1MH1A

Small g-protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
183
Chain Sequence
GSPQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVSLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human rac1, a member of the rho-family complexed with a GTP analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding
molecule keywords RAC1
total genus 60
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 1997-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mh1A00
2Z6VA 4TMKA 1XX6A 2QMEA 4A4DA 2WJIA 2YV5A 4G01B 3A6PC 1UJ2A 2J5XA 4V0MA 4FCTA 3LNCA 4KITB 3I61A 1IAQA 1YVDA 1OXUA 3VTKA 2P6RA 2R2AA 3CRVA 4NYIQ 1KK0A 3C7KA 4FIDA 4TLBA 4ZO4A 1OB2A 1JXOA 3M4YA 2GHIA 4IVPA 1EX6A 4OBEA 4GT1A 2FEMA 4D4JA 4DVGA 2DPXA 2DBYA 2OG2A 3CNNA 1QHYA 1JJ7A 1KK1A 3UXMA 3U7EB 1P62B 5HE9A 3IHWA 2J3EA 5K8LA 1EFTA 3CWZA 2IS4A 1VKJA 3VR4A 1T8TA 1KMQA 2GJ8A 1VYUA 4PC1A 3WMFA 4UXJA 3A1TA 1W0JA 5JWHA 1M34E 4BECA 3A4MA 4QM7A 3B1WA 3GFPA 4DZZA 3THWB 1OFTA 1VHTA 4XSGA 3LW8A 4S2EA 3KQLA 1CS4C 4OQNA 1XD2B 4QXAA 3QSYA 2D7DA 2CJWA 2SHKA 4C0JA 3B9QA 4B3BA 2ZSFA 3ND9A 3U7HB 3ECCA 3LBNA 1I4DD 4PPNA 5KTYA 3HDTA 2QNRA 3B78A 1T4GA 2XEXA 4N0DA 1EXMA 1TL7C 1QHSA 1TMKA 1E98A 4LY6A 3WP1B 1N2CE 2IHBA 3WNDA 1WB9A 1IN7A 1N6HA 2QORA 3CLVA 1M2OB 4RD0A 2QY9A 1YR8A 4OK3A 1IOZA 5KU1A 4EJSA 2AXNA 4MITA 1R0WA 1F2TB 2ZITA 4B3XA 1AM4D 2WPDD 4IW3B 3GP8A 1G7TA 5P21A 1R5BA 3RS4A 3BORA 1GWNA 1CJUC 2F43A 4CIDA 1GKYA 2BBSA 4BUJA 1N0UA 4QM6A 4GP7A 1CJVC 3U60B 2VP0A 4Q4JB 3GJ3A 5G3ZA 1CRQA 4Q4AB 2OAP1 1XP8A 1DAGA 2GNOA 3MWKA 2CE7A 1QHIA 5JWRA 4BFYA 4B33A 1SULA 4M53A 3GEIA 2CL0X 4KFRA 4A0RA 3BBPA 3U3MA 3L0OA 821PA 2MSCB 5CK5A 2P67A 2ZSDA 2QT0A 2ZRJA 2ZJ2A 3AVWA 3KKPA 4Q1AA 1IM2A 4QGAA 4XJXA 2JLYA 1TQ4A 2NG1A 2CNWA 1ZP6A 1O87A 2OESA 4M1WA 1NY5A 1GILA 5KO2A 2GXQA 2GAAA 3Q5EA 2JEOA 4D4KA 3EZFA 3HWSA 4MYHA 3SN6A 4DUGD 1R0ZA 3RABA 2WJYA 3BH6A 5FPYA 4TWZA 1QRAA 3QJYA 4G0NA 1ZM9A 4B6FA 3BB1A 4JLNA 2J9RA 2CXXA 2WV9A 4HUQB 4NDZA 3TK1A 3CX8A 5L3SB 4HZUB 1D9ZA 4C0AC 121PA 1G7SA 1P75A 1ZBDA 2W6JD 5IDVA 3SHFA 5EE3A 2HJGA 2VHQA 2WWGA 3PEUA 3BRWD 4ILEA 1G5PA 2G9NA 5AUQA 2NZJA 2ZRAA 2AD5A 1KO4A 3RAPR 4F92B 1NRJB 2JASA 2QE7A 5SZKB 4JS0A 4XSHA 1OFIA 2W6IA 4FMCF 1K6MA 4ZDJA 3AF4A 2QRZA 1XTSA 4ZIRA 2J0VA 4NHOA 3PUWA 2VEDA 1Z83A 2ZRCA 1SVLA 1KI4A 4Q00A 4XD7D 4D0GA 2HT1A 4V03A 1VG0B 2OFXA 4B32A 1BMFD 2QT1A 2QROA 2BWJA 3DOFA 3PUYA 4H1UA 4NBSA 1DO2A 1FW6A 3R20A 4TQAA 4V0LA 1Q44A 3K70D 2IXFA 3SBEA 3UWKA 5AUOB 1Z6YA 2JIZA 4TMVA 2IYUA 1PZNA 1ZCBA 3KL4A 1OFUX 4Q7JB 3SJBA 2GDJA 2ZQ5A 1KO5A 3UMRA 1CR0A 2QMOA 1OXXK 1ZVQA 4DCNA 2AFHE 3VQTA 2JJ8A 1F2TA 1KSFX 1XU4A 1EWRA 2JLVA 2Q3FA 2ZRGA 3LAWA 3I72A 1N5LA 2QL6A 3GLHA 3VR3A 4YLGA 3VHLB 2FSFA 1RPZA 4UXIA 4EIWA 2ZRLA 4N3NA 3SC3A 3EIHA 3QG1A 2F3RA 3LY5A 2ZI4A 1NSFA 2XJ4A 4IDHA 3B1VA 4E07A 3KB2A 2HDNB 1DADA 4PSVA 4JL6A 3A36A 3GMTA 4M9ZA 2EYUA 3I92A 4NCIA 3KXIA 3IGFA 5GJVC 3ZJYA 1XD2A 2OLKA 5HKKD 3RVBA 2ZJ8A 2DR3A 3HU2A 2IWHA 3L2OB 3RS7A 3EIQA 3T35A 3GLFE 4IFBA 5EXPA 1CF4A 2AD1A 2C9YA 3GCGA 2BEJA 5CITA 3W8RA 3THWA 1XFAA 3V00A 2DYKA 3RRYA 2WHXA 4CEJB 2IC5A 3PEVA 2CLSA 3RDPA 3R9XA 1GL7A 1WBDA 2ODBA 1D9XA 1Z6XA 1XTRA 3QF7A 3AF1A 3LV8A 3TAHA 2IYYA 4NYMR 1F60A 4DSTA 4ZIRB 1HTWA 8OHMA 1E0SA 4B3CA 1ZUNB 3Q7PA 1KI6A 1T3SA 3K09C 3QKUA 3SOPA 1LB1B 4AURA 5E4FA 1QBKC 1G8FA 2XOKD 4JZKA 1JR6A 1HH4A 3GFTA 5AUNB 3AUYA 3GD7A 3GPLA 3IPYA 1RW4A 3FKSA 4W5JA 1XJ0A 2P0EA 2JA1A 3AVOA 1NSTA 4LV5B 5JMTA 3L0PA 2DY1A 1TQDA 3O8RA 3GQBA 2CL7X 1T3HA 1YZUA 2XNDA 2WM9B 4TMZA 1HA3A 2G1JA 3GJ7A 5HCIA 3QUSA 3RWMB 2NPFA 2BMEA 3CKLA 2VF8A 4PAOA 1E1RA 4US2R 1E4YA 4Z54A 2IBMA 2NIPA 2PBRA 2KE5A 2ZVPX 4WXPA 3WNBA 1NG1A 2OAQ1 3VKGA 4Q9LA 1DG3A 4ZI3A 1YJ5A 2P6NA 2P5SA 1XEFA 2VYFA 