1MH1A

Small g-protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
183
Chain Sequence
GSPQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVSLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC1
publication title The crystal structure of human rac1, a member of the rho-family complexed with a GTP analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding
total genus 60
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 1997-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mh1A00
2CCGA 2G88A 2ZRFA 5HE9A 3SI7A 3WP0A 3VR3A 3SC3A 1GKIA 1NMXA 1KJYA 1G3RA 2ZQ5A 5E3HA 1Z63A 1T4GA 3NHAA 2OT3B 3CWQA 4GOKA 1XEWX 4AKGA 5KSZA 5EZ6B 4W9MC 2ZITA 1NLZA 3EZ2A 5CJ2A 5FOVA 2OZEA 2IYLD 2YC4C 5BN3A 1EWQA 4LX0A 3HWSA 2XZPA 3NTUA 3U2QA 3X1ZA 1AJEA 3B1WA 1GOTA 6Q21A 1S9HA 1EGAA 4C0JA 2V6IA 5DGXA 1S1MA 2ZAMA 1WE2A 2ZJZA 4MGYR 4W5WA 2WWGA 1VDZA 1OFUX 4F4IA 4NYIR 4Y0VA 2A78A 2QORA 1P75A 1E79A 2GDJA 2QPAA 5G41A 1X86B 2DR3A 1U81A 3GCGA 3CH4B 3RRMA 2NTYC 2MSCB 2XOKD 2IXEA 4QNMA 2G1JA 1SVSA 1YE8A 3LW7A 5F9HA 4L8GA 1Z0AA 3EASA 4M1TA 2JEOA 1E2EA 1NN1A 3I5XA 1Z2CA 1F5NA 3GJ7A 1JBKA 2UKDA 3QVVA 1G20E 4DRZA 2IS2A 1SHZA 1A2KC 1T6NA 4B3FX 4R7ZA 4O25A 2F9LA 2Q9BA 2IWRA 4IDNA 4EFNA 2VP6A 1M1YE 1E2QA 1N5JA 5GJVC 4IOLA 4ZDJA 3FOZA 1WBBA 3TBKA 4JLPA 2JJ2A 3NVAA 4V0NA 1H8HD 4R71A 5FI1B 1P9NA 4YMUA 1OXXK 1W0JA 4PZZA 1FNNA 5FTKA 4MYUA 1TF7A 4EDHA 2GJAA 4MYTA 1XZPA 1ONBA 2J7PA 1TNDA 1X8JA 1Z8FA 2K5UA 3I92A 3MAAC 2CBZA 3AP2A 4KXFB 4TL8A 2FPLA 5C2JB 1NBMD 3TLXA 1P5ZB 2A7QA 2QAJA 3U3KA 1WRBA 4RVCA 1TU4A 5KDLA 2IUSA 4LPKA 4NCJA 2C04A 1LS6A 2PEZA 5FBQB 5JS7A 2AKAB 3PIRA 1KDTA 3KB1A 1QHHA 2X2EA 4II7A 2XEXA 1N6HA 3LVQE 4OHVA 2BBWA 4C4PA 1KJZA 3K0CA 1Q57A 4UKDA 2OG2A 421PA 4IVRA 3BB1A 1KMHA 2QP3A 3FFBA 3RC3A 1UJ2A 1K6MA 4GI7A 2ODEA 4P3YA 2D7DA 1HURA 3RS3A 3I61A 4QJ4A 5AUOB 2DPXA 1SVOA 4G5QA 1ZC4A 1TAGA 4MKHA 5FH9A 1KI1A 1I2MA 2ZS8A 4EAQA 3Q9LA 4GFDA 2KBFA 4BASA 1G7RA 2J45A 5FPHA 3TUJC 4XSHA 3KQKA 3EPJA 2YOHA 1J8YF 1XNJA 4TLAA 3TVDA 1VG9B 1P3JA 3L0SA 4GZLA 5EQTA 1QVAA 1OB5A 4FMDB 4E03A 3PQCA 1W5TA 1DTSA 4X8LA 3SHWA 3SJAA 2JATA 4PO9A 1VYVA 4FMCF 1R8QA 3WYAA 1OFHA 1N2CE 4QRHA 121PA 721PA 1UKVY 3O8BA 1M7BA 3UG7A 3U4QA 1YZQA 4HLDA 5EE1A 5CK4A 2GCNA 2ZJYA 3OIVA 3WP1B 1II9A 2O8CA 5AUQA 2G77B 3A4NA 4QNRA 3FB4A 2R6CA 2O8BB 1N5LA 2VP4A 1G6HA 3B9PA 4DBLC 1US8A 1RRPA 5L3SA 3QBVA 1W7AA 1GFIA 4R2IA 4UXIA 3DKVA 5JEDA 3AVXA 3GLFB 4URXR 2W0MA 1RJ9A 3LVRE 2ZTSA 3N5CA 3PUXA 5F9FA 2F1RA 4IDPA 3ZZTA 2IS1A 2NZ8A 3GEEA 3WBKA 2O5VA 1E3MA 3TKLA 2V8OA 1ZINA 1G18A 1NVWQ 5BQ5A 1JQJC 3PEUA 3G0HA 621PA 4G0NA 5FFMA 4EPWA 4A0RA 2R6AA 2ZRAA 3KL4A 5JI2E 2GTPA 3C14C 3JVVA 3AUYA 3WNBA 1VCOA 3VTKA 2AN9A 2YOFA 2XNSA 5AJXA 2VTKA 4TYNA 1KJWA 3DKPA 3SDZA 4OHXA 4B3GA 1VG0B 4KSCA 5DYIA 4V0LA 4GOJA 3LWNA 3ZZUA 5JWHA 1FPMA 4L16A 4MRNA 2ANBA 3I73A 4KCGA 2PX3A 1KNXA 3FGNA 4PXAA 2TMKA 4TQ9A 4JJZA 5GJWC 2FEOA 1DAFA 5AJWA 2NO9A 2XSZD 1FUUA 1N5KA 3AKDA 4IEEA 4RFVA 1GVNB 2CK3A 5BYKA 5P21A 4NPHA 2ODWA 2C98A 3NDPA 2C78A 2ZVPX 1II0A 4NYJQ 1KTVA 2X77A 1A5TA 2R44A 1MH1A 2ZRIA 3B78A 1ANKA 1NLFA 3B7GA 2ZRJA 2IYVA 3E70C 3NBZC 2Q3MA 2GZDA 2C9OA 3B9QA 3K70C 4BE7B 4IHQA 3SEAA 2WM9B 1XDBA 2CEAA 4BFVA 1SXJE 2FMXA 2GEVA 2X1VA 3F5FA 1DO0A 2PCJA 1AZTA 2E9SA 2G9NA 3DZDA 4M1WA 4D0GA 4G5OA 2O0HA 1TL7C 1E2FA 1W36B 4TMXA 3IUYA 2ZXUA 2AWOA 2IHYA 4EFMA 1OH8A 1G41A 3AGQA 4Y0AA 1ZJ6A 4GMXA 2NG1A 4JLDA 1MO5A 2YNMA 2BKUA 1FQJA 2XAUA 4PO8A 1TX4B 1XJQA 3UKDA 2V3CC 3H4MA 3FKQA 2H5EA 1A7JA 3WMGA 1KI6B 4PQRA 4FN5A 1EWRA 2C2HA 3VQTA 4HDCA 1VYUA 5L3VA 4AKHA 3K0CC 4AD8A 1Q1BA 4RZUA 5GJBA 2BV3A 2PL3A 1XTKA 3BWDD 3EWSA 3LX8A 3A8TA 3RANA 4GPTA 4XSGA 3GJ3A 3U4QB 3BB3A 3EC1A 3RVBA 4F38A 4YXWD 3IHLA 2R65A 4JSYA 2QG6A 1UDWA 4D4MA 3NXSA 2O8CB 4OHZA 1JR3E 3P27A 1IY2A 1XCPA 1TF2A 1TADA 2ZRMA 4LHXA 3KQUA 4UJ5A 2EFCB 3IPXA 4MGZR 2CNWD 1SVMA 2BCGY 2FJUA 4Q9JA 4BEJA 3KUCA 5CK5A 1UDXA 2D74A 1XTRA 1IJFA 4JBYA 2WJYA 1JECA 1RJ9B 2RGDA 4HLCA 1RFLA 4I1OA 2HCJB 4F4JA 5JWRA 2RHMA 4RCYA 3T06B 2DY1A 5CITA 3MD0A 1ZD8A 4OK5A 4P0TA 2V7QD 3FDIA 4XOIA 4XWOA 5B64A 2ERYA 4NYMR 2XITA 4LUCA 5BWMA 3IEVA 1GAJA 2BJVA 4B6FA 4QGAA 3SN6A 1BH2A 2ZRHA 1O3YA 2VHQA 4Z1MD 5K8IA 2CL7X 1Z07A 3GP8A 4QM7A 3SBDA 5B58C 4LWZA 1G5PA 4LV5B 1P6XA 3ZIAA 1NKSA 4P4SA 1CJKC 2ZJ2A 3LQRA 3K9HA 4UNRA 1F60A 5DN6D 2I4IA 3T1QA 5JRJA 1FL9A 1LFDB 5FR1A 4FMBB 3W6NA 5A5GA 2PMKA 1AKYA 1S3GA 2QPOA 1Y63A 2PZFA 4MITA 2F1IA 4ZKDA 2GF9A 4CGZA 1R6BX 2RKOA 4TL6A 5IT5A 2ZRCA 2J0VA 4MQBA 1NIPA 3AVOA 3U7HB 2V1UA 1G8YA 3QG1A 4US0R 4NBSA 1I4TD 1Z08A 4BFWA 3A4LA 2WSMA 2ZI7A 3S1AA 1XMVA 4AI6A 5JCPA 2VHJA 2JLRA 3U61B 2IA5A 3KJGA 2YWFA 4LJYA 3L8ZA 2ZS9A 4XD7A 4A92A 2J0UA 3FMPB 4DHEA 4Q9IA 2OBLA 4AG5A 5G3YA 5EXPA 4P4UA 1ZM7A 1AN0A 4Q7LA 2R8RA 1RW4A 5AUNB 4NCIA 2DBYA 1Q21A 1XF9A 3RWMB 3EZ9A 1GL7A 1T8UA 4D0NA 3HR8A 1G7TA 2FPKA 4MH0R 2RGNA 4HUQB 3P20A 5C46F 3HDTA 3U3RA 1J99A 4Q4HB 2CLCX 1W47A 3L0IB 4HLUC 3Q72A 2IL1A 3AP1A 1SVKA 4Q48A 3QF7A 3VR4A 1KI8A 4PHTA 1DAIA 1KI9A 3ZZ0A 4KFUA 4AYTA 1OF1A 5CYOA 3T5GA 2OCAA 3IGFA 3QKSA 1E0AA 