1MH1A

Small g-protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
183
Chain Sequence
GSPQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVSLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC1
publication title The crystal structure of human rac1, a member of the rho-family complexed with a GTP analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding
total genus 60
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 1997-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mh1A00
1OFTA 4Q1CA 5F9FA 4JYBA 3D31A 5JBQA 3HR8A 2QQ0A 2YC2C 1N5LA 2FMXA 1XPRA 4HB4A 2BMJA 3NVAA 2VHTA 2ZUBA 2IXGA 4OQNA 1W48A 1JNYA 2Z83A 3E2IA 4TT3A 4Q21A 5TMPA 3DEFA 2HUPA 2JLVA 1L4YA 2ZE6A 3MWJA 2EFCB 1COWA 2RHMA 1HURA 1P3JA 2OLJA 4NZYA 5EQTA 3T5GA 4M1SA 4KVAA 4C3ZA 3U7EB 5TXGA 3K53A 3EAQA 2F7SA 5EZ6B 1YHNA 2YKGA 4KV9A 1KGDA 5EXPA 2ECKA 1OLOA 1IJEA 2YWFA 4U02A 1DELA 1Q20A 4NCJA 3RYTC 1AN0A 1NIPA 3PR1A 3PUYA 4Q1FA 4R2IA 4GNKA 1FMLA 4AWXA 1GRNA 1N6RA 5CLLA 2XZOA 1E0KA 5B58C 4EQ6A 1VECA 3W6OA 1SKQA 4F38A 3GLHA 4TN1A 3W8RA 4TT3D 3QPWA 4BZQA 3UPUA 2XSZA 3R8CA 1KKMA 2QU8A 3AGPA 2QAGC 4FINA 3REFA 2GILA 4PAMA 3HU3A 3IIMA 1YU9A 2XAUA 2HEIA 4NYJR 2V1UA 3VR3A 4HAWA 4RZ2A 1E9SA 1P72A 1WE2A 1W36C 4O25A 3KQNA 3ADBA 2P6NA 1Z6YA 4YDSA 2ONJA 3T1OA 2WBLC 2PZGA 2FU5C 1TUIA 1DG3A 2ZRGA 3ADKA 5BYKA 4MRSA 1OF1A 2FFAA 2H57A 4ZDWA 4ZCIA 4URXR 3QKTA 4ACBA 1XZQA 1UKVY 2O8FA 2WIBA 3LRPA 2GEDA 5HZKA 1Z0JA 2XZLA 2Z0MA 1AK2A 3TIFA 3PUXA 4NYJQ 1PUIA 4M1OA 4BFUA 4M8NE 2EFHB 1OYYA 1PJRA 2FGKA 3OEEA 4JLDA 1E9AA 2J0UA 2G3YA 3TUZC 3B1WA 4RD4A 5E7JA 1OB5A 2XSZD 5AWFC 1U8AA 5DHAA 1OH6A 3EZ7A 1NJGA 2RGNA 1NY6A 4BWYA 4Q02A 1KY2A 2KSQA 1NN3A 3MWLA 5BW8A 2VHCA 3P4YA 4MITA 1YRAA 1LS1A 3FHCB 3PENA 4KFTA 3G0HA 2QMEA 4QJ5A 2IUTA 2HYIC 2JLZA 1UEJA 2DFNA 4Q7KA 4PHTA 1VPLA 1NIJA 4OI1A 4BUJA 5KHOC 3EIHA 5P21A 3U4QB 4WZ6A 2QN6A 2VSOA 2ZAMA 1ZD1A 4B3XA 2QQEA 2F9MA 1DEKA 3H4MA 2PCLA 3QNUA 1CULC 1GUAA 1XB2A 2RH5A 4PXAA 2VP0A 3OEED 4JLNA 5LB4A 5AUNB 5JZVA 1QG4A 1Z6AA 2MMCA 3THXB 1OJLA 4B3CA 1K8RA 1U90A 1E32A 5C46F 1MRNA 3P20A 5LB2A 2J7PA 5DHFA 1T0HB 5HTKA 3FFBA 2FV8A 4BLRA 3QBVA 1HT1E 2P6UA 5FPHA 621PA 3RANA 1CU1A 2FN4A 1W7AA 3H0KA 2VP5A 1XD8A 3GLGE 1J99A 1US8B 4G5OA 1AGRA 1NLZA 4RD2A 5AUQA 4JYCA 2SHKA 2OBNA 1J7KA 5AUPB 4I1UA 1TX4B 3I61A 3BB3A 3CKLA 1RRGA 3O8DA 3DOEA 2JDIA 4CRWB 2ATXA 3C8UA 2E1RA 4L8GA 4URVR 1WMSA 1XRJA 1Z83A 8OHMA 4IXMA 1TTTA 2VL7A 1R4AA 2QPAA 4BLPA 5JHGB 1GVNB 2XXAA 2MMGA 3W6PA 2YINC 2O8DA 4DSTA 5TV2A 1LFDB 1U0HC 3RS0A 1II8B 5C1BA 4RCYA 2GVDC 2ZRFA 1DOAA 4DDUA 5EZ5A 2YNMA 5A5GA 4CVNA 2RGCA 4CYMA 4MRRA 1Z0AA 3AH8A 3RSOA 3DZDA 2OFOA 1F2UA 5KDLA 4P4TA 1O87A 3RC8A 1QF9A 4OK6A 2QSZA 1BIFA 1AZSC 3IGFA 4HDQB 2IEZA 4GOJA 3SFVA 1KKLA 1Z28A 4RJLA 4L4UA 3U44B 3LBNA 4TMZA 4O2RA 5DYGA 2VA8A 1TF7A 3CR7A 3EASA 4LBZA 2CK3D 2GJ9A 1VMAA 3EWSA 1RC8A 4NU0A 2ANBA 1GRQA 2J46A 2ZI3A 1I4LD 1T5LA 2IL1A 2JDID 3AVPA 3VU9B 2BBOA 4S35A 5F3WB 4FIDA 4GT1A 2GXQA 2IS4A 2ZAOA 4W5JA 4B73A 5FTKA 5B64A 3ASZA 1F2TB 3ZJYA 2I3BA 1UKEA 1L8QA 3GQBA 1YZLA 2MSDB 4AIIA 4B2IA 4P0TA 3FHTA 1UAAA 2YV5A 3O8BA 1ZCBA 2GF9A 1VTKA 1Q1BA 5JS8A 5JFGA 3THYB 2V9PA 2BBSA 4FMCF 3IKJA 3R9IA 4HLUC 4B3GA 4XSHA 3QXSA 5L3QA 1G8FA 2AR7A 4RD3A 3CIOA 3CF2A 4PPNA 2ZXUA 1M6NA 2G9NA 1NG9A 4LJ7A 4ZIRB 3TKLA 4V0MA 1OB2A 5CK4A 3QY0A 1FX0B 3BK7A 5BN5A 2DCUA 4POAA 2GZAA 4DT1A 1OFIA 2BMFA 5IHPA 4BQSA 1Y63A 3IDQA 4PPQA 1X8KA 4IFEA 4L9SA 3ICQB 3VQTA 1WBBA 4DLRA 1GKUB 3IO3A 4EKDA 2A5FA 3LVQE 1M1YE 1GKYA 1W5TA 2DWQA 3LQRA 4G5RA 4QG7A 1II9A 4V0OA 3ASYA 5DIFA 2OLKA 1IXRC 1ZINA 4AURA 4GZMA 1Z8FA 3DHWC 2IEYA 5GVSA 4LPSA 4YMUA 5KPDA 4RFSA 1G7CA 3SYLA 2A2ZA 1ZM2A 2TMKA 4DLVA 3RWMB 4BZPA 2F43A 3BRWD 1JI0A 2GZHA 5FL3A 2A30A 4JL8A 4EQ6B 3I8SA 3HR7A 3L82B 4F92B 3NWJA 1CR0A 3GLHB 1NVVR 2HCJB 1EX7A 1QBKC 4M22A 4CW7A 4IFBA 3ADDA 1VCIA 1GP2A 4ZKEA 1R2QA 3UKDA 2IBMA 3B85A 4B3DA 5DO9A 4XD7A 2ZRJA 2G88A 3L0IB 2ZI4A 2P5TB 5C4MA 4HLCA 3L8YA 3OFNA 1BH2A 1JEDA 1ZNWA 1IAQA 4CEIA 2O8FB 3N2IA 1NVVQ 3CUEF 2FH5B 1YQTA 5FPSA 3SYNA 1ZW6A 2IX3A 4UNQA 2D2FA 2VP6A 5JRZA 2FSHA 1VG9B 2XNDA 3AVUA 1ZNZA 2GJ8A 1J70A 3UG6A 2WWHA 3V4FA 2IWRA 2J0UB 3GCGA 4BFWA 1CIPA 2HLDD 3AVQA 4MGZR 3T1TA 1CRQA 3LXXA 4C0BA 4MKFA 3VFDA 1MABA 2F6RA 3QE0A 1T3HA 2JLWA 2MSCB 4LV6A 4LHXA 4XD7D 2NIPA 4A8JA 1IN5A 4HUQA 1A2BA 3CRW1 2R6FA 3LD9A 2I4IA 4PC7A 4WXPA 4EPWA 5HR5A 4URYR 4EPYA 1E99A 3TRFA 2F55A 3IQWA 2CHGA 4R2HA 3NKVA 1SULA 2H18A 1II0A 1E6CA 5LD2B 3IILA 4AI6A 3RDPA 3SJCA 1XP8A 2ZI7A 2ZRLA 2G77B 4NONA 1CRPA 2R44A 1D6JA 2E87A 5FFMA 3WMGA 3CWQA 1XPOA 5BN4A 4HI0E 2JIZA 5DI9A 2ZS7A 1KI4A 2ZRPA 2JJ1A 1FTNA 3SS8A 1OFHA 2YVUA 1P61B 3EPJA 1OYWA 2WKQA 3LW7A 4H1UA 4NP6A 4TQ9A 4WVFA 4DWJA 4PZZA 1P2UA 1GSIA 2VO1A 3K70C 1P7CA 4PC2A 1FOEB 1DAEA 1W4AA 1TEVA 4M4SA 2N42A 3QPUA 3A1VA 1E9EA 1QVRA 3B2EA 2D4HA 4HDCA 3R9WA 4UJ5A 3RRZA 3DM5A 3IBGA 3I8XA 5FL7D 4GP6A 3RS4A 2ZE5A 2NG1A 4MRVA 3R20A 2WJHA 3B13B 4PAQA 3T06B 4DLSA 4RD6A 1TF2A 1JXOA 5FOVA 1P2VA 1NG1A 1AQUA 5SZJA 1F60A 4Q4AA 4XOIA 4M1KA 4D81A 2XXAB 4WA7A 2O8DB 1QHYA 