1XEXA 3OEED 1ZC3A 2ZAMA 3L43A 4QJ5A 2EFHB 2RGNA 2FZLA 1PV4A 1E9DA 4GI7A 1NIPA 3AP3A 1E2FA 4TSFA 1XCGB 1ZNYA 3GJ0A 1FMLA 4LBYA 2O52A 4HZIA 1IN5A 2ECKA 1JPNA 1RE0A 2N46A 4LHWA 4MDEA 2PZFA 2VP5A 3GLIA 4Q7LA 5D3QA 3SJCA 4HAZA 3AKEA 4IJMA 4QHSA 4PHHA 4HDOB 4L8GA 4LBWA 2FGKA 4PAMA 3EWSA 1YZTA 3W5JA 1OPXA 1Y3AA 5CIQA 4DLVA 3R9WA 1UKVY 4PR0A 3WRYC 1GIAA 5FOUA 3EARA 1H8HA 1KMHA 4DJTA 3TSOA 4JLJA 4JJKA 2GCNA 4EFLA 4GP6A 4BRUA 5LD2B 1B0UA 1RYFA 3E5HA 1QHNA 4NE2A 4LPKA 1NMXA 3OE7A 1R8QA 2F1HA 4EPRA 4QJ3A 2CCGA 2YJTD 1FQKA 1OF1A 3B60A 3NIBA 1ZNXA 2GEDA 5JSZB 5FOVA 4FCWA 2OZEA 2I4IA 2AKYA 4KVAA 1X6VA 1PVOA 4PAQA 2VHCA 1OLOA 2IYTA 2XNSA 5KYKA 2XTNA 2R6GA 3QVUA 4HAYA 4D6PA 2IYZA 3IIKA 4P4TA 2XB2A 1TF2A 2ZI6A 1R5OA 1SKYE 4URZR 5JHHB 4UKDA 1TF7A 4WXRA 1DAHA 1ELOA 4NYJR 4URXR 5JI3E 2JDID 3MUFA 1ZUHA 1X3SA 4IOMA 2GF0A 5HZKA 4OK6A 4PSKA 4ABYA 2ORIA 4HB2A 4P32A 3ZQJA 2EQBA 3AUXA 4ERNA 2BKUA 2D4HA 4DBLC 3FE2A 2YOGA 4B2LA 2ZETA 4IHQA 4DDWA 3AKCA 3C4JA 1W49A 4MYUA 3TUJC 3CPHA 3VX4A 2IXEA 1FX0A 2VSXA 1P6XA 1ZD9A 4N0EA 2P3SA 1V43A 4Q1BA 3H2YA 4RZ2A 5IK2D 1XXHE 4BEJA 4AG5A 5LB4A 2TMKA 3F3YA 1XMJA 1AZTA 1HQCA 2FE4A 1TQ6A 2VHUA 3NKVA 1OW3B 721PA 4FN5A 1LFDB 1BIFA 1NKSA 5H70A 5CDFA 1AIPA 1E79D 2O8FB 2C99A 2IUTA 1UADA 4PPFA 2P2LA 3ASYA 3OHMA 3TH5A 2GJKA 4RFSA 1CU1A 4DLYA 3N70A 4C3ZA 2EFCB 4ACBA 4PO8A 2AN9A 4C7OB 1L8QA 1ZNZA 3KKQA 1AK2A 4MGKR 4PX9A 3QXXA 2UKDA 4DCUA 2BHRA 1S4QA 1GNRA 1VMAA 3SS8A 4OQFA 3NG1A 4B2PA 4WVFA 3EZ9A 4TL6A 2R44A 2QP4A 1DO0A 2BVNA 1U98A 3W6OA 2H7VA 3K0AA 2V1XA 4YMSA 3X1YA 1MO6A 1J2JA 1JQJC 4FINA 4R2IA 1FFHA 4Q9KA 2ODEA 3LVRE 5DH9A 3S1AA 4CEJA 1AS2A 5FOTA 2XJ9A 2J46A 4AC9A 1DAMA 4LZZA 5TVKA 4KJZA 3ZZ0A 4JBXA 4BLRA 2BBTA 3G0HA 1X8LA 1KI3A 2GXSA 4D2IA 1E2QA 2FPKA 3Q85A 4FWIB 1Z3IX 2JJ1A 1O3YA 3N2IA 2DCUA 4BEBA 4UJ5A 2G6BA 5KUTA 3M6AA 2WTUA 1YQTA 2QA5A 2HCJB 3UK6A 2IEZA 2YOHA 5AK0A 4E22A 3GJ5A 3I8XA 5DI3A 4Y0VA 1KHTA 3PUVA 4URWR 4U00A 3FHCB 3IQXA 1XD8A 4C0SA 3M0EA 4GZMA 3TLXA 3IBGA 4TSFD 1Z07A 3A1WA 1FPMA 2RHDA 2I3BA 5KDDA 4CDGA 2WJHA 4URVR 4JT2A 4JVLA 3V4FA 1OB5A 2PZGA 2YYZA 5GADl 5IRCD 3T06B 2ERYA 2MMCA 4G1UC 4HEJA 1C4OA 4HAUA 1KJZA 1RVDA 1VCIA 3V4RA 2RMKA 2LKDA 4QHTA 2B6HA 1KDOA 3TR0A 3ZQ6A 2YWGA 4JLPA 3UATA 2ZREA 2HLDA 3A1VA 2O0JA 3U44B 2RGXA 1E9BA 2GK7A 1WCV1 4WA7A 2CBZA 1TQ2A 5FTJA 2BV3A 2ZE6A 4MKHA 4ZKEA 3FOZA 3U5ZB 2BMJA 1QVAA 1XTIA 1G5RA 5JZVA 3IILA 4CF7A 4EPWA 3WYAA 1HT1E 1FTNA 1NMZA 4LJ5A 2WZQA 2YNMA 1T9HA 4IXNA 1E99A 3KJEA 4JLOA 4Z8XA 2IS6A 2XTMA 1G6HA 3C16C 3BK7A 1V5WA 3DMDA 1UEJA 1LVGA 1NN0A 2W0MA 1W5SA 3TUIC 2BBWA 2C8VA 4EPXA 4RCZA 2C04A 2MMGA 3CNOA 5JCPA 2KWIA 1G7CA 1G8YA 3CRQA 4HZUA 3KFVA 2F9MA 3AF2A 1PLLA 4HUQA 3ADCA 4LK2A 2OUKA 3KQKA 3DKVA 4TLEA 5CIWA 2FSGA 2QQ0A 2ZS9A 2A2ZA 4A0HA 3VR6A 3LBHA 3I5YA 1KYIA 5GJBA 2ZI7A 5H1YA 3DM5A 5HKKA 1L4YA 1R10A 4NYMQ 1R0XA 4I81A 3SQXA 3EW9A 1D2EA 3AVQA 4Q4HA 1TUIA 1S3SA 3AQ4A 1F3OA 2ZI5A 1KJYA 4M9XA 1XJQA 1DVRA 1X1SA 1KO8A 2F1RA 1VPLA 3ZS9A 4A92A 3B85A 3PEWA 2JLZA 3TSZA 4NPHA 2H5EA 1GAJA 3G5UA 3LLUA 2A5YB 2ZJYA 2HT6A 5EZ5A 2O8DB 2BM1A 2QAJA 3K0CC 4EPVA 2GJSA 3AH8A 2YWHA 4LDJA 1U0HC 4Q4AA 5GJWC 5IK2A 1JR3E 1OKKD 3IEVA 2FA9A 4Q18A 3ZIAA 4PO1A 3GLFA 2W2XA 3GJ6A 3A37A 5L8VA 4TYPA 2NO0A 1QF9A 2CCKA 1GUAA 1WBBA 1OT3A 5D3MB 3ICQB 3QPWA 1OFHA 3EC2A 1U0JA 2R6CA 3NBYC 4GPTA 3ZD6A 2GBLA 4JMPA 3C8UA 2IUUA 3KFXA 3W9YA 3TQFA 2RHMA 4MKIA 2O8DA 3ZYCA 2IF0A 1FNNA 1VIAA 1XD9A 2GCPA 3CF6R 4ITRC 1F2UA 3T1OA 4OI1A 3THYB 2VA8A 2OFOA 3G82C 3THOA 3L0IB 2GETA 2G83A 3CR7A 2FF7A 2WMOB 1EX7A 1QHHA 1CEEA 4EFNA 1FL9A 1FP7A 2CJWB 4MDFA 2ZSEA 3J81k 4JT4A 1SVIA 3GEEA 3EPJA 3OIWA 4LV6A 4FWTA 1XTQA 1XTJA 2VHTA 3ND8A 1EWQA 1SQ5A 4Q1CA 5JJKA 3SE0A 3C41J 2V6IA 4R9UC 4B47A 3NVAA 1W4AA 2YC4C 