1XFAA 5D3QA 4HAWA 3N2IA 1XEXB 2QQ0A 2QBYA 4PPFA 1OXUA 3VKWA 4YDSA 4LBVA 2ZJBA 1KYIA 2XGJA 1CU1A 1TU3A 4FD2A 4M1OA 2FX3A 4PC1A 1D2EA 3KJIA 1NVXQ 2J9RA 4UXJA 1GRNA 4XTRA 3ZD6A 1GTVA 3PR1A 5GVRA 5J4YA 1BKDR 3CO5A 5SZIA 4IOJA 4DDUA 5DI3A 4ACAA 1CXZA 4PHHA 5G40A 3AVVA 4YONB 4M2LA 1KO4A 1E9DA 2OV2A 3M4YA 1XPRA 4GP6A 4ERNA 2IBMA 4ZCIA 1XMSA 4LSGA 5FOWA 1E79D 1Z29A 2WOOA 2HXSA 3OEEA 4MUAA 1G5RA 4LK2A 5ELXA 4Q5IA 5E7IA 4QBIA 3THYA 1SQ5A 1T3HA 1ELOA 4URVR 1VYTA 4IFEA 3ND9A 4PC3A 4PC2A 2VQSA 5HE8A 1II8A 2GZHA 2HCBA 2BKEA 4BLSA 1NG9A 2ZUCA 2OBNA 1J2JA 5EZ5A 4JZKA 1E2JA 1U0JA 5CIQA 5G53C 4B34A 2J59A 3AVTA 4Q4AA 1QHIA 3D3QA 3ZVLA 3D6TB 1XTSA 2B8WA 2VO1A 3O8CA 4P4SB 4TWZA 2VP5A 4TT3D 5EE9A 3K70D 2JJ2D 4NKRA 3NC0C 3RLFA 2WKRA 5DH9A 5FTLA 1W0JD 4PAOA 2P5SA 4ON9A 2FF7A 1T3SA 1DADA 2BIFA 4G01B 1MRSA 3C5HA 1ZMXA 3VR2A 1JR3A 2N46A 1R0YA 2P5TB 2EWWA 4GP7A 3T34A 4KSBA 1G64A 2WMOB 4QM6A 1KO5A 2CMKA 4B35A 4BFZA 2IYUA 1GWNA 1XXHE 1FX0B 1IXRC 3LLUA 3BJIC 2F6RA 2Z0MA 3PCRB 5C1BA 5FL7A 4G5RA 1XRJA 2HV8A 4D80A 3SJZA 3OFNA 3CX6A 2OHFA 1YQTA 2PZEA 4DVGA 4DLRA 5D3MA 1N6RA 1IHUA 1CR1A 1DAGA 1Q1ZA 2F43A 2J0UB 4JLJA 1UADA 2REBA 2W6JA 4IDQA 3GFTA 2GILA 3KKOA 4URZR 4DJTA 2ZM5A 1HTWA 3VU9A 4HB0A 4QG7A 3MMPA 3QJYA 1FMLA 3RS0A 1EX7A 3K9LA 5G3ZA 4RSGA 5DSZA 3TRFA 2QI9C 4B6EA 3ADCA 1U8YA 1HV8A 1QDEA 3C4JA 1P61B 2QQEA 4JLVA 4CEJA 5JLJA 3ASYA 2IYXA 1ZIOA 3Q3JB 1TQDA 3I1FA 1UPTA 2H92A 3EIQA 3GD7A 4KFTA 3SNHA 5DHFA 1G9XA 3KXIA 3QPUA 2FNAA 3DL0A 5A0FA 3TVTA 3CX8A 4FW9A 4C3ZA 2SHKA 1QHNA 3VMFA 4C0LA 1OE0A 2AXNA 3K8YA 4QJ3A 4BPBA 3KJEA 4GDFA 1JR6A 4J0QA 4IEIA 2ZI5A 1AK2A 4C0QC 1MT0A 4OJQA 4QOSA 3IQXA 3ZS9A 1DAHA 1YZNA 3ADKA 4C2TA 2WWFA 1YR7A 5KU1A 1R8SA 3W6PA 1NNEA 4B44A 3I4LA 5FPSA 1VECA 4LHWA 2NGRA 2WWHA 4D6PA 4IRUB 4C0HA 2R2AA 3AF0A 1O87A 4DSUA 1OLOA 3AGPA 3QEJA 1U90A 4DUGA 3NG1A 3CR7A 1Z06A 3EC2A 3UMFA 1R5BA 2OE2A 2O8DA 2BOVA 4M9QA 3KXKA 3PEYA 5LPNA 2RHDA 1SXJB 5FBRB 2OBMA 5J4LA 2IEYA 1CS4C 1EK0A 3THYB 4WZ6A 2Q3FA 3ZGXA 5KHOC 3THOA 2BMFA 4AKEA 2J0QA 3AKEA 2XTZA 2XB4A 4XWKA 4Q1EA 4GOXA 4URUR 1E9BA 4AYWA 4HLQB 1QZXA 4UQOA 3IO3A 4RD2A 1QHYA 1CULC 4W7SA 2C9CA 3BXZA 2ZI4A 4CW7A 1YHNA 2G0TA 4DIDA 1OH6A 2GBLA 2PJZA 2HF9A 3CF2A 1E2HA 1X1SA 3FMOB 3QENA 4OYHA 1G3UA 3U3OA 3AVWA 4B32A 2JIZD 4DSTA 1Q3HA 4Q21A 1HE8B 4DKXA 2ZSBA 4JSTA 1NG1A 4A8JA 1E1RA 1XP8A 3B1XA 4A6XA 2W58A 3QEOA 1WXQA 4OI0A 1XWIA 2ZE7A 5FUWA 2QM8A 3QG5A 4PAQA 3U7EB 3DMNA 4DDTA 4JVLA 5JZVA 1FTNA 5FOTA 1HUQA 3LRPA 5KOYA 2ZVQX 1AS3A 4W5HA 1HE1C 4MGKR 1AM4D 1GP2A 2FU5C 3D8BA 5GADl 1G4UR 3THXA 1QBKC 5IRCD 3R9WA 3BH6A 4PQFA 4GSYA 1WP9A 4R2HA 1GG2A 5FUVA 2QP9X 2WVJA 4U02A 2RGGA 5D3MB 4TZ6A 1XB2A 4OQXA 3NH9A 2DFTA 2F43B 4TSFA 3DEFA 2BMEA 1XPOA 3L8YA 4IJMA 5KNDA 3VU9B 5EP4A 1MRNA 3GJ6A 2ZSEA 4HZIA 3R20A 4NYJR 2BM1A 1YKSA 4TMTA 1MO6A 2JLWA 1ZM4A 1W4BA 2G3YA 2V6JA 4CEJB 3RYTC 2B21A 2W2XA 1NN3A 1ZNYA 4HAUA 4TLDA 5KTYA 2A5FA 3AVQA 4JKYA 1W4RA 2YWHA 4Q1CA 5JSZB 1HYQA 2YC2C 4A0GA 1N6NA 5FBWB 4PSAA 2QZ4A 3PXGA 4KO8A 1G5TA 4PR0A 4OK6A 5EUQB 3TQFA 2WV9A 2QRZA 3U6KA 1B23P 1VCNA 5JMTA 2O8BA 4DLZA 1OHHA 3KKPA 2IS6A 1W48A 4MA4A 3HJNA 3SHFA 1CF4A 1UFQA 3HU1A 1N6OA 1XD2A 4E09A 3WMEA 1PUJA 2DYKA 4WA7A 5FTMA 1HQYE 2EFHB 2CHGA 3X2SA 2XNDA 1GKYA 1CTQA 3GLFA 4D25A 1G291 3BC1A 2JASA 3P4YA 3QPWA 2J5XA 1G3IA 5H1YA 1KI2A 1Q3TA 4PSKA 3F8TA 2WBLC 1RVDA 1U9IA 5LD2B 4KBGA 2ODNA 4IDOA 1CJUC 4DZZA 2GA8A 2O8DB 4M9XA 2ZRNA 2IYQA 3AV0B 1HA3A 4P32A 4IFBA 3GQBA 3JVUA 4UJ3A 3SU8A 1E2IA 1FW6A 4HEJA 2OAQ1 5F98A 2QTFA 2FG5A 3NDBB 3MG9A 3QXXA 5EJEA 1KDRA 4O2LA 2PMDA 1N3BA 4OI1A 1OPXA 4AIIA 3MWLA 1YRAA 1E2MA 2DB3A 1G16A 2FN4A 4LY6A 4QJ5A 2ECKA 2OILA 1E98A 2V4ZA 2ZSDA 4XTCS 2OLKA 2F3TA 3MJRA 2C8VA 3GFPA 2JLVA 2MMGA 4XIGS 4A8JB 1KKMA 3CNOA 1R4AA 1DG1G 1IM2A 2IHBA 4WZAE 3ZS8A 3UIEA 1SKYE 1RZ3A 4TYPA 3GLHE 1ZC3A 5AR1A 4CT4B 5HR5A 1ZYUA 3LXRA 1QG2A 3HP1A 4EFLA 4K81B 2RH5A 1J8MF 2LWIA 2P3SA 3FTQA 4KLNA 5HCIA 1L4YA 4YMTA 1D2NA 4B2LA 2ZEJA 1NRJB 3PFIA 2BHRA 3C5CA 2G0NA 3THXB 1XD8A 2ODBA 3ADBA 1OKKD 4LHVA 4FXPA 2GBLC 4B33A 5FOXA 2GEUA 3OESA 2D3WA 3B5JA 3IDQA 1OB2A 4LZZA 3PEWA 4DWJA 4PX9A 1EG7A 2BEJA 4WZBE 3CX7A 4JMPA 4A8JC 2WWYA 2HUPA 2DWOA 3FHOA 4NCNA 2VF7A 5FPKA 1KSGA 5JBQA 4HDOB 521PA 4ZCMA 4AG6A 3RNLA 4DDVA 1KSFX 4LJ5A 4B3XA 3WMFA 1KI6A 1G1MA 3C15C 3A58B 2BMDA 3H86A 3IEUA 2VEDA 3FPAA 5CLQA 4I81A 2ZRKA 4O3MA 4BWYA 2IUTA 3I8SA 4B75A 2MMCA 3NC1C 4EJSA 1SGWA 1NSFA 2GESA 5CLLA 3VX4A 1DPFA 2QROA 1XTQA 1LTQA 3THWB 5SZKB 4ASUA 4F91B 8OHMA 4L9SA 2X8AA 1NJFA 4FMDF 4EIWA 4POAA 3MSXA 4OKSA 1IN8A 3TH5A 3QBTA 1Q12A 3W8NA 1NBME 1XD2B 3ZH9B 1W4CA 4JVSB 4US1R 4S35A 1Q44A 4ESHA 4BRWA 1HT2E 3ADDA 1HH4A 4Q1FA 1XXHB 3L0OA 4BZXA 3I62A 3WHKA 3CUEF 1S8FA 2FZ4A 4UNPA 1X8LA 3QKTA 4UNQA 1T0JB 3W90A 5CIWA 3MWJA 2MSDB 4CVNA 4Z51A 2QSZA 2D2EA 3OEED 3OEHA 3B60A 2N42A 1JAIA 1UAAA 2XJ9A 1DOAA 5FBVB 1W0KA 1NL3A 2E87A 5IK2A 3LV8A 2HXYA 3U7FB 1KKLA 1GUAA 4S2EA 3E5HA 3Q8XB 2A5YB 2OAP1 3TW4A 3QPVA 4DLYA 4EPTA 1OH7A 1CLUA 2OM2A 5KDOA 2QT0A 2GVDC 4GMDA 1JB1A 3TR0A 5C18A 1XPUA 2V54A 1VPLA 1TMKA 1EXMA 3T1VA 3TE6A 