4IDQA 1G21E 1LW7A 4MGKR 2IYUA 3ZYCA 4XWKA 4M9XA 3ZVLA 2WJGA 5EE5B 4DLZA 4Z8YA 1SKYB 3W8NA 1F2UB 4XWOA 3B7GA 3TGPA 4LV8B 2O8CA 4AKEA 3FKQA 2KBEA 2VRWA 4JIMA 1E9BA 3I4LA 2OXRA 5F2EA 1RZ3A 4E03A 2R8RA 2HT1A 5L3VA 4DDTA 4XIGS 1LS6A 2W2TA 1JBKA 5AJWA 1ZRHA 4B3FX 2WICA 1OHHD 5JJLA 3EX7C 1I4DD 1DARA 1ZIOA 3RRMA 3W5JA 4IRUB 2Q6TA 2VHJA 4KLZA 3OIUA 3TR5A 3AM1A 4JLAA 1QZXA 4A0HA 3R8FA 1F3OA 4Q5IA 3WYAA 5BN3A 2QNRA 1NJFA 2BM0A 5JWRA 1WCV1 1JAHA 1XEWY 2RGAA 1KJWA 3NTUA 5TARA 4LJ8A 2AD5A 1ZM4A 2J0SA 2V7QA 2UZ3A 3MUFA 2JJ2D 3BOSA 4JVLA 4DC9A 2HJVA 1W2HA 3NBYC 4TQUS 5L3QB 2R6AA 2W0SA 4IW3B 3TLXA 2FFQA 3AF1A 1DAMA 1G5TA 2VF8A 1BYUA 4PC1A 5KYKA 3R7WA 4RY2A 1E0SA 2IYSA 4GI7A 1W1WA 1JPJA 1KOFA 3BAFA 3Q7QA 2E9SA 1E4YA 1A82A 4ZI3A 2WHXA 1DG1G 3HP1A 3IHWA 2WZQA 1ZUIA 3M4YA 4DT1B 3EC1A 3EZ9A 1KK3A 1G3UA 4YXWA 4JS0A 3FMOB 4XTRA 4AG5A 1N0UA 3EZ2A 2ORIA 4P32A 4U5XA 3SJZA 4IVRA 4W5WA 2WSSD 1T0JB 2ZRMA 2AL7A 1OKKA 3VR1A 3SJBA 1XTIA 2RGNC 1G8GA 4TTQA 1ELOA 4LBYA 4UXIA 3V9PA 4D4JA 3I92A 1KO1A 1UADA 3SBDA 3FYHA 1KYIA 5C4GB 4A92A 2V7QD 2EW1A 4HB0A 4H9GA 1UM8A 2W6JA 4OI0A 2RGXA 1G7SA 3P27A 4RFSB 2O0KA 5LD2C 1DS6A 3DPUA 4X8HA 1EFRA 1JJVA 3VTKA 3BB1A 3T35A 5E7MA 1T9HA 4PC6A 1CLUA 1GAJA 2KB0A 4A2WA 4GDFA 1PLKA 4ITRC 4DBLC 2OCAA 1YZNA 2ZM5A 5J4LA 4Q4JA 3A4LA 1XD2A 1NSFA 2MSEB 2RGBA 3K9GA 2ZRHA 1KMHA 4X8LA 4Q4HA 5ANRB 3THOA 4DLYA 1XNJA 1Z6GA 3GLFA 1QHNA 3KXIA 1Q21A 1X1RA 3C7KA 3IPYA 1N0WA 2OM2A 1XXHA 5FPYA 1QHIA 2R6DA 1CTQA 1GL6A 1P2SA 3C5CA 3RVBA 4UNRA 4YMVA 3T61A 3SE0A 1YR9A 2B21A 3AB3A 4DCSA 2FFBA 1NBMA 4HYYA 4PSAA 4CEIB 1QHHA 3OIYA 4RVCA 2W6JD 4MYTA 1P2TA 3K0FA 4HAUA 1KI1A 4KO8A 4M2LA 5LBIA 1MO6A 1Z0KA 4ZV4A 4F93B 2YOGA 2QGZA 5CIQA 2IA5A 3AP3A 2Q9BA 1JAIA 4RSGA 2QI9C 3MWKA 2UVQA 1VYTA 5G40A 4GL2A 1EWQA 3QBTA 1V43A 2BVNA 4NCHA 5DN6D 4K46A 4ZKDA 3KKPA 1MABB 3ZVMA 2IW3A 1N6HA 2RKOA 1CF4A 2ZQ5A 1E9RA 1IN4A 2FSFA 2P3SA 1FL9A 3QKRA 2VSXA 1Z06A 4M53A 4A8JB 2GETA 2Z43A 4HUQB 2IS6A 5B2ZA 3G82C 1Q1QA 4B33A 1IJFA 2D7CA 2FX3A 2ZJ2A 1KI9A 1Z6TA 4NH0A 4QNRA 2LKCA 4XWAA 1A2KC 2F1IA 1OT3A 5JWOA 1TU3A 4IOJA 5GJWC 3N5CA 2O0HA 3L0SA 3PUZA 4F91B 2ZI6A 1FPMA 3VAAA 2QPTA 1TAGA 3NBXX 4JBWA 1KAOA 2KJQA 3ZQJA 5IK2D 3VKHA 4LHVA 5JLJA 1J90A 1G8PA 1KI6A 1FW6A 3PUVA 2OCPA 1UEIA 1OFUX 2GHIA 4LBVA 3CH5A 1R10A 5J47A 1KSFX 3SN6A 1JR3E 1ZCAA 2XEXA 1G291 3GJ4A 4KLNA 3M1IA 1WXQA 3CNNA 4C0JA 4MUAA 3AVYA 1DO0A 2GXSA 2QZ4A 1R8QA 1JALA 2EFDB 2HT6A 3FTQA 4MYUA 5TVKA 1I2DA 4MRPA 3LFUA 2VLIA 5FTJA 4M21A 3WHKA 2JLSA 1DADA 2HXSA 4CDGA 2DWOA 4ZIRA 3GPLA 2IYXA 3FVQA 2WMNB 1FX0A 3ZH9B 1W4CA 1M7HA 2D74A 2ZVQX 3ETLA 4EJSC 4RD1A 1XEXB 4JLVA 1XPUA 1MOZA 2AX4A 2O8BA 4Q9IA 2JJ8A 3ZZUA 2JGNA 2OCYC 4KBFA 1KZGB 3PFIA 3CLVA 4W7SA 4XSGA 1S1CA 2C96A 4TLDA 3EWAA 1FNNA 4Q4AB 4ZPXA 4EFMA 4L15A 3QIAA 4OQXA 3MAAC 4N0DA 4TYPA 5FBVB 3FMFA 2AXNA 1R0XA 4OHXA 3WNBA 2HV8A 3NIBA 4BLQA 1TUEA 2WM9B 3K0AA 1LY1A 4MQBA 2ZANA 5AJXA 2X2EA 2FEMA 1GDDA 1SZPA 1X86B 1SXJC 2VYFA 4L5BA 2O8CB 821PA 3ZD7A 1UBGA 2PX0A 3L2OB 4DSOA 1P9WA 1UJ2A 4LUCA 4DLWA 4DUGD 2QMHA 2AWOA 3AVWA 4M1MA 4BRUA 2CCJA 2ZUCA 2Z4RA 2OT3B 1OXSC 1G18A 1TEXA 3O8CA 1KO7A 1SVMA 1P9NA 2JLRA 2Q3FA 4LDJA 1OH5A 4LV5B 3AF0A 3X1ZA 1U0LA 1VG8A 3TR0A 4WIAA 1BYIA 1HE1C 2IXEA 2D06A 2OAQ1 1D2MA 4B2PA 5KNCA 2HYDA 1M74A 2IS1A 2VH5R 2V1XA 3ZS9A 1G64A 1HUQA 2OFXA 1NN1A 3K0CA 1P5ZB 1ZM7A 3PEVA 3VX4A 1EG7A 4EFNA 4Q01A 1ZNXA 5J4KA 2GJSA 4I99A 3MJRA 4B75A 4GMXA 2ZRAA 1GM5A 2EVWX 3CX8A 2QAJA 3OEHD 2IS2A 3B9QA 5CYOA 4N3NA 1E2EA 3GEHA 1AJEA 3KL4A 4PX9A 3AKDA 3TUIC 4ZDJA 4URWR 3OIVA 2CL0X 2QTVB 3U7FB 1KDOA 3R7WB 4EPTA 1MV5A 3KXLA 1BO6A 3FMIA 1FZQA 3L43A 5FI0B 1NKTA 1XFAA 5EP3A 2ZYVX 1RFLA 2B7BA 1E2MA 1XMSA 3CONA 1W49A 2FSIA 3RHFA 4BEJA 3CRQA 4FN5A 4GOKA 1PV4A 1W46A 5KUTA 2H5EA 3QJYA 5B57C 1OSNA 2YC4C 4MDFA 2ZJ8A 4JLKA 1YE8A 2OBMA 3TSZA 2BC9A 3BBPA 3B60A 4JZKA 1E96A 4GZLA 3GD7A 4TMKA 2QY9A 1KI8A 1FUUA 4MUBA 2PLRA 1WRBA 3U3JA 1E9DA 1UDWA 2V4ZA 3OE7D 1DAFA 4EPRA 4D4MA 1WDTA 1JR3D 5EE3A 1G1MA 4OI4A 1Q3TA 4QRHA 1TADA 4O3MA 2W2VA 1N2CE 1J2JA 3TSWA 2ZI5A 3I3SR 5TDHA 2ZRIA 4Q4JB 1GKIA 2EYQA 1I4TD 3LA6A 2IYLD 1XD2B 4TTPA 5GADl 2ZUDA 4LJYA 4CF7A 4URZR 4OYHA 1KMHB 2QEQA 1G8YA 2CHQA 3IPXA 2DYKA 4Q4HB 3C14C 1U99A 3NBFA 5HCIA 4TL9A 1MR3F 4HZUB 1ZU5A 2G83A 3GLFB 1DO2A 2FE4A 3LX8A 1XCGB 1ZYUA 2IYTA 1XXHB 4HSEA 2CK3A 3MLEA 2O5VA 1XTRA 1RKBA 4I81A 5JSZB 3F5FA 1Z22A 3RRYA 1KI7A 1G3QA 2D62A 2Y8EA 4LC0A 1HTWA 1KK0A 3SU8A 4DEYA 1EK0A 5AK0A 1QHHB 3TMKA 2W58A 3K0FB 3MD0A 1YZQA 1G3MA 1E2PA 4DIEA 3BE4A 3A8TA 4D0LB 1N5KA 5CB6A 2FJUA 2DFTA 4C0LA 3Q9LA 1ZC3A 2GEVA 2BMEA 4TLAA 2ZJ5A 2GAAA 2ZI9A 3DL0A 5IDVA 2EWVA 4OJKA 3A1SA 3SDZA 4B74A 5FUWA 5E3HA 1N5IA 2DBYA 4JVSB 1U8YA 4JLOA 2QP3A 2CL6X 2OSBA 4HZIA 1ETUA 3L0OA 5HKKD 2ZE7A 3KKMA 4P31A 4BFXA 1SXJE 3QKRB 3ICEA 3D6TB 3HYTA 1G4AE 1B0UA 1UBFA 3W90A 3IO5A 2CEAA 3IEVA 5J4YA 1AS3A 1BS1A 1GILA 2QM8A 3M0EA 4HLQB 4HB3A 2EWWA 4KFSA 1Q1EA 1ZUNB 2VTKA 1FMJA 1CR1A 1CJTC 1NLFA 3EC2A 3TBKA 2CJWB 1NY5A 4PO8A 3MMPA 2WAXA 5JCPA 2NO6A 3S1AA 1MT0A 2ERXA 4CT4B 1NMYA 3FFAA 3NC0C 4UNSA 4ZO4A 4LWZA 2V6JA 