1E2LA 5EE1A 1CJKC 5KSOA 3U6BA 1TAGA 3EWAA 5G3YA 2QBYA 4FD2A 2F9LA 1UBCA 3K9HA 4KU4A 5FBVB 4W9MC 3SQWA 4MKFA 3U3KA 3O8DA 2XXAB 2RB4A 5KNBA 4AKGA 3T5GA 1KOFA 5CM8B 2ANBA 3CBQA 2VIIA 1M7BA 4RD6A 1GNQA 1W1WA 4LYHA 3LLMA 4TTPA 2CVFA 2ZIAA 4JJZA 4C2UA 1ODFA 2GAOA 4PPQA 2CHVA 2DFNA 5G40A 5AUPB 5L3QA 1B23P 4BFUA 1NLFA 1TEXA 4Q1EA 3L82B 4G5RA 3W3ZB 2G77B 5TMPA 2B7BA 3AVPA 1N6LA 5E7JA 1PJRA 1CR4A 2FPMA 4RD1A 1Q1QA 1JALA 4FMBB 3SFVA 4BLOA 4A2PA 2DHRA 3I1FA 1L4UA 1IHUA 2GZAA 1AGPA 3WHKA 4J0QA 3KQNA 2GJ9A 4A6PA 3WMEA 4Q03A 3MD0A 5BN4A 2PT7A 1PUJA 1XEWY 4HATA 4KO8A 5FFMA 3CF0A 1NG9A 4YXWD 2PLFA 2VQSA 4JVMA 1W0KA 2XNDD 2OBNA 1A2BA 2C2HA 2VLIA 2ZJOA 1MT0A 4I1OA 4QL3A 2A5GA 4OQMA 1GRNA 4MYCA 2GEUA 1NVUQ 4C30A 1CJTC 3ZH9B 5JI2E 1KI9A 2PLRA 1OIXA 2ZAOA 3NH6A 5BN3A 4C0BA 4HB0A 2QMUA 4OK5A 2NO7A 1X8JA 1NL3A 2A7QA 1S9HA 2GCOA 1G21E 4KCGA 1N5KA 3CIOA 3HU3A 5JBQA 1G9XA 4UNSA 4L16A 4BE7B 3RLFA 3U44A 2O5VA 2L0XA 3DMNA 4QC2A 1IY2A 2QU8A 5SZJA 4AD8A 4X8OA 3AM1A 4RZXA 2WVJA 3TMKA 1UM8A 2DFLA 1W4CA 3GJ4A 4DDTA 3MGCA 4F38A 1UKEA 1U8ZA 4URUR 4A0GA 4ASUD 3AVVA 1GVNB 3EZ7A 4DRZA 4H9GA 4DCSA 2RH5A 3W6NA 2O0HA 3NHBA 3TW8B 2QI9C 1NF3A 1KSJA 1G3IA 2DFKB 1XXHB 2WICA 4UNPA 4LGMA 3HP1A 4RFSB 5KDLA 2FN4A 4PO9A 5JS8A 3K0SA 1Z2CA 2OCBA 4AI6A 4Q9HA 4DDUA 5EUQB 4QGGA 5EUMA 1DE0A 1U9IC 1M7HA 1R0YA 4MUBA 2J7PD 1D6JA 3A58B 1ZIPA 5DI3B 3EAQA 4X8MA 3SHWA 2E1RA 2O8BA 5AJYA 4WZBE 2GF9A 3AKDA 4LJ9A 4LSGA 2ZRKA 1E1QA 2D7CA 4B3DA 3VKWA 4M2LA 2QTVB 2G1KA 4G5QA 5JEEA 3I62A 2FPLA 4AK9A 4M1MA 3HR8A 1W47A 1T8UA 1WMSA 3IPXA 4HYYA 1CR1A 4PQYA 3U3JA 1A5TA 4CEIB 1OXVA 3ONWA 3RS2A 1FTSA 1X8KA 4XD7A 3T1VA 1OHHD 4A2QA 4RCYA 3SEAA 5F2EA 1E2IA 1NN3A 1SVOA 1P2TA 2ZUDA 3OAAA 421PA 1COWA 1BYUA 3O47A 2FX3A 2KB0A 2W6ID 1GZSA 3P26A 2JLUA 2X2EA 2QEQA 1M6NA 4JSYA 2ATVA 2F1JA 4V0NA 2KI5A 4MH0R 4OHYA 4QGFA 1EGAA 5EZ6B 3MCAA 3LDAA 1FZQA 1II0A 4QBIA 3BFXA 1WE2A 3PQCA 2ZYUX 4B74A 3EIEA 5JRJA 1GITA 3THXB 3L8ZA 3RC3A 1G8PA 1QG2A 4M0LA 4HLDA 4KXFB 5EXTA 5F9FA 1WF3A 1ZCAA 3ZD7A 2D74A 1KMHB 1GKUB 2IYLD 2V9PA 2GCOB 2J41A 3QOFA 5LBIA 5TXGA 3SYKA 2VO1A 4AYTA 4B73A 4Z1MD 1CULC 4Q02A 2Q0HA 2O8CB 4AKEA 1NY6A 4CEHB 5LB2A 2ZTSA 1UBFA 2AHOA 2XZOA 2HXYA 3RYTC 4E09A 2ZRNA 1AGRA 4DDVA 4DSNA 3SJAA 2PJRA 4IOJA 1XMVA 2X8AA 1K5GA 2AKAB 3CUEF 3FTQA 4Q01A 5FL7A 3RRMA 4PZLA 1P9WA 3RSOA 2RGDA 4DXAA 4FXPA 2AR7A 5B58C 4A15A 1Z0KA 5CLLA 1HURA 3QBVA 3LFUA 4M1SA 1XPUA 1OV4A 1RRPA 1TF5A 1ZU4A 1VHLA 4HLUA 5KPDA 3ZVNA 2R62A 1E9FA 2HUPA 1EESA 3B8HA 4DLXA 4MRNA 3R9IA 5C18A 2IEYA 2FFQA 5DYGA 3DZDA 4Q48A 1D5CA 5IT5A 1FNMA 1VECA 4F4IA 1VCNA 1U94A 4PC6A 1AQUA 5SZHB 3B9PA 3BC1A 3UWOA 1US8A 3PJRA 1EFRD 1NBMA 1MRSA 2J0UA 1DOAA 4P4SA 1SKQA 4YMVA 1UBGA 3WRXC 1MR3F 1YZGA 2QN6A 1JAIA 2Z5FA 3MFYA 2QRNA 2GRJA 2OHFA 4Q19A 4K46A 2J45A 1VYTA 2NO9A 2HXSA 2OBLA 3C5HA 3TSWA 4F4CA 3I32A 1Q12A 1RRCA 2EVWX 3D7MA 2WWXA 3TNFA 2OCPA 3ADBA 4BFSA 3NBXX 4Z51A 4DLUA 4B48A 4HI0E 2WSMA 1N0VC 3TE6A 3IKJA 1OJLA 4RKEA 1KI6B 2QAGB 1KNXA 2IYRA 2Q21A 3L0SA 2D2FA 2R6AA 1W36C 2D62A 3OESA 4LC0A 3VHXA 2XITA 3NXSA 3K09A 3SFZA 1YRBA 5CYOA 3ZDQA 3SDZA 4A2WA 4II7A 4BFVA 2ATXA 4RD3A 2NGRA 3RSLA 4M9QA 2YC2C 1KI2A 5JFGA 2CMKA 2X2FA 2ZYTX 2QPTA 5C46F 1P9NA 3EZ2A 3IUYA 3FMIA 5EE0A 5DHAA 1MRNA 3CX7A 3T12A 4R98A 1Z63A 1QHHB 3DPUA 1AS3A 1NJGA 1T0HB 2R6FA 5KSYA 4TMXA 4W5WA 2WOOA 2IUSA 3THYA 2ZRHA 2WSSA 1G8HA 4OJKA 5EP2A 4JBWA 3MRSA 4LOAA 2CDNA 2WWHA 2H17A 3CWQA 4DSUA 5FL7D 4YMUA 1G4UR 2BIFA 4QHYA 2WAYA 3PCRB 1Z0JA 4EDHA 5HZHA 5UKDA 2J1LA 3E1SA 3PFIA 4DLZA 1G8GA 1OIVA 4HSEA 5D3MA 5KHOC 1YZLA 2QAGC 3EC1A 4BGDA 1DELA 1ZIOA 1ZM7A 1ZNWA 3DOEA 3KJIA 5JECA 2ZSAA 2BBOA 3GLGE 4LRWA 3T15A 2QBYB 3C15C 3W90A 4Z1MA 2EFGA 1AS0A 2WIBA 3KJHA 1IBRA 4OI4A 4PQFA 4AYWA 3ASZA 2AK3A 4JKIA 