3H2YA 1T9HA 1DG3A 1IOZA 2DCUA 1UEJA 2FWRA 4HSEA 4JLOA 4Q1AA 2D06A 5JCZA 2VPPA 1U9IC 4LHZA 2OESA 2Q6TA 4JT4A 2G1KA 1PV4A 4H1UA 1E4YA 1PLJA 1X1RA 2MSEB 2ZR0A 1RC8A 3L2OB 1XZQA 2YINC 3TUZC 4LI0A 3K0EA 1YZLA 1F48A 3PITA 3TR5A 3KB2A 5EXXA 1U0LA 3IHWA 3KUDA 4MKFA 5CDFE 4TYYA 4TZ0A 1T3LA 4Q9HA 4GT1A 1NJGA 4Q03A 1GRRA 1Q20A 4DCVA 2G83A 1OT3A 3ZQJA 3CNLA 1HY3A 2HJVA 1AGPA 3SQWA 4C9BA 3VFDA 3NBXX 1X3SA 3IBYA 4QBHA 5TVKA 2WICA 4LBYA 3DO6A 1TQ2A 5B57C 1I4LD 5EP1A 3LBNA 1NVUQ 4HUQA 4Q4HA 3ZDQA 2FSGA 1GM5A 2JJ1A 3A6PC 2V55B 2D2FA 2FE4A 1RRCA 5F3WB 3AB3A 2GXQA 2ZRPA 1C9KA 3OIWA 2QAGA 3KKNA 1GKUB 4XVQA 3N70A 2B6HA 4LJ8A 3EA5A 3CPEA 3QXSA 4OQMA 4OK3A 4Q47A 4LPSA 1XEXA 4EJSB 2GCOB 4B43A 4UXHA 3SYLA 2HF8A 2ZIAA 1C1YA 1GNRA 1VG1A 3NEJA 4RKEA 4RD1A 4BLRA 2VHTA 1Z28A 2ZU0C 4PFSA 3TNFA 3W5JA 4KFSA 2FGKA 4UNSA 3RHFA 4TN1A 2ZROA 3GLHA 5KPJA 2NOAA 5TDHA 2ATXA 1W36C 1XMJA 1NN0A 2ZJ8A 3UMRA 4LC1A 3NEYA 3P1JA 3P32A 2WSSD 1RE0A 1OJLA 3X1XA 1E2PA 5DHAA 2VL7A 2ZPTX 2P65A 1XBTA 1KK3A 1XEFA 4ARZA 1ZM9A 3UPUA 1M2OB 1ZD1A 2ZI6A 3FVQA 4UNNA 1QRAA 1EFCA 2ZI3A 2RGCA 3LBIA 1NY5A 2CCKA 3RDPA 4DLSA 4B74A 1HEIA 1KY2A 3M0EA 4OQLA 5JHHB 1G3QA 2VIIA 5A4JA 2XOKA 3SR0A 2QUZA 1U99A 2ZAOA 3X1YA 3U7GA 1ESNA 1GSIA 1M6NA 1M7HA 3ICEA 1KOFA 1EFRD 5E7MA 1KZ7B 1OYYA 5BN5A 2Z5FA 2YZ2A 1LW7A 1UBFA 3PUZA 2AXPA 4HDQB 1WQ1R 2FZLA 5AJYA 2C95A 3RRNA 1XMIA 3CZPA 2BJWA 1NMZA 3AUXA 3GJ4A 3OIYA 1H8HA 3L0PA 1EESA 4PAMA 1ZU4A 2VSXA 2ZJOA 1IY1A 3HR7A 3MFYA 4LV8B 4QC2A 2HLDA 4QL3A 3TSOA 1QVRA 2FH5B 2CL0X 2L0XA 5FPTA 4MRRA 5AK0A 2AL7A 1SULA 1L8QA 4F7WA 4A2QA 2XTNA 2HT1A 1FX0A 5DISB 3FHTA 3KDSE 2XZOA 2ONKA 2FSHA 2H7VA 3OAAD 2E1RA 5L3QB 1LVGA 3F0TA 3WXMA 4ACBA 1SVIA 4PZYA 2H17A 4BFYA 2R62A 2YKGA 3P4XA 1NIJA 4QBFA 4QHTA 3U3MA 2Z43A 4URYR 1IXZA 1SZPA 1KK1A 3DOEA 1COWD 2J3EA 3VHLB 3TAUA 1CJVC 2ANCA 2XJ4A 1V43A 2F3RA 2KJQA 4IOKA 3UATA 4PANA 3U5ZB 4IVQA 1IN5A 1TPZA 2YVUA 4RFSA 2QY9A 4CEHA 2DHRA 2DWQA 3WNDA 3ICQB 3CIOA 3VHXA 2QE7D 2QAGB 3WYGA 1W4AA 2WJGA 2VLIA 2ZR9A 2WIBA 4WBSA 2C9YA 1WMSA 3B1VA 1Z0IA 1XTJA 3VNVA 1AGRA 821PA 4XJXA 1IQPA 2DFKB 3ZVRA 4JS0A 4KJZA 4DB2A 5TMPA 1SHKA 1R0WA 2OFWA 3UANA 3KQNA 3BH7A 4CZ2A 1SVLA 2QA5A 3O8RA 1SKYB 2GNOA 4DSOA 2GF0A 3CRW1 4OQNA 2W6IA 3GLHB 4TMWA 2D4HA 2EFGA 3DZ8A 3ZLJA 2EFEB 1I2DA 1OHHD 4IW3B 4RZXA 1E96A 2VP9A 2YYZA 2YWGA 5TY0A 3GLGE 3AEZA 3QI2A 1OXVA 5CM9C 1G8FA 1E9EA 4DC9A 5CDFA 2O0KA 1D5CA 1DBSA 1LV7A 2XNDD 1U2RA 4U00A 4O2RA 4ARZB 3UWOA 1EFTA 3OE7A 4AK9A 1SXJA 1E2KA 3K09A 3AF2A 4ZIRB 4QGHA 3DMDA 3R8FA 3ONWA 1N0WA 1FOEB 1PLKA 3I32A 4Q7KA 5KSYA 5IDVA 1CR4A 3U44A 1JJ7A 2GETA 1U94A 2FFHA 1ZAKA 1VCIA 5F2EA 4EPXA 4EPVA 4QKQA 1NI3A 2CLDX 3R9XA 1DELA 1UBCA 2FV8A 3CNNA 3RS4A 2QSYA 4Z8YA 2A30A 5CJPA 1KAGA 5J4KA 2KB0A 1G19A 2PLRA 5LB2A 1L7VC 3LQQA 2Z83A 4WVFA 4B71A 4CIDA 2F1HA 3SFZA 2JCSA 2RMKA 4NP6A 3I5YA 2ZU6A 2FFQA 4C7OA 4G3XA 3VKHA 4AURA 1FFHA 3VKGA 3AVPA 1DS6A 2J7PD 3SOPA 3W3ZB 2VSOA 2H8KA 1W1WA 1L4UA 2GK7A 1EFUA 3V4RA 2WHXA 2QGZA 4R9UC 4D0LB 2BM0A 2HJGA 4QBGB 4NONA 1E99A 1A1VA 3B85A 4HB3A 2IF2A 4M1KA 2GEDA 1WB9A 1NLYA 4FWIB 3FE2A 1JAHA 2EYUA 5BXQC 2XB2A 1AKEA 1TEVA 3IIMA 2JDIA 4EPRA 2Q3HA 5JEEA 3W6OA 3MGCA 4YMVA 4X8HA 1T91A 3TSZA 2WMNB 2D62A 1W44A 5HCNA 3GLIE 3SZRA 1J90A 1N25A 4AWXA 2GHIA 2FFBA 2WJIA 4JKIA 1W36D 4HZUA 2J87A 4RFSB 2OFOA 1N0VC 4LYHA 3ASZA 4A6PA 2GXSA 1JXOA 4CEHB 1YZGA 4M4SA 4BQSA 5JSZA 2WJHA 2BWJA 3R9IA 4WOPA 3QE0A 3CRVA 3MUFA 1VTKA 4P33A 1J70A 1KDPA 3V4FA 1GIAA 4JLMA 4ZO4A 2QMUA 3EPKA 3A37A 2WPDA 4LJ9A 4PTLA 1CR2A 2GCPA 3BOSA 4B73A 4BZPA 4JLAA 4K8OA 1EFHA 3AF3A 1QHSA 3HYRA 4ASUD 4NTZA 2BC9A 1XTIA 3DDCA 1RPZA 2VHCA 4N1AA 1PZNA 2ZE6A 1D9XA 1PJRA 1Z2AA 5AJVB 3CW2A 3LO5A 2QMOA 3MWYW 4RZ3A 4RY2A 5FI0B 3TSWA 3UMSA 1P2TA 2RGNC 4TMVA 2BEKA 1LF0A 2QN6A 2CNWA 3AF1A 1KNQA 2ZE8A 4DB4A 3NBYC 2F1JA 2YWEA 3QY0A 3B8HA 1E32A 3ZYCA 1OIXA 3PEVA 2CVHA 1Z6AA 1ZUIA 2WIAA 3I8XA 4FCWA 1UEIA 2PX0A 3IKJA 4DLXA 4KI0A 1SKQA 4M9SA 4LGMA 3QSYA 2Z4SA 3EX7C 3C16C 2ZREA 2PCLA 2ZRBA 4TLEA 5FTJA 2Q9CA 3A1TA 3U44B 1Z83A 2N1BA 2NZJA 2OO7A 2RGEA 1ZNXA 2KE5A 4OL0A 3P26A 1VIAA 2IXGA 3BD9A 2V7QA 1AS0A 2OUKA 5B2ZA 4HUTA 4TL7A 1BIFA 1W0KD 4D4LA 1ESMA 3ETLA 3CF6R 2ONJA 4Z1MA 4ZKEA 1D6JA 3W8RA 4LJ6A 4MYCA 4I4LA 3AF4A 4LJAA 4C7OB 1GNQA 3TMKA 1P73A 3LLMA 1G6OA 4CRWB 4A36A 1SXJC 1ZCAA 2OXCA 2I1QA 4Q1BA 5DN6A 1NN5A 3K09C 2HT6A 2OEPA 2AWNA 2CK3D 1KI4A 4M21A 3I72A 2A3RA 4ZDWA 4NZYA 1MV5A 4EQ6B 3GJ0A 2KI5A 3MCAA 4DLUA 4RD4A 2REOA 1FNMA 1KAOA 2YOGA 2CE7A 5C4GB 1QHGA 5JJIA 1A4RA 3BAFA 2WAYA 5EE0A 1JI0A 3Q85A 2PT5A 4NCKA 1DO2A 3T1TA 1DEKA 2DWPA 5DLQC 5EXSA 4I1UA 1GL6A 2IC5A 4JVMA 3LD9A 3KXLA 2ZE5A 1KDOA 1MKYA 2PZGA 1UF9A 1OFTA 1R7RA 2V9PA 3BORA 2GAOA 3L43A 2J46A 1SVWA 4IVPA 1YVDA 4HZUB 4JYBA 4B76A 2CVFA 5CM8B 2EYQA 2AD5A 4B3BA 5JI3E 4LV6A 2GXAA 3JZMA 3C41J 1NF3A 2JJ1D 2FFAA 4PC6A 1MABA 1ZUNB 2C77A 1OYWA 3KZ1E 3THWA 1JJVA 2QTVB 2BMJA 2LKDA 3IILA 3M6AA 3SYNA 5HZKA 4C2UA 2O8FB 2JA1A 1YR6A 1U8AA 4ZCLA 4ESVA 5TV2A 2FDCA 1GILA 4RD0A 1IN6A 5FBLB 2ZYUX 2FA9A 4MKIA 3SQXA 1ZM2A 2OXRA 4Q1DA 5HPYB 1CBUA 5L3RA 1P9WA 5AUPB 