5DYIA 1A7JA 1ZD9A 1JPNA 5LPNA 2WMOB 3AKEA 1E2LA 1PLJA 3ZLJA 1QHGA 1ESNA 1KI6B 3B1ZA 3B78A 2XJ4A 4YQFA 1Z2CA 5FTMA 2GRJA 3HDTA 3KUCA 3SR0A 4LJ9A 5D3MA 4TMVA 3AVXA 2WWGA 2Q21A 4P4UA 4LJ6A 4F7WA 3LBHA 4Z51A 4E07A 1Q1ZA 1E2DA 4RCZA 1JR6A 3T5DA 2J7KA 3OESA 4LJ4A 1KTVA 1S8FA 4AD8A 1E2IA 1ZBDA 4ASUA 1WF3A 4KXFB 1N6NA 1R5BA 3AVOA 3VR5A 2C77A 2GBLC 3IIKA 3LWNA 1N6PA 4LYJA 1XBTA 3REGA 4ZDKA 1HT2E 2O8BB 3I5YA 4IDHA 4Q9KA 1D2NA 5H1YA 3MSXA 1W2GA 1BOFA 1DAHA 4DLTA 1SVWA 2ZE8A 3TVDA 4M9ZA 2ZVPX 1TU4A 3H2YA 4QBFA 1LVGA 4PZLA 2G1KA 2GA8A 1AZTA 2WJJA 1DTSA 1XTKA 3IQXA 4MRNA 4YONB 1LB1B 4FMDB 4BLOA 2NOAA 5EP4A 4A9AA 3K0AB 1KMQA 5FBRB 1VYVA 3JVVA 4C0SA 4QKQA 2JLXA 2IYZA 1VHTA 5CITA 4N1AA 5AUOB 2Z6VA 3QEOA 4IOLA 3U3KA 1G9XA 2FG5A 1IBRA 4Z1MA 3WMFA 5K8TA 1GFIA 3PVSA 1G5RA 2H92A 3P32A 3E1SA 2GK7A 4TL8A 4ASUD 4C7OB 2BEJA 1OV4A 1VDZA 1H8HD 3U5ZB 1MKYA 1GZSA 3TK1A 1T8TA 3QPVA 1KO5A 3LW8A 2HLDA 1LV7A 1HQYE 2PX3A 4XH9B 3K09C 3ADCA 2HF8A 3JZMA 4B47A 2WOJA 4BFSA 3GFPA 4JSTA 2OFWA 4G01B 5EE1A 1KI2A 2R9VA 3DMDA 2ZRBA 4G1UC 5E7IA 1TQ2A 4GFDA 2J9RA 1RRFA 2QAGA 4JLPA 4GSYA 4LYHA 2PZEA 1W44A 4LGMA 3ZGXA 5EUQB 2ZTSA 5JECA 1G19A 4AC9A 2BBWA 1N6LA 3OIWA 2GJAA 1GNPA 3HU1A 4Z1MD 4DSNA 3LLMA 3QKUA 3EW9A 4CEHB 1JJ7A 2WIAA 2ZSDA 4NBSA 3EIEA 3THWA 2EYUA 3AKYA 2QM7A 3AKCA 4PQFA 1T3LA 2IC5A 3CNOA 2ZSBA 4JBYA 4US2R 3ONWA 1K5GA 2I1QA 4LX0A 4YMWA 1OXUA 5J40A 2RGDA 4TSFA 4TMTA 2J3EA 4W5HA 5EXSA 2D3WA 1Q44A 4S2EA 2PT7A 2XB4A 2IF0A 4PTLA 4K8OA 4A0FA 3B82A 5FL7A 2ZYUX 3WYFA 1G8HA 4FCWA 4KSCA 3ZVRA 2QROA 2IK8A 1CBUA 2REBA 3UMSA 4D2IA 4TMXA 1W36D 1G16A 4B71A 3RAPR 3TNFA 5EXXA 1DBSA 1P75A 4MA4A 1OXVA 2QT0A 1GRRA 2AK2A 2A3RA 1OE0A 3U6KA 1RJ9A 1NF3A 3EXAA 5FOUA 2ZR9A 3AQ4A 2VEDA 2GAOA 1E94E 4Q7JB 4QHSA 2D2EA 1TMKA 2G6BA 5A0FA 5IRCD 1OH8A 2ASEA 1CJVC 1J8YF 3RS2A 3X1XA 2ZITA 4HEJA 4AG6A 4BZXA 1JXMA 5CDFE 1X6VA 4NMMA 1D2EA 5JJKA 4TSFD 4C9BA 3WXMA 3CPHA 4DZZA 1Z07A 2YWHA 4DLUA 3KQHA 4FCTA 4ON9A 3T34A 1J8MF 3I1FA 3KJIA 5KPJA 1KO8A 3WBJA 1P6XA 4MYHA 3RABA 5J4VA 1XEXA 2Q9CA 3DMNA 2CVFA 1GNRA 4AKGA 3LDAA 3CM0A 3LLUA 1XZPA 1Z29A 2C04A 1TPZA 4BFZA 1OHHA 2BV3A 2P5SA 4HAZA 1G7RA 1ZP6A 1G6OA 2B92A 4PHFA 3EIQA 2QT1A 1XWIA 4US0R 3LX5A 2RGGA 3CF6R 5SZKB 2A5GA 4MKHA 2ZRDA 2C9CA 2YOHA 1MO4A 3L0PA 4J0QA 4BPBA 1NN5A 1NRJB 1E2FA 5FH9A 4B34A 4C30A 2WV9A 3DDCA 3GJ8A 1AS0A 1FQKA 3K9HA 3SHWA 2QA5A 2JJ2A 3SOPA 1XJCA 4OK3A 4HATA 2IF2A 3MRSA 4QJ3A 3UANA 3UATA 3SQXA 3HPQA 5FI1B 4OHYA 2G0TA 5EUMA 2ODBA 1VKJA 1KAGA 3LH5A 2WKRA 4RZXA 1ZUHA 2VBCA 3QXCA 1G17A 4HB2A 1KJYA 4V0NA 5H68A 3RS5A 2QRZA 421PA 5FR1A 4DB2A 3VKWA 5KTYA 4BFYA 2F3TA 2W0MA 1Z6XA 5TY0A 2NZJA 3EPLA 3S1AB 3FMPB 2N1BA 3SJAA 521PA 3QG5A 2PMKA 2YWEA 2F3RA 2O8EA 3Q3JB 3AF4A 1VIAA 1WB9A 4R71A 2WSSA 5L3RA 4GOXA 1A1VA 4AK9A 5F98A 2CLCX 1XJQA 2BJVA 4BGDA 4Q66C 1T3SA 4II7A 1LF0A 1H8ED 2A7QA 5KDDA 1AS2A 5D3MB 4YC7A 2EFGA 1L2TA 4RKEA 2J0QA 3W5IA 2WWFA 2PJRA 3HYRA 3K0CC 2XX3A 4MGIR 4KSBA 2A78A 4X8MA 3T12A 1XDBA 2QTHA 4A2QA 1DAKA 2QENA 3PIRA 1Y3AA 3BFVA 3NHAA 3WP1B 2REOA 4HLUA 1OIWA 3C5HA 4E5UA 2IWHA 1W5SA 4E22A 4R9UC 4Q9LA 1KDTA 4DRZA 2Q9AA 3ECCA 4IKEA 4QJ4A 1AA9A 3OF5A 3EZ6A 2GNOA 5FUXA 3UMFA 3EPKA 4A15A 1S4QA 221PA 4EDHA 4B43A 3GLGB 3HPRA 5FR2A 5SZHB 1Z63A 2DY1A 2NGRA 3EA0A 4MGYR 5AJZA 3EARA 2B8TA 2FPLA 4B2LA 2C98A 2VHUA 1ZD8A 2A5DA 4WBSA 4G0NA 1S1MA 3FB4A 3LAWA 3W3AA 1U0JA 5DI3A 2DHRA 3NHBA 2C78A 1F48A 1NMZA 2X8AA 4FMBB 3IUYA 4BECA 1NI3A 3QUSA 2FF7A 5K8UA 3OAAD 4QGGA 1ZAKA 3TJZA 4NHOA 1EGAA 2W2XA 1YKSA 1T6NA 2QORA 5L8VA 1NLYA 3QXXA 4E09A 3RLFA 3B9PA 1K5DA 1ZC4A 1QRAA 3KJGA 4M1YA 4I1SA 4W9MC 1PZNA 4NCNA 2F1RA 4NTZA 3O8RA 1P73A 1R7RA 2WVJA 1VG0B 4QL3A 4NE2A 3JZAA 2FWRA 2FPKA 3QI2A 4TLEA 4Q7LA 4B6EA 4B32A 3RRNA 4EFLA 5DLQC 4RFVA 1GG2A 3CRVA 2C95A 4M0LA 4QGFA 5DN6A 2W6IA 3NG1A 4FWTA 5CM9C 2KBFA 4V03A 3CF0A 4A6XA 1HY3A 1R6BX 1GL9B 3W6NA 4HZUA 5KSPA 4GPTA 1WP9A 2AN9A 2Z5FA 1CXZA 2J5XA 2HDNB 4C0QC 2VF7A 5JSZA 2QAGB 5CM8B 1UKZA 4N0EA 2FZ4A 3FKSA 2AFIE 1W36B 5K8LA 2H16A 4LHYA 4C4PA 2QSYA 4BLTA 4UXHA 5SZIA 4KFUA 1W0KA 3FGNA 5EXTA 2QP9X 5EE9A 2WJYA 1N0VC 2X1VA 3C15C 3BS4A 1DVRA 3ND9A 2IYVA 2WTUA 2C8VA 5IK2A 3GMTA 3TW4A 4Y0VA 1F6BA 1QHXA 2ZJAA 3THWB 1NVWQ 3QENA 1Z5ZA 1R5NA 4Q00A 4O0MA 3BXZA 2W6ID 2GXUA 3KZ1E 4CGZA 1W47A 3CO5A 3SC3A 3WRYC 2AWNA 4TZ6A 4JL6A 4IEIA 4EUNA 1TQ6A 3Q8XB 4O2LA 2H8KA 1IQPA 1D9XA 2IYQA 3A1UA 1AKEA 3V00A 4DVGA 5JMTA 3GP8A 2ZETA 3X1YA 2RMKA 4IXNA 5BWMA 3MJHA 1Z0IA 5C18A 2ZU6A 3VNVA 4LC1A 3X1WA 1HQCA 2GDJA 3A6PC 1W4RA 4Y0AA 1GOTA 3T1QA 2KE5A 3FKSD 2CJWA 4ZCLA 2ZROA 1YVDA 3AVTA 2NO9A 3HJNA 2Q0HA 3LV8A 2VQSA 4KBGA 1U9IA 1W0KD 1CR4A 5FPKA 2GESA 4JJKA 3LO5A 1T8UA 1CKEA 3GJ3A 4D4LA 3GLIA 1RJ9B 2K5UA 3TQFA 5JEEA 4I1VA 4FMCB 1OXXK 1Q0UA 2ATVA 3PITA 1OPXA 3GLHE 4D0NA 1UKYA 1VHLA 1ONBA 2A9KA 3LBIA 4PSKA 1YR7A 2OE2A 4QHTA 5BQ5A 4GP7A 2OG2A 1XMIA 4KYIB 4CT5A 2O0JA 2AHOA 4XJXA 3KFXA 4A2PA 1XCMA 2IUSA 2QGNA 3LXRA 1M34E 2B7CA 1HA3A 2CVHA 2GKSA 4JKIA 2JLQA 1SVIA 4OHVA 1EESA 4YMSA 3H1TA 2PJZA 1E2JA 1UPTA 4DUGA 3H84A 1E2NA 1S96A 3KJEA 5HE9A 1U81A 3ZQ6A 2X19A 3IHLA 4Q1BA 