4LJYA 5HCNA 3WHLA 4LC1A 4DT1B 3F5FA 1OYWA 1N6NA 1Z28A 1ZMXA 2HYDA 2V6JA 1XEWX 4BFWA 3B6EA 4XIGS 5FBQB 3Q72A 2V55B 3CM0A 4LHVA 4NONA 3QBTA 1CRPA 1S9DA 2DWPA 2GZHA 1RFLA 4MRPA 3R8CA 1SVKA 2MSEB 2UZ3A 3JZMA 4B71A 1E2PA 3X1XA 1P2UA 2W0SA 3OAAD 1NJFA 4XOIA 4TZ0A 2B8WA 3CRRA 4KI0A 1P9RA 2JJ2A 2C96A 2ZUCA 3WMGA 2HF8A 3B7GA 1DARA 2CVHA 2EWWA 1OYYA 3QPVA 1X1RA 4LHYA 1A82A 1Z6TA 2V3CC 2HV8A 3SU8A 1S1CA 4DCVA 4L15A 2ZRIA 4JLBA 1N6OA 3REGA 4BASA 3ZZTA 1YE8A 2V4ZA 2H18A 1U0LA 4IOLA 3BIFA 1HE1C 1OH8A 5E95A 3GLFB 4DIDA 1SKYB 1Z22A 2VTKA 2W00A 1RJ9B 4M8NE 4IDNA 1JQLB 4YMTA 2J7PA 4AKIA 1ZD8A 3DO6A 4O2LA 3CH4B 4UJ3A 2H16A 2P5TB 5FOWA 3I73A 1KJWA 4XTRA 1KIMA 4AKHA 1E0KA 1G3MA 2VSOA 2GXAA 4RZUA 3FGNA 2KSQA 1R5NA 2P6UA 5J4HA 1RC8A 2GKSA 2ZRFA 1QZXA 5FR1A 5JWOA 1W48A 3EA5A 4IVQA 4Q4JA 4AIIA 1Q3HA 1LNZA 4NYJQ 2C95A 4ASUA 2F43B 4M1TA 2A30A 3U7GA 2XAUA 4GNKA 4HLQB 1NLYA 1E0JA 2WAXA 3KUDA 4D81A 1JJVA 4GOKA 2EFDB 1TTTA 3IO5A 1WP9A 3A4NA 3LW7A 4XWKA 2WKQA 4LHXA 1K5DA 1OSNA 1II8B 3U7FB 2G0NA 4NCHA 5KSZA 4YQFA 2OCYC 3K0EA 4IRUB 2YZ2A 2BEKA 3B13B 2IYWA 1H65A 3GJ8A 2JLWA 1BOFA 3NWJA 3MSXA 5B30A 1G16A 2NPIA 4URYR 3RRZA 5HR5A 3TUZC 2QTFA 1NN1A 1OXTA 3AGQA 3VFDA 3W3AA 1U8YA 3K9NA 3Q9LA 3CNLA 4XWOA 1Z6GA 5L3RA 4L4UA 4HAXA 2OILA 1XBTA 2WWIA 3LO5A 3PUZA 4BPBA 1UAAA 2B21A 3BB4A 3PENA 1NBMD 5GVRA 4RJLA 3U3OA 3FFAA 1Z06A 4BLSA 3VX3A 1XJCA 2N42A 5TY0A 3IO3A 4D26A 4BLQA 1T3LA 3O8CA 1SHKA 2GVZC 2H1LA 2WWWA 4P33A 4R7ZA 3AVYA 1JXMA 2ZRMA 4PHGA 4BLTA 4BZPA 2FG5A 4BFTA 4CZ2A 5FBLB 1PUIA 2VPPA 1J70A 1DAFA 2VF7A 2ZS8A 2X1VA 1OH5A 3BFKA 3FWYA 4TN1A 4H1VA 2ODWA 2W2TA 4D4MA 1Q1ZA 4MGIR 4ARZA 1ZC4A 5J47A 1S1MA 1JBKA 1JEEA 2QTHA 2REBA 3DEFA 5DN6D 4WAUA 3VU9A 4JL8A 1D2MA 1GTVA 4N1AA 1JR3D 4CYMA 3QF4B 4OHZA 5DGXA 4LYJA 5TV2A 4IKEA 5M04A 1F48A 1QG4A 2OLJA 3QKSA 2AX4A 1A2KC 1ZRHA 2G3YA 4C0LA 1JAHA 1XZPA 1I2DA 2Z83A 2C5LA 1XB2A 2GWHA 4LI0A 3NEJA 2WMNB 1YU9A 3B1XA 2ZM5A 2VHJA 1BS1A 3QF4A 1QVRA 1W44A 4Q1FA 3FB4A 5J4YA 5EE5B 1Z0DA 3OFND 4MRVA 4V0KA 1NKTA 1U99A 2OXCA 1SZPA 4KLZA 4MRRA 3UG6A 1COWD 3WBKA 5KPJA 1J8YF 3IDQA 4ZPXA 1LY1A 2XX3A 3R7WA 2FZ4A 2QGZA 1W4RA 5FL3A 4UQOA 2D2EA 3MMPA 2PX3A 2JLXA 2AFIE 2F7SA 4C9BA 2XGJA 1OH6A 1KK2A 5JCZA 4NU0A 2GTPA 3X1DA 4NH0A 4DB4A 3N5CA 1E9SA 2J0UB 2UZIR 4K81B 4PXAA 5A5GA 1YR6A 4JVNA 4GL2A 3D8BA 4PSAA 5KDOA 1H8ED 4M1KA 5TB5A 2NZ8A 3NEYA 4MUAA 4PTLA 4E03A 4EUNA 3LXRA 5EQTA 221PA 2BDTA 3EPKA 5DSZA 3BWDD 1E1QD 4HDQB 5BQ5A 2AWOA 4NTZA 3K1JA 2QP9X 4OI2A 2ZEJA 5SZIA 4M1OA 1OXSC 1P2VA 2ZU6A 4DLTA 2F6RA 4B3GA 3JZAA 3D31A 4KBFA 5CK4A 3TRFA 3E70C 2AL7A 1Q22A 3KB1A 4HAWA 1SXJD 3EASA 4C0HA 2ZJZA 4CT5A 2ZVQX 5FPKA 3PUXA 5CYPA 2A9KA 3H0KA 1N6RA 3T34A 3I5XA 2Q3HA 3K53A 4JYCA 4LYFA 1KSGA 4ZV4A 3LX8A 4P0TA 2F1IA 4I4LA 1NVVR 2CCJA 4L5BA 4BZQA 2Q9AA 4ON9A 5FTNA 1XPRA 5CM9C 2OBMA 3LQRA 3NC0C 3QG5A 3NC1C 4EPYA 2O8CA 3K8YA 2Y8EA 5LD2C 1TU4A 2B92A 2PMKA 4EPTA 2FFBA 4B2IA 1G41A 4MRSA 2A78A 3PG5A 1KKLA 2RGCA 4A8JC 1X86B 1W36D 5FOSA 2AXPA 1VYVA 2BMDA 2EW1A 1M74A 3P32A 2QG6A 3R7WB 1T0JB 2IW3A 2RCNA 2W58A 4HLUC 2CK3A 2FNAA 4MQBA 4XVQA 3QNUA 2IA5A 1CXZA 1T91A 4OJQA 1KI8A 1JI0A 4Q47A 5CB6A 1G20E 3DZ8A 3FVQA 3GLIB 4NCJA 4O2RA 1KO7A 1NP6A 1WDTA 2BOVA 3KTAA 4QNRA 4MGYR 1W0KD 3ADKA 2FOLA 3U61B 4YXWA 3A4LA 4A0FA 1ANKA 1CTQA 4TLAA 2VRWA 5JLJA 3TGPA 4HLCA 2CE2X 4KFUA 4LJ4A 3ZGXA 1G64A 5J4LA 5C2JB 1GL9B 2I1VB 3Q5DA 3QQ5A 4NYIR 1D2NA 4TLCA 2GVDC 1KK3A 1E2NA 4TYNA 2FDCA 1G4AE 5FTMA 2LWIA 4U02A 4D80A 3EZ6A 3KKMA 1UPTA 3ZS8A 4A8JB 5EP1A 2O8BB 1KDTA 5AJVB 1KAGA 1HYQA 4ARZB 4D25A 1EK0A 4QGHA 1W2GA 5J5CA 1IN8A 1KTVA 3TVDA 5B64A 4TL9A 1RRFA 2YOFA 1TNDA 2Z4RA 4TT3A 2ZUBA 5DHFA 3KQUA 4ZDKA 4PC3A 2JGNA 2RGAA 3F0TA 4LX0A 3A1SA 1SHZA 1DBSA 2JJ1D 1ZM2A 4CGZA 1E3MA 4Q9IA 