1KHTA 2DFNA 2IXFA 3CWZA 2QTHA 3SBEA 5JJKA 5JJLA 1E9RA 2QP4A 1PUIA 3EZFA 5J5CA 4G1UC 4NE2A 1XXHA 3LXXA 2ORVA 3B1ZA 5KSPA 4BZQA 4ZI2A 2O8EA 4NHOA 4RZ2A 4PC7A 2A9KA 1IY0A 1AIPA 1UKZA 1IAQA 1X8KA 3NIBA 2Q0HA 4JT2A 1RYHA 1TQ4A 4KODA 2PBRA 4L5BA 4MUBA 1P4SA 1JQLB 3QKRB 3VR6A 3A4MA 2AHOA 5KSOA 5EE5B 3BRWD 5JRZA 3GMTA 5HTKA 4M53A 2G6BA 3GLIA 3FWYA 1Z47A 1S4QA 4LHYA 2C99A 4BECA 2BBOA 4HAXA 1YR9A 2PJRA 4B47A 3TQCA 4E22A 1Z3IX 1TF5A 2IYTA 4KFRA 1TUEA 2NQ2C 1AS2A 1XJ0A 2WJJA 4W5JA 3VR5A 1P7CA 2Z4RA 2KBEA 1VKJA 2VYFA 2YHSA 1RRGA 4PPQA 1F2UB 1FTSA 1NY6A 3CLVA 1E0KA 2ZJAA 1FP6A 4OI4A 4DT1B 3IBGA 3ZIAD 1I4DD 3B6EA 5LD2C 3CRQA 1A2BA 4HAZA 5EE3A 4A2PA 4AYXA 4DDWA 5HZHA 1W2GA 4TT3A 1Z6TA 2W2TA 2AD1A 3V00A 1RKBA 4D82A 2JJ8A 1ZUHA 2ORIA 3O47A 4N0EA 2VHUA 1CEEA 1W5SA 2HLDD 4QXAA 1E1QA 2ZUBA 1JEDA 4FIDA 2CJWB 2P67A 2X19A 3M1IA 4A2WA 1JPNA 2GZAA 3GLGB 2GAAA 1IBRA 4DCUA 2P2LA 3EIEA 4LJ4A 2LCFA 1P9RA 2QM7A 4YMWA 1NP6A 1U8ZA 2EVWX 2GKSA 3W9YA 3NKVA 1AQYA 4GNKA 3RS7A 3H0KA 3R8CA 3K0AA 5CYPA 2FGJA 4XD7D 1K5GA 3EZ7A 4AY2A 3SJCA 5J4HA 2CL6X 1IONA 1JXMA 2ZR7A 2ZRDA 1UBEA 4Q9KA 4KYIB 2AK3A 2B7CA 4MKGA 3PUVA 4LOAA 1G4AE 5DI9A 4N0DA 4OI2A 4D4KA 1Q22A 5BN4A 3ECCA 4IKEA 3RC8A 2W0SA 2ATVA 3ZVMA 4CDGA 2Q21A 2R9VA 3WYFA 3LFUA 4FMCB 1W46A 2GCOA 2AX4A 3B1YA 3BB4A 4Q00A 1NSTA 4JLNA 5HKKA 3FKSA 4RJLA 1MABB 3WBJA 2OFXA 4WAUA 4LYJA 4DEXA 3RSLA 4IXNA 1N6PA 3RAPR 2UZ3A 4QGGA 3T5DA 3DPUA 1BMFA 2WAXA 4BFUA 1NVVQ 2VRWA 3GJ8A 1LF5A 4YLGA 3CF0A 4PZLA 3H1TA 1JEEA 2AFIE 5J40A 3QKUA 2QPTA 5FUYA 4KLZA 1YU9A 2W6ID 3CR8A 4MDFA 5E4FA 2O8EB 1S1CA 4MRSA 3CBQA 2JLYA 3QQ5A 4NMMA 4JVNA 4DLWA 1KO8A 3OZXA 4MGIR 1KSHA 3Q7PA 3B2EA 3NH6A 4Q9LA 1DAKA 2GK6A 3RSOA 3AH8A 2GRJA 1CJMA 3NWJA 4TLCA 2Y8EA 1ZNZA 3SYKA 2XZLA 4M0LA 1GDDA 2NO1A 3OE7D 1SXJD 4BLTA 4A1FA 1FMJA 3GLIB 5FPYA 2AFHE 1ZRHA 1AA9A 4DCSA 1YR8A 1WF3A 4TQUS 2RAPA 3H84A 1FUKA 3FFAA 2WZQA 4F4CA 2EW1A 2XX3A 2ZUDA 4P4TA 4XWAA 3A1VA 3AP3A 3T35A 1LB1B 2JGNA 4V0ME 4D2IA 2EWVA 2O0JA 1S2MA 1T0HB 1XX6A 2D7CA 2FSIA 2W2VA 3FMFA 4U7DA 2C03A 2J1LA 5IHPA 2WJVA 1N0UA 1E6CA 1G21E 4TLBA 4YC7A 1Z5ZA 1Q1QA 2PT7A 4FCVA 5DE3A 1BS1A 4KBFA 4BLPA 2VBCA 3BERA 4B48A 4OHYA 1N5IA 4MYHA 5H8WA 3A36A 1GITA 2JIZA 4KHZA 2NMVA 4Q18A 3WRXC 3K70B 5FUXA 2CHQA 1ZW6A 3HU3A 4ITRC 4TYWA 3HPRA 4BLQA 1P72A 2RCNA 2FOLA 4TYQA 1XJCA 4BEBA 1P60A 1QG4A 1JR3D 1YRBA 2CXXA 5LB4A 3K0SA 1NKTA 2QT1A 5L3QA 3X1DA 1Z0FA 1MO3A 4D26A 4LBWA 1G7CA 2UVQA 2A2ZA 1Z6XA 2VH5R 4QFMA 1VMAA 2Q9AA 3BH0A 1WCV1 4TTQA 1IN4A 3BE4A 2ZI9A 1XCGB 5H68A 3A1WA 4AKIA 1GL9B 4NCHA 4HLUA 1H8EA 1W49A 2YJTD 5FL7D 3RWOA 5KNBA 3OFND 1X6VA 3IIJA 4G5GA 3LX5A 4QGFA 3K0AB 4JYCA 3LH5A 4A9AA 1QHHB 4F92B 3Q5EA 2JDID 5EUMA 2W6JD 5GVSA 2Z6VA 5JHGB 4L4UA 2P6NA 4D81A 2KWIA 3T15A 1KMHB 1ZU5A 1WBDA 5DYGA 3CH5A 5FL3A 2RGXA 1ETUA 3KTAA 4MRPA 1GZSA 2C96A 5FTNA 5JECA 1E9FA 3QVUA 1S3SA 2JLQA 1Z0DA 4P31A 4ZDKA 1A82A 1CJTC 1T8TA 2HYDA 1LS1A 4A4DA 1TUIA 1DVRA 2FSFA 5TB5A 2ZYTX 3PV0A 1BOFA 1N6LA 2R6FA 4C0KA 2NO6A 3E2IA 2QL6A 3T61A 2VF8A 1XCMA 2ZANA 1Y3AA 3G5UA 4TTRA 4L9WA 3HPQA 4NYIQ 3R7WA 1OIWA 1MO4A 4LYFA 2WPDD 4RCZA 1VIYA 3WRYC 2IUUA 1TQ6A 2BBSA 1E0JA 2ERXA 2NPIA 1KK0A 4Q4JA 5DIFA 3DOFA 2QMEA 3C7KA 3K53A 2ZSAA 4PHGA 3OHMA 4V03A 1KK2A 2GJKA 1BYUA 3EPLA 2P6UA 3WHLA 4BRUA 3Q7QA 2BCJQ 4LC0A 4C0SA 4DXAA 1LNZA 4ZIRA 2R6GA 4EJSC 2IF0A 1YZUA 2RB4A 3JZAA 3U3JA 4CT5A 3KKQA 4DUGD 1R0ZA 1US8B 1E69A 1VCMA 4TTPA 3RRYA 4DLVA 2P0EA 3FHCB 4DSNA 1CRQA 4DEYA 5L3SB 3KQHA 4DIEA 3K9GA 3BGWA 4LYAA 5C4MA 2R6DA 4CEIA 4NDZA 2DFLA 1R2QA 1OSNA 1M7GA 3ND8A 3QIAA 3REFA 1RIFA 1KI3A 1Z6YA 3K0FA 4TL9A 4A0FA 3QF4A 5FOSA 3CB4A 4WW0A 1L2TA 1T5LA 4FWTA 2WKQA 2ORWA 3TAHA 4M22A 1F6BA 3KQLA 1WA5A 4KVGA 4PPGA 3U60B 5LDDC 2IT1A 5TXGA 5DO9A 4H1VA 4I99A 2BBTA 2IW3A 3PVSA 1E1RD 4HATA 2QNRA 4M1YA 2QMHA 4TQAA 4Z54A 2I1VB 3CONA 3SE0A 2WKPA 3QNUA 1PLLA 2IYSA 1NBMA 2CHVA 2PH1A 3OF5A 4D4JA 1JNYA 1P2SA 1P2UA 2GJSA 2UZIR 1WDTA 2IX3A 2J0SA 4GRAA 4X8OA 1M8PA 4FI3C 1D9ZA 4A82A 4CF7A 3GEHA 2QU8A 4I1SA 3VNUA 2NIPA 2GVZC 3GEIA 4Q02A 2I3BA 4M9ZA 3T12A 2QGNA 1U0HC 2X2FA 1R10A 2J7KA 3RS2A 2QRNA 1OKKA 3LDAA 3Q5DA 3REGA 2OCPA 1HQCA 3SS8A 4KU4A 3NHBA 4TSFD 1M74A 4Q01A 3GJXC 3PUYA 2IWHA 1ZP6A 1XD9A 1YZKA 4ZPXA 3AKCA 4DCNA 1MR3F 2AK2A 3EA0A 4PO1A 1F2TA 4O0MA 1NMYA 221PA 3KTAB 4E5UA 3W34A 2F55A 3MRSA 4V0MA 3K1JA 2H1LA 4M8NE 3EPHA 5K8LA 1CIPA 2PEYA 2A5JA 3NBFA 3QXJA 5AJZA 5KO2A 5UKDA 4BFXA 1ZVQA 2B92A 3EG5A 5LBIA 4LCBA 3DVLA 3W5IA 5KDDA 2REXB 2XTMA 2VA8A 3KKMA 2ZSFA 4B3CA 1IXSB 4LDJA 1DARA 2EU8A 1N6KA 3R7WB 1CR0A 3U6BA 2H16A 2WWIA 2WTUA 5GJCA 3VX3A 3KFVA 3BFXA 3IQWA 4XVRA 4Q4JB 3C8UA 1AQUA 1ZM3A 1UKYA 1R0XA 5KYKA 4HAYA 2GJ9A 4B2PA 2CLSA 2ZRLA 4JL5A 2VSFA 2W83A 2QAGC 3EWAA 3TW8B 4OQFA 4NH0A 3LW8A 1HT1E 2ZJ5A 2FEMA 5BYJA 1ZD9A 1G7SA 3UXMA 2B7BA 4Q7JB 3DHWC 4WXRA 5AWFC 2J41A 4HB4A 4KAXA 1ZIPA 2HDNB 1MOZA 1K5DA 1IJEA 3D31A 2PLFA 4CEIB 2OCYC 2BVNA 2IYWA 4JL8A 4DCTA 4MDEA 5EP2A 4Z8XA 3ZVNA 3K0FB 2JLSA 4EUNA 3QF4B 1CKEA 3GFOA 3EIHA 2IS4A 4ZV4A 2XXAA 1E9SA 3BFKA 3MLEA 2ZRGA 2A5GA 3WY9A 2EQBA 1JPJA 3N2EA 1S0UA 2VP2A 