4Q4LA 2V8OA 1F5NA 3U60B 1XD9A 1XMVA 5KU1A 3IEUA 1RE0A 3FE2A 3GJ5A 3SHFA 3QVUA 2VP2A 1KDPA 4ARZA 5F9HA 4PQRA 3PEUA 1R0WA 1Z0FA 1KSGA 1QDEA 2ZRNA 1O3YA 1M8PA 2CDNA 4NPHA 6Q21A 2IHYA 1E9FA 1X8JA 2CL7X 2YHSA 4RZUA 4D25A 1KJZA 4PFSA 3P26A 3FOZA 4OL0A 4UQOA 1YR8A 2RB4A 2ZRCA 3OEHA 3QVVA 3UWKA 2WSMA 1CJKC 3OZXA 5H8WA 4TLCA 1OIVA 1E1QA 1ZVQA 3K70D 5H70A 1M7BA 3MWYW 1EFHA 4C7OA 4OK5A 1G3RA 4NYIR 4FD2A 1JB1A 3CBQA 2XGJA 3WNDA 5JRJA 2ZIAA 4A1FA 2OEPA 3B5JA 4XTCS 4QM6A 4Q9HA 2CMKA 2G1JA 1IXSB 2NO0A 3F0TA 1NP6A 3FDIA 3KKNA 4WZAE 5JHHB 3AGQA 3K0SA 1SVLA 4PANA 2O8EB 2PCJA 5E95A 1S9DA 3QG1A 1UFQA 4Q1AA 3X1DA 2ODEA 4DDVA 1Q12A 2KWIA 3FHOA 4NYIQ 5EE0A 4I4LA 3X2SA 4A82A 2DPXA 4AYTA 3CWZA 5UKDA 3A4NA 3QF4A 2QP4A 1ZM9A 2XZPA 4RZ3A 3WY9A 1OW3B 1SVKA 1RPZA 1XU4A 3KUDA 1COWD 5AJYA 3U2QA 5GJVC 1GTVA 2P65A 4EAQA 1G5PA 4PHHA 1E1QD 3W3ZB 3OE7A 3OHMA 3ZZ0A 2BBTA 3DKVA 5JI2E 4CEHA 3EG5A 4PC3A 5FBLB 1SVSA 1JR3A 3NDPA 2FGJA 4D4KA 4ERNA 3QOFA 3QSYA 3BJIC 2IYWA 1PLLA 1KI3A 4Q9JA 3KTAA 3KKOA 2OO7A 1TL7C 3ZDQA 1OH7A 1G6HA 3SNHA 1KDRA 3PEYA 5CIWA 4KI0A 3VHXA 4IVPA 1E0AA 2CHVA 1X8LA 2H7VA 1NNEA 3C4JA 1YZKA 3AUYA 1E69A 1L4UA 2BJWA 1XTQA 4KYUA 2AK3A 1YR6A 1MO5A 3BH6A 3K1JA 4Q7MB 4DLXA 3O47A 5FBWB 1TQ4A 5DI3B 1SKYE 2OILA 4BRWA 4DHEA 3ZD6A 2XTNA 4DKXA 4A8JC 1KNXA 1XEWX 3RWOA 3DVLA 4JL5A 5KNDA 3CZQA 2OZEA 1CS4C 3M6AA 3GJ7A 1N3BA 5CK5A 5FUVA 4QM7A 2ZR7A 5G3YA 5BYJA 2EFEB 2ORVA 4TZ0A 2A5YB 3WHLA 4TMWA 4C2TA 3A58B 3ND8A 3TE6A 2JLYA 2V3CC 4JLMA 5HPYB 1QG2A 1ZM3A 4I1OA 2FZLA 4DCUA 3DO6A 4P33A 1UBCA 4PO9A 4Q1EA 1S2MA 3LVRE 1GL7A 2ONKA 4LHWA 2NMVA 2P6RA 5FOWA 2BCGY 1R0YA 2QPOA 1EX6A 2XTZA 2YJTD 4UXJA 5HKKA 4MDEA 1LF5A 4QBGB 2PLFA 1E98A 1N6OA 4MH0R 4RD0A 1D9ZA 3UMRA 4JJZA 2N46A 3MG9A 2DR3A 3F3YA 1E4VA 5EP1A 3PG5A 3U3MA 1MH1A 2ZU0C 3A4MA 3CRRA 4K81B 1ZJ6A 4GMDA 3A1WA 1XTSA 1IXZA 3HWSA 4QBIA 4WAUA 4D82A 4LRWA 4H1VA 4M9SA 4URUR 3AP1A 2FA9A 3RSLA 1CEEA 3SI7A 4Q03A 5DGXA 5GJCA 4V0ME 3P4XA 1H65A 1JQLB 2NO7A 4HLDA 3B1VA 4GBMA 1HYQA 3EA5A 3QKSA 1U98A 5FBQB 5EJEA 2C9YA 3MGCA 4NDZA 5IT5A 1KSHA 1R0ZA 2ZJOA 5HZHA 4PZYA 2GK6A 3WBKA 1AIPA 3K9LA 2PEYA 4IDNA 2JA1A 1E9CA 1QHSA 1FNMA 2J0VA 1EFCA 1EFTA 1BMFA 3VKGA 1V5WA 4B6FA 2DWPA 1IN7A 2PT5A 1DE0A 1JQJC 4Q1DA 3TVTA 5BXQC 5CB8A 3KXKA 4UJ3A 1TQDA 3NC1C 2ORWA 2NPFA 3I32A 1VIYA 1ZIPA 2J7PD 1VCOA 2ZEJA 3PQCA 5G41A 3GLIB 5GJBA 1CR2A 4HAYA 1S0UA 4KU4A 1AGPA 1K6MA 2QMUA 5JJIA 2BDTA 3GEIA 5FOTA 4TYNA 2YOFA 4IVQA 2OV2A 4DJTA 3ZS8A 3CZPA 3WP0A 4QNMA 2YWGA 2BIFA 1C9KA 4UNPA 1Q3HA 1JECA 3L8ZA 1VYUA 2O52A 1WQ1R 2WKPA 3A36A 4PSVA 4YLGA 3SQWA 1BMFD 3K70B 2IXFA 4OBEA 4PQYA 5DE3A 2LKDA 4CEJA 1E3MA 1H8HA 1FP6A 2BOVA 3KDSE 1FP7A 1QVAA 2F9LA 4G3XA 4AY2A 2BM1A 2GZDA 4IDOA 3GLGA 4G5QA 2FFHA 3K9NA 2BKUA 4A0RA 4XVRA 2FNAA 3UG7A 4EJSA 4ARZB 1XJ0A 4U7DA 3GFOA 3CX7A 2F1JA 2AKYA 4RKFA 3EZFA 2ZYWX 4AKIA 2ZSAA 4M1TA 2CCGA 4V0LA 3GEEA 3D8BA 3KQUA 5DSZA 4L9WA 3E5HA 4Q19A 3WNCA 1VCNA 1XMJA 3ZIAA 2DFLA 1G3IA 5TB5A 5M04A 2QTFA 3Q7PA 1ANKA 2V54A 4NYMR 4DIDA 1W0JA 2ZS8A 1N5JA 4BEBA 2WOOA 4BLSA 4OKSA 1XX6A 4BE7B 1G41A 2GJKA 4Q47A 3NH9A 4HDOB 4YDHB 3QXJA 4IJMA 1SXJA 3FPAA 3KB2A 1IY1A 2VSFA 1KO4A 1ZNYA 4MKIA 2OAP1 2BWJA 5DISB 3GJXC 5CYPA 3VR2A 4BASA 4CZ2A 4US1R 4DEXA 2CLDX 2CE7A 2GTPA 4WXRA 1TF5A 3K0EA 1NL3A 3NEJA 1T91A 2HCBA 2H17A 3KX2A 4JT2A 4NYMQ 3U6BA 1RVDA 3KFVA 3TH5A 3N2EA 4HUTA 3BH7A 1Z47A 2P67A 2OUKA 3NH6A 4MKGA 5G53C 4FW9A 2QBYA 5LDDC 4ZI2A 1RRPA 4WW0A 1HV8A 2V6IA 3CW2A 4NCKA 5FOXA 3U3RA 4D6PA 3ZIAD 3AP2A 2W83A 3QF4B 4IDPA 4F4JA 1XTJA 2WPDA 2GCNA 3BC1A 3AF2A 4UNNA 3TSOA 4LOAA 2WWXA 2JAQA 1E2KA 1P4SA 5AJVB 4IEEA 1W0JD 4OJQA 1A4RA 3E70C 1PUJA 5GVRA 5KNBA 2RAPA 3BIFA 3SBEA 1AQYA 4PR0A 4B48A 1I2MA 5KSYA 1SXJD 3BWDD 1MO3A 3KTAB 3FWYA 4EIWA 2CNWA 5DNYB 4ESVA 2ODWA 2JASA 4LYAA 2VPPA 1Z0DA 2GEUA 4D80A 2OXCA 1IOZA 2J41A 1CJUC 3P1JA 3QEJA 1RW4A 3Q72A 5A4JA 3U7GA 4XVUA 2JLUA 1G7TA 1KNQA 1IY2A 1GIAA 5CLQA 2ZREA 2FOLA 4TL6A 3BB4A 2EU8A 3VNUA 1YRBA 3NEYA 5JS7A 2BEKA 1GITA 1WA5A 2D7DA 4Q18A 4QHYA 2WPDD 1W4BA 2CXXA 1KZ7B 2Q3MA 3QQ5A 2UKDA 2H1LA 2PL3A 4KVGA 2ANCA 5L3SA 3C41J 1L7VC 4C0KA 1C4OA 2HJGA 3BD9A 4DDWA 4B44A 1NN0A 2OHFA 2CBZA 2PMDA 2PZFA 4QGAA 2ZSFA 1U9IC 4DSUA 2NTYC 4JLJA 4TLBA 4DCVA 3WRXC 2GCOA 2CNWD 4LJAA 4QGHA 3GFTA 5FOSA 3OFND 3W34A 2J87A 4ABYA 1R8SA 2IT1A 2BKEA 3U7HB 2KI5A 1U94A 1IN6A 2GWHA 3A37A 4JVMA 4TWZA 2AFHE 3I73A 2WJIA 2PH1A 3LQQA 2EQBA 4QBHA 2HXYA 2G0NA 1M7GA 4ACAA 2XNDD 5G3ZA 2AKAB 1YZGA 2GF0A 5FUYA 1IM2A 2R6CA 2WAYA 2RGEA 4C2UA 1N6KA 2QE7A 2XJ9A 4PHGA 2LWIA 3AF3A 1G4UR 4P4SA 4JT4A 3G5UA 3T1VA 4TTRA 1RIFA 1KSJA 3CPJB 5KOYA 1IHUA 4LSGA 2IYYA 1P62B 5CJPA 4JSYA 1KIMA 2J1LA 2C9OA 4KODA 2QL6A 1NVUQ 3DZ8A 3Q5DA 4JKYA 1SVOA 3IBYA 5KDOA 5KO2A 1LTQA 5JCZA 4LCBA 3QKSB 1FFHA 2XOKA 1OXTA 2PBRA 1H8EA 2RHDA 2Z4SA 3B1YA 4FI3C 4JVNA 4LI0A 4A36A 2C5LA 2X2FA 1N25A 2QG6A 3RNLA 3UWOA 1U8ZA 2ODNA 5JI3E 2R6GA 2WWIA 2JIZD 2WWYA 1DPFA 1KK1A 2JJ1D 4DB4A 5FTNA 3CPEA 1SQ5A 1NKSA 3AEZA 2C2HA 3ZZTA 2QE7D 1CJMA 3RS3A 3TQCA 3SFZA 4JBXA 4OQMA 4JMPA 3AV0B 4Q48A 4WOPA 5J5CA 1DAGA 4Z8XA 3J81k 5FTLA 