3PITA 1YZKA 2I1QA 1E2GA 3MJRA 4Q1DA 5FBWB 4DT1A 5FH9A 4A1FA 4QFMA 5LPNA 5FPSA 5HE8A 1P3JA 1FUUA 2B8TA 1W2HA 4ZDWA 2PEYA 3TR5A 1L2TA 4JLVA 3PVSA 1GM5A 3A1UA 1W36B 4WOPA 4I1SA 1MKYA 1UDWA 1QDEA 3B1YA 1DTSA 4XTCS 3ZZUA 1EG7A 1Z0IA 1Q21A 5FPTA 4C0QC 2YWFA 5AR1A 4GBMA 1TEVA 4NKRA 3AVTA 4OQLA 3U3RA 1KNQA 1UKZA 1GOTA 1II9A 2EYQA 5A0FA 2J0SA 3ZVMA 5A4JA 5BW8A 1U2RA 4DHEA 1I2MA 4W7SA 3GLIE 4WIAA 4OI0A 2C98A 2V7QD 3OEHD 1G3QA 1CLUA 3D6TB 3ZVRA 2BCGY 1KI7A 5AWFC 3MG9A 2WJGA 2ZI9A 1DS6A 4A8JA 4LJ7A 2WKPA 1PLKA 2CHQA 3EG5A 2PZEA 4S35A 2LKCA 1XCPA 3UANA 3B82A 1TUEA 2QPOA 3H84A 3KDSE 1LF5A 3C14C 4GRAA 1E94E 3ZIAD 4RFVA 2ZE5A 5FUWA 4FMDB 5FI0B 1OKKA 4MKGA 1E2DA 3WYGA 1YR9A 1SXJE 4B35A 5DIFA 3BAFA 4O3MA 2G0TA 3K0FA 1G5TA 5FTLA 2GBLC 3EPHA 3X1WA 3K9LA 3FMPB 4JBYA 1R2QA 2PL3A 3KXKA 3T1QA 3P27A 2BCJQ 1G3UA 2A3RA 2V7QA 2JDIA 3KTAB 1W4BA 1E9RA 5C1BA 1DG1G 4B43A 5L3QB 2ORWA 4M21A 3AVXA 2ZYWX 3QVVA 1ETUA 4KSBA 2Z43A 3N2EA 3IIMA 4XVUA 3W6PA 2R6DA 4DLRA 1Z47A 1Z5ZA 1RIFA 2WBLC 1HEIA 2JLSA 4DLWA 2XXAA 1QHGA 4KSCA 1MO3A 2O0KA 4I1VA 4KHZA 3RWOA 3EX7C 1AQYA 3OE7D 3NTUA 4B6EA 4LJ8A 1WRBA 4U5XA 1N6IA 4EJSC 4JIMA 3BFVA 1A7JA 4EFMA 4UXHA 2VP4A 1YHNA 1N5IA 4NCNA 1R7RA 5DLQC 2F55A 1KDRA 3T5DA 3FHTA 1SVWA 2WJVA 4G3XA 4Q5IA 3VKHA 1MO4A 3KJGA 5EXSA 3MAAC 4ACAA 3RS3A 3PR1A 4R71A 3BS4A 1J7KA 3DHWC 5FOXA 2PEZA 1QHXA 4RVCA 5ANRB 3VR2A 5KNDA 4DEXA 3LVQE 3EPLA 1GNPA 3K9GA 3QPUA 2FSIA 2QUZA 3VMFA 1M1YE 2BJWA 3IEUA 3SYLA 3CB4A 4BZXA 2CEAA 2J59A 1E2MA 2XB4A 2QENA 4GSYA 3VAAA 4AWXA 2Q3MA 4QBGB 3X2SA 2HEIA 3LWNA 5F3WB 2HCBA 3NHAA 4GFDA 4AG6A 3K0CA 2HLDD 3OF5A 1E32A 4LBZA 1IJEA 1KSHA 1YR7A 1SVMA 5JJLA 4V0OA 1LS1A 1ZAKA 2C03A 3MJHA 2XSZD 1DAEA 3CPEA 1HQYE 3FMOB 1VG9B 1T5IA 4V02A 1PLJA 1N5JA 4B76A 3AP2A 3OEEA 4K8OA 4TQUS 3QENA 2XSZA 4XH9B 1E9EA 1J90A 3GJXC 3EA0A 2C9OA 3BE4A 3PIRA 5IF9A 4EJSB 3TKLA 2C9CA 1E1RD 4DC9A 3RS0A 2QSYA 3CH5A 4I1UA 4TLDA 4W5HA 2V54A 2E87A 4M4SA 1AKEA 3P4YA 4KYIB 5H68A 1E2KA 2ZROA 2FMXA 5G53C 4QOSA 5F98A 2JATA 2YKGA 2KJQA 1T5LA 1Q3TA 2PMDA 2XZPA 3HJNA 1AZSC 2CLDX 4JLKA 3U2QA 3VR5A 3QIAA 2XOKA 4PC2A 3AF3A 3WBJA 2YVUA 1FQJA 3WP0A 5FTKA 5CLQA 1AJEA 3QXJA 4LJAA 2IS2A 2XZLA 1ZINA 1NVVQ 5K8TA 3VNUA 4EQ6A 2J0QA 4ZI2A 3T1TA 2QZ4A 3BJIC 2VSFA 3QXSA 4Q21A 1UKYA 4FMCB 4KFSA 5JS7A 2Q6TA 2IX3A 3KKNA 1CBUA 1E9AA 2PT5A 3CW2A 4X8LA 3TQCA 3QKSB 2GJAA 3ICEA 1E4VA 3F8TA 3U6KA 4KYUA 3FPAA 4CT4B 2A5DA 2QAGA 4RZ3A 4UNQA 3TVTA 4RD4A 4Y0AA 2A5JA 1U90A 3QKRA 1XCMA 4M22A 1MV5A 4P31A 1W46A 4ZDIA 3DL0A 4B34A 1TADA 5HPYB 4JL5A 2WJJA 3OZXA 2QP3A 4OYHA 3VU9B 3K70C 2DWOA 2NQ2C 4G5SA 4IXMA 1MH1A 4G5OA 4UNNA 3NDPA 2RGBA 4DSOA 4WZAE 1SXJA 1VTKA 1E79A 4GOJA 1HUQA 1OE0A 3X1ZA 1C1YA 4PFSA 4PANA 1S0UA 4LBVA 4P4SB 1US8B 1W5TA 4DWJA 2PCLA 2W2VA 1SXJC 3CZPA 2NMVA 3H86A 3TW4A 4A9AA 3BOSA 3Q7QA 2O8EA 2JIZD 2CLCX 3P1JA 4HB3A 3BXZA 4L9WA 4NL4H 4TTRA 5DE3A 1Z08A 2VBCA 2Q9BA 1D8TA 4HB4A 2VP9A 2ZJAA 2EWVA 1UFQA 1HY3A 1BMFA 2GA8A 3FYHA 4IEEA 4Q7KA 4TYYA 3UIEA 3E2IA 3EXAA 1S8FA 2NO1A 4F4JA 3U4QB 2D3WA 3SR0A 4B44A 3OEHA 2ZR0A 3LBIA 2NOAA 4TYQA 3Q3JB 3LD9A 1KI1A 4D82A 1P73A 4IDQA 2ZYVX 1L7VC 3MLEA 4C0KA 1CIPA 3CPJB 3FFBA 2A5FA 3PV0A 3OFNA 4MYTA 2IT1A 4IDPA 2GEVA 5JEDA 2R9VA 2Z4SA 4G5GA 4RSGA 3R8FA 4CEHA 1ZM3A 4KLNA 4LCBA 2PX0A 3KX2A 3QXHA 5DISB 1JECA 1RYHA 5EXXA 5FUVA 3FHOA 2ZR9A 4IEIA 3WXMA 1II8A 1FOEB 2FGJA 4Z8YA 1RKBA 3SBDA 2V1UA 3U4QA 2OM2A 2IF2A 4OQXA 1H8HD 1YRAA 4AYXA 4HAVA 4CVNA 4A82A 3K0AB 4EQ6B 2OCAA 2ZI3A 2PJZA 1LV7A 1C9KA 4DUGA 1I4LD 1UDXA 2QQEA 2BKEA 1P5ZB 2V8OA 4NMMA 4KVGA 3SNHA 3ETLA 3D3QA 2O8EB 1Z0AA 4NCKA 3OIUA 1JR3A 2X19A 1E6CA 3WNCA 1Q20A 3UG7A 4C7OA 5DN6A 1KY2A 1NI3A 3CO5A 3GLHE 2YINC 2REOA 5KNCA 2G88A 2REXB 4TT3D 4QBHA 4B3FX 4KODA 2IK8A 1P61B 3NH9A 1XMSA 3MWLA 