2ZETA 1E4VA 2GXUA 4V0OA 3I3SR 4WXPA 1P62B 3A1SA 3CRRA 3BS4A 4LBZA 4V0KA 1JALA 3CZQA 1EX6A 2C5LA 2XSZA 3DM5A 4IDHA 3RS5A 3V9PA 4ZI3A 1F3OA 2W00A 3HYTA 1RYFA 3B13B 2JLXA 1GNPA 4HAVA 4M1SA 4KVAA 4V02A 3E1SA 2NPFA 4WIAA 1D8TA 4EQ6A 5K8UA 1DAMA 4NU0A 3SJBA 2RGBA 1E1QD 4LRWA 1AZSC 1YZTA 2F9MA 3RABA 2H57A 4KV9A 4Q4LA 1R5OA 1C4OA 3TK1A 2AR7A 2QEQA 4H9GA 1DE0A 4EPYA 4RD6A 1ZNWA 3UG6A 1Q0UA 4PSVA 2IK8A 4N3NA 1Z6GA 3GLFE 1G8PA 3PENA 4BFSA 4U5XA 4C30A 1KMQA 1G8GA 3S1AB 3QOFA 3CPJB 2F7SA 1ZBDA 3WNCA 5H70A 5BW8A 5KPDA 3TGPA 1F2TB 2IYZA 4OHWA 4X8MA 5FOUA 1Z0JA 4GBMA 3J81k 2IYRA 2OSBA 3AQ4A 4L15A 3CPHA 4JIMA 3QXHA 4OJKA 3ZQ6A 5E7JA 1OW3B 2O8FA 1XU4A 3AM1A 3UWKA 1P2VA 3OIUA 3T1OA 5CB6A 3VAAA 4XVUA 1FZQA 4I1VA 5HKKD 3FKSD 1D2MA 1FQKA 1E0SA 4Q66C 5K8TA 4FINA 4KYUA 4YQFA 4HYYA 4JLKA 4LJ7A 4URWR 4JJKA 4Q19A 3PUWA 4JBWA 3FMIA 1BMFD 4YXWA 4IXMA 4JLBA 1E2GA 4A0HA 3AVYA 3O8DA 1CP2A 1DAEA 4PQYA 2ZYVX 4BGDA 3QKSB 2B8TA 5EXTA 2BDTA 4XH9B 5DNYB 1QHXA 2QBYB 5IF9A 1T5IA 3LAWA 2VP0A 5L8VA 3A1UA 3RRZA 4R98A 4GL2A 3IO5A 1OXSC 5FR2A 3K9NA 4TMKA 1Q1EA 1G8HA 3QKRA 3SFVA 1U98A 3IIKA 2HYIC 4YMSA 4ILEA 4BLOA 1E94E 5EP3A 4NYMQ 1CRPA 1YJ5A 1KSJA 2WSSA 4RKFA 4IOMA 4FCTA 5KUTA 4KITB 1ZCBA 2IYYA 2JLUA 3PJRA 2CE2X 4B2IA 1UBGA 2NO7A 3G82C 1ODFA 3CM0A 1E2DA 5J4VA 4MRVA 5M04A 3DM9B 2NO0A 3EW9A 1B0UA 1NVVR 4DLTA 3FYHA 3AVUA 3KFXA 3CKLA 3PG5A 5B30A 5KNCA 1N6IA 2YV5A 5SZJA 5DI3B 1KO7A 1FP7A 3ZJYA 4BUJA 3IPYA 3LY5A 3OEHD 4Q7MB 4E07A 1G17A 2V1XA 3HU2A 3LA6A 2CDNA 2JAQA 4HI0E 2GWHA 1VHTA 3EAQA 1F2UA 4QHSA 5IK2D 3GJ5A 4BFTA 2RGAA 1EFRA 3BK7A 2OLJA 4DT1A 1RRFA 1GRQA 2XXAB 4B3DA 2HEIA 4A15A 2JLZA 4AC9A 3EARA 1H65A 3TJZA 1II8B 2A5DA 3BBPA 4EKDA 1TTTA 3W3AA 2FPMA 3B82A 4CYMA 1BYIA 3QXCA 4C0BA 3MJHA 4ZDIA 1E2NA 1S9DA 1E9AA 4PPNA 4HB2A 2EFDB 4QHYA 1QF9A 2WOJA 1VG8A 4JL6A 5CB8A 4Q4AB 2IEZA 3LNCA 4G5SA 2OCBA 2CJWA 3TUIC 4YDHB 1LY1A 1UKEA 3F3YA 1OFIA 1OV4A 4RD3A 1Z0KA 3X1WA 3GLGA 4K46A 2KSQA 2WWWA 3LBHA 1S96A 5J47A 5JWOA 1G3MA 3EZ6A 2CCJA 5SZHB 2AKYA 1KO1A 2H18A 2ZS7A 1Z22A 3KJHA 1TEXA 3KX2A 1OXTA 2QENA 1W2HA 4PHFA 1OH5A 3D7MA 3OAAA 4M1MA 1KZGB 1IN7A 3MWKA 1E9CA 5E95A 1BO6A 1VHLA 5ANRB 3L82B 1XEWY 3QUSA 5JFGA 1H8ED 3AKYA 4F93B 3BIFA 3VR1A 2ZYWX 3GPLA 2LKCA 1COWA 4GZMA 4JBXA 2P6RA 1UM8A 1K8RA 1KI7A 2O52A 2GJ8A 4US2R 4ABYA 3UK6A 1KIMA 1V5WA 4NL4H 1R5NA 1M34E 1J7KA 1OIVA 3ZD7A 4C0AC 1PVOA 1KGDA 4OBEA 5JS8A 2WWXA 3BFVA 5TARA 1E2LA 3EXAA 3TIFA 3CRMA 1KY3A 2QE7A 2ASEA 4TMZA
chains in the Genus database with same CATH superfamily
2TS1A 3ROMA 2G88A 2NVUA 2ZRFA 3R44A 2OCDA 3EC7A 4MK4A 2EARA 1P5JA 5HE9A 3N75A 3NTOA 3HDYA 3SI7A 3WP0A 5AW2A 2BLNA 1KMMA 2GLUA 2ZQ5A 2IIPA 1T4GA 1XA4A 3NHAA 1PZEA 1ZOIA 2OT3B 5DK6A 2YMMA 3U3DA 2AVNA 4FDUA 1XEWX 1JTFA 2PIAA 2V6GA 3R0IA 2Y6UA 2FP4A 3AY0A 1JU4A 2OCIA 1BXKA 2KYRA 4HNQA 1GG8A 1AF7A 4IHJA 4P84A 3VDQA 1TQHA 2OZEA 3OWXA 4LX0A 2X8JA 3L8GA 3EH1A 4NFLA 3VUFA 1DC8A 1WQ4A 1ZOOA 1GDHA 3EXHB 3NASA 3U2QA 2QSUA 3WLRA 3WK5A 4LXIA 1V48A 5JVDA 3B1WA 3BYZA 5FXMA 4EARA 4Y2UA 3BDVA 5KTPA 3GN2A 3U0BA 3PWZA 4BWFB 2ETVA 2R68A 1RWKA 2YCBA 2Q3BA 4W5WA 4Z86A 5IKEA 1O5IA 2AQKA 4HRAA 4QBKA 1ULZA 2ISSD 5HA5A 1PFGA 4AY3A 1X86B 2DR3A 3FUUA 4MQLA 1L7RA 4Y2PA 1U81A 3DZCA 1JU9A 3E5MA 2NUAB 1NOIA 4NZMA 1MU0A 4PGHA 4RAOA 5G0SA 2XOKD 4G0OA 3H97A 4YCCA 1SVSA 2A0KA 4M1TA 3E9ZA 1NN1A 3DO8A 3WIOA 4HUJA 4P0PB 4UBOA 5FCDA 1YJCA 1T6NA 2EKLA 4R7ZA 1PKEA 2F9LA 3KFLA 1L9XA 4MV5A 3PNSA 4IDNA 2X76A 1XQ1A 3K5PA 2CHFA 4MWDA 5IAAA 1W29A 3E35A 1NW9B 3EXHC 4ZDJA 2APJA 4KMRA 5BVHB 3H5NA 3L01A 2M98A 4H6WA 2G76A 1C1XA 1ST3A 1OXXK 3FZEA 3LE8A 2FB9A 4PZZA 3S0JA 4QDUA 3OD5A 3ZDAA 2B34A 1W4LA 3F3MA 3PVZA 5JQGF 2ZAGA 3FYUA 1IUNA 3HBMA 3LPAA 3FCEA 5E38A 5KSWB 1HI9A 1Z8FA 2J7PA 2Q62A 3MRTA 1UBTS 2QRVA 4IIJA 3ZZMA 4C4TA 3WLAA 3MAAC 2C3PA 3AP2A 8ABPA 3U1VA 1U31A 1NBMD 1WDKA 1LH0A 2QAJA 3B53X 1GPDG 1N8SA 1PFWA 1TU4A 2J3HA 4AJKA 1KGSA 2XGSA 1LS6A 4AZTA 3ZE9A 2QAIA 2PL5A 4JA0A 3PIRA 4LK3A 3M4NA 4UU8A 4F8JA 3LT0A 2L82A 3KB1A 3OWHA 3SHOA 2X2EA 3ACCA 1I2ZA 5FO0A 1IHOA 3BXPA 3U37A 1VRVA 5JY1A 3ETHA 3BB1A 3BTVA 1DI0A 2QP3A 3FFBA 4LKRA 4YVFA 1ODLA 1K6MA 1FDIA 2QRLA 3UAYA 2ODEA 5EJ9A 2Z2YA 3UGKA 4MVCA 3AM4A 5TQ0B 2D7DA 3B3AA 3KT6A 3RS3A 3GOQA 1P33A 1SVOA 5L53A 2JHFA 5NLLA 3ODGA 1YMUA 2JFXA 3QH4A 4DV7B 2KBFA 5EIXA 1HEYA 1G7RA 3JD1A 3N2LA 3Q12A 2BGWA 1E1DA 4RZHA 4RSRA 4XWWA 3TUJC 4XSHA 4MA0A 4LOIA 2XR1A 4ES6A 9ATCA 1PI3A 3LYHA 1P3JA 1VJRA 4BTVA 4ARAA 4D6YA 4AG3A 3NYWA 2NZUG 3JQPA 1QVAA 1YCHA 2O07A 4RPLA 2H1HA 4LYYA 4E03A 1DAPA 1OB5A 3C3AA 3RYHB 5EMKA 3SVZA 1YQGA 1BAPA 5COAA 1ODKA 3KE9A 1EZ4A 1NC1A 3WE7A 5K2MA 4U5QA 4ZOEA 3EF0A 4ZQHA 1EVZA 3VU3A 2B25A 4X85A 121PA 3SICE 1UKVY 1NQVA 721PA 3UG7A 2NU9A 2DHCA 4U7TB 4QOJA 1CY8A 5D3ZA 3OIVA 1RP7A 3EMBA 2NLOA 3HS3A 4LW8A 1DXHA 1II9A 1I1QB 3VV2A 2WI8A 2AH5A 3A4NA 1VBNA 2O0LA 3FB4A 3WLLA 1VPEA 4O1IA 3VPHA 5JROA 2VP4A 1IPEA 2CMGA 2WNIA 1FUEA 3WDLA 3OO1A 4BEVA 1O2DA 1W7AA 1I3KA 4GR4A 4DLBA 1TLTA 4V38A 1JMYA 1M5RA 2G82A 3DKVA 3ESYA 3D1JA 1C7FA 1NYRA 1Y1TA 2GPSA 3X2FA 1JHPA 5JNLA 3AVXA 2R11A 3I12A 2I54A 