6NA 1WXQA 2IYUA 1KDRA 5EZ5A 3QG1A 1J2JA 1TQ4A 1O87A 1YR9A 2FPLA 2ZI4A 4OL0A 5E7MA 3TR5A 4GOKA 2ZJAA 3TBKA 4MDEA 4B3FX 4CEHB 3L2OB 4QGGA 1M6NA 1ZCAA 2LWIA 2C5LA 3TW4A 1QBKC 3JVUA 2GF0A 4RY2A 2XGJA 1E4VA 5FTLA 1G8GA 1GILA 3QKRA 4D2IA 1ZUIA 4PXAA 4R7ZA 4KFRA 4UKDA 3ZS8A 4DKXA 2C99A 5FBLB 2VP5A 3K9HA 4BGDA 1U90A 1R0YA 2HDNB 4U02A 5JJIA 3V9PA 2ZI9A 2D7DA 1FP7A 1LNZA 2J87A 1TU3A 3PUVA 3TE6A 3RVBA 1FOEB 2HV8A 3CF6R 3I73A 5CIQA 1OH5A 4V0ME 1N25A 1X86B 4A8JB 1NMYA 1F5NA 1P2SA 1K6MA 2IEYA 4X8OA 4F91B 4AK9A 1MO3A 4XOIA 3AUXA 4JJZA 5FI1B 4G5SA 3SNHA 2D2FA 3ZD6A 2WZQA 4B6FA 5CLQA 3WHKA 1Z6AA 1CU1A 1HQCA 2WSSD 2CEAA 3L0IB 4G5QA 5JRZA 4IVQA 2QTHA 3VMFA 2BVNA 1W46A 1XF9A 1TQ6A 1G5TA 4OQXA 3WMFA 4YMTA 3CWQA 5GVSA 5CIWA 4TLBA 3VKWA 2X8AA 4P0TA 3NC1C 5L3SA 2XZOA 1G41A 4Q9LA 5KDLA 4A1FA 4G5GA 2WAYA 3IQWA 4CW7A 2Z43A 4RD2A 2H1LA 1K5GA 1MH1A 4Q01A 1E0SA 3A1SA 3FGNA 4Q5IA 1E2MA 3EZ7A 4M22A 3AF3A 3RS4A 1OXVA 1N0UA 4UJ3A 4HLUC 3O47A 2WJVA 1SGWA 2ZI5A 3K0FA 3FKQA 2QAGA 3FKSA 2QU8A 1IQPA 1NY5A 3L8YA 4L15A 3F8TA 2GAAA 2YV5A 4MKHA 1Z6GA 1KI1A 1ZC4A 1F6BA 3IIKA 1E96A 4JLAA 4LSGA 3GJ8A 4EUNA 4MDFA 2GCNA 2GNOA 4PSVA 2YVUA 3C4JA 1MRNA 2QPTA 2CL0X 2GKSA 4I1VA 1IAQA 4NH0A 4PC7A 4DLSA 1XX6A 2XZPA 4DJTA 3U2QA 1YZLA 1KK2A 2F1RA 5CITA 4M1OA 3FKSD 3PEYA 3KKMA 5LB2A 1SVSA 2QUZA 2ZSDA 1CF4A 4LHXA 4OJQA 4M1WA 3PUWA 3THWA 3E2IA 4AY2A 4EJSA 1G7CA 4LZZA 3HYRA 4HZIA 4JLDA 3ND8A 1HEIA 2O0HA 2LKDA 1BOFA 3AP2A 4OBEA 5SZKB 2ATXA 4XSHA 5FOTA 2A9KA 2J46A 1KI6B 4L9WA 4C2UA 3GLFE 2VTKA 5H8WA 1EGAA 4RD6A 3A58B 1WA5A 1IXSB 1VTKA 4GFDA 3GLFB 3T1TA 3GEHA 4KBGA 1W4CA 2QBYB 2OLKA 1LVGA 2BBTA 5J4VA 2ZYVX 4AIIA 2ZU6A 5FPKA 3UG6A 2I4IA 4LX0A 2GVZC 4NYIR 2OG2A 3T1VA 3B13B 1JBKA 3THXA 2P0EA 3ZS9A 3DL0A 4Z8YA 5IDVA 2DFKB 1R5NA 1E4YA 1ZP6A 1XNJA 2F6RA 3SS8A 4NYMR 1QF9A 4NP6A 3TMKA 5FOSA 2EFDB 2GESA 2O5VA 4BLTA 1R10A 2G0TA 4BFSA 2IW3A 2OUKA 2GEVA 1YR6A 5FUVA 4D4JA 4LJYA 2Q3MA 2GVDC 1QHSA 2NMVA 1KI8A 2BMFA 3NTUA 4M1TA 5HZKA 3SYLA 1AZTA 1JPNA 5KHOC 5HR5A 4RCYA 3CWZA 4MRSA 4H1VA 4ZKDA 1GDDA 1P2TA 4O0MA 2PCLA 1IN5A 3IO5A 4I4LA 4DCSA 2NTYC 1KJZA 3IKJA 1TL7C 1E2LA 4B34A 4QNRA 3AVWA 2ORVA 2VP9A 1Z2CA 4JVNA 1NN5A 3LDAA 1HTWA 3CX8A 3K70D 4HZUB 1ZM7A 3B1YA 1II8A 2XTZA 3AV0B 4RD4A 4OI1A 2J9RA 3KUCA 1HE1C 4L8GA 2DWOA 3SHWA 2WV9A 5CM8B 3AVYA 5EXPA 2ZJ2A 3U7GA 1KK3A 3A6PC 1WMSA 3BB4A 3F0TA 2WMNB 4JBYA 4JYBA 4Q19A 1JR3A 2KWIA 2UZIR 5L3QB 1IJFA 2V8OA 1RPZA 4JVMA 2YNMA 1GITA 2YKGA 1DG3A 4QJ4A 1GVNB 1O3YA 1JEEA 3K8YA 1PLJA 2A2ZA 1M74A 2O8CB 3QENA 3NXSA 1SVKA 5J4LA 5JCPA 4B2PA 2X19A 4D81A 2O8DB 2CMKA 4P3YA 4EFLA 2FNAA 4D0LB 4DUGA 1KZGB 4CEHA 1RE0A 1HT1E 2BC9A 2ZRFA 1MO5A 3OIYA 2ZE7A 3SI7A 4KYIB 3B78A 4V02A 1W36B 2YWHA 4GMDA 2AXPA 3DKVA 2HLDD 1GFIA 3E1SA 5HE8A 3ZIAD 4EJSC 2NOAA 1KY3A 1E9RA 1G4UR 1NJFA 3MGCA 1KK0A 3Q7PA 4PC3A 5K8IA 2J3EA 2OILA 5DHFA 3MFYA 4AKGA 5J4KA 3KB2A 3BFXA 1DAFA 1OB5A 4C30A 3U4QA 1XTQA 3RHFA 4TZ0A 2QGZA 1TX4B 4RSGA 2ZRNA 2HXSA 3B1WA 3N5CA 4JSTA 5BN4A 4C0QC 3QPVA 1QHNA 3OEHA 4QXAA 3HP1A 3KXLA 2IYQA 1VMAA 2PZFA 1A1VA 4LDJA 1RYFA 5JS8A 4X8HA 3GJXC 4Q4AA 3W6NA 4NONA 3MWJA 4HB0A 4OQNA 3AVTA 4ARZB 3AQ4A 3QEJA 2RGNC 1E2DA 3PVSA 1P4SA 3I32A 3ZQJA 4C0BA 2QPAA 2IS1A 2ERYA 1R8SA 2OFOA 1N6KA 5KPJA 3DPUA 2GHIA 1N6OA 1OF1A 3C7KA 5CM9C 3GLFA 4JLKA 2JLXA 1E9CA 1XTRA 5AUNB 2QBYA 2ZRBA 3FFAA 2OEPA 4I1OA 1N2CE 4F4CA 2WBLC 4DB4A 5EUMA 4DDWA 4XVUA 1T3SA 5DYIA 3SEAA 1ZINA 4LCBA 3CW2A 1G5RA 2WM9B 3VKGA 1VG0B 1FMJA 1OSNA 3UATA 1KAGA 4HAWA 4U7DA 1MABB 3MMPA 3NDPA 5IHPA 1X3SA 5JECA 1D8TA 5C2JB 2EYUA 2G88A 1E2HA 4MITA 3GJ4A 1AQUA 