1A4RA 2NTYC 4EAQA 3CR8A 5LDDC 1M8PA 1MO5A 4JYBA 4CEIA 1CP2A 1RJ9A 5EJEA 5C4MA 1UBEA 3C5CA 2IYSA 4YDSA 1AN0A 4FMDF 4PZYA 1KDPA 2ERXA 2IXGA 2JLRA 4QNMA 3O8BA 5KSPA 1JNYA 2GESA 3MWJA 4OHWA 4F93B 2N1BA 3BERA 2WPDA 1UF9A 1IQPA 1N6PA 3TBKA 3LH5A 1NNEA 1NMYA 4OHXA 1HT2E 1RRGA 1DAIA 1WXQA 2LCFA 3BGWA 2IYQA 2FFHA 2RGGA 4LJ6A 4TMWA 1DAKA 2ZS7A 4IDOA 5BWMA 3VR1A 2F3TA 1U81A 3W8NA 3CONA 2OT3B 5E3HA 1VG1A 1BH2A 3JVUA 1BYIA 4LYAA 1GFIA 4Q9JA 4GOXA 1AKYA 3DM9B 2JLQA 2WKRA 3IIJA 3KKOA 3LRPA 4QJ4A 2QM7A 1ZM4A 3FKSD 4EKDA 1MABB 4PHTA 1P2SA 1HE8B 2BJVA 3GLGA 2CL6X 4JLMA 2CK3D 3NBFA 2FEOA 2FU5C 4OL0A 1N3BA 2D06A 4MA4A 4DLSA 1LW7A 4JLAA 2E9SA 4TZ6A 1G7RA 4TQ9A 3UKDA 4ESVA 3TAUA 1J99A 5JSZA 1N0WA 3FMFA 4AY2A 1W0JD 3BD9A 5FI1B 2ORVA 3QEOA 3DKPA 2ZRPA 3BH7A 2GILA 5FUYA 1IONA 3RS5A 2OXRA 1KZGB 2ZPTX 1GRRA 1J8MF 4P4UA 3ADDA 4PHFA 1YKSA 1CR2A 3AGPA 2ASEA 1GL6A 1P7CA 4F7WA 4FW9A 1DEKA 4JLDA 1E2HA 4X8HA 5FUXA 1CKEA 3AKYA 3RC8A 5DI9A 4HDCA 5JJIA 1EFHA 4TMTA 4LPSA 2WWYA 4JSTA 1LF0A 1GRQA 2R65A 4NP6A 4POAA 4QRHA 5J4KA 1EFUA 1IXSB 1IXRC 1G291 4MGZR 1IY0A 4RD2A 5BXQC 1ONBA 3NDBB 2EU8A 5GVSA 3WYFA 2FV8A 2H92A 2OFWA 4DIEA 5HTKA 2OV2A 1YZQA 2JCSA 1W7AA 4V0ME 2H57A 5TDHA 4KBGA 2JAQA 3AVUA 1XMIA 1JEDA 2HYIC 4P3YA 3BB3A 1H8EA 1LS6A 3RNLA 4LV8B 2ZXUA 2RKOA 1GSIA 2C77A 4M9SA 4QBFA 2R8RA 4D0LB 3IQWA 5B57C 4LUCA 5JRZA 2MSDB 4RY2A 2WWFA 3CRW1 1TX4B 1LTQA 1S96A 5K8IA 2P65A 4WZ6A 2QGNA 2QSZA 3B5JA 3HYTA 4OHVA 1XNJA 4C2TA 3SZRA 2ONKA 4M1YA 3UMFA 3HPRA 2DB3A 2ZJBA 1P4SA 1SGWA 3I8SA 2QE7D 3GEHA 1BO6A 2KBEA 621PA 2ZR7A 3LXXA 1Z29A 2W6JA 5EP3A 1IY1A 1E2EA 1ZD1A 4PZZA 4DEYA 2ZE7A 2AWNA 4I99A 2NO6A 1S3GA 2RGNC 3DVLA 3VNVA 3P4XA 3K0FB 1MOZA 3AF0A 2H8KA 1NN5A 1KGDA 3B2EA 4UNRA 1KZ7B 2FJUA 1EFCA 2VP6A 4IFEA 2IWRA 3Q8XB 4Q4LA 4DCTA 1WQ1R 2K5UA 5B2ZA 2CNWD 3H4MA 4Q7MB 5G41A 2X77A 3HU1A 3GLGB 2YHSA 3GFOA 4TL8A 2FWRA 5GJCA 2ODNA 4IOKA 2IYVA 1FUKA 1K8RA 2ZJ5A 3QKTA 4ZCMA 1JPJA 1Q0UA 4QG7A 1F2UB 1E2JA 5ELXA 1E0AA 1ESMA 1VCOA 3A8TA 3QXCA 2IL1A 1ZYUA 5H8WA 1BKDR 3IHLA 4KFTA 2Z0MA 5BYKA 3GLHB 2ANCA 1KY3A 5F9HA 2WSSD 3SI7A 5BYJA 3CF2A 1VIYA 2RAPA 2DFTA 3AV0B 4JVSB 3WY9A 4BWYA 1ZW6A 4BLPA 4TL7A 1AA9A 4ESHA 4GMXA 2YWEA 4Q66C 3SJZA 2GK6A 4OKSA 4L9SA 1NVXQ 1P72A 2FSHA 3QE0A 1CJMA 1IXZA 3CRMA 4DKXA 4FI3C 1I4TD 2OO7A 2HF9A 4XVRA 1G18A 4JKYA 5IHPA 3THXA 5EE9A 4QKQA 2GZDA 4PQRA 3QI2A 1XDBA 1E96A 2CHGA 4PPGA 1R4AA 1U9IA 2PH1A 5CB8A 3RHFA 2PCJA 5DYIA 4F91B 3KQHA 4US0R 4Q4HB 1R6BX 2QPAA 3HPQA 4ZCLA 1TU3A 1MABA 1VDZA 4IVRA 3M1IA 1GG2A 3LQQA 4BRWA 4GZLA 2QMHA 4U7DA 1IN4A 4YMWA 2AK2A 2ZRBA 3P20A 4A36A 2O8FA 2FFAA 5FBRB 5L3SA 5DNYB 3REFA 2XTZA 3KZ1E 2C78A 1EFRA 5FPHA 1E9CA 2IYXA 2VP2A 1GKIA 1XF9A 2RGEA 3PEYA 1Q1BA 1XRJA 2OE2A 4GMDA 4US1R 5E7MA 1FMJA 2IHYA 1Z2AA 5EP4A 6Q21A 2J7KA 1N6KA 3PXGA 1E69A 3BH0A 1G1MA 1FX0B 521PA 2J87A 4BFXA 5AJZA 4BFZA 2DWQA 1ZJ6A 4FCVA 4CRWB 1A1VA 4NZYA 2FH5B 1GP2A 1XPOA 3RANA 5JHGB 1JB1A 3H1TA 4A6XA 5BN5A 1DPFA 4PC7A 1NBME 1NVWQ 4RKFA 3UMSA 1XXHA 1Q57A 2ZE8A 2ONJA 3FDIA 3UPUA 3W5IA 1G17A 5J40A 3KXLA 3OIVA 4ZCIA 2B7CA 3K70B 4KAXA 1G3RA 1HV8A 3OIYA 1F5NA 1G19A 2BC9A 5CDFE 1YZNA 3SYNA 5FR2A 4CW7A 2OEPA 1R8SA 1SVSA 5K8UA 1P60A 4GDFA 1M7GA 4ZKDA 1XWIA 2ZRDA 1F6BA 1NLZA 3W34A 1XTKA 3CZQA 1ESNA 5J4VA 4D0NA 3DDCA 1T6NA 2BMFA 1U8AA 1KO1A 1Y63A 3LA6A 5TARA 1SXJB 1IN6A 4YDHB 5E7IA 1N25A 2JJ2D 2QM8A 5AJXA 5KOYA 1ZU5A 3HR7A 2HJVA 2Q9CA 3LX5A 2BM0A 2UVQA 1S2MA 4DB2A 5C4GB 4R2HA 3B1ZA 3T61A 2VL7A 1WA5A 1KKMA 5AJWA 3QEJA 1Z6AA 1OH7A 1RZ3A 2GXUA 4BQSA 4TTQA 3MWYW 5L3VA 1OIWA 3TJZA 3QKRB 1IJFA 3CX6A 4O0MA 3ZLJA 5CJ2A 4C4PA 1G6OA 3QY0A 2ZANA 4WW0A 3I3SR 1XZQA 3HYRA 2KBFA 3ZVLA 1Q1EA 3AEZA 1GDDA 2WIAA 3IBYA 3L8YA 4D4LA 1ZUIA 3KUCA 5DO9A 3TIFA 4LHZA 3S1AB 1OHHA 1VCMA 1Z8FA 5CJPA 2ZU0C 1FP6A 1NIJA 2VH5R 1UEIA 2W83A 4HUTA 4YONB 3AB3A 1TPZA 3AP1A 1KAOA 4B75A 3JVVA 1VG8A 2EFEB 3I4LA 2IS1A 4LWZA 2OSBA 2WOJA 4XWAA 4O25A 4YC7A 3RRNA 3FKQA 3V9PA 4TYWA 1XEXB 4WBSA 4KV9A 4E5UA 1Z0FA 3NBZC 2ZSBA