4IDPA 1AZWA 1Y80A 5DM4A 3ZZTA 5KJFA 1WXEA 3GEEA 4ENSA 3NHSA 3HA5A 2Q5LA 2X0IA 3LS2A 1CFZA 3H9QA 4W8GA 4B80A 1YFJA 4CTMA 3G0HA 5BPHA 4L02A 2PD6A 3BHMA 4EPWA 2Y99A 1JT9A 2ZYRA 1UOOA 2X7HA 3KL4A 3INRA 4ZYVA 5IT4A 4E6PA 3BF7A 5IYZB 5JI2E 1C9NA 3SXJA 4FFOA 1SD2A 1WVMA 1AKWA 1AUQA 2AXEA 1U4NA 4YR7A 1OJ7A 5KYWB 1Z73A 2AN9A 2EBWA 3NVKI 1VXRA 1YS2X 1PJZA 4KXQA 3KPWA 3IB3A 4TYNA 1AU9A 2RBEA 1VG0B 3BGOS 5DYIA 3NFRA 4GOJA 3LWNA 1W76A 3ZZUA 4L16A 1ZI8A 2ANBA 3I73A 4KCGA 4S1VA 4H27A 4OFXA 4L27A 1DL5A 4L5IA 4GDMA 2RHTA 4JJZA 3ELDA 4UU7A 3U09A 2Q6LA 2XSZD 5LA6B 4GHWA 4BE4A 4XLLA 3JQ7A 2MINB 4N47A 2WB2A 3K4HA 2NU7B 3BXGA 3L6CA 1HTBA 2HIGA 5BYKA 2D1QA 1GGKA 1RM4A 4DCOA 1R27A 2QK4A 4NPHA 1LSUA 3E8SA 4R9VA 2VXBA 1PT9A 4R5MA 4NBTA 2FRDA 1NV9A 2C78A 1XE3A 2CB9A 1KTVA 3AFHA 3ZBTA 3I9V6 3QMMA 2R44A 4HGYA 2WVAA 3WWCA 3OJFA 3HYLA 1NQ5A 3NBZC 1LV8A 1W75A 5DNWA 5ALRA 3HVIA 1GSOA 5EJMA 3QUBA 3ZLBA 5I48A 5AT1A 4KRFA 2WYUA 5AVUA 4BE7B 3COWA 4IHQA 4BGIA 2WM9B 1FFYA 5AM2A 2CEAA 2CF5A 2FMXA 1SHLA 3I01M 4DQVA 4NOKA 2PCJA 3B3QA 1AZTA 2E9SA 3QMVA 3ZHCA 4QFCA 4EKNB 1CSEE 4X1OA 1J2TA 3GA7A 2JZCA 3DZDA 2O0HA 3O21A 3FWHA 2P1DA 1W36B 3K8QA 4N40A 2AWOA 3I9OA 3IV7A 1OH8A 3AEUB 1EUCB 3AGQA 2W90A 3HA7A 1NOKA 3UUEA 2QLJA 1ZJ6A 4Y0AA 4GMXA 2NG1A 3L49A 1UOQA 4PO8A 1XCJA 1CZNA 3H4MA 3ODPA 3WMGA 2GAJA 2R66A 5BUQA 2R7LA 1X70A 3NAZA 2YZKA 3RYCB 2WIJA 4Z9BA 4E31A 3IDOA 5KWEA 2GN1A 4HH3C 5AESA 4A1OA 3UV6A 1Q1BA 4BN5A 2VWHA 3H2KA 3JZDA 3M6VA 4R9NA 4U2DA 4OM7A 1TIBA 1Y82A 2BV3A 1XTKA 3BWDD 3IVAA 1IRXA 2R1VB 3LX8A 3O90A 4GM0A 4HK4A 2JJQA 2FLWA 3CR3C 2AHRA 4J0FA 4XSGA 5IEJA 4FYMA 1S89A 3GEPA 4IMIB 1K08A 1MFZA 2W2LA 3P9KA 2O8CB 1KPGA 1JR3E 2WABA 1OZHA 1IY2A 3NT5A 3T5CA 4DM7A 4RPIA 3KQUA 2EFCB 3BL8A 3K31A 1NE2A 3IPXA 2BP7B 2NVBA 2CNWD 4L8WB 4MGZR 3RTDA 4JXZA 1VJDA 2BE9A 1JG6A 2DFPA 3GJRA 4MWBA 4YAJA 5JAQA 3KUCA 3KZOA 3UHJA 1PU2A 1F6DA 2H52A 2HWWA 2IEAA 3GG2A 3OPYA 2EERA 2WJYA 1I3NA 1I6LA 3D59A 4JBYA 3U40A 2CXNA 3ZYZA 1E3IA 4KH0A 4F11A 4JEHA 5ITZB 1V9SA 1R6XA 2HCJB 1JZTA 2AOXA 2ZWMA 3IJPA 1IPFA 5TQJA 3SC4A 4F4JA 4KLRA 2DY1A 5CITA 1NP3A 5BWNA 1FTGA 3MQ2A 4I66A 5AI5A 3QOXA 4GECA 1IZZA 3EJWA 3QV2A 1RPNA 4MEAA 1ZD8A 3PGXA 4I3HA 3UOGA 1E3TA 4FT2A 5ALYA 4BZZA 4RDIA 4OK5A 5K8CA 4P0TA 2V7QD 2IPOA 3N2KB 2P11A 2DEUA 1P19A 4UBIA 4AJJA 5B64A 2ERYA 4MCAA 4MZDA 5D00A 5J5VA 2CUZA 5KQGA 5KVCA 1CCWA 3IEVA 1JTEA 2BJVA 5K4AA 4QGAA 3SN6A 3ZPXA 4EYKA 4Z0HO 4DWOA 1N5MA 5K8IA 1O3YA 1JJBA 3OT4A 4GGPA 1Z07A 2XVXA 4ZK6A 1QCDA 1J49A 2Y1OA 4LWZA 4ZGBA 2E49A 1P6XA 4GI2A 4Z3OA 4HDNA 3QEBZ 3FBGA 2KPOA 1NKSA 1L8OA 1UBUS 3KSUA 1OROA 1QO0D 4BJ3A 4E4TA 2EZ9A 4BNVA 2I4IA 3UHAA 3D3WA 3QP9A 5AVRA 4Y2TA 1BNCA 3DYIA 3HCWA 5JRJA 3PKJA 3G8AA 3I04M 3LT2A 1Y5LA 1IWPB 2XKJE 3EXFA 5HDBB 3F73A 4XPIB 2F9FA 4MITA 5BV2P 4QOGA 4JP1A 1K4YA 5KNCH 3P9IA 3ZE6A 4V0RA 2PUAA 3EEOA 3ZLVA 3AVOA 4Y30A 3U7HB 5KINB 1G8YA 1ONSA 3M5DA 4I6EA 3QEMA 5FHRA 4R8RA 4S24A 1ZLYA 2P4EA 1ZW1A 5FNVB 5TQ2A 3VZPA 1TKRA 4L3WA 2VOEA 3B6ZA 2BFFA 1UZAA 5LYYA 1HMPA 1FW8A 2PWZA 3DS8A 4RKRA 3RTCA 4X93A 4RZIA 1QK3A 4C05A 4F2WA 2QYSA 4AI6A 1UBNA 1WCXA 3H6GA 4HYTA 4L51A 2YWFA 3D7LA 1X7DA 2MDTA 4X20A 1JKFA 3FMPB 1UPCA 3GAAA 4JUAA 5EXPA 4P4UA 1ZM7A 1AN0A 4FS3A 4QTZA 4HQ0A 4L0MA 3FTPA 2HNBA 5AI4A 2YV1A 5DBIA 3KNZA 1JFLA 1ENPA 3EZ9A 1GL7A 1T8UA 4HHEA 1UDBA 5FNZA 4D0NA 1V7QA 1XNHA 4MH0R 4XWYA 2ENWA 2BEUA 1ISGA 4B17A 3HDTA 1M1YB 1WLYA 4Q4HB 4Z0NA 2CT8A 4JGGA 2J5RA 4B8YA 2IL1A 3WADA 4D45A 4F86A 3PC8C 1KI8A 3OEWA 4ER0A 4KPGA 1T5SA 2JCYA 3S8EA 1CF9A 3MXTA 4AYTA 1OF1A 4R2LA 2FR8A 4DA6A 1N32B 1YWGO 2OCAA 2R8YA 3IGFA 5GMOA 4OLHA 5D3QA 2C1ZA 2L69A 3LOUA 4C08A 3L1IA 3N2IA 2IZ1A 5AI8A 4OVKA 4LTNA 4BQQA 1OXUA 3RASA 3A7EA 4HN2A 4YDSA 3VKWA 3MFQA 2I9KA 4D46A 4KH1A 1OU4A 1CU1A 3CSDA 4FD2A 4M1OA 1XDUA 1BFUA 1R0KA 2FMFA 2Q28A 4MVJE 4YH1A 4GM1A 5IU6A 3ZW8A 1NVXQ 1U1IA 4JZYA 1T8PA 5AW8A 4ZVVA 2C83A 3NBKA 3HWX1 1GTVA 4ER7A 3HRHA 3M70A 1K86A 4PICA 4NAVA 4EITA 3KSAC 3O94A 1CUUA 4RXMA 5SZIA 2P91A 2F8TA 3I6MA 2AA3A 4DDUA 5F5XA 4Z4EA 2V7EA 5CYFA 1SC1A 5ITWA 4PHHA 1L6RA 3ETGA 3HKBB 5ALSA 2CGEA 2Z3WA 1E9DA 4GP6A 3CMMA 3EVNA 1APBA 5ELXA 1IJKA 4UHCA 2IODA 2WB4A 1C30B 1M2KA 3C6BA 4EJFA 4Q5IA 4DJFC 3SVTA 1RIIA 1A4IA 4OKIA 3UHOA 1IHPA 2VQEB 1SQ5A 4G36A 1T3HA 3HNPA 3QLVC 4OL9A 4X3OA 4K9NA 4CDNA 2RG7A 5HE8A 2VQSA 1W96A 1RKUA 1X7XA 1D0VA 4BLSA 1NG9A 3ROQA 1J2JA 1JLHA 2POCA 5EZ5A 3VGJA 5JFTA 4YO8A 3R7AA 1KR5A 1GCAA 3AVTA 2EDCA 4FW8A 2O4UX 3G0BA 4Q4AA 4E1VA 1EGMB 2F64A 3OLVA 4YIHA 1FF9A 3HE3A 2B8WA 3PR3A 3TTUA 4TWZA 4RGVA 1S3FA 5EE9A 2H1CA 4H59A 3QPCA 4NKRA 3RLFA 5JZOA 4JJ8A 2OWDA 3TECE 2OAEA 2VJNA 4PAOA 2QB5A 1VLZA 3ZZ1A 2HB6A 4AJOA 3GL9A 5U9CA 2AOTA 2BIFA 3EXIA 4IZIA 2V7PA 2XNCA 4YP1A 5DVZA 1EBFA 4D8WA 3VR2A 4PSCA 1R0YA 3SSNA 4GP7A 1NPYA 2FRXA 4DARA 2R0QC 3KD2A 4NMHA 4KSBA 4FN4A 4RLFA 2JFBA 3N7AA 4QUEA 2OO5C 1E7SA 2WMOB 3BRQA 4H3VA 4MIKA 3VOTA 3IHTA 1M67A 3OOJA 1HFKA 2AMVA 3RIXA 4JI3B 4BYMA 3W8DA 3B3GA 1FX0B 4BQNA 4KXUA 2XWJI 3BJIC 1BJKA 3KOXA 2VNAA 4IMPA 4P86A 3N58A 3PCRB 2PRSA 4LVOA 4OQEA 4YRDA 5FL7A 4G5RA 