2OCBA 1W0KD 2OFXA 4D0NA 3K70B 2I3BA 1G7RA 2P6UA 4HLDA 4B74A 2CVHA 4WXPA 4BPBA 1SVLA 4Z51A 1DBSA 3GLIA 1U99A 3BK7A 3L43A 2YYZA 4P4TA 4P4SB 1US8A 1EESA 5E95A 4JSYA 5DNYB 2ZITA 4GRAA 5FTKA 5K8UA 3UMSA 5TDHA 1UPTA 1LY1A 4NCJA 1OXUA 1TADA 1KO7A 3B85A 4KBFA 2NO1A 4LPKA 2HT6A 4MGKR 3K9GA 5EJEA 4UQOA 2H8KA 2JA1A 3WRXC 1ZVQA 2IXEA 4LPSA 4DEXA 1TPZA 1MT0A 2ZYWX 2F1IA 1XMSA 2IHBA 2YJTD 3A4MA 3BIFA 4LJ4A 3ICEA 3GFPA 1XTIA 1YU9A 1ODFA 5G3ZA 1G18A 2WWXA 1COWA 3B60A 4KLNA 2FEOA 3IPXA 4IDOA 4Q9KA 3EA5A 5FFMA 4DDVA 5C1BA 1WBBA 2QE7A 4LJ8A 3REGA 2ZUBA 1CRQA 4TWZA 3ADKA 2AFIE 4TL8A 5SZIA 2RMKA 1IXZA 2P67A 4EPTA 1RKBA 5E4FA 4DCTA 2H7VA 1AA9A 1Q22A 2Z0MA 4JL8A 3BORA 3K70C 1E3MA 5D3MA 5JEDA 2ZJ8A 2VSOA 4Q4HA 3Q5EA 4PSKA 3KX2A 4TTPA 4KXFB 3CRW1 3O8CA 2QT0A 3QUSA 1W49A 1QDEA 3Q9LA 2VYFA 3SU8A 2JJ8A 1Z08A 2KSQA 3VU9A 2PCJA 3CBQA 3B2EA 3U6KA 1EFTA 1BO6A 1II8B 4M2LA 4V0OA 4QGAA 4C7OA 3WP0A 1N5JA 5BWMA 1AK2A 5KTYA 2PX3A 3RC3A 1HQYE 3N2IA 2J59A 1Z3IX 3TVTA 1AM4D 1YR7A 3A37A 4BWYA 2B8WA 4BFVA 2QENA 1XCGB 5P21A 3AVUA 4BECA 1S8FA 4Q02A 4C4PA 1X8LA 2C04A 3DOEA 4JIMA 4L5BA 5F2EA 3X1ZA 3W6OA 1E79A 3E5HA 2JDIA 3SQWA 3K09A 1S0UA 3OEEA 4LC0A 4RCZA 4TQAA 5AWFC 4F4IA 4TL9A 2GJ8A 1YZUA 2RGNA 3H0KA 1FZQA 4QBFA 2XXAA 3J81k 3F5FA 3UMRA 1S9HA 4BFYA 4U00A 1ZNYA 4LHZA 1E2GA 3Q72A 5CK4A 4BLQA 1NMXA 3W5JA 4PZYA 4A0FA 4Z1MA 5AUPB 1CJUC 1WDTA 2AWNA 4CZ2A 2TMKA 4ZCIA 4WOPA 2ZR9A 5EP2A 3BRWD 3NIBA 2ZRIA 1W48A 4GOXA 4AKEA 3PJRA 2BIFA 4Y0VA 4IXNA 2WIAA 4URXR 2ZE6A 2FU5C 3SHFA 4Q4AB 1P73A 1Q21A 3PITA 3OIUA 4G0NA 1DG1G 5DIFA 3CO5A 3VR1A 2Z5FA 2FH5B 1NSTA 3DM9B 5TV2A 2D2EA 4JL6A 2BDTA 4TL7A 3HR7A 4KFTA 5KU1A 1P61B 1AQYA 2O8BA 1N5LA 2VBCA 1CXZA 1RVDA 1W0JA 2YOFA 4MUAA 3RS5A 4ZDKA 2AK3A 3OHMA 5KSPA 1Z0JA 4HAUA 4A9AA 3QQ5A 1GP2A 1FQJA 3ZJYA 1XMJA 2BMEA 2A5JA 1ANKA 1G8FA 1IBRA 1YZKA 4GZLA 4JLVA 1Q1ZA 4QBGB 2QEQA 4PPNA 2DHRA 4UNRA 4TYPA 4IOJA 2FOLA 3C14C 2NZ8A 3ETLA 1W0KA 1ZAKA 4EPXA 4G01B 4K46A 421PA 2D06A 2P3SA 5DN6A 4KLZA 3VQTA 1W0JD 5EE1A 1DELA 1C1YA 3HPRA 2IX3A 1UDWA 2B7BA 4WW0A 1QRAA 3VNVA 2R8RA 3D3QA 2B92A 1I4LD 2RCNA 2XJ4A 1DAHA 1WQ1R 2P2LA 2ZRJA 1VCOA 3C5HA 4Z54A 1DADA 1K5DA 1DAKA 1ZUNB 2JDID 4M9QA 3U3RA 3M1IA 1OJLA 2DFLA 1YJ5A 4Q7MB 5UKDA 3AKEA 3P32A 4LJ7A 1D2NA 1L7VC 4R71A 1S96A 2ZRMA 2FDCA 4PSAA 5KSOA 3QJYA 1E9SA 4TQ9A 1I2MA 1QHIA 1FW6A 1OHHD 3VHLB 1AKYA 2AXNA 5KNBA 3OIWA 3TQFA 2FSHA 2C03A 1U94A 2RGAA 2ZXUA 4W5HA 3HJNA 1J90A 2OAQ1 3FOZA 3MCAA 3I8SA 1CR0A 1CRPA 1T0JB 4EQ6A 1G6HA 2QL6A 2A30A 3I4LA 2ANBA 2ERXA 4M9SA 1US8B 1OT3A 3QE0A 2P6RA 3A4NA 1G17A 2VEDA 4FINA 3SYNA 2VA8A 4ZDJA 3PIRA 4Q18A 1NRJB 4KHZA 1Z0AA 4KV9A 3EX7C 5C18A 3ADCA 1JPJA 4JL5A 2IUSA 4IJMA 2QORA 3B1VA 3PCRB 4QJ3A 1VIYA 4NDZA 3Q85A 2EW1A 3ONWA 1II9A 3IBYA 1DARA 5IRCD 3UANA 2VF8A 4URWR 1P75A 2OESA 4QOSA 4C0AC 1OH6A 2B7CA 4ARZA 1ZYUA 4XVQA 1IY2A 1Z47A 4DDUA 1OXXK 4RFSB 3ZIAA 2G1KA 3OESA 1JI0A 2QP9X 2EFEB 4NTZA 4Q48A 1OKKD 4FD2A 2A7QA 521PA 1X8JA 1QG4A 5G53C 2QMUA 2OLJA 4BFXA 1KJYA 1GL7A 2NPIA 3B1ZA 4PHGA 1E6CA 2P65A 3Q3JB 5AUQA 2PX0A 2F7SA 1XD8A 2FSIA 2QZ4A 2ZAMA 4NKRA 2QN6A 4I1SA 1ZD9A 1KSHA 1EXMA 3AKDA 1HYQA 1NVVQ 1Z0KA 1NG1A 2AR7A 2XOKA 4X8LA 3W6PA 4EFMA 1XD2B 1YZNA 1YR8A 5FH9A 1XPRA 2Q3HA 4NYMQ 3GLIB 1GKIA 2R2AA 4BRUA 1EX6A 1ZCBA 2F1HA 3CZQA 4DCUA 1OH8A 5HE9A 1P9NA 2ORWA 2CDNA 4R98A 1I4DD 1CIPA 1Q1QA 3VHXA 1JAHA 4IEEA 5H70A 4EQ6B 3THXB 4JLOA 2QAGB 4ZI2A 1W1WA 4L9SA 4LHWA 3KQUA 1GZSA 4DC9A 1XTSA 1U0LA 3IIMA 3T34A 2QPOA 2HJGA 2MSDB 1A2KC 4URUR 2K5UA 4UNQA 2QAGC 1Q1EA 4NYJQ 3CRRA 4BLRA 4UXIA 2VHQA 2FPKA 4EAQA 2DWQA 2W00A 1JB1A 2QGNA 4BFWA 121PA 3NBFA 1JEDA 4G5OA 1DEKA 4GMXA 1XP8A 3KB1A 3T12A 1KMHB 2BEKA 1E2NA 1TU4A 1F60A 1N5IA 1S1MA 1F2TB 1U9IC 4FMDF 3CX6A 1U8AA 1R7RA 4ESHA 3RWOA 3SYKA 5AJVB 2EQBA 4DEYA 3E70C 2PLFA 1M7BA 3SBEA 4MKIA 1GIAA 2BJWA 1QHXA 1YKSA 1OFUX 2X77A 3U7EB 1GUAA 2DCUA 3MG9A 1G8PA 4DLWA 1NJGA 3A1TA 2ZROA 2OHFA 3WBJA 5DH9A 3CPJB 4DLXA 1CJTC 2FGKA 3K9NA 3K0EA 1KO8A 2VP2A 3OE7D 3EIEA 1OIVA 2WJIA 3OAAA 3UWOA 1VIAA 2AK2A 2ZI7A 3BB1A 2EWVA 1SKYE 3GFTA 4KODA 1KJWA 5JJKA 4WBSA 3SN6A 2ZR7A 3D6TB 5DI9A 1BYIA 4B48A 3HU1A 4HUQA 4S35A 4MRPA 1SULA 4LJAA 1KNQA 4DLYA 1JR6A 2CVFA 2OCYC 2ZETA 4C0HA 5DI3A 3BC1A 1KTVA 2AKYA 4BE7B 2JJ1A 2OAP1 3BBPA 4V0KA 2BM0A 1V43A 4LJ9A 4XTRA 3DDCA 5EE0A 1UKVY 2NQ2C 3THYB 1LW7A 4ITRC 4OK3A 4PHTA 3ZVNA 1NI3A 3IHWA 2B6HA 4JKYA 3CPHA 4IDHA 2BBOA 4IVRA 5H1YA 4PPGA 2W6JA 4B6EA 4A92A 1E2EA 3UG7A 4F7WA 2V55B 2WSSA 4XSGA 5AJXA 1OIXA 1IY1A 2Z83A 1EFCA 2V7QD 5J4YA 2PEZA 1IN8A 4HSEA 1LV7A 1S3SA 4IDPA 1VKJA 3LBNA 2AL7A 1G9XA 2ZYTX 3NEYA 3MJHA 2IBMA 1X1SA 3I1FA 1S1CA 3EZ9A 1RRCA 5L3SB 4ZIRA 1NG9A 2V1UA 1XMVA 1ZD1A 1VHTA 1VCMA 2IXFA 2JGNA 3SC3A 2N42A 2FFHA 3FVQA 3DEFA 4TYYA 1T91A 2G6BA 2QP3A 1TEVA 3KQKA 2Y8EA 1ZUHA 4CEJB 2NO6A 1F2UB 1S4QA 3C16C 3FYHA 4PO9A 4DXAA 621PA 4Q1CA 3R7WB 2XX3A 1X6VA 1E69A 1KKMA 3KXIA 1OKKA 1JECA 2G3YA 3GEIA 4B2IA 2J45A 4ERNA 2JLSA 3U5ZB 3LO5A 3LLUA 1JJVA 1KGDA 2Q21A 2H16A 2GK6A 4KI0A 3RRZA 2WKPA 4N0DA 4DHEA 3ND9A 1T5LA 4JT2A 4K81B 4DLZA 4Q03A 4GSYA 4TT3D 3NDBB 5KNCA 3BERA 4FW9A 1COWD 2ODBA 3EZ6A 2NO7A 1NP6A 1NLFA 3FMIA 2DBYA 3BE4A 1J70A 4KVAA 3THWB 1PZNA 3OIVA 1F3OA 4TSFD 3ZZTA 3HWSA 4MKFA 2ODWA 2QRZA 3CLVA 3RNLA 3VR3A 3BJIC 2EFHB 1RRGA 1E0JA 4DBLC 2F43A 4RZ2A 3MD0A 4ASUD 4LK2A 1P6XA 3WHLA 1PV4A 4FMCB 3QNUA 3R9WA 5J5CA 4CEIA 1XEWX 3IGFA 1J8MF 4P32A 1NBMD 4TLEA 4AURA 1T9HA 4HLQB 2WTUA 3U7FB 3T1QA 5GJBA 3CNNA 2W6JD 5EXXA 4QC2A 4YXWD 2QRNA 3K0CC 3TLXA 3GP8A 1WE2A 2QP4A 2A3RA 3RRNA 2BM1A 3CRQA 1OHHA 3AF0A 3TSWA 2JLRA 1EFHA 1NN1A 4Q9HA 2XZLA 3QPWA 2ZI6A 4DB2A 2CNWA 5TVKA 4TYNA 2W6ID 5FR2A 2VSXA 3EPKA 1J7KA 4GNKA 2J0UA 2WPDA 2VSFA 3QIAA 4NYIQ 1DTSA 4DSTA 4CEJA 1DO2A 4XD7D 1LFDB 2WSMA 4HLUA 2FFQA 3HPQA 4PPQA 3RS0A 2FEMA 2ZI3A 3HDTA 2PT7A 2ZS8A 2REOA 3KXKA 4Q1FA 2UZ3A 4DCVA 2C98A 4OHVA 1G3RA 2AX4A 1OV4A 1M34E 1Y63A 4M9XA 1AS0A 4C3ZA 2GCOA 5TARA 3W8NA 1VG1A 2FG5A 2ANCA 2WPDD 1W47A 4C0SA 5J47A 4HAXA 1KKLA 4PQRA 4CRWB 3R7WA 3EPJA 1GRNA 1N6NA 1LTQA 4LBYA 3WYAA 5HPYB 1G3UA 2DFNA 1KHTA 2CK3A 2O52A 1Q3HA 1UM8A 1XJQA 2WJHA 4E09A 2R6DA 4B44A 1VG8A 1W36D 1KO1A 2BMJA 2R6AA 4I1UA 5DISB 5EQTA 1GKUB 1T5IA 1UKEA 2R9VA 3SR0A 4AG5A 4KITB 1GL9B 1UJ2A 4XH9B 2MSEB 1L4UA 1Z6TA 2EWWA 3HU3A 5JCZA 3MWKA 1HH4A 2MMGA 4BRWA 5LDDC 3OZXA 3AGQA 2ZRGA 4B3GA 1L4YA 4QFMA 3O8DA 3JZMA 1RYHA 5JWRA 1XU4A 1R0WA 1VYTA 3BXZA 4G1UC 4Q1BA 4ZO4A 4BLOA 5HKKD 2GJSA 4H1UA 4WIAA 5BYJA 5A5GA 1CP2A 3PUXA 2CJWA 8OHMA 1AZSC 3EWSA 2CLSA 3WXMA 3M0EA 5JMTA 2QI9C 4JLPA 4POAA 4HDQB 5BN3A 4I99A 1UEJA 2JLVA 1E0AA 1KDOA 2QQEA 4JS0A 4LWZA 3OFND 4D0GA 3TUIC 2V9PA 5CJPA 1M2OB 2O8FB 1MR3F 3T5GA 2BJVA 2WJJA 3C8UA 3TR0A 4EFNA 2FFAA 4DDTA 3Q8XB 4BUJA 2A5GA 2BHRA 4Q4JB 1ESMA 4IEIA 1L8QA 5JLJA 2QQ0A 4BASA 5A4JA 1F2UA 1JXOA 1SXJE 2REXB 3B8HA 4B3DA 3GLIE 5G40A 5CDFA 1SXJB 4M1KA 4V0NA 4CDGA 4EPWA 1D2MA 4NCKA 4MQBA 4AG6A 1YZQA 4PC1A 1X1RA 1N6RA 4HB3A 2IYZA 5FTJA 1GTVA 3HU2A 2JLQA 3THYA 5C4MA 3QY0A 4BEBA 5EP4A 3KKPA 4Q4LA 4A2PA 2Z6VA 4KSCA 4YC7A 3MRSA 1G4AE 2GBLA 2UVQA 3EW9A 2CE7A 1YE8A 2CLDX 4B3XA 5JSZB 3LXRA 3V4RA 3R8CA 3SJCA 2AWOA 2QM7A 2RHMA 4FMDB 1R4AA 4HI0E 5GJWC 3LRPA 5FOXA 3RS3A 3NG1A 4XJXA 4BFZA 4F93B 4AD8A 3VR2A 2FSGA 2C77A 2IYLD 1BKDR 5EXSA 2PZGA 4HUTA 4LGMA 4YMUA
chains in the Genus database with same CATH superfamily
5CDFE 1K7YA 3ZE1B 1ISGA 1WU7A 1ZITA 2SKEA 4C9BA 1G4HA 4MUYA 1PUJA 2GERA 5HZMA 1KQ3A 2GTHA 1UXIA 1HE4A 3CTMA 3D1VA 1S9DA 5DIZA 1U8YA 4P08A 1W25A 3HL4A 4NNJA 3V4FA 1OZFA 4LVCA 5E1BA 4JI8B 4JYMA 4ZA2A 1CS4C 2PGJA 2WIGA 1S2LA 4A2QA 4B6PA 5CBKA 2JEOA 2V0NA 3INYA 1ZIPA 4BZPA 1FFGA 3OI7A 5LN1A 1GZ3A 3ER6A 3ICOA 2OBMA 1KMIY 2VDMB 3FFBA 3LL4A 4RL4A 3RVJA 3WGOA 1DAIA 3BGOS 4KE9A 3VX4A 1SBIA 3ZWXA 2I3AA 2NG1A 3VU9B 3ZHSA 4DSZA 1J2RA 4Y2UA 1C9NA 2UYQA 2BPOA 4XFKA 3ICQB 3UHFA 1USIA 1YI8A 2ZDGA 4MYUA 1AHIA 1BFUA 3PICA 3R41A 1DS6A 2ZQ5A 4RAQA 2X3FA 2QW0X 2I4NA 3PYLA 4BXOB 4JOBA 1F9AA 2V4MA 3Q5DA 1BTOA 2ONYA 2JI9A 1T0HB 3UK0A 5TLSA 3HVHA 4P54A 2DLNA 4QTYA 2P79A 3V8MA 3DKKA 4UEQA 4U3JA 5E9JA 4CI9A 3HUFA 4ZT5A 2PUCA 1J8QA 1KEEA 4RVCA 4DNOA 5MHTA 1E2BA 1ZOSA 4AKSA 4EGSA 1A5BB 5TSDA 2JGRA 1IM5A 2YWDA 4XRGA 2A78A 5KMGA 4I46A 2CHFA 3BMCA 4JQSA 3ZGLA 4N0QA 1Y81A 5FPSA 4ENPA 4Y6LA 1UBTS 5EPOA 2IYYA 1C3OA 2OCKA 1Y98A 4NRDA 5HTKA 2AG0A 3AZQA 3LOUA 1QVZA 1VCIA 1VSVA 1TF7A 2JIOA 3DT9A 3IEUA 4IR7A 4KN8A 4M0EA 4QTTB 5DHQA 5K6RA 2JK0A 4RTMA 3NNNA 4ER6A 1J0CA 1JDZA 4LZOA 4NMHA 1WOYA 4ZGBA 2P2SA 3FVWA 2IK8A 3LLMA 2AB0A 3R6LA 5BSMA 3RRBA 4DR4B 1OZGA 2OE2A 3AB3A 4I66A 2PKQO 4QUDA 4U2FA 1OC4A 5J59A 3X1WA 1QVWA 1XEFA 4BJ3A 1CLUA 2D3WA 1XZFA 4OBWA 5HK8A 3ZEAA 4DMMA 7ABPA 4MW2A 1SR8A 2Z8YM 1XJWA 1V37A 3KE9A 1GD1O 3FOCA 4QPNA 4XX1A 2C83A 1YA8A 4E5UA 5KNLA 3R8FA 1UXGA 4UZSA 2C9CA 1Z33A 4UNSA 5JHHB 2ALJA 4F84A 3FTQA 4CG0A 3RD5A 4G0PA 1P7ZA 2J6CA 2Z8YA 2HCFA 1DBQA 3CB4A 3OCYA 4MGYR 5F4ZA 2CL6X 2BCJQ 3GT4A 1QPGA 4W8HA 5BR4A 2FW8A 2FR0A 3MSCA 2J0UB 3RC1A 1IM8A 3OQPA 3HR8A 4YRNA 3CN9A 5JNWA 1JBQA 1ZC3A 1V5WA 2JBAB 3TYXA 3V8VA 4CCWA 3EGVA 3R4VA 1T4GA 2IS4A 4KJZA 4PR0A 3EFHA 1FFEA 3BKWA 4I6JA 2NLOA 4PQEA 3IDOA 3RBVA 3C8DA 1A72A 3EXHA 3S2FA 3VKFA 4L8LA 4OOFA 4RYDA 5JQGF 1JG1A 3A9VA 1MKYA 3NORA 3P2MA 3WSTA 4A36A 1F8FA 2QRKA 3ZK8A 3IMEA 3UJDA 3VR4A 4A6DA 2WC1A 3V4VB 1GOTA 2C4KA 4R1LA 3C48A 4MINA 4BKMA 1IWOA 1VPLA 5DTEA 3I61A 2C31A 4YMIA 3RF7A 4KR6A 1J8YF 1U0EA 5GONB 3RG2A 1DAGA 1F6DA 3QX7A 3S55A 1J42A 5AUOB 2AZTA 4WUVA 5A0FA 5C8ZA 4V1CI 4LMAA 4DUGD 3FB4A 1AHHA 4KB5A 2BFNA 3M9LA 2JASA 5GMOA 3TFOA 2N47A 5B58T 4ALMA 1JKMA 2NXEA 3JALB 2I66A 1A5TA 4BZQA 3GJ3A 1T2CA 2DLDA 1E18A 3RO7A 4WJLA 4CKWA 1QIKA 4EI9A 4OXQA 2HMSA 4GPTA 4L4UA 1W8DA 5JE8A 1OIWA 3I92A 3LM8A 2VG8A 1CD5A 4Z3KA 5JADA 4YYZA 3PNMA 1MJ5A 4JUIA 2MINA 1LBSA 3PFKA 4Q7JB 4PX5A 2ZW9A 3TQIA 2GF9A 2VT3A 2OAEA 3K15A 3EDQA 3UWKA 3UEOA 1I3NA 1IUNA 4KYUA 3ROKA 1Y37A 4KYTA 5K0FA 2F3RA 1BMDA 2RHRA 3BMNB 4G5HA 5F5XA 5L4SA 4X62B 3FJOA 4OYHA 5DLPA 4ED9A 2OT3B 2RG1A 5IDWA 1C2YA 3NTXA 4M1MA 3ZDDA 1Z29A 4KXVA 4H7EA 4CKXA 1NFQA 4PZCA 1SCAA 5FPYA 4BATA 4IQGA 2J5XA 3QBJA 1KU0A 1P2VA 5B2ZA 1KMQA 5BN3B 3RODA 5B12A 4BQNA 4DCOA 3A26A 5TE9A 2YASA 2IYWA 1NRIA 3OM1A 4IICA 4DUYB 1RJEA 2C95A 2R7NA 4V0LA 3PDJA 4EMUA 4N5NA 1MO6A 3LFUA 3F7TA 4NBLA 4NESA 4L95C 2HAEA 1YDHA 3HCBA 4GZ6A 3UBTA 1TEZA 2FPGB 2CK3D 5DGDA 1NL3A 4GX2A 4EB0A 1D1TA 4L5CA 3RSLA 5LJIA 1AC5A 5ALXA 2ZIXA 2QZPA 1XWIA 1GCUA 3PPVA 4EM6A 1V8PA 1XKQA 1DBIA 3R7DA 5BPFA 1OGIA 2C4WA 3K0SA 1AGRA 1FU4A 4YX9A 4GR9A 2ID8A 1FB5A 2C96A 2PS3A 5JG7A 5KREA 4OV6B 2JFFA 2KE5A 1HQDA 1CYDA 1OXSC 3KB8A 2JVJA 4S24A 4A6XA 1JMVA 4QU5A 1H6AA 3PQCA 1LZKA 1DAEA 1FSFA 4R1SA 4TYQA 2CDCA 5B64A 1NU6A 3V6MA 4DJFC 1CNEA 1KOFA 4B3TB 4WOBA 4YCDA 2W71A 1ZUWA 5DM1A 4WK6A 5DWVA 2JBWA 4AICA 5I7UA 1E1QD 1P0MA 3GYGA 3N76A 4MB6A 4O4LB 5AJYA 5DW0A 1SU8A 2R62A 3UGKA 4PLGA 1OFIA 1GKLA 1SUCA 5JFOA 3DQPA 4ND8B 4P2GA 4MKGA 1JPUA 1QRDA 1RCUA 4PG4A 2F8SA 1YVEI 2FMKA 5H80A 4XGIA 1BDHA 1SELA 3K1ZA 5F21A 2FUKA 3H1PA 3NHWA 4Q1EA 3L7IA 5JPIA 1KE2A 4HH0A 4GH5A 5FT9A 5BQ5A 3ZE8A 1NI4B 1R66A 2AD5A 2A35A 2O8CB 1PJ2A 4BZXA 3O3CA 1QM5A 2C7RA 3K0AB 2OV8A 3V80A 1KPHA 1AB6A 2C5AA 3ECAA 2BZSA 3N87A 3SZUA 4BKUA 1QSGA 2GWHA 3RV3A 1D5WA 1FMTA 1GQQA 1VJ0A 4KQ9A 3O6VA 3VPSA 3T8YA 4IAOA 5LP6B 2QJRA 1KQFA 1FTSA 4RDIA 4OXXA 3W90A 4BX0A 2BR4A 4IJQA 4BNFA 3IL2A 2JJ2D 3HADA 2XOEA 4NHOA 1A9TA 3TLGB 1AU9A 1FTQA 2OKGA 1XALA 2AN9A 1RZRD 2VK2A 4F72A 4MVYA 2WTXA 3QBTA 3X2EA 1YULA 5G3YA 2AOVA 2HN9A 4RNDB 2XNSA 1LK0A 4FMBB 2QE7D 2ZSAA 4QGFA 1YQUA 1Y6GA 5KX5B 4MVJE 1CUHA 1XCJA 2VJLA 4BO2A 5HJEA 4CKEA 1YS6A 1ECGA 4FLEA 3MOIA 3PP8A 3WLEA 1T2UA 1DU4A 2I6SA 1J2EA 1DJQA 3C5EA 1T5BA 2E89A 1NIJA 1R6DA 2E5WA 3K9LA 4P5DA 1C1HA 5FTMA 4E0BA 4WZBE 1LW6E 2WYWA 1UM9A 1QIEA 4PAWA 3I4CA 1MJGM 2QJFA 1XZ8A 4HH1A 1UF9A 3DL4A 1JN0A 1B26A 3GEPA 4RIFA 3P20A 4WEOA 1FUKA 3RABA 3QKIA 3MJRA 4U8HA 1GL3A 5BUCA 4B71A 1BEUB 1JLHA 1YKFA 2CXNA 2HCBA 3C1AA 2JI6A 2C58A 4DJJA 3EIQA 3DDHA 4X1IB 3VR5H 4HZUA 4MIOA 2IZ7A 1TLTA 4RTNA 3JWHA 2C5GA 1IXKA 2ZJBA 3IE1A 3MTQA 2H65A 4US2R 7GPBA 5CX4A 4Q9IA 2VHZA 2OMKA 3R3VA 1NN3A 1YKGA 2IYSA 2EEZA 1L7XA 3KU1A 2QRGA 3HJGA 4WSOA 4QJ5A 4D9FA 4DSUA 5FBRB 1JAXA 1DXYA 1QF6A 1Q83A 3JWIA 3K53A 3TMAA 3GMTA 1YR3A 4GGPA 1LUAA 2ONKA 4TSFA 4X20A 4D3FA 2OBBA 5CT9A 4WMLA 4HDMB 3HXLA 1BFDA 2HJVA 3FTNA 1IHUA 5EINA 4MVJI 3W0LB 4YTEA 3TZ6A 3NLLA 3ZZNA 4A8PA 1M75A 3GVCA 3TW8A 3J80A 2CWDA 4FLFA 3JXEA 2ZUWA 4CI0B 2DAPA 1QRTA 1OVMA 2FPPB 1XD2A 2QVGA 3K4QA 4FYYA 1W4BA 1V9LA 1O94A 2FR1A 2P2NA 2P8JA 1CIVA 1QGUB 1OXKB 3I6QA 3QX9A 4H0NA 4B33A 4RANA 4UTRA 3E3OA 3GVIA 2QM3A 1MAVA 2DR3A 3G79A 4HQ6A 3BGSA 3QV2A 1J1ZA 3B51X 3I5AA 1FYDA 4LJKA 2PZ8A 3EXEB 4P84A 3SXJA 3EVZA 2JGEA 3QFSA 3NOQA 2R65A 5C5IA 3L7YA 5D5HA 4LYFA 2C9ZA 2OV2A 3RIMA 2HNKA 1OXTA 5C8VA 1IBLB 2I91A 2ZGVA 4XDYA 4L78A 5E7JA 2CZCA 5CRIA 1IVYA 3HVIA 3VZRA 5BQFA 3R20A 1KAOA 3OIDA 1NY6A 4W5TA 4UHEA 4JXZA 1U4SA 1DIOB 3O2SB 4PV7A 5FPQA 2CMGA 1ZS9A 5AI9A 1KYWA 1NP7A 2G83A 1K4YA 1IH8A 2XTNA 4OA8A 4RSMA 5GJCA 1H5NA 3IJEB 4ECEA 2HSWA 2CLCX 4NBVA 2C4VA 2UUBB 4V1CB 2PMCA 2Q9CA 5DTRA 1DCTA 2XYQA 1ESEA 1ADBA 1M1YB 1NUHA 2F3UA 3PC8C 4U9IS 1HT2E 2HPVA 2JGFA 4ZVPA 5JCOC 2VRWA 2I1VB 4AKHA 2OCGA 2DHCA 2HCRA 4NEQA 4P81A 4AL4A 2ZATA 2UYHA 4JYZA 1J23A 1KFEB 1K2WA 1Q7CA 3AFMA 1YHNA 3HRKA 4JI6B 3M2TA 1M8PA 2HRZA 1Q50A 1RLJA 3A7EA 4Q6BA 1RRMA 1XU9A 4UMEA 3RYTC 3V7WA 4B79A 4EPYA 1BDMA 3VNUA 3TNLA 5FKJA 3VH2A 2YHUA 1SG9A 2CKDA 3ANNA 1U5BB 1ZUD1 3S68A 4ZK6A 1IIRA 5KNCH 2L17A 4N1AA 4BX3A 3EQZA 3HYTA 1F1BA 1O94C 1ZNQO 5A5VA 5JSYA 5SZHB 4BYMA 4L4XA 5JAOA 1R8YA 2ZWIA 2Y6VA 1UMDB 3WKDA 3WLPA 1QZXA 1IK6A 2PJDA 4FWIB 4MWDA 3X2SA 1K9VF 1WO8A 2W58A 3HSSA 3DZBA 3DMRA 1C7FA 4P3KA 5EZYB 2UVPA 1PDWA 1T5OA 4MWZA 2H52A 1GPWB 4IV8A 4DRXB 4HQNA 4NBKA 1MORA 2ZIAA 3IEMA 3JALA 1V4BA 5KYVA 3V00A 5A9SB 4DL9A 1QQ6A 2Q0HA 3KIPA 1SMKA 1HDCA 1CQZA 3U9SA 4IJ5A 2CLEB 1O2DA 4OP3A 2EJCA 1JT2A 1AE1A 2BKUA 3NHBA 4O4HB 1MABA 4YPVA 2PT5A 1EXVA 2M6SA 3I4FA 2FKNA 3KV3O 4OH1A 5HOEA 4AO8A 3L7JA 2G40A 4P5PA 4GE3A 3TIVA 5FHQA 5IVIA 2Q6IA 3CPEA 4K9LA 3TK1A 1T24A 3AG6A 1EE2A 4RHEA 2DF8A 2C2ZA 2DP4E 3FDIA 4DIEA 3ZQ6A 5BRAA 2F1JA 2OXEA 1P3JA 4IS2A 2H2FA 2SCUA 1XFAA 3AEYA 2ODNA 3ETGA 3H2JA 1MP0A 2OOSA 2FFJA 3SF8A 1N3BA 3B5JA 3KZOA 3OM0A 3T06B 4NZOA 2IOYA 5C53B 3FD8A 4FFBA 1X1AA 3QXSA 5FEMA 3IPRA 4FEAA 4MUGA 4BE4A 1KBZA 2BELA 2CCGA 2RBGA 4EB6A 3WYCA 3IDQA 2QTTA 4KU4A 5KAPA 1A8SA 2IV3A 1SCIA 2RB4A 3CX7A 4MTCA 1HRDA 4TM8A 4C4RA 5AVRA 4HZGA 3W2IA 1VE6A 3DMTA 4L72A 2ZTLA 2JRLA 1USKA 4N12A 3BWMA 4RNCA 3A4LA 4ENVA 5BVGA 5JDIC 5JQWA 3DXZA 4F11A 3ORQA 1H8ED 3TINA 5KTKA 4IMRA 4NWIA 2JIBA 4G41A 3VVLA 3GBPA 4BX2A 5K4GA 4UZFA 3TDMA 2P2ZA 2UAGA 3CNHA 4FDVA 4LF9B 5HIIA 1R0KA 1HE8B 2OZEA 4QYWA 2WWWA 3PNLA 3U44A 2MCFA 2AG8A 1XKTA 2CN1A 1H4VB 3R9IA 4YMVA 5EL0A 1KYYA 1YUBA 2HFJA 3INGA 4HQKA 4BIIA 4KQFA 1Z5UA 5AQEA 3AT1A 3SFTA 2HDWA 2YIVX 4D98A 3BGIA 2C2BA 1ZISA 2D8AA 4CT5A 3ZI0A 4CKCB 2A1UB 5BWCA 3CMMA 4I55F 1P0IA 1G21B 1DI0A 2JIMA 2J9FB 3LWNA 4CR8A 2XB2A 1GY8A 4UNPA 1YIDA 1W5TA 2WSIA 2P4SA 1NV8A 1BXZA 3PVZA 4UBKA 3UHOA 3DDSA 5A6SB 3LKVA 4WVFA 1AQLA 1W4AA 3V42A 2YQ5A 5LOVB 2VHCA 2C84A 4M8IA 1LS1A 2E4AA 1NM5C 3EE6A 3FUXA 1PU2A 2WJPA 5B3AA 1Q0PA 1UPBA 3RVLA 2EQ5A 1HDXA 1N6IA 4H4DA 2G06A 3G7NA 1XMPA 5AK4A 1VKRA 4FFPA 2CNDA 1YOBA 2H1VA 2WLTA 3P0RA 3UXHA 1OAOC 5IJWA 3P4YA 1U1DA 1L4NA 3A4TA 3BSYA 3HUDA 3LH5A 2YWRA 1UKZA 2EOAA 2LDBA 3I37X 5HNKA 821PA 4GSKA 3NBUA 3D6UA 2PKRA 4X20B 4XZ3A 5FOVA 3D8RA 3SKVA 4BS9A 2AHOA 4G9EA 2QSUA 3FUTA 3NPAA 5GONF 3BWBA 1EP3B 2FZGA 3PZRA 3S99A 1RPAA 3ZWNA 5E4JA 3U3MA 4COKA 1VCNA 3NKVA 1JYEA 1X1QA 3IEXA 4V39A 1FLAA 2D0DA 5DM60 4Y2YA 3T3EA 3TZCA 3R7AA 2GKGA 4BFLA 1ZOLA 1LV8A 1RYYA 2INGX 1GADO 4AROA 2VHVA 5DYNA 4LVOA 1SU6A 5CUQA 4LF5B 4URVR 4FOPA 3AG5A 1OFTA 2O05A 2FEXA 4I5FA 4UXHA 5JNTA 4LJ6A 3LOQA 2ZKIA 2ZRHA 3T9BA 2KLHA 3PD0A 5IS2A 1I80A 3TRIA 2VPIA 3IUQA 3S7ZA 1F20A 2CLHB 3RUIA 3RANA 5KDOA 3NHPA 4YV7A 1L5LA 4ENRA 3Q5GA 2C2WA 2ZRPA 2GASA 4PGFA 2SNIE 4ZOBA 4AT1A 4BAZA 4ZCLA 1D4OA 4RPIA 1ODLA 5LFAA 2F3TA 4EJSB 1J9GA 2GLXA 3OOYA 4W5JA 4QM7A 4M53A 1WLSA 2WEKA 4CKEB 5JCJD 2XCOA 1Q0ZA 2VCEA 3AINA 4KAXA 3DLTA 3ORFA 5F7XA 2YOGA 1UAGA 1T1SA 5T8KC 3WQBA 3F90A 4GIBA 1EEXB 1YS9A 1U0SY 1J56A 3U3XA 4AN4A 1ORWA 1ZM4A 2BN4A 2FOIA 2X76A 4B2YA 3QE4A 4B0PA 4UM9B 2W2VA 2F64A 1QFSA 3DLAA 2OV1A 3RGGA 5AESA 2HNBA 2H0AA 1AX9A 2PV7A 3C2QA 4ND2A 3AP3A 4RK0A 5FOUA 3MIIA 4E11A 5EZSA 2B1JA 3GNQA 2GK7A 4OBBA 4XA8A 3KU4A 5J2TF 4B3BA 1CQIA 1Q1BA 4H7HA 1TA0A 5G0SA 3ITKA 5K4HA 1Z2DA 1H0HA 5DOVA 2FZVA 2QXYA 2GHQA 1P1KA 2HXYA 1EGQA 3STUA 3ESCA 4RY0A 2CYCA 3TKYA 2GT1A 2NTVA 2VDRB 2HBQA 2AOTA 2Y0PA 3L05A 3KJHA 4H3VA 3KKZA 3L46A 2H5LA 4RXTA 1JHYA 4X94A 5FPTA 3I2JA 1VGVA 2UYYA 4YRFA 2OO3A 3R7NA 1FVFA 1CNMA 1ICIA 4X1OA 5G4LA 4KQMA 1E1CB 1EK6A 1E5XA 1H8EA 2DZDA 3HB5X 3L6EA 2D3TA 4KN9S 4L02A 4H4EA 1CZUA 4QDJA 4RK6A 3BREA 4EWLA 5J1SB 1G8YA 1CLEA 2GZMA 4AS2A 1XCLA 3CG4A 3DKPA 5GM1A 5DP2A 2WQ6A 4YREA 1SIOA 1ZNZA 1E2FA 2RJNA 1DKNA 3LO8A 4M1SA 2ZJOA 5TS3A 1RQXA 1M6VB 2WTEA 3L6OO 3MXTA 4HEJA 5EG5A 4NF2A 5JJBA 3AVVA 1U63A 1A5SB 3OECA 1MC8A 1V48A 2ZJYA 4LYHA 3L8HA 4TZKA 4RESA 3ZDQA 3QF4A 2VYCA 3ZZ1A 3FNBA 4B32A 1SQGA 5I6DA 1UEIA 2R8YA 3T7JA 4B73A 3GAAA 1O9HA 3V5NA 3GT7A 3OFKA 5JS2A 4UAVA 2FQXA 1OAAA 1XEXA 2DYKA 2B21A 1P0FA 1SHZA 2BGKA 2VJOA 1KI2A 3HDHA 3W3ZB 4ACBA 4LV5B 1AG9A 2GHRA 4TTJA 3FNRA 1EWRA 1GPUA 2JH9A 1JQDA 4M1ZA 1JAZA 3CINA 3EEIA 3WK9A 5JZMA 2WHPB 2QIOA 1G2QA 3CY6A 5JSQA 3ZE7A 3FPFA 2R8BA 4LRTB 4GOJA 4QYIB 4AKTA 4MYTA 2IHYA 1IPEA 2E3JA 2HJWA 1HKUA 4B7XA 3PX3A 1KBQA 2PUJA 4CLOB 3STHA 3BD8A 1XBTA 1N2JA 1P4RA 1TIPA 1YF3A 2WG0A 4OMDA 1KOLA 1QK3A 2PGXA 1SBNE 1DKRA 3VFDA 4UFOA 2ZIVB 2FUCA 3UJBA 2EKPA 2RIPA 2G71A 1PT9A 4LYAA 5A03A 4R8VA 1WM1A 3H04A 4Y1RA 4CLHA 5BVHB 1QQBA 2FETA 2GZ3A 2JJMA 2Z2IA 3BOSA 1JR3E 3L1UA 4I55B 5FWYA 3R7BA 1X8KA 3Q9UA 3PBKA 2E9SA 2IZ1A 2X3YA 3F6RA 3I09A 4Z9BA 3U4QB 1AMNA 4UTVA 3JZAA 2BRUA 3ASZA 3BILA 4ITUA 4ML3A 4E7OA 2RHBA 3CRNA 3G9UA 1T3TA 2C7GA 1EM8B 2PBLA 3BGWA 1C9KA 2R00C 1TFUA 1GPDG 1SZJG 1ZGJA 1O95C 1PDVA 2QMOA 4H3SA 3OCCA 4U5XA 3SJAA 4K9SA 1K3TA 2W6QA 4DIMA 4LYJA 5IH3A 3I8OA 3K1JA 4RF4A 4HXGA 2H57A 5KDDA 4KO4S 1YONA 3OF2A 3HTXA 1UQTA 2ZJZA 4JLBA 2HBZA 2W4IA 2C4HA 3H7AA 5DBEX 3KLPX 2VT2A 4OXYA 3E9RA 5KYNA 1M0SA 5H59A 3QHPA 4NARA 1QONA 1Q2UA 3VISA 3KKNA 1GNRA 2C2MA 2Q3DA 4LOAA 1J0BA 4Z1MD 3F4LA 1F7UA 4YALA 5J58A 5FL7D 4M76B 3IAS6 5BW6B 2O8DA 1AUPA 2OSVA 4P83A 2SCUB 1A2OA 1IN7A 3IQFA 4W7SA 4UCXA 3DOIA 1PWXA 1KC1A 4W8GA 2C00A 2P4HX 5JEEA 4AN1A 1M2JA 2VWGA 2WUFA 3F2VA 4GGOA 5CXSA 2PJZA 3KQLA 5G41A 3SC4A 1MV5A 1KMHA 1Z4IA 2WWIA 4DFDA 1FTWA 4D8WA 3T3GA 2QNIA 4EB6B 4GPD1 2Q3JA 2VP6A 3ZV6A 3C98A 5DNEA 3VNQA 4YI3A 2EKZA 4UVHA 1XFDA 3DAFA 1HDYA 1XZQA 1IWBB 1I7PA 4ZEOA 4F3CA 5IDQA 3CVUA 2ZAGA 2AFHE 3PUZA 4HEHA 5KHLB 3SZRA 3LW7A 2OHIA 1IUOA 3C6KA 3KETA 4M7RA 2I6FA 1KYZA 4PZPA 3S2ZA 1JGTA 2F3QA 2J08A 4IDCA 5AXDA 4II7A 2YXEA 1WB6A 1OCEA 1T34A 2ZPUA 2ZRKA 2ZJ5A 5EYPB 2PSDA 3MB5A 1W9HA 4UE3S 3BXPA 5IF9A 2V0CA 5KC8A 1F2TA 4LHSA 4CU5A 3SX4A 1LPPA 1J5XA 1XRPA 3MERA 1UXHA 1ZCZA 2J67A 2ZZNA 1WL8A 2FN4A 3L6DA 4KOEC 2IF0A 5JD6A 5BW8A 3D6VA 4ASUA 3STXA 4FKBA 3RKSA 2WA1A 4BFCA 5ECYA 1THZA 1I8TA 1RZUA 1YJ8A 2P2GA 2FUEA 2YHBA 3HRIA 3MWDB 2VYVA 4LDNA 2XEXA 4X91A 2IODA 2FLVA 3K4PA 4MX8A 1UFKA 3TLCA 4ATNA 1CEYA 1XNGA 2JHFA 3TX2A 4D8XA 4PO8A 2NV0A 2OO7A 1HY3A 2IZZA 1IPFA 4ZO8A 3ASUA 4PQFA 4BE7B 1EVZA 1FP4A 3LDHA 4E22A 1H0SA 5TMPA 3IMKA 3KOXA 1ORIA 2BGNA 3RHTA 4BBAA 2R1TA 2AFHA 1Y7TA 1WCIA 4HFJA 1IG3A 5DBOA 1ZRHA 4BIMA 1TYDE 1ARZA 2BFEB 3C3BA 3DFMA 3AP1A 3AM4A 3CLTD 3JVDA 5I7WA 3Q7RA 3VX3A 5F23A 5MN6A 1R18A 4RGQA 5K0ZA 1APBA 4X7MA 1QIHA 2W6NA 1JU4A 1RAGA 3ES9A 1CE8A 1JIQA 3LT0A 5LM3A 5BRNA 4F7DA 4F06A 5IJZA 1PFQA 5ERYA 3LQ2A 1FSGA 1N8KA 1NBOA 2GAOA 2HWYA 3HCOA 3QU7A 5L9AA 2QT1A 3NBZC 4MUBA 1XZIA 3WNDA 2RGCA 3WL3A 1SCBA 3N2GB 1XDWA 3OZSA 2RGDA 1G21E 2QN2A 3SIPA 3D7KA 4HQLA 2OSBA 4EVRA 3IIJA 4L1KA 4W1RA 3HXPA 2EEPA 2NO5A 4IS3A 1A9QA 3D5EA 1R0XA 3DLCA 3EFOB 5EMLA 5TB5A 4C3OB 3E22A 3D9QX 4ABYA 5M29A 4P7KA 3HVRA 3QKSB 2EU8A 2LGJA 4QX6A 4D9BA 3LMKA 4DVJA 3GLGA 3OPYA 3O8NA 1YRYE 2FZ4A 1KVUA 4LN1A 4HAIA 2ICAA 2I22A 4B6GA 4RVSA 5IJ9A 3A6LA 2VF5X 2WWHA 3KSDO 9MHTA 4OA5A 1VDZA 2BM8A 4W1QA 2YRXA 3S1AA 4O4IB 5KQPA 1T9GR 2FG7C 4N5DA 4PGAA 2YC2C 1ZVJA 2BGLA 4U2DA 5ITVA 2XXAB 2AFIA 1K68A 1XSEA 1Z0UA 3LKBA 2GBFA 1AS2A 1U0JA 3EF0A 2GRAA 4Z86A 2WICA 5D3MB 3EVAA 3TL3A 2PY6A 3KCNA 3QWHA 1IFXA 2R66A 5BSRA 1SHUX 4QPZA 4P93A 4DANA 1FMLA 1G291 1U0NA 4HGNA 5CYOA 4ZD6A 4BP3A 3E9EA 1RQRA 2C54A 5IT9A 2Q50A 4NFYA 4PBSA 1PYGA 5ENZA 2XCUA 3VTAA 4TMXA 1D6JA 2DSTA 2XTMA 4AIRA 4DWJA 4RPCA 1MW8X 3AEXA 5HFNA 4C7OB 1CEEA 1ADFA 2XQVA 1EHIA 4G4IA 5DNCA 3OURA 4EY4A 2JH3A 1U1GA 3P45A 4H17A 5GJVC 1TK3A 4YN3A 4Y2SA 1UJ5A 5HIAA 3WGGA 4HDMA 4P7GA 3DMFA 2P6PA 3RRFA 1QHGA 3SC6A 5KTOA 3R5XA 2QG4A 3U37A 3QA9A 1K6XA 3V4ZA 3VYSB 4M9UA 1E3DA 5L4NA 4KSBA 4V24A 2C8LA 4GKAA 1G6OA 3VPXA 1FUUA 1PQUA 4ALIA 3H18A 4TQGA 1ZZEA 3OMXA 4WTOA 5HWSA 2DHEA 3BB3A 2GTPA 3BK2A 5TGTA 1QKKA 4GXTA 4LMRA 3T5BA 5I4CA 3TAXA 2IEIA 3PTLA 4XM1A 5AVKA 4UBLA 3SOPA 5HRAA 3GD7A 1E6LA 2XXJA 2JFWA 1FNDA 1WKCA 4E07A 2AZ4A 3V32A 1FFHA 3BM5A 2ZZMA 4M60A 4S12A 3RAJA 1M6VA 1JIUA 4HF7A 4GQIA 3ZHZA 4CT4B 1TMYA 3GNLA 2Q5FA 3QPAA 1GPLA 4WA7A 2X7JA 4NU0A 2GAFA 4CF7A 1LF5A 1WZIA 1J0DA 5EUCA 1VHQA 3LY8A 4HYQA 3HHEA 4ZT7A 4BO7A 1PL6A 1QTRA 2QR2A 3U61B 1I6KA 2CYAA 2NSYA 2YC4C 3KVNA 2BDEA 3TL6A 2QM0A 2I2BA 1EZ1A 3LZ6A 3TVDA 3DUFA 3E8MA 4REQB 1ZXLA 5EHXA 4BEWA 3RLFA 1SOWA 4JYCA 3QWBA 1IBCA 3D6HA 1WMDA 3F6BX 1MRZA 2DQYA 1U7TA 3A9TA 3EQ6A 1W581 3C3XA 5AI8A 3UMFA 1JEYA 2Y1GA 5CNMA 4PBTA 3ZZMA 4YPOA 5C46F 3BFVA 1TK2A 2ID9A 2YZ7A 4UUAA 3RLIA 1N8TA 1EFPB 2A0FA 4ZU6X 5L51A 1QDLB 3KJEA 4F46A 2PJRA 3I5XA 1C5KA 1P1IA 5IK2D 2D0OB 4M86A 6CHYA 3TUJC 3VGPA 5JTTA 5L95A 4F5WA 1JSRA 2A6PA 3K20A 1VJ5A 3PJGA 5FWAA 3P0HA 2ZM5A 1LKZA 1L5ZA 1UJBA 1UK6A 1HDOA 2V6IA 4URYR 3QKUA 2H48A 2YJGA 1IB0A 4O2RA 5IJXA 1NVWQ 2BGWA 3I83A 3PVCA 3AHCA 2HIHA 4I55A 16PKA 3CVWA 1A8HA 1G42A 3HNRA 1E3WB 1PL7A 4I8XA 4N82A 4LRYA 4DC1A 1DV2A 4P35A 1ZM9A 1TZJA 3FMPB 2GJ9A 3A4YA 3KALA 3TW6A 4C2TA 2H31A 1WZNA 4J0KA 3GNSA 2DQKA 2FX5A 3MQ2A 1RABA 2ZJ6A 4JROA 4Q7KA 4D5EA 4I2VA 1MA3A 1CR1A 4FYMA 3SP1A 5F3WB 1U9CA 2H51A 1QIIA 2RC6A 5FCDA 4NCHA 4EF5A 2NWQA 4B0OA 2JAHA 3QG5A 1NF9A 3BMQA 1NUSA 3VR4D 1Z9BA 3CUEF 3KD3A 3MGAA 4MQ4A 4HATA 2YTZA 4ZXPA 5A04A 2ZUVA 4LA4A 2Z6AA 3HB1A 1MBZA 4Y6OA 5AI5A 3DBOB 1WF3A 2PL3A 4TS4A 1GSIA 4RFSA 1EFAA 1H05A 4XQEA 4EDHA 4XRRA 2GS9A 2HF8A 5HQTA 2NUPB 1FRQA 1UJ4A 4J7CA 3E7WA 2Q29A 1M10A 1Z6QA 3PGMA 2ZK7A 1RS0A 1WCV1 2DWPA 2Q6TA 2X5XA 2H1CA 3B53X 3HL0A 4O2LA 4WK4B 3VOSA 3PHGA 4F21A 4Q4CA 1P3DA 4J94A 3DDNA 5A5DA 1ODCA 1D6MA 4MWCA 4E14A 4LECA 3QBDA 2R11A 1DCMA 2BZGA 1SOUA 2YJ4A 3FNGA 4M6WA 5FO1A 1GTJ1 4CQMA 3S4YA 3ZV3A 5KSWB 1BC5A 2IWRA 3T4XA 3CKLA 3EARA 4O0LA 1I3MA 3LW8A 3GZNA 2PQ6A 3DVSX 3HBMA 3L7CA 3NX4A 4U2GA 4Z4IA 1MC4A 4LE1A 1EUCB 3PQ7A 4H3HB 2CWWA 3W3AD 3W5SA 5JNUA 3OSZA 4JMPA 2A1TR 3DBRA 1ZONA 3JQAD 3WLNA 3GI1A 4YRZA 5BSHA 1ZBDA 1NASA 1YQTA 1BH6A 2X9QA 3UV7A 2XNHA 5C7OO 4PRKA 3RHZA 4BJ1A 3B52X 3IP1A 2AD1A 4NU5A 2A5FA 3VU1A 4PM4A 4OK6A 2IQ5A 1WP4A 3EQ2A 2V9ZA 4B3HA 3AM1A 1YOVB 2ZAYA 3PYMA 2Y4NA 2VCHA 2PKEA 3DO6A 4RGYA 1BXRB 1NPTO 4WKBA 4IHAA 4EL0A 1O6CA 5CFQA 4QO8A 3W04A 4C89A 4WFQA 2F62A 1EMDA 2V1XA 4G5XA 4CKBB 2H5JA 3ILXA 3M6LA 5I9TA 5AM2A 1E2JA 1FQKA 3VDXA 5CPBA 3K7EA 3CR8A 3AF2A 3L8EA 4Z9YA 1V1RA 2PGDA 3KBOA 4DILA 3QTBA 3ECSA 4KMSA 2NT3A 1ZY2A 2WWFA 5EJ5A 2ATIA 1ISMA 4R2LA 1UAAA 4RZ3A 1BKYA 2IE0A 2ZG6A 2ZSIA 5KTNA 3WO0A 4FYWA 1PEDA 1JG3A 1CR6A 2E5LB 1G63A 5LOVA 1GNPA 3VR5A 3ULKA 5CB8A 1XMQB 5DXAA 4DLRA 4WN3A 1L5HA 1WXQA 4HXEB 4XQGA 1I30A 3Q8MA 2Y1FA 5DX1A 2JHGA 3HFGA 3P9IA 1TQ4A 4MUFA 3M5DA 5ITWA 4LGVA 2XMBA 4GOKA 5FAKA 4QRIA 4YCMA 2QRMA 4B3FX 1WPXA 3G13A 1RRKA 3I34X 3HM2A 4QGGA 1E4EA 2R1TB 1QBKC 2XRYA 2ZJ0A 2GF0A 4RY2A 4YRCA 1CEXA 3CUYA 5FTLA 3M9XA 3R5SA 2Y0CA 1POWA 4KFRA 3RSZA 3RTDA 3UW3A 3ZS8A 4C87A 1CUCA 3WLAA 5GTDA 4BO8A 3M1YA 4EP1A 4AUMA 2VP5A 4Z2YA 2F59A 4NDAA 3BD7A 2G9VA 1DFGA 2MU1A 3R0QA 2D7DA 2YHIB 4N5IX 1E5TA 1OVGA 1PNTA 1QLHA 4N8SA 4UDNA 4D79A 4EVIA 3VNRA 3WLLA 1OH5A 1KAQA 3S1LA 1H23A 2R48A 3UCFA 3HXQA 3CZCA 1R8XA 1BE8A 3HR4A 2BSXA 1W5FA 4MKXA 3DVRX 1YFKA 3GXOA 4X93A 4JJZA 4UAUA 5DXFA 4G5SA 3ME5A 1XN1A 3STWA 2D2FA 5T6BA 3V7NA 2NU9A 2HQRA 4HX5A 5CLQA 2C2OA 3WHKA 1P29A 2CEAA 3VZSA 1CF9A 1U6JA 3NVKI 2RH8A 2GPAA 2JFZA 1MF7A 4HNRA 1EB9A 3TXYA 1RYZA 3FF1A 4MP6A 5JXJA 1DJMA 1ACJA 1XF9A 2ETVA 1G5TA 3GEBA 4FR5A 3WMFA 1THGA 2IOQA 1IZ0A 1PFVA 3HQ4O 1ZXXA 2W6OA 5GVSA 5T4BA 4ENQA 2X4GA 1ZXBA 2X8AA 3NC1C 4P0TA 4XGNA 5DBFA 2XZOA 5KDLA 4CW7A 3NRBA 2WAYA 2JFUA 4RD2A 2H1LA 2X2OA 2ZYAA 1OWMA 1W88B 2POCA 1B6TA 3BWVA 3A1SA 4MO9A 3K0KA 3EZ7A 3MAGA 4L22A 3FZYA 3MUOA 2XMGA 4KXNA 4HO1X 4EVSA 3FH0A 3HFJA 4I4TB 1OR8A 1XA0A 1O95A 5AW3A 4CL2A 1O7JA 3NR2A 3AI7A 3COSA 1KPIA 1DBPA 1NXPA 2HK9A 4RF3A 4H6PA 1L5NA 1C9DB 5AO9A 3HKCB 1QX4A 4ZU3A 1RQ7A 4L15A 5J2UB 4UTXA 1MJNA 1F6BA 3LDFA 3U7RA 4JLAA 3QYAA