chains in the Genus database with same CATH superfamily
1OU0A 2YN4A 1SHLA 4C43A 1XX6A 4FHDA 2DSTA 2WJIA 4PHCA 4RADA 4W7IA 3SBXA 1Q2XA 5KJEA 5GIPE 3BREA 3WGJA 4V0MA 3LUCA 3LNCA 3I61A 5EKDA 3G6KA 5CNMA 2IHVA 1GAQA 1QNFA 2WUVA 2PGOA 3L7AA 5IM4A 1GPNA 3OLCX 4J4BA 1OXUA 3IBFA 1QR2A 1JFTA 3E15A 3ZE2B 2P6RA 2HBYA 3AJAA 3CRVA 1KK0A 3IV7A 4M0FA 4NYIQ 1THGA 2Y1EA 3DYVA 4PNZA 4TLBA 4IVPA 4F2PA 3U4CA 2D4AA 1IOLA 2FEMA 2ACKA 2OSVA 2DPXA 4MLPA 3E7FA 4J9VA 5C1DA 3K16A 4AMUA 3ZCRA 3EEFA 5BUQA 4J1QA 3VZDA 1M6YA 4YIKA 1IHOA 1QHYA 3HJUA 4H6VA 4YTEA 4DARA 6REQB 4RCVA 1Z25A 3UEOA 2Y05A 2H4XA 1NNI1 3FLAA 4MHSA 3T9AA 4AFNA 1XA4A 4AROA 4L4SA 4CUKA 2XH8A 2G80A 3VR4A 1XQWA 2FB9A 2GJ8A 5DMHA 1VYUA 4ZT3A 5IN5A 3SEZA 1T6XA 5FUBA 1T43A 2VYCA 4GC9A 1T8RA 2A9OA 4UXJA 4YI3A 3H9QA 3J7TA 5JWHA 1NZFA 4B3RB 3T8YA 3KM0A 1EVKA 3A4MA 3K1AA 2HAEA 3GFPA 4DZZA 3LY9A 3Q88A 2XCUA 2R8OA 4XSGA 1CHNA 4RWZA 4FZ3A 4FBMA 3GGJA 3COPA 4L4ZA 2XE8A 4Z4HA 1JHYA 3NHUA 2X23A 3MT7A 4XFJA 1GUBA 3R5HA 4IQ8A 3P2OA 5F73A 1B8UA 5H7XA 3WFIA 1FRVA 1RCFA 3TNDA 1J0XO 2RI0A 1UBMS 3B9QA 3Q8WA 4C0JA 1XCJA 3QVWA 4ARSA 3LBNA 1I4DD 3H8VA 3ETHA 2DC1A 3TS1A 4BMOB 4DMHA 3O8OB 3HYLA 1P1RA 1XZEA 1ABEA 3OF2A 5IMBA 1U7XA 1PGJA 3VA7A 3UXHA 1SPBS 4N0DA 1EXMA 2XLCA 5DSTA 4CLRB 1E98A 3WP1B 2IHBA 2GUGA 1P1HA 2GB4A 3GYGA 4LI3X 2QORA 1M2OB 4XYMA 2QY9A 4DLLA 1BH6A 8GPBA 5FYQA 1SZCA 2HIMA 1ATZA 1BOOA 1YB2A 2BFEA 2I2XB 4TV9F 4G2TA 4MITA 2ZITA 1F2TB 1EWTA 1QNLA 2NSYA 1LDGA 4L8FA 5T67A 3VDNB 4B3XA 1HL3A 4IW3B 4I6GA 3RVQA 5P21A 4PTZA 3RS4A 1GWNA 2F43A 2Z04A 1CRWG 3ZCSA 3EFOB 5C3MA 1ODTC 3D6MA 4QM6A 4PU0A 1CJVC 2VRCD 4H1HA 3GJ3A 5G3ZA 3SC4A 4XCQA 1M83A 5KYTA 4Q4AB 4QLBA 3L7CA 4RPIA 1GGFA 1IC6A 3MWKA 2CE7A 2BJHA 1UP7A 5BMVF 3NYWA 2ZTUA 1R37A 2V7VA 1SULA 3R0QA 4FNOA 1A9PA 1Y1PA 2CL0X 5TF0A 5IBRA 4ESEA 4ZHQA 4LECA 4DADA 3U3MA 5IJAA 2B4TO 3HUUA 1ZVJA 3AHFA 4RQAA 3WADA 1NW9B 3DBVO 4DSAA 3D9QX 4CV1A 2QT0A 3C1AA 5KNCD 5AVOA 2FWIA 2I67A 5HM8A 3AVWA 1PZXA 4D99A 4Z4FA 4QQKA 2IVFA 4MAFA 1IM2A 4MAAA 1DU4A 3VHRA 4WJLA 2JLYA 3WBBA 5LZ7A 1NJ8A 3DLTA 1XZCA 1NY5A 3NAGA 5KO2A 2X3YA 1X13A 3HJBA 4OY3A 5H0IA 3DAYA 3QUAA 3OZDA 5JE8A 4OHPA 4WASA 4MYHA 1QYCA 1UMDB 1XZHA 1LEHA 4NXNB 1QRAA 1EAYA 1OBOA 2GI4A 2A1IA 3ZU6A 3NJ8A 2ZYIA 2WV9A 1VM6A 4HUQB 2DXIA 1CZNA 4BGIA 4HZUB 4BX0A 1G7SA 4RU1A 3HVHA 4C14A 1DKRA 3Q7TA 2YX1A 2OMKA 2PN1A 4ILEA 1FLNA 2XQIA 2ZRAA 2QE7A 3MOGA 3E53A 1NXVA 5KX5B 4LXGA 3RH0A 4OXNA 3L8HA 2IUYA 5J2TA 2O3SA 1C1DA 1TYBE 4G4SP 1CK4A 3C3EA 2B20A 2XRMA 1Q74A 9ABPA 4FMCF 4ZDJA 5C8VA 1XEAA 3AF4A 4M8KA 2DX7A 1SBQA 2NUAA 5EZYF 5JZMA 2OHHA 2J0VA 3F9IA 3MQ2A 5LZ8A 4Z4CA 1GPKA 2BKAA 1KI4A 2Q1YA 3H2BA 4FYKA 4D0GA 2HT1A 2GN2A 3IE2A 4IMRA 2OFXA 4V3BA 4WEOA 3B48A 1BMFD 4A8TA 3A2KA 3D8HA 5MFZA 2FEAA 3CQ9A 3NHMA 2H06A 4OHRA 4F8JA 4ZEXA 4F3TA 1N2GA 1Q44A 3DLPX 4I19A 4UCFA 1KEPA 1M6HA 2P5YA 1EE9A 3SBEA 3T95A 3VDMA 3K70D 1OJ7A 4KP7A 2FX5A 3VU8A 3RIHA 3D0KA 3NHSA 1KO5A 3MBKA 4AB1A 1ZVQA 3AF5A 2L17A 1QKJA 4Y6OA 5B3JC 2D54A 3BTUA 3F3KA 1AZLA 4DREA 2JLVA 3W5UA 5T3YA 2Q3FA 2ZRGA 3LAWA 1NW3A 2OFFA 3I72A 1N5LA 1O97D 1WX1A 3HKBA 1ODIA 3RK4A 5HUQA 3VHLB 2FSFA 2WKSA 4MQEA 2NU8B 4EIWA 3L1KA 1RPZA 1QRRA 3HKBB 3L1UA 4N3NA 3AX6A 4HGPA 4TXHA 2Y1OA 2F3RA 4N0QA 4Y1RA 5C8YA 3SC3A 4E07A 3EWIA 4R51A 5IUJC 3KB2A 3R7FA 4PSVA 3A36A 3GMTA 4M9ZA 5FPQA 4H31A 2EYUA 4NCIA 3IJ5A 1HE5A 4EMTA 3KXIA 4ZALA 3A6ZA 4DCOA 2ZJ8A 5K3CA 3MTDA 4WTOA 2E4WA 2IWHA 3FI9A 3L2OB 3EIQA 2AUNA 1Z6QA 3O2JA 4IFBA 3T35A 3VR6D 2BEJA 3UXEA 1LI4A 1XVTA 