2HRRA 4D80A 3SJZA 4MA5A 2OZPA 2PXCA 2OHFA 5L9AA 4DLRA 2BFPA 1IHUA 2AI1A 1Q1ZA 1XMQB 2J0UB 2ZB4A 2J6HA 3D6JA 4IDQA 4RL4A 3U80A 3IDSA 4NV3A 3RVPA 5LQKA 1J8FA 4GX0A 3DBHA 3JTMA 1KY4A 4QG7A 1E3WA 5DTJA 4BVEA 2DC1A 4JQSA 4QVIA 4RSGA 5F1KA 3KBOA 3GFBA 4LDRA 4RTLA 1U8YA 4JLVA 1M8JA 2QQEA 3HFSA 3L4SO 4MR7B 1Z15A 4KYVA 1I94B 1Z18A 3BIJA 1E2BA 4GSLA 4D5EA 3RBZA 5G0VA 3H19A 2GB4A 5CEEA 2BISA 1H6CA 1TQDA 1UPTA 2H92A 4RH3A 3EIQA 3GD7A 1K88A 3VTAA 4AS2A 4DPKA 3LI2A 3M83A 4X94A 3BMNB 1RP1A 5A0FA 4OAOA 4TTIA 3TVTA 4J7AA 3V1TC 5HGJA 3VDRA 1R64A 4XIJA 4IEIA 1QKKA 1TAQA 2ZI5A 5EAIA 4C0QC 2VI5A 3IP3A 3SYRA 1I01A 4F85A 5JNWA 1QXSA 3KJNA 4JLWA 3ADKA 4JXJA 4C4RA 3RVNA 4ZQGA 1YR7A 4XWOA 5KU1A 1B0PA 1FNDA 3WL6A 4B44A 2GCIA 1NNEA 4PQEA 1OGIA 3KTFA 1D2CA 1NULA 1PN3A 3GRRA 4JYMA 2R1TA 3H4IA 1Q50A 1JYSA 2NUAA 4BRZA 1Q0LA 3Q9NA 1MX3A 1QH9A 4YFVA 2ODAA 1R6DA 3ZHXA 4C43A 4B84A 2YXNA 2DQSA 3RU3A 5BV1A 5LMCA 4RWZA 3LC2O 3CR7A 3B6IA 1U2TA 3PIIA 4MZXA 1Z06A 1DXYA 3INYA 5DLDA 2OE2A 4K9MA 5GONB 1GT6A 4HPWA 3PEYA 5LPNA 2RHDA 1B74A 1NYTA 5HIJA 4BKOA 5KWSA 2PO7A 2D0IA 3D0RA 2H1SA 4TV9F 5HF6A 5TGDA 5K9ZA 1LI7A 3F6CA 1ZDMA 4MINA 1B8OA 5A0TA 4ZEWA 3T7AA 4L4YA 3VI3B 1B26A 1PEYA 3I6BA 2XB4A 4XWKA 1XKQA 4D3XA 4URUR 4AYWA 5T3YA 1QZXA 5BVHA 1Q15A 2GASA 3O2QB 4RD2A 4W7SA 4QJIA 3UT0A 4BFLA 3OMLA 5HFAA 2HGZA 3BSYA 4CW7A 4Y6SA 4OYHA 3CF2A 1AZLA 1N4DA 2WAMA 5L7WA 1G3UA 3FOEC 4X1KA 3TZQA 1I2BA 2LCQA 5J2TB 3AVWA 2JIZD 1EUDB 3ZUGA 1Q3HA 3U62A 1J23A 4B5LA 1HE8B 4DKXA 2ZSBA 1ESEA 2B99A 3I01A 3VHRA 3S44A 3GT0A 4HDKA 1E6MA 4A6XA 2W58A 3QEOA 3QKWA 2WYWA 1JIUA 4BP1A 2QM8A 3K6KA 4QECA 3U7EB 2XQGA 5JR3A 1MB2A 4JVLA 5FOTA 4AJLA 4K6MA 5EXDA 2ZIFA 3ANMA 1AS3A 1KH3A 5IXYA 1TT7A 1UJ4A 3KT3A 4GSKA 3L04A 1Z8HA 1UWVA 3NBQA 5REQA 1AN9A 3DE6X 1PQ4A 3PP8A 5AQEA 1OI4A 1EVKA 1UDRA 2QTRA 3R9WA 1TYBE 2O2CA 2C7RA 4I14A 1J06A 1JEJA 3F8SA 1YL7A 3H3XA 1R50A 1WP9A 3CUWA 4O4HA 4BKRA 3IPRA 1A71A 1XZBA 1M1ZA 2NXCA 3FPKA 2XMQA 4L0CA 3I9JA 3OPXA 4X60A 2GD0A 1A7UA 3LC1O 3ZJ5A 3TLEA 3L8YA 2QN1A 3I0NA 1YI1A 4ID3A 4WPGA 3HCEA 2W5UA 4X84A 1PWZA 2D5BA 3T7SA 1P81A 5EP4A 3W7AA 1WMFA 2H51A 2ZSEA 4HZIA 4DUYB 2AUMA 3K3PA 2FJ0A 4PINA 3WLTA 2HA6A 2NO5A 2BF4A 2V6JA 3G6KA 5B3KA 4ZALA 4RDHA 4D8VA 3FJYA 4HAUA 5ALFA 1SIBE 1Q0RA 3IIEA 2YWHA 4Q1CA 3DFUA 4NG4A 3HC7A 1I33A 1Z0UA 3B2NA 4D4GA 3LUPA 5FBWB 4J76A 1T3TA 2W2OA 3NGMA 4CDMA 4JB0A 2OK7A 2JAUA 4HQ6A 1G5TA 1D03A 4LXQA 5EUQB 4AO8A 4KYTA 1AHHA 1RLJA 2BFEB 2WV9A 4GM4A 2Y77A 3HWWA 1GQQA 2I62A 4MV3A 3V48A 2E6KA 3H5AA 3JZIA 3R7DA 2X0RA 3HJNA 3IP1A 2VQFB 1UZLA 3HU1A 1PUJA 4D9GA 2COKA 2PUWA 5A2GA 2XNDA 1GKYA 4AUEA 4J0KA 2CSXA 1BCRB 3BC1A 1IY8A 3AILA 3WRVA 3FDXA 2E1PA 3EA4A 4DTCA 2GLTA 4F84A 3BK1A 5DP1A 1KI2A 4Y1EA 4X97A 5DMHA 5IM4A 3F67A 2VXOA 1U9IA 3QU5A 1DT5A 2ODNA 1XLWA 2OUIA 5CDTA 6LDHA 3I04A 3HR4A 2GA8A 5E9QA 2O8DB 1D6NA 3CKMA 1GNSA 2ACKA 2IYQA 3AV0B 1HA3A 1SUCA 1KQOA 3QU2A 2HU5A 4IFBA 5EVCA 1XR3A 2RSLA 2Y0CA 3EQ7A 4Q3CA 5KYWA 3IOBA 1TT5A 4R6WA 5HRUA 3N86A 4HEJA 2BRUC 3ZGVA 4OYRA 3ZU5A 2QIPA 3DVQX 4U9IS 5BT9A 1XMPA 1KOJA 2FG5A 5F73A 5HVNA 3NDBB 2R96A 3PBKA 3URKA 3RSQA 2PMDA 3WKCA 2J30A 1IQRA 3H04A 1J5PA 3H0CA 4XARA 4FHEA 2DB3A 1ZN9A 1JMKC 1G16A 1YGPA 4LY6A 1HNZB 1VI6A 1LBSA 3VNRA 1FMTA 3O84A 4E21A 2OILA 3ESZA 2V4ZA 2ZSDA 4XTCS 2OLKA 1VE7A 5LLDA 5I7WA 2MINA 3QSGA 3QWFA 3GFPA 3OPVA 2W2NA 2E5LB 3O31A 1DG1G 1WY7A 3CLHA 4KIGA 4WZAE 5KC8A 4KXXA 4HAOA 2VYND 2B1IA 3FIUA 3NR2A 2A7XA 5AR1A 4W9NC 4GGOA 3L4EA 1FMFA 4CIYA 4Y2HA 3HP1A 1EJ2A 3A70A 4K81B 2NQTA 3PNKA 2G7ZA 4GS5A 3UCFA 5HQTA 1ARZA 1I4EB 2HL6A 1NRJB 3O2NA 3X0DA 4BQPA 5C7YA 2BHRA 1UBHS 1PVDA 4K9LA 2FPPA 3CZCA 4QQFA 1UT5A 5E9JA 1OKKD 3ILXA 2OGZA 1C41A 1C2YA 1IUOA 2GBLC 2H4JA 2JCVA 2VJOA 4FXPA 3UMGA 3AL2A 2D3WA 2AF3C 1N75A 3B5JA 1LRLA 3G1WA 4UDOA 3W2TA 4B46A 4BCBA 2PX2A 4C6HA 1OB2A 3O0TA 4DWJA 2VZLA 1HPLA 4JMPA 4BNWA 1P77A 2YHIA 1T2VA 2YWDA 3ETNA 2DWOA 1QIGA 5K3SA 1ZGBA 4BO0A 5A4MS 3HN2A 4HDOB 4CG3A 1ZVVA 4NK4A 1EHCA 3GGGA 3QBJA 3ZE2B 5BQXA 2O2SA 2FN9A 4LJ5A 5EESA 2RIPA 3C5VA 4N4AA 3IEUA 3C15C 2D6FA 3FPCA 2IXDA 4M38A 4BKPA 1VOTA 4Z9AA 4YUWA 2VTEA 2QU7A 1Z2PX 3V1YA 5B7PA 4O3MA 3TVYA 2MMCA 1U5AA 4W7IA 1MJHA 1SGWA 3A0UA 1FK8A 2NSDA 1O54A 3OUTA 5C5CA 2QVBA 1E3SA 2QROA 3EQ8A 3OTOB 4A03A 2MOKA 2VDNB 3EIFA 4JB8A 3JAWA 1T2DA 8OHMA 4LCEA 4B31A 2X8AA 3CT4A 3ST7A 5KJ1A 1CUXA 1YK0A 3IAM6 4M1ZA 4EIWA 1RQXA 4OKSA 5LR6A 4YLEA 2XGMA 1O97D 1RAFA 3IEKA 2BP7A 1Q12A 2QJTA 1NBME 4O4JA 1H0KA 3QY9A 3ZH9B 2RH8A 3ZIUA 3VC3A 1IOVA 3ZHBA 2AMLA 1IULA 4EA9A 5H3LA 3FCXA 3WI7A 1O94C 4ESHA 3H9CA 1NJ1A 1NBWB 1SFRA 3PUJA 1F38A 1Y6QA 3QTTA 5M3BA 1HT2E 4UAVA 3ADDA 3DT9A 1L6IA 4MV1A 3I62A 4BZXA 4IF4A 2QZ9A 2BMAA 4WUTA 2A1TR 2HDHA 4CMEA 3Q2KA 1NE7A 4U63A 4RHEA 5F64A 2FPIA 3C85A 2I6SA 4NI5A 3O9VA 3BG5A 4Q34A 4UNQA 3N05A 3S7ZA 3VR4H 3N2KA 1T0JB 4E4YA 4Z51A 5HBGA 4YFYA 4JBLA 1PIWA 2PUHA 1Q1NA 3UXHA 4LZAA 1UINA 1J9ZA 1AQ6A 1QZTA 1JAIA 1SC3A 4EB6A 1XAIA 1P2GA 1DOAA 1HXHA 3DMGA 2E87A 1NL3A 3HEBA 2WYOA 2HXYA 2RK4A 3KIPA 4JROA 1E1CB 4JXXA 3Q8XB 3RKUA 1KP9A 1G0OA 4EPTA 3BRCA 2QX9A 1T9DA 1CUGA 3TR0A 3DULA 1XPUA 1C2TA 1BX0A 2XA2A 1OR8A 3EEFA 1LTKA 4UEKA 5IYZF 4JU9A 2DKNA 3TE6A 3H2YA 4F97A 4XPIA 2FWRA 4KK4A 1J42A 1PL0A 2D06A 2JI6A 3L05A 1WD5A 2VPPA 2GYVA 3QHQA 2DPHA 2VRCA 2XT6A 2UUCB 2QLLA 5L3ZA 2JK0A 2XUKA 4JT4A 2QQFA 3WGJA 4M0EA 5CFZA 3ULKA 2YBDA 2WTNA 3D2CA 4MQ6A 3M9WA 2PYIA 3DE1X 8ADHA 5DV9A 1POXA 4PXYA 4BBZA 1MC5A 2B30A 2OCXA 3AHJA 3MTJA 4OGLA 3MWDB 3VR2D 3PA8A 1YZLA 1XZKA 5LA6F 3RROA 4BNHA 4DWVA 1U0LA 3IHWA 5A9TA 4MKFA 3S2GA 3OLWA 4F2GA 5CBPB 3AY6A 3HXQA 4XI9A 4PFJA 1Q20A 4KXNA 1EJ0A 1N1GA 3H2BA 1Y7LA 5T67A 1WW2A 1HZZC 4MW5A 1HY3A 2WK1A 4N5HX 4R1SA 4X0EA 1TRHA 4YYEA 2KM1A 3SQWA 1X3SA 2WHPB 4UNIA 5TVKA 2FETA 4OGFA 1NJ6A 1XTUA 3KZXA 1TQ2A 1H2BA 1YFKA 2V65A 1FFAA 1E6KA 1U0BB 4JLUA 4KQ1A 5EP1A 3AEYA 3LK7A 1DAOA 1FFDA 4IZ6A 3FPHA 4Q4HA 3ZDQA 5LP6B 2JAHA 1GM5A 2ID7A 3WWYA 2VF2A 1XGKA 5ICCA 1EB8A 3NALA 5F3WB 2CWWA 2GXQA 4JJ4A 2ZRPA 2CZCA 3WAJA 4F71A 1D1SA 1GKUB 4LJ8A 4RIHA 1RQ7A 3H7AA 4BBAA 4Q47A 3R0VA 1ONPA 1Z4NA 2Y6VA 5K1ZA 3KQKA 4FFLA 4MDFA 4UXHA 4GC9A 4LN1A 3UH1A 3WHPA 1M0EA 1PJAA 1WSBA 2ZIAA 1KMCA 1C1YA 4HNSA 4HR7A 4RD1A 4AWAA 4IF6A 3LK6A 4BMXA 2BTQB 3WLQA 2ZU0C 4D0SA 4PFSA 4EG6A 3DT6A 4O4IA 5CVUA 2D5AA 4N5NA 1W5AA 4Z9FA 1N0IA 2HTEA 2G1PA 1M83A 1XYVA 2FWAA 3BICA 4JJIA 3B6MA 2NV0A 3KHUA 1XMJA 3VC1A 1NN0A 2PXAA 2FCRA 2O2ZA 1WOMA 4LC1A 3DEYX 5J58A 3C1UA 3P32A 2HN9A 2QD2A 3A9TA 4WUVA 1RE0A 4C14A 1OJLA 5LP6C 5JH7A 2CXUA 1E2PA 1JKJB 2ZPTX 4IIXA 3ZWAA 5JCXA 1KK3A 3BRWA 2HWXA 3HCOA 3DW1X 3OC6A 4RORA 4QXMA 4YJFB 4RS3A 1C30A 1GR1A 1M2OB 4UNNA 1HDEA 1EFCA 2R85A 4Y1RA 2EZ4A 4J0EA 3CCCA 1FJ2A 3A2NA 5HZGA 4B74A 1HEIA 3AO0B 4HPXB 3RVLA 3OM8A 4U39A 5JHHB 2VIIA 3OZAA 5JPDA 4NDNE 1ZXXA 1LZLA 3U7GA 1ESNA 5IH7A 2DETA 3WJ7A 5K6AA 1EVEA 1KOFA 2BTOA 1LJ8A 3H11A 5E7MA 1OYYA 1JLLB 5C1DA 2Z5FA 4YJGB 1B73A 2YZ2A 1LW7A 4A0QA 5ESXA 4L95C 1NVGA 1JKXA 2AXPA 3WGUA 2GERA 2JGDB 1RE1A 1P8JA 4AJPA 3USZA 5HRAA 3HY6A 3QA9A 3QWAA 1CQIB 4QPJC 5K03A 5AVYA 1TK2A 3ZCUA 3IAAA 4C4XA 2CL5A 1UAYA 3EVAA 4GNRA 1U2QA 1ZU4A 4PAMA 5TMDA 4LV8B 1IY1A 1B2LA 1P74A 4I7EA 1QVRA 2G70A 1P0MA 4REMA 1GNLA 3KV3O 1SBIA 2CL0X 5FPTA 3ZCPA 3R4CA 2V6BA 4DY6A 4QA9A 5DLYA 2AL7A 2Y1LA 4F7WA 2C7GA 5FQNA 2G40A 4HEHA 3FRHA 4A2QA 1YS4A 3OLXA 5HIMA 2CXOA 3UW3A 3L7AA 1FLAA 3R7LA 3O3CA 1FX0A 5DISB 5I7FA 2O0MA 3FA2A 2P30A 4I46A 4TTSA 2YFHA 1V2HE 2J67A 4GZ5A 4LE2A 3V55A 9ABPA 2H7VA 3QVXA 4Y7DA 3UWMA 5BSGA 5L3QB 2XPCA 3P9CA 1LVGA 1W93A 2WJ3A 1ABFA 1WP4A 4YJHB 3GQVA 1Y8ZA 2H17A 1UMBA 3FH0A 5CT8A 3KBBA 2OXIA 2FAXA 4B4DA 1NIJA 4QHTA 3U3MA 2ZJFA 2PZLA 4URYR 4LJSA 1LVUA 4GUDA 4CHTA 2NO4A 3DOEA 4CI9A 1EFVB 1YC5A 5FNVF 4LF5B 3OT1B 5TT0A 4U7GA 2ANCA 5L51A 4NCAA 3R75A 3A2LA 1CW2B 4A7PA 3V8BA 1TPZA 2Q8NA 2YVUA 3ABSB 3FLBA 4YRZA 3A6LA 1JV2B 1Z13A 4FHCA 3ORQA 3DFIA 1VKZA 1NZDA 3G13A 1D2AA 2DHRA 2XEDA 4NULA 4HJXA 1ENYA 1L5RA 5IJAA 2VQ6A 3LFTA 1FS6A 4MULA 4YLYA 2AN3A 3DD1A 5LQRA 2QAGB 3NJRA 3TQTA 3UA4A 4LFAB 1K7SN 3BMNA 2HK6A 1WMSA 1WJGA 2Y05A 3TW6A 1Z0IA 3VNVA 4YV1A 2B0JA 3OCJA 1IQPA 4N8DA 4D41A 3ZVRA 2IY7A 2XECA 5C7OO 1DUSA 4DBVO 2XVAA 3KQNA 4K2AA 1SZCA 2NWQA 4YUAA 1XMOB 5HS6A 4CV3A 5IF3A 3LLSA 2GLXA 1GFWA 1BKYA 3CRW1 4G0QA 3M4ZA 4G5HA 1MQ9A 4INAA 3IAS1 2XUOA 3KEGA 3FD8A 1SIUA 3G17A 1U6IA 4WESB 2PNFA 1E3LA 3QI2A 2ZT5A 1OXVA 5JXJA 3NATA 3QX3A 1B8UA 1YQDA 4PCAA 4DC9A 4KREA 5CDFA 1D5CA 2XNDD 2YN4A 1T10A 2CXSA 3H5TA 5CVCA 4U00A 4I2NA 5K7SA 3IAFA 3OE7A 2YV2A 3HJUA 1T2AA 2ZCUA 4LGCA 4ZYXA 4OREX 4K6KA 3DMDA 4WKOA 5A5VA 1FDVA 5ICMA 4YAUA 3EDMA 2C4KA 5TGTA 4R01A 4AAYA 1HORA 3LP8A 5IDVA 2R8ZA 5C7LO 3ZIDA 3DG9A 2B8NA 1U94A 4QFBA 3UCXA 1ZAKA 1VCIA 2QN8A 1PX2A 1G8SA 2A94A 3GZ4A 3CKKA 3MUEA 4P98A 3ROEA 4QKQA 5B7NA 1K6JA 2C2GA 1RABA 3KRTA 2C82A 5BN5B 3RE1A 1S5PA 3CHYA 4TVBA 2PNJA 1QF6A 5J2TA 3AM5A 4KWEA 4ZQIA 5DSTA 1PT5A 4UEQA 1EUDA 2DPGA 2WF7A 2ZSUA 5CW1A 1RAGA 3FROA 1MNQA 1KAGA 2V59A 3CUKA 4OMDA 1R18A 2D59A 4UATA 3LQQA 5LB2A 2Z83A 1ZWLA 3H4VA 4RC9A 1J09A 2RC6A 4FGJA 2G5PA 1OLXA 5TLSA 2FFQA 2FX5A 2K7FA 4GAEA 5EFOA 2Q1WA 3D6FA 3UC9A 2FPSA 1UFKA 3EBLA 1TVMA 3G7UA 3SOPA 5JADA 4ZVRA 4DDKA 4WN9A 4IJKA 3FLEA 2OKGA 5E0KB 3TLJA 1GCOA 1W1WA 3WLFA 1M6HA 2VR1A 4NQZA 3ZXSA 2FHSA 2QGZA 3QKIA 5E7QA 4KR6A 1OZGA 1MZPA 3WDMA 3U0VA 1ACJA 4NONA 1E99A 3U9LA 4PG8A 1A1VA 3VSBA 1JB9A 2XMDA 1G38A 5EUBA 3QVKA 4ZD6A 1C50A 2GEDA 1NLYA 4FWIB 1WB9A 1Z45A 3DC2A 2EYUA 1MHPA 2HI0A 2XB2A 3DHYA 2ZDHA 1Y6FA 2RHBA 1CWUA 4AJEA 2P3LA 4JUBA 1VB5A 2YR0A 3HDQA 4BVGA 1PSDA 2QRUA 4Q3KA 1IVYA 4N5DA 3AJEA 2X0EA 5ECDA 2Q5OA 3L0DA 5F76A 4F06A 4YMVA 4B40A 5KQRA 2O7RA 1M8FA 1NBHA 2QZJA 3TSZA 1W44A 2A0XA 4HGNA 3SZRA 4ZV9A 3RK4A 4EK9A 1K8YB 2GHIA 4G5XA 4NICA 2WJIA 4TX1A 5H5JA 3V4SA 1W36D 3OCZA 4HZUA 3D8NA 3I4FA 2OFOA 4XQEA 5M34A 1CERA 1YZGA 3PC3A 1AB5A 1SCBA 1O95A 4GXNA 4Y1GA 1ZWKA 3P5BA 1IL0A 2JIOA 3TMYA 3TGWA 2BWJA 4AJ1A 1JAZA 4WSOA 3PYXA 3QE0A 3DTYA 1KMNA 4E5YA 2X5JO 1QX4A 3INTA 4ZO4A 2BFEA 2BE7A 1QSGA 1X9IA 2WPDA 1IUPA 3LHFA 1QAMA 3FGPA 3AR4A 3T38A 4HFMA 2EX0A 3F4KA 4ZOCA 4BZPA 4JLAA 3VO8A 5CXQA 2C7OA 1EFHA 1U8FO 2BT4A 5T6BA 4HJRA 4ILKA 3OJWA 4NTZA 2ZQYA 5I47A