3JVUA 2RCNA 4JLBA 4LJ5A 4Z54A 3LNCA 4F4IA 2FDCA 2NPIA 2XB2A 1EFUA 1VCMA 2OCBA 5JEDA 1WBDA 3CX6A 3PJRA 3NBZC 4DXAA 1KK2A 4UKDA 4B35A 2XOKD 3OAAA 4LHZA 1RRCA 3I62A 2FSGA 4ZCMA 4PAOA 5ELXA 4B3BA 3QXHA 5HCNA 3GLFE 1CP2A 1E79A 2UZIR 2YZ2A 3Q5EA 1NMXA 1XXHE 1XF9A 3V4RA 1VG1A 2CLSA 3BFXA 4WZBE 5CDFA 1IN8A 1Q22A 1DAIA 3BORA 5HE8A 121PA 3CRMA 2R62A 4V0KA 4D26A 1NBME 4CEJB 4LZZA 4KFRA 3VR6A 3GJ6A 1MRSA 1YJ5A 2NQ2C 2P0EA 2QUZA 1T5IA 3KQLA 2FPMA 3B6EA 2FEOA 4LK2A 2CCKA 3HU2A 4X8OA 2R2AA 3PEWA 3TAHA 1ZMXA 3MFYA 5J4HA 1S9HA 3AVVA 2J45A 2JCSA 2GBLA 2ZJYA 2ZS9A 4CIDA 4M9QA 4G5GA 3PUWA 4EJSB 2C99A 4R7ZA 3BFKA 2A5JA 721PA 2DB3A 1U2RA 3DKPA 3PCRB 4LY6A 5FPTA 3VHLB 4A0GA 4QXAA 3D3QA 1S3SA 3D7MA 1YZTA 1E2GA 3BGWA 4U00A 4A6PA 1E79D 3T15A 1S3GA 3DOFA 4TL7A 2B8WA 1HH4A 3UK6A 4TYWA 4OQLA 4ILEA 4PO1A 3U3OA 2IUUA 4C0HA 3UXMA 4QOSA 4OHZA 4KHZA 5C2JB 3N70A 1XEFA 2J59A 3A1TA 2CE2X 1E0JA 4XVQA 3I5XA 4HAVA 1SXJB 3GLIE 3U4QA 3U61B 2Q3HA 2BHRA 4DCTA 4NL4H 4NCIA 3AUXA 4GRAA 4NKRA 4FMDF 3KQKA 1JEEA 1KHTA 4EPXA 2NZ8A 5D3QA 4LBWA 1Z08A 2AD1A 4KCGA 4YMTA 1EXMA 2F43B 3KKQA 1SHZA 3PXGA 1SGWA 3K09A 2JATA 1AKYA 4IOMA 3THXA 2QBYB 4KJZA 1Q57A 3SYKA 1KY3A 2ZSEA 3H86A 2GVZC 3I72A 1P60A 2NO1A 2L0XA 3WYGA 1XCPA 4C0AC 1X3SA 3Q85A 2VP4A 3WMEA 1PVOA 1T4GA 4F4CA 2OESA 4R98A 4BFVA 4YXWD 2VIIA 2XNSA 4L16A 2OBLA 1E1RA 1FTSA 3BERA 5EP2A 1HE8B 1OKKD 1TNDA 1YZUA 1US8A 3SZRA 1NVXQ 2ZYTX 1GWNA 3TW8B 2B6HA 3PV0A 2R65A 4ZDIA 1X1SA 2W00A 4FWIB 4B76A 2IHBA 2XTMA 3DM9B 2GCPA 1LNZA 2DFKB 2VHQA 4FCVA 4BFTA 3VX3A 4AKHA 2QMOA 3TAUA 1EFRD 2HF9A 1Z3IX 2WJVA 2ZPTX 2ZR0A 3KB1A 4MYCA 4OHWA 3F8TA 5DH9A 1II8A 1N6IA 2VP9A 1ZU4A 4TQAA 2C03A 5KSZA 1RYFA 4KAXA 4FXPA 1EWRA 4AYWA 1AM4D 1SHKA 4TYYA 4ESHA 5CJ2A 1RYHA 2AXPA 4TYQA 3W9YA 3R9XA 2X77A 3LY5A 1GNQA 1ODFA 4LPKA 1E2QA 1A5TA 1ESMA 2QRNA 3B8HA 3CR8A 3K8YA 5K8IA 5L3SB 2YYZA 2F1HA 2V55B 1E1RD 4G5SA 4OI2A 4EPVA 1OIXA 2LCFA 2BCJQ 3U44A 1B23P 1HEIA 2JEOA 3KJHA 2XITA 3EPHA 1E2HA 1P9RA 2GCOB 2ERYA 3CH4B 3VMFA 1M2OB 1UF9A 4P3YA 3VU9A 1NBMD 2PEZA 1D8TA 3C16C 5E4FA 1UBEA 5KSOA 2GXAA 4AYXA 3UIEA 4LYFA 1BKDR 5B30A 3MCAA 5AR1A 3CNLA 3RC3A 1F2TA 2ZJZA 3TUJC 3NXSA 2REXB 1IONA 3QF7A 1FUKA 4PPFA 3ZVNA 1G20E 4KITB 3IIJA 1FQJA 4PPGA 4V02A 3SEAA 4IHQA 4QFMA 4IOKA 2WWWA 1D5CA 2ZJBA 3B1XA 3GJ0A 4DCNA 5JWHA 3THYA 3NDBB 2BMDA 4OQFA 1NSTA 1UDXA 4QC2A 3CB4A 4P4SB 3RS7A 1IY0A 2I1VB 1R5OA 1C1YA 3BH0A 4HAXA 1Z2AA 5IF9A 2IYRA 4D0GA 2P2LA 4A4DA 3VR4A 4M1WA 2ZRKA
chains in the Genus database with same CATH superfamily
1A50B 4Q1CA 4ZRNA 5IT9A 3Q98A 4GOMD 3HR8A 1XZGA 3W6UA 1FNSA 1M1ZA 1DAPA 1EBFA 4JUFA 4KK3A 4RF2A 1JHAA 2ZUBA 1OZGA 2IXGA 2Z83A 3PC6A 2HUPA 4A16A 5JZSA 2ZE6A 5T6MA 1BQ4A 3K1YA 1WY7A 1P3JA 4N65A 4S1PA 4TXLA 2OLJA 4JHXA 5JNTA 1OFVA 2PGXA 4OB7A 1MOQA 4ADSG 3W8DA 1CYDA 2O3QA 3HADA 1AGYA 4H7JA 3L41A 2AR0A 5DOVA 3TDKA 3EAQA 5EZ6B 1YHNA 1NULA 2F90A 4RAQA 4NAHA 3TFWA 1P7YA 2PUEA 1TYBE 1MAWA 2X0FA 2I6TA 2AG8A 2Q29A 4ZO6A 5KYUA 2VPQA 1DELA 3NC4A 4D3DA 3IBCA 1AN0A 4Q1FA 4XB2A 2Y4NA 1AKTA 1DFHA 2D5BA 4GNKA 1FMLA 4AWXA 3VR4D 4MS3B 1E0KA 1L7QA 4NMXB 1BKSB 4D8VA 1MOSA 4L07A 1VECA 4O5AA 2O3SA 3W6OA 4IG4A 4ETIA 4Y1FA 4BLWA 1PJZA 2MU1A 4XWTA 5GOTA 4BNNA 1U0GA 2R751 5D5HA 5J2TA 2PA3A 1AUPA 5AOVA 3ZJVA 2XSZA 1A9RA 2Z2KA 2QU8A 4FINA 2BFDB 4G5YA 4M9UA 2GILA 4G41A 5ALOA 3W5UA 4W9NA 4X1KB 1YU9A 1LA2A 2REQA 1MHPA 4NYJR 3M7IA 3FAKA 3GFSA 5K51A 3BD6A 2YN4A 3FZEA 4L5JA 5C5IA 2V1UA 1P72A 4Z2AA 2FPIA 4O25A 5EHNA 3LGXA 4A6DA 1APBA 1ODIA 3OWHA 3I2IA 3NTVA 3ADBA 1Z6YA 1SG0A 1VE3A 4XM0A 1PNQA 3GPDG 3E9EA 3KJQA 4BV2A 1R9JA 3E15A 5A2GA 4LRSB 1MJFA 3FF4A 2V98A 2VBGA 4FLEA 1OF1A 5AW0A 1V47A 2BE9A 1E5LA 1BXZA 2ZWOA 3QKTA 1Z45A 4GKVA 5GV7A 1FYDA 3A28A 1Z0JA 2XZLA 2ONZA 1AK2A 1U2TA 3HRHA 3LK7A 2R8ZA 4D45A 4H6PA 2GK3A 2P6OA 2W43A 3FCCA 5MN4A 5LQRA 3A9RA 5E6SA 1IWPB 2EFHB 2WRZA 1PJRA 2PBZA 2PX8A 1AURA 5K3FB 5AVZA 1DCTA 1JHUA 1E9AA 5ILGA 1K0UA 2FPUA 3S6JA 2J0UA 2DPYA 4F1JA 1YONA 1FCJA 4JQCA 3GHYA 2VOJA 3B1WA 4X6YA 3VTAA 4RD4A 1SOWA 4IZHA 2XSZD 4FBMA 2IY7A 5DHAA 2X0DA 3WKDA 4UUAA 2XUDA 5CYFA 2RGNA 4ZRDA 1OH6A 4BWYA 1LPAB 2PD3A 4X93A 3GLKA 4P35A 5BW8A 4FSHA 3UUWA 3VZQA 3V7FA 4S0XA 3MEQA 4MITA 1YRAA 5FWNA 2V7XA 4QXOA 1VSQA 1P9OA 1MIHA 4N9WA 4OXYA 5E6RB 4QJ5A 3U26A 2HYIC 1GLGA 1UFVA 1UEJA 4DIKA 5IM4F 1MX1A 1VRVA 1OYVA 2YIMA 3ZLUA 2TSYB 3TLEA 4BUJA 3V8NA 3ZK8A 3IKVA 2QR5A 4ZI5A 2IXTA 2HQOA 4JIGA 5DM2A 4DCOA 1Z38A 4O4LB 4L74A 3V8EA 4WOKA 4IHJF 3ZXXA 4WKNA 4BATA 3U7RA 1GJRA 1RLJA 4Z7NB 4M8LA 1KAHA 4INPA 3O9MA 3DBHB 4JI8B 1XB2A 1YZ3A 3IXLA 5ERYA 3TTWA 1OX4B 4JLNA 5JZVA 2BFEA 1QG4A 4BKOA 4C7JA 2XKAA 1D07A 1M33A 4JUIA 5DYNA 1L5HB 1GFZA 3JD1A 1SCBA 1NV9A 2B34A 2MOKA 5I4IA 5HIMA 5HUHA 3I23A 1CY4A 1MRNA 5DULA 1U0SY 2J7PA 1T0HB 2IQIA 4IUDS 5B7PA 2RC6A 1TU0A 1HT1E 2XVZA 3KOOA 2OO3A 1OV6A 3PJFA 3LCUA 5FPHA 621PA 2QN3A 1GG5A 2QZZA 3FROA 4ZVOA 2NAFA 3HKCB 2ZYSA 2VP5A 1GTMA 3PKIA 4MYRA 3RFTA 3WL8A 3GLGE 1XC7A 3AHIA 3L79A 1AGRA 4PBTA 5LCXA 5AUQA 3SVZA 4LF5B 2BUBA 4MRMB 2HA0A 1Z68A 3BB3A 3CKLA 1SR8A 4P83A 5ADUS 1I4OA 2PANA 2Z5VA 3O8DA 3DOEA 3WX0A 2JG3A 4CRWB 5HGJA 5TRTA 4URVR 1WMSA 6GPBA 1YVUA 3BDVA 5CFRA 1T25A 4Z9AA 2VL7A 3I1IA 2QPAA 1TJ5A 4BLPA 4UTNA 1FE8A 3INGA 3A9TA 3CC8A 2O8DA 3EXFB 2D0PB 1R6AA 4BCDA 1ONNA 2FUCA 3I53A 3MTJA 1JKMA 4RCYA 4Z2YA 5AW9A 4AY3A 4CMAA 7REQB 1DOAA 4DDUA 1JEQA 5A5GA 1CDDA 1O1YA 4MIYA 4OJMX 5F7OA 3VYTB 1JFTA 2IY8A 1ZZGA 2OFOA 1PGPA 3JQQA 4HRXA 5KDLA 1O87A 1YVPA 1QF9A 4ZARA 1RACA 2QSZA 5A7FA 1AZSC 4B87A 2FEPA 1ENPA 5EKUA 4GOJA 4YYZA 3S81A 5E7QA 4KVZA 3RFCA 5KYYA 1GLNA 4FSXA 4M7WA 4O2RA 5DYGA 4RK1A 1O6BA 1TF7A 4WMLA 3ETCA 2GJ9A 4HY3A 5IXYA 4OLJA 3IDZA 4NU0A 1AZLA 4RANA 1UIMA 2HBRA 5EVJA 2J46A 1FDRA 3VKFA 1OWOA 5HQJA 1XZAA 1Y3CE 1GU7A 2HK9A 3IAEA 2HC9A 1FUEA 1E5XA 2ZT7A 1LBIA 1FFBA 1WUJS 2I9PA 3AVPA 3BSSA 3DO5A 4S35A 2ZT5A 4GVXA 4IGIA 4JDUA 2JW5A 2EIHA 2YYAA 4GT1A 3PQDA 4K6GA 4LDPA 2ZAOA 3QWHA 1VHJA 1RADA 3K31A 4M0EA 3Q8KA 1ZMTA 4OIMA 3QOXA 4NK4A 1PL7A 3VA7A 1GPAA 3TWOA 4M76B 4P0TA 2R8EA 5DT2A 1RYDA 2XCLA 1UAAA 3UV3A 4X7MA 5B1IA 1NJ1A 1Q1BA 4M7RA 2P41A 3AJRA 3LVFO 5JOQA 3MT8A 4PO3X 1QKIA 3THYB 4FMCF 3G8AA 3H19A 2JFPA 2X4DA 3QLEA 3SLKA 4M60A 2QW8A 1ADBA 3R3WA 3NR2A 5DBGA 5SYMA 2OV3A 3NTLA 3BMOB 1R5JA 1G8JA 4UFPA 1UKBA 5L3QA 2WJZB 1G8FA 2VATA 2AR7A 3PQFA 3MSCA 3F49S 1NBAA 1Q83A 3VR4H 3LUAA 1M6NA 4C6TA 3MJCA 1A5AB 1OROA 1W5BA 1B6GA 4EKEA 2IUFA 1NG9A 1Z4QA 3IFSA 1UM9B 2H7XA 3LT4A 3TKLA 5ESRA 3ZC3A 1F9EA 1OB2A 1WIWA 1LZLA 4EGCB 1UMKA 5BN5A 3M4JA 5JFTA 2YJ6A 1CV2A 3FNFA 2WYHA 1JLHA 2WU4A 3LUFA 4YRMA 1C4WA 1OFIA 2OLEA 4UU0A 2PMWB 2V4MA 4BQSA 1TTHA 4P80A 4PYNA 4L9SA 1SCDA 1KOLA 1WBBA 2G9ZA 3MILA 4B3MB 1DMRA 3VMMA 3LVQE 4F6LA 3DP7A 4J0IA 5BW4A 4I55A 2DWQA 2JEYA 4QG7A 5TMEA 3PHLA 4KAJA 3UGJA 2I91A 4V0OA 1NHGA 3OICA 3VPSA 4DANA 2O4UX 4JQZA 5AKGA 3WYDA 4AURA 1Z8FA 3H1AA 4WEQA 3PVCA 3DHWC 4U6NA 4JR0A 5GVSA 5EN4A 5HVNA 5INTA 1QFJA 1KC3A 2CYAA 5A02A 3AU9A 4YMUA 4M0CA 1LC0A 2P0AA 1G7CA 3SYLA 2A2ZA 2PS0A 3FZNA 3UCEA 4DLVA 5E9QA 4G25A 1CEYA 1ZGGA 4XAQA 1XSEA 2VHVA 4WASA 2F43A 2J0EA 4R2MA 4WCDA 1JI0A 1PG0A 3CCCA 3SEQA 2AZTA 5K0BA 2A30A 4J0KA 4EQ6B 1EVJA 1QTQA 2NLOA 3D8RA 3OPMA 2RGYA 2H3EA 5EWJA 3GLHB 1NVVR 3P2YA 2XUJA 2HCJB 3T7JA 1QMPA 4EG8A 5I7EA 1M1UA 3MF4A 2HLNA 1QBKC 4M22A 1Y89A 2ZBQA 2PTGA 2GZSA 2W2KA 5CB4B 3OVMA 1XCBA 1LDGA 3L4KA 2HRRA 2C8LA 2HCFA 1PJSA 2IBMA 2P9JA 3B85A 3QGMA 2JHCA 3MYYA 4XD7A 1H4SA 1ISPA 1CETA 2PX5A 3QJGA 1D5WA 2GA9A 1FLVA 1EFPB 1PR2A 2RFLA 3OOYA 3L04A 2R79A 3HGQA 5MFZA 2GFHA 5AW5A 5BSVA 2XE7A 1P77A 1JEDA 1WF6A 1ZNWA 2CZQA 2RHLA 3IXQA 4KDEA 4YCBA 1U7ZA 5CX4A 1E6WA 1IAQA 1FVHA 1N57A 5A4AA 5C81A 2NP7A 1N7HA 2O8FB 2OORA 3EE6A 3ZHUA 1FK8A 1YQTA 1VGRA 4JJGA 3F6BX 3GXBA 2FUKA 3X3HA 4FQ5A 2I55A 4HHEA 4UNQA 4ENTA 3VC1A 2VHZA 4X6LA 1YCFA 3IA2A 2VP6A 3J81A 1NBHA 3ID6C 4P98A 3V4VB 3FIUA 1L3CA 1J70A 1HYHA 1ZNZA 2GJ8A 3Q5GA 3UHAA 3ZNPA 4EB6B 1OC2A 3I34X 3T0GA 2FI1A 4ED9A 1Z0UA 2PYIA 1IH8A 4ZAXA 1RJDA 5DVZA 3UJ9A 2QUIA 2WTXA 1MQAA 4OBBA 1ZUWA 4BFWA 1GQ2A 1PFVA 3DMGA 5F5XA 2XPCA 4P38A 1JR4A 1CRQA 1N0IA 2WT8A 2H2IA 1XZ8A 3FPBA 2YY6A 3L8DA 3MINB 1T3HA 2F62A 3CS3A 4Y6GB 2LGJA 5G0SA 5EJ8A 3ORQA 3ZK7A 2WB4A 4XD7D 1JMKC 3BWYA 5B7QA 5H83A 5AVVA 3O91A 4UMDA 1PT6A 3CRW1 5F21A 4H0NA 1NW4A 2I4IA 2X0RA 4RS4A 4PONA 3IQWA 4R2HA 2C4UA 1YIOA 1EDBA 1JZSA 1E6CA 3Q6IA 4WLEA 4BNGA 5M2QA 4BUCA 3HZRA 3ISTA 3ORYA 1MJGA 4L50A 3P9KA 1DHTA 1ZMRA 2TYSB 2R44A 3N8KA 3P96A 1BG6A 1D6JA 1OX6A 3GH3A 2NTJA 2PS3A 1L5VA 3DVRX 1PFWA 4G0XA 4DW8A 1H0KA 3T3EA 2ZRPA 1U8EA 4UOEA 2OGSA 1G8MA 3OIDA 1JDZA 4WZAB 5JAZA 3LW7A 4NP6A 4LEIA 1XZNA 3ZPXA 2YXPX 4PZZA 4Z4EA 3HCWA 1P2UA 2VO1A 1BX0A 4ALNA 3ZH2A 3DPIA 4PC2A 1DAEA 1XQ6A 1TEVA 2YMPA 3U5TA 3FPJA 1YBHA 3QKWA 3OBBA 4ZAWA 3T5BA 5ECDA 3ECSA 3L8GA 1I6KA 2LRHA 4WK4B 2A35A 3A9UA 4HDCA 1T4CB 4UJ5A 3RRZA 2QE6A 4MVJF 1IBCA 2W4IA 3K8OE 3I8XA 5FL7D 4AJ4A 5LOVA 3MWEB 5DM70 2FR0A 3E58A 5LP6F 2ZE5A 5DW3A 3B13B 3T06B 5K0JA 3MUEA 3F6PA 7YASA 4OATA 1RKVA 5E1DA 3UAZA 3MMNA 3I9JA 3FKJA 4BP9A 3TCXB 4BTVA 1JXOA 4H27A 3PQ6A 2VRCA 3ZG6A 4CM7A 2IHNA 1A7UA 3R77A 4UVEA 2I2AA 3Q7SA 3GLTA 3RC9A 4AW9A 1JAXA 4XOIA 2PZAA 3AL0C 1JG7A 4R81A 2Y2VA 1DFGA 3ZD8A 3I0ZA 1NLMA 3HZOA 5DT9A 4D81A 1K7EB 1M1NB 3BTUA 3KOUA 5A6VA 5C7IO 1QHYA 4UOQA 1G21E 1Z5VA 3N28A 4J6FA 4ZOLB 3DOUA 3EGDB 2X0IA 3ZYCA 3I6ZA 1FIUA 2IJGX 3ZVLA 2WJGA 3SKYA 1FFYA 5EE5B 2CFCA 3DR3A 4EYGA 4HH1A 4ALJA 3DXFA 3BGDA 3PEEA 4KIFA 4LV8B 2IXBA 4ZK2A 3FKQA 3QLJA 1PT8A 1PQPA 2OB2A 3NYQA 3I4LA 5DHUA 2HHAA 4XRGA 2ZUUA 4HNAB 1MJGM 4K9PA 5F2EA 1LD3A 4M37A 3UJ6A 4I4CA 3R24A 3STUA 1T6ZA 3HE3A 2AX3A 3HDYA 3UWPA 4A03A 5A4IS 1THZA 1TEZA 1THTA 3PQ8A 4B3FX 3ICCA 4WV3A 1OHHD 5JJLA 1H2XA 3EX7C 2VCYA 2PD4A 4JEIA 4DHWA 4L76A 4D9JA 4J76A 3DOJA 3UHFA 1BCSA 1TKRA 4WKPA 2RHTA 3AM1A 3OZDA 5IVPA 1RJGA 3ZXUB 1QZXA 4OU5A 3KVRA 3R8FA 4HTAA 4J7CA 3DKKA 2B8EA 1Z4NA 2WFAA 5YASA 2H4XA 1YRWA 2V8BA 4WLUA 4YI5A 3UYLA 2BM0A 3K6RA 1WCV1 2RGAA 5THQA 4DPKA 1KJWA 4GGPA 3F3SA 4HYQA 4IP0A 4PGHA 3UMYA 4EG6A 2BFFB 1DP4A 1ZM4A 2B4TO 2WE7A 5FDFA 3IRVA 2VYND 2FUNB 2XA1A 2ST1A 3O82A 3MLBA 2JFOA 3BOSA 3I0NA 3DTYA 1Z7GA 4Y18A 4GRDA 2AIRA 1Y5MA 3NBYC 1I4WA 4TQUS 2W0SA 4GH5A 4IW3B 1ML3A 4M46A 2Z2IA 4K28A 2G9UA 4KNVA 4IIUA 3BAZA 1NW8A 2VF8A 4G1CA 3OX4A 4UZSA 4P5EA 5KYKA 5IEBA 3R7WA 3RWBA 4IO1A 1E0SA 2DQYA 3INRA 4GI7A 1W1WA 2V6FA 1OGJA 3JSXA 2MT9A 4QGBA 1OU0A 3ZDBA 2I3DA 3QUBA 1V16B 5DB4A 3V8PA 2G06A 2BGMA 3DAOA 3KB6A 5ALWA 4AO7A 3UJNA 4MI3A 2IYEA 1WOMA 5ALFA 3VRHA 1K68A 3ZWKA 4ZOQI 1KK3A 2POQX 1D4AA 1G3UA 3MJFA 4YXWA 5LA6A 3AY3A 2DT5A 1N0UA 3TLKA 2H4YA 2ORIA 3TVYA 4C14A 1PG2A 1MIOA 2A5LA 2OUIA 2WSSD 1T0JB 2Q1YA 3PGA1 1OKKA 3WIEA 4IWYA 1JWLA 1XTIA 5TE9A 3U9LA 1SG9A 4TTQA 4CKXA 2OKCA 3V9PA 3SBDA 4RK5A 4BYGA 2C20A 3OMWA 1Y6FA 4U3JA 3CLUD 1MQSA 1U4NA 3DXXA 3FGZA 4TV8A 1N2BA 1O94D 1UM8A 2W6JA 3P27A 4M0MA 2HIGA 3B7WA 2O0KA 3AEXA 1ORIA 1DS6A 3DC7A 3FYSA 3L8EA 5NULA 3DBLA 3KOMA 2NTNA 2OR3A 2EP7A 4ISBA 3VTKA 5LSAA 4QBKA 3T9AA 5E7MA 2OGUA 1T9HA 2Y9PB 3G17A 2WDZA 3HEAA 2KB0A 1NJ2A 3DBRB 3L6EA 5FV7A 1PLKA 2QF7A 1ZI6A 2BAGA 3KVNA 3FVRA 4LVNA 4ITRC 5IVDA 3NRCA 4DBLC 3DF9A 3I2JA 4Q4JA 2ZJFA 4I1IA 1V8DA 1XZFA 4E21A 4JI0B 3E81A 2R1TA 1H4VB 5AW7A 3K9GA 5K8CA 4RH3A 1F1BA 2VJNA 5CJJA 2BGLA 2PZJA 4QSMA 5ICMA 1EA5A 2QX4A 1MJ5A 5HRCA 4Q4HA 1DJNA 4ZYVA 1NQWA 5JXGA 1EK6A 4LGVA 3PPWA 4EA9A 3J80A 3VNSA 3KXIA 3C7KA 3QUAA 4H0FA 3IPLA 3W3AD 3NYWA 1Y9JA 1QHIA 2R6DA 3AEQB 3CLRD 4WBNA 2DUNA 1YL6A 1YF3A 4KGVA 4NEHB 1EM8A 3RVDA 3UMVA 2PKYX 2Q5OA 1XQXA 2O7QA 3SE0A 1YR9A 1QF6A 4PSAA 1NBMA 5CA1A 2YFYA 1U2GA 2QSUA 2W6JD 4AZ0B 1P2TA 5FHRA 1HXHA 3MZ0A 3OQIA 4KO8A 1DCMA 4Y6LA 8ATCA 1Z0KA 4C1BA 4IDCA 4EM6A 4RTSA 4AS1A 1KH1A 2ILTA 2PKQP 5CIQA 4NCBA 1PT9A 2GPAA 4RY0A 1LPSA 3AP3A 3UW3A 2YZ7A 3WDKA 3ZLBA 3BA1A 2UVQA 3DV0A 3MWKA 2CLIB 2H5LA 5G40A 4UASA 4CEHB 5BW6B 3ER8A 3QYJA 1CNFA 1EWQA 5MGNA 4D4GA 3I6MA 3JWIA 4K46A 5ICEA 3OP1A 4O02B 1W19A 1WTAA 2WD7B 3PRHA 3VGPA 1AKMA 3ZVMA 3KQPA 1BAPA 3VV3A 1CF4A 3WK9A 4U7JA 3IVCA 5AXDA 2BFBB 2VJMB 1FEZA 1B26A 4M53A 1Z06A 1CY1A 2Z43A 2IS6A 3ELUA 5PNTA 3TD9A 1Q1QA 3TI7A 1E3WB 1SUFA 2JD2A 3IT2A 1ZUNA 1ZD2P 3JR7A 5BQ3A 2FX3A 3B6IA 1KI9A 4NH0A 1SUEA 3KXPA 2QVXX 3HFGA 3JYQA 4K9NA 4LZLA 3UW1A 4ENPA 2J31A 5C3MA 3JQDA 3RTDA 2Q4TA 1QGUA 2B8JA 2TMYA 3U81A 2QWXA 3MB5A 1TU3A 4IOJA 1F20A 1GCAA 4G2NA 5EVCA 4D9HA 5HIAA 5BN4B 2O0HA 3FWKA 3L0SA 1FBTA 4J2TA 5BSTA 2YMLA 3VAAA 2RG1A 4JBWA 1VE1A 1KAOA 1PV2A 5IK2D 3BSWA 5BT9A 4PLCA 4YCLA 1G8PA 1X0XA 1ZLYA 1ZRNA 1EAYA 2AOTB 1L8OA 2QJRA 3EIFA 4ZC1A 3ZK9A 3FTFA 4KVFA 2FR8C 2OCPA 3RHSA 3PFFA 3DONA 5EESA 3T5CA 2C2XA 4WJKB 1YI8A 2A88A 4ZOBA 1R10A 5J47A 1KSFX 1Z4KA 4DLBA 1GPUA 5D7BA 1ZCAA 4F5EA 5IANA 3M1IA 1WXQA 1NA5A 4OGLA 1HOTA 4A8TA 1DO0A 2QZ4A 4RO0A 1R8QA 4MYUA 3FTQA 1I2DA 2I2CA 1USKA 2QW0X 1EDOA 5FTJA 2G5CA 5LC1A 5ADWA 1BEEA 2HXSA 4EYSA 2VC2B 1GQOA 4ZIRA 1L5MA 3D6UA 1I8TA 4QEZA 4ZK6A 1FDVA 1FX0A 1KHHA 1UIRA 4MWEA 2HJSA 2ZVQX 4DNFA 1XEXB 3HVJA 3R5SA 2GEKA 4PXSA 9GPBA 2QG9A 3FNHA 3FPCA 5EXEA 4MLDA 3E7XA 3ZZUA 2OCYC 4KBFA 4OXRA 3WK7A 3PFIA 3PSAA 2DUWA 2K7FA 4XSGA 2PR2A 4TLDA 4AJNA 4L5CA 1FNNA 4XQCA 5LU8A 3GAZA 1CQJB 4JFAA 1RIIA 5HK8A 1YQQA 1T4MA 2AXNA 5EEHA 3TLZA 1C3OA 1C8KA 2HV8A 2X8WA 1BVUA 3U4GA 1K7YA 2WM9B 4RETA 5E3IA 3N2YA 1OGYA 5EGNA 2WAOA 1TKAA 3KTOA 3AR4A 1X8XA 1EEHA 2HNBA 1QAQA 3I1JA 1KBZA 4MLPA 1KGSA 1JWAB 1X86B 3L46A 4L5BA 3TW6A 2QL5A 1CUBA 5KYTA 1ZMBA 1KFBB 3I58A 4I0WB 1IOLA 1P9WA 1UJ2A 2UVDA 2AWOA 1K98A 3C97A 3SEFA 1PR1A 4G23A 4GGOA 1BXGB 3HWX1 2WA2A 3O4GA 1RMQA 1SVMA 2PNFA 2FTKE 2I8LA 3M4ZA 4KK4A 4MIKA 1NXWA 2YMQA 1OH5A 3CEJA 2NYUA 4UMVA 4WIAA 3Q8WA 1BYIA 1J8QA 2IXEA 2VDJA 4W5RA 5HKBA 1OZFA 3SF8B 3HFSA 4B2PA 4ZJPA 5KNCA 4R68A 3VPXA 2PV7A 4LMRA 3RU3A 5CCEA 3L1JA 2IS1A 2O0MA 1DIOB 1AHPA 1M34A 2VUIB 3EXIB 3UB3A 1PKEA 3ZS9A 4C3VA 2OFXA 4D79A 1TJ3A 2AFHB 1NN1A 2AE1A 3K0CA 3VX4A 4K86A 1BGXT 4F4HA 2WHPA 2Q3BA 4E14A 4M8KA 1ZNXA 1HDYA 5BQPA 3O26A 1IOVA 2GJSA 4LF9B 3M2PA 2EJWA 3QFFA 4LF4B 3BXOA 3MJRA 1RQNA 2UUPA 4N6OA 4BJ5A 2BTQB 1GD1O 1ZH4A 4MV0A 2PUTA 3NUGA 1HEYA 4R1LA 1E2EA 4IXTA 4K87A 1SC6A 4J1NA 1UXKA 1AJEA 2EW8A 4K88A 2JAPA 1IC6A 4ZDJA 1CVIA 3KJFA 3LE8A 3OIVA 4QOFA 1O96B 2GT1A 1XQVA 1WZIA 2Q1WA 4P5PA 4YRSA 4NE9A 4EPTA 3HDHA 3KXLA 3FFWA 3SAJA 4EECA 2C2ZA 1BO6A 3FMIA 4UMFA 4C2AA 4D4HA 1XL1A 3JYHA 1NKTA 1OBVA 4NV1A 3HU5A 5F35A 4EHBA 2C2WA 3Q88A 2HWUA 1FP4B 4FBLA 5KNCD 1AO3A 3AUTA 4FN5A 2BMWA 1E1CA 3VJRA 3G1WA 1X7WB 2X6RA 1EFLA 2O1SA 2G28A 3N7TA 5B57C 2BM9A 2X22A 3DUFA 3KU1A 2YC4C 1EXDA 3W3AH 4YAUA 3EFHA 3RSQA 3TSZA 3BBPA 1ZKMA 3NV7A 4JZKA 1L7AA 1RWNA 1VB5A 4GZLA 4CV0A 1XAGA 4TMKA 2QY9A 4W1QA 2I6SA 4L4XA 2ORED 3HNOA 3MB8A 3OJLA 3WGTA 1W0CA 1KJQA 3U3JA 4DG8A 1J2EA 4RS3A 2CL5A 2GN2A 2UAGA 4GPAA 4J6EA 4D9GA 4B3SB 1UDWA 2PLWA 2V4ZA 3I42A 4ILKA 3TCNA 3UAXA 1DAFA 1E5DA 1U3UA 4L5YA 3C8DA 1WDTA 3RFUA 4D4MA 1IDOA 1U6KA 2ATEA 3GFFA 4G1BA 2W6OA 4O3MA 2QIPA 1HQKA 2EBHX 4WWHA 3RIEA 1H05A 2X9QA 2ERCA 3OBIA 3RE1A 3UY4A 1JS1X 2R8XA 1GKIA 2EYQA 1I4TD 3GT3A 3QMPA 4EB3A 5TLSA 3UK0A 1ZCFA 1T5BA 3R7AA 4BBZA 4OYHA 4ZVMA 2ZBEA 1Z0SA 3ENNA 2CHQA 2RJNA 2WMDA 3KV3O 1JPUA 1NV8A 1BGVA 1XDDA 3AFNA 3EXG1 2DHQA 2DYKA 3GLQA 5H7XA 4I3GA 4C03A 4ZJZA 3FSJX 2IP1A 2ZPAA 2LDXA 4BAZA 3GPIA 1DO2A 3VNRA 2IYTA 1F9AA 3WLJA 1XXHB 4OFZA 3MLEA 3PFCA 1VFPA 3QE2A 3ODPA 4FCCA 3BWBA 4WZBB 5DBFA 1KYZA 1HMPA 4FJ0A 1I7SB 4LC0A 4CCSA 2R2GA 1KK0A 4CLOA 3SC4A 3C3AA 3SU8A 1RQ2A 1P18A 1SEVA 4BU1A 1UQUA 3VSDA 4ARIA 2W58A 1CWUA 5IC5A 3AR6A 3EEYA 1R8JA 3P71T 4IIHA 4Y1GA 4ZHQB 3A8TA 4PS0A 2CF6A 3S70A 3U7JA 3TL3A 3QE4A 2YFKA 3QPBA 2ZUSA 3STVA 1DC3A 4CL0A 2F3UA 3RNOA 2F64A 3DZIA 4FS8A 2O3JA 5HMLA 1PEDA 3FOWA 4J16C 2GEVA 4I19A 1GAXA 2XY4A 2GAAA 3Q7EA 5DX8A 4Q6BA 2ZI9A 5C34B 3CB2A 5C8YA 4ATNA 4OJKA 1M66A 1AKQA 3A1SA 2EJTA 1RLMA 2IPAB 3HP4A 5E3HA 4RNCA 1RP7A 2JRCA 3AESB 2QP3A 2CL6X 2OSBA 5FOSA 2C54A 4G81A 3EVZA 5HIIA 2ZWPA 1WJGA 1SXJE 4HGOA 2I80A 1KJ9A 3OZEA 4TOIA 4AJEA 3WI7A 1G4AE 3KSDO 1UBFA 4KOEC 4PZ0A 4FUQA 2QSJA 5J4YA 3ZHCA 2QM8A 2PVPA 1SU4A 2ZK7A 4HLQB 2EWWA 1Q1EA 4RTNA 3JWJA 3LRTA 1FMJA 1QYIA 1SELA 3CCBA 3QVGA 4RVHA 4O8ZA 2UYCA 3JQAB 4NIMA 4O1HA 4ZU3A 4IH9A 1NY5A 2ES4A 1N8TA 1H1LA 3MMPA 4R01A 5ECYA 2ERXA 3FFAA 4D5GA 3F7OA 3DPSA 1HSOA 3IAXA 4IJWA 1G55A 4MA5A 4UBLA 5DYIA 3NV9A 3UPTA 1ZD9A 1BD4A 1NZDA 1VJ5A 1WCIA 2AMYA 2EZ9A 4JC5A 5LPNA 2WMOB 4DLNA 1E2LA 4J2OA 1JSZA 1NE7A 1GO2A 4X61A 1XROA 1QHGA 1ESNA 3DYIA 1YA4A 1KI6B 1IMJA 1JVBA 1RMYA 2H9IA 1LI5A 2XJ4A 1N2JA 4LZOA 4NU5A 1T6XA 4NX2A 4Q3BA 5FBQB 5FTMA 3V2IA 4TMVA 3AVXA 4Z4HA 1E5VA 3PIIA 2KQUA 4WADA 3RJMA 5DMXA 2XCOA 4HXEB 1W2WB 1K4YA 2GQ0A 3DEYX 1E1DA 3LBHA 3IR6A 4AX4A 4XDHA 2V3VA 4Y98A 4YJ3F 3QBDA 1KETA 1TEHA 2J7KA 5GAJA 3T5DA 3TS1A 4TSRA 5JPDA 2PT6A 1M6YA 4OOFA 5C52B 1XJWA 1S8FA 4AD8A 2FZEA 1FRNA 1GRVA 4QUEA 4ASUA 5G4LA 1AU9A 2GCGA 2QRHA 3DMFA 3I6IA 5BV8A 1N6NA 4LXIA 4PZ9A 3DFUA 5SY9A 4LQLA 3G85A 4U39A 4X85A 4JU8A 1N6PA 2C3OA 3ZI0A 3HVRA 3REGA 1Q1AA 4E46A 1HT2E 5LL6P 1UQTA 3KYIB 4IMJB 4Q9KA 3CEPB 4ERXA 1C2YA 2CLFB 3ZZNA 3U1BA 3TRHA 4LYYA 3MSXA 3VJMA 3SGLA 1ZSNA 1W2GA 2XBMA 4RV9A 2CLOB 4KNWA 4YRTA 3DT6A 5JZ9A 4WRRA 3H2YA 4H77A 1LVGA 3AI1A 3SQNA 1XTKA 1YTUA 1YUBA 3IQXA 4MRNA 5HSGA 3LDHA 2QT9A 1HEUA 3C98A 4HQOA 1N3LA 3CUVA 2Q4OA 4EW1A 3AG5A 1KMQA 2P4EA 2JLXA 3JVVA 4BNIA 4KAFA 4C0SA 4G0VA 3JTMA 4MIEA 2IV7A 1PFYA 1BFDA 4N1AA 1NFFA 2FLVA 2Z6VA 9ABPA 1ZSVA 3QEOA 3ML1A 2DQZA 2NV2B 1AKUA 4ARSA 3IALA 1GCOA 1C0IA 2EL7A 3BQMB 4EHAA 1BRMA 4NSNA 1URPA 1ZOLA 1GKKA 2BEJA 2M1XA 1VDZA 3EPRA 2E4YA 4ASUD 4ND2A 3VR5D 2DH5A 2Y1DA 1SKMA 1LV8A 3TK1A 3QPVA 4D6YA 4AS2A 1Y98A 4O4HA 1W88A 1LV7A 4E33A 3HM9A 1GKLA 3DHNA 3A9WA 3QLUC 3UTDA 2YWRA 1LTKA 5IULC 5F12A 4MW1A 2AEMA 1XYVA 2R4UA 2EX0A 4MOWA 4PYIA 4RV4A 4B47A 5KNCH 3GFPA 4YUXA 2NYVA 1QDUA 5EE1A 2DPLA 4K9MA 1VRCA 3WA6A 3RVOA 5BUCA 4GFDA 1TYAE 5FNVB 3R8CA 2J9RA 4OA5A 2QAGA 1U2DC 2JI6A 4X1IA 2N0SA 3PL1A 2G17A 3AINA 4XLTA 4ZEWA 1PD0A 2VNHA 4KR9A 4DJ5X 2PZEA 1A8UA 4QAQA 4RPKA 3TZBA 3KT3A 1LSOA 5EUQB 2MSKA 4F12A 2PHZA 4RORA 2EW2A 3L9XA 3VSAA 4D92A 4FGWA 2NQTA 3R7FA 3C3KA 1N6LA 1XNQB 4K6CA 4ARUA 3ZHVA 1GNPA 5L53A 5JFOA 4R40A 4ZEXA 3K2IA 4MSUA 3HU1A 1KEEB 5A9SB 2WZDA 1YQDA 4DSNA 1RWPA 3LLMA 3ZHXA 1N75A 4KWTA 3F73A 3IP1A 4MP6A 1XPJA 2Z56A 4PBSA 3GYGA 4RENA 3U39A 9MHTA 4IJVA 3F4LA 3FAZA 3VI3B 3AKCA 4HLNA 2IC5A 4GU5A 4LJLA 3VKVA 4Y2PA 2WD8A 4US2R 1ISMA 1WWKA 3ONWA 4IZIA 3T3MB 5IKEA 1QZUA 2FFJA 5FLYA 2BI8A 3RRJA 3QNWA 3OKCA 3KEGA 1I4EB 1E1LA 2BR5A 2E1PA 2RGDA 3QTTA 3SYRA 1K89A 1SAYA 2ETXA 3BEDA 4K8RB 3BMNB 3HXLA 2PSDA 1XMXA 3SR3A 4S2EA 4KXVA 2CXUA 2PT7A 3PC7A 4WSOA 1VLMA 1PEYA 3N0RA 4PLTA 4PTLA 2BSAA 3NU1A 5J9FA 3OA0A 1U1GA 2OBYA 2Q2OA 4OV6B 4JC0A 1CBUA 4H6XA 1RQLA 4D2IA 5BSGA 1NPTO 5BRJA 3UOGA 2QJFA 3H1FA 4BMZA 1V95A 4EGAA 3RAPR 3GRAA 3KZXA 3PNOA 3NAZA 2DLCX 1AX9A 2F3SA 3W9BA 4JI7B 2A3RA 3HR4A 3U6KA 1DQNA 4YQYA 3EXAA 4HWTA 4NLLA 5K3DA 2VEDA 3EGCA 1E94E 2QTLA 2Q50A 1JDNA 4R3UC 2G6BA 3OETA 2ASEA 2OC4A 3ROXA 4BE4A 3REQA 2C9MA 3DNFA 3I76A 3GR6A 5B3JA 4YFVA 1JXMA 1USVA 1F0NA 2O7NA 3CISA 2P1RA 1XLTC 3G2NA 4MUFA 4NMMA 1E59A 4IDBA 1LRLA 5DXAA 1YZYA 4TS1A 3R7LA 4CR7A 1NX6A 4YMHA 1C9MA 4W7IA 1Z07A 4DY4A 3KQHA 3W5BA 2QRKA 4FCTA 1HX7A 1O9GA 3H13A 2R7NA 3EVBA 4EJ0A 1X3LA 1J8MF 3H2SA 3I1FA 5KPJA 4AO6A 3JRNA 3RV3A 4FFDA 4IGFA 5EI5A 1UJ4A 5ARCA 2BUCA 5JSKA 3NANA 5CNKA 3RABA 1NT2A 1WDKA 5KJFA 2GD0A 4AKGA 3C3WA 4BLVA 3L7DA 1WVGA 1Z29A 1TPZA 2BV3A 4CTKA 3UM9A 4HAZA 3KPJA 1G7RA 4XQGA 4S1OA 4BMSA 3QEAZ 4UUOA 1R12A 3CYFA 1BGWA 3QU4A 4US0R 3LX5A 3WLAA 3NIWA 2C7BA 3MELA 4MKHA 5ULLA 2X1MA 5JD6A 4FB5A 2PQ2A 3SDSA 4CQJA 3TXAA 4CV3A 1A8IA 2F8SA 1KA9H 1E0DA 3LOQA 3ZCTA 4IV5A 2XQJA 3B8EA 3L06A 5LZ5A 3WGNA 3UUEA 5EG5A 4CE6A 1DB3A 4FHZA 4GDMA 3P7MA 2WV9A 4CM9D 1DMSA 2X9NA 4E1VA 1AS0A 1U0BB 2NUBA 4XYMA 4OK3A 1D04A 5AVOA 1Z26A 1O8BA 1Z88A 3KO8A 2AEFA 4N48A 1O4VA 1P4JA 5EAIA 3HHEA 2G4CA 5KTKA 3IXMA 5FI1B 2I0FA 2G0TA 1EH5A 4Y3UA 1TO1E 3AO0B 5KTMA 3HL0A 1KAGA 2JIBA 3CX4A 2WKRA 3LH5A 4ZGWA 4GBED 4HWSA 5AI6A 1V11B 2PGJA 4DB2A 4ZQHA 1XRRA 4HS9A 4P7KA 2GBCA 4QO7A 421PA 4BNZA 3D0KA 5DWQA 4UM9D 2ZJ6A 3I9MA 4QIHA 1UC9A 3S1AB 2X3YA 5TQ2A 3QWBA 3FDFA 1EUDB 1RHUA 1U2PA 2P5YA 3HQ4O 2O8EA 3D3JA 1KDYA 4MXDA 1JKJB 2WTBA 3FCYA 1VE9A 1A1VA 3WGZA 4Y9UA 3ABOB 3EZYA 3H05A 2O57A 2Y1CA 5DHPA 5AQ1A 5IDXA 1EDDA 3MWFA 4D3FA 4II7A 4AZVA 3SLGA 2Z3WA