1K97A 1QO0D 2I7TA 3PQ4A 3G2KA 4B2YA 2AZTA 4AXXA 1U1IA 1QH9A 5JJCA 1H66A 2CLSA 4AJ9A 3TCKA 1Z6XA 2Q8NA 4N9WA 3HVIA 5E6RB 2GJ4A 2UUAB 1SU6A 3DXXA 4NYMR 1P1CA 2ODQA 1HTWA 4YT8A 2X0JA 4B3CA 1GKLA 1Y3IA 1NJ5A 1EP2B 4MKXA 2K87A 4ND8A 1IH8A 1T3SA 2C83A 2XVXA 1C41A 3SOPA 4UUAA 2C4TA 1WNTA 3ZHSA 1LB1B 4ENSA 3GELA 3PQ7A 1SUEA 2GLXA 3R24A 4QTYA 4W7HA 2D00A 1QCZA 2K2WA 3RSFA 3N86A 4QYIB 1QV9A 4KWIA 3IPYA 4DA7A 5JATA 3FKSA 1XJ0A 3FTNA 5JOQA 5JMTA 2DY1A 1DRKA 1ORDA 5TJHA 4CMEA 3GQBA 4LXQA 2CL7X 4OP3A 5LFAA 3CLTC 2WM9B 5DYTA 2FPSA 3PDJA 5HCIA 4JU8A 1GCGA 3IPAA 3RG2A 2BMVA 3QUSA 2XGSA 4I9UA 3MJSA 4RTPA 1T9BA 1ATIA 1W34A 3CKLA 4O29A 4UBLA 2VF8A 2CEKA 3PNPA 1CETA 4QXOA 4US2R 2EZ8A 2NIPA 4WXPA 2RSLA 1KR5A 1U5CA 2Q3CA 1DG3A 2VJCA 4ZI3A 3N0RA 1YJ5A 1NW7A 2VNAA 2P5SA 3QOYA 4HPWA 1OI2A 4O63O 3TI9A 5B2EA 3OA2A 2XE4A 5KQGA 1EXDA 3WLSA 2R3SA 5JXIA 3PGJA 5J43A 2YR0A 4WD3A 3STUA 5A4FS 1YIDA 2FZLA 2V7UA 1E9DA 1O8CA 2C1EA 2Y27A 3H1EA 1R8XA 2X7HA 3AP3A 1E2FA 4OAQA 4TSFA 3FDXA 5K0EA 1T5BA 1XL0A 4F2DA 1VL8A 1IN5A 2QMQA 4IJKA 5JAHA 4TRNA 1N7GA 3EXHC 1LPMA 1A8SA 3DW1X 1JPNA 2N46A 1D4FA 1U8EA 3WYEA 5BWOA 1HFEL 1MOSA 3JD3A 4YRCA 3CUUA 1EVZA 4MR8A 1M2VB 1ULTA 3HEBA 4LOLA 3AFMA 4LVCA 1G5FA 4E30A 4ZZ1A 5A7FA 3LIIA 4QHSA 4PHHA 3HXLA 4AS3A 1OB5A 3KEQA 1TK3A 2J32A 3O93A 1IXYA 4FTWA 4PAMA 3EWSA 5EWLB 2R85A 1YZTA 3W5JA 2AF3C 1QRUA 1HG0A 3CXRA 3RODA 4F1KA 1BQ3A 1GIAA 2E48A 1NQXA 1KMHA 2HBZA 2HK8A 2P9CA 1NULA 2J67A 3RK1A 4GOOD 3TSOA 4A03A 3R75A 4NE2A 3E5HA 3KIPA 4RK1A 1ABFA 1NMXA 1ZRSA 3ANTA 3H3XA 3N6RA 3OE7A 1X3LA 3P0HA 4FFOA 4FGWA 4EPRA 2YJTD 1FQKA 3NIBA 1ZNXA 2DY0A 3KXDA 3PI7A 2XMBA 5ADHA 3TEJA 1YRWA 3FCEA 4PAQA 3LFTA 5FI3A 2XLBA 4Z3DA 1OLOA 2EJUA 4CM6A 2H1OA 4KGVA 1FDRA 3WNVA 4BQQA 5IULC 5KYKA 4XUDA 4CMKA 5IJ0B 3OLWA 3RROA 1Y8ZA 1TF2A 1GLVA 2BKLA 4OU5A 4J3FA 5JHHB 2QL9A 1HQDA 2EZUA 2L69A 2Z1NA 4X97A 3AUUA 2JDID 5JI3E 2HB6A 1YDGA 3L6EA 4IOMA 4IICA 1V3QE 2D59A 4OK6A 5AKHA 1E3TA 2ORIA 3ZQJA 4YPOA 1B76A 1IRXA 2EQBA 1C0LA 2HRBA 2VCEA 3DMYA 4KK3A 4ADSG 2I2WA 5SYAA 5IKPA 1NI4B 3TO5A 2W8ZA 4OBBA 1WPXA 4DDWA 4EW3A 2Q50A 3TUJC 2D8AA 4KI7A 4E08A 2FCRA 1LFAA 1Z7GA 4JGBA 4Z49A 3OG9A 1P6XA 1ZVKA 3DFIA 4MW4A 3HI6A 2VYQA 1AF7A 3T9FA 3HJAA 3ZE8A 3OJOA 4YS6A 3QRWA 3H2YA 3ZC3A 1TJ4A 1XF1A 4GQAA 3S44A 4BEJA 4J3NA 5LB4A 1PEYA 5BQFA 2TMKA 3TDMA 4AMVA 2NZVG 3F3YA 1XMJA 1HQCA 2YIVX 4IM7A 3GNTA 4MJ3A 5IZ4A 4BTEA 4FN5A 1LFDB 2W2LA 2Q62A 5H70A 5CDFA 3R3XA 1IG3A 2IUTA 2YW9A 4FYWA 2X1HA 2P11A 4PPFA 1CUAA 4U9HS 4WXEA 2NTEA 3BKXA 3LVBA 4OHMA 5AJHA 1X42A 1TTPB 4TUYF 4C3ZA 5HWSA 1ZR4A 1J39A 2AN9A 4MIKA 5COBA 2B4QA 5BP7A 2ABWA 3MRXA 4Y30A 1ZNZA 2F17A 1AK2A 3AW8A 2CYAA 3QXXA 1AT1A 2NQ8A 5H59A 1K4YA 3SXPA 3EBLA 1OGJA 3KPYA 1P91A 4WZBA 1H2WA 1SQFA 1S4QA 1GNRA 1T6YA 1VMAA 2BHRA 5CXSA 1MDFA 4LOKA 4PBTA 4X6XA 3BMNB 2QMZA 1E9VA 3NG1A 4ISBA 5CT9A 1CY1A 3RAGA 4WVFA 1YFKA 3O4FA 5DTRA 1A9RA 2QP4A 1XRPA 2BVNA 5A6VA 1KQPA 1XZNA 3OIDA 3QLUA 1EVYA 3WBFA 4B79A 2IYFA 1XAJA 1J2JA 4FINA 1QGAA 2BMWA 4R2IA 3HVRA 2BGTA 3LVRE 1L3IA 4CEJA 4FOPA 4QU8A 2JIBA 1AS2A 5FOTA 4TKMA 5F52A 4O2BA 3OC0A 1C8KA 2FG6C 4I5GA 1UOOA 3I9OA 1D0VA 4WOJA 4E5YA 3EISA 1NNUA 1ZUD1 1TVKB 2RARA 3HJRA 1Z68A 1WIWA 1LXCA 5BN3B 6AT1A 1A8QA 4W9RA 1X8LA 2PUBA 4JXZA 2NXWA 3Q85A 3EZGA 3K05A 2YNMD 4LW8A 1FSSA 3PA6A 1Q0QA 2JJ1A 3N2IA 2DCUA 3UJ7A 2FPRA 1FDVA 1W581 3QWFA 4FIZA 2B7LA 1AN9A 4IVNA 5A5EA 1DINA 2R97A 4R2LA 1WUHS 4E22A 2CLHB 3ZV5A 4IDAA 4QEKA 3JQCA 3RTBA 2OQ2A 1FMFA 1KRWA 1ODLA 1RJWA 3RVRA 3FHCB 2XGGA 1XD8A 3I76A 5FWAA 5GZ1A 5K03A 2SECE 3W1WA 1GR0A 1U7DA 4GZMA 5CPFA 3IBGA 5EFZA 4NFHA 1FFGA 3TLXA 4X62B 3K2IA 3NXKA 2RHDA 2RAFA 5KDDA 2YJ6A 3DGEC 3PUJA 4ZOLF 4JT2A 4JVLA 3EB9A 3FOBA 4MUYA 3V4FA 2P9JA 1ZNQO 2YYZA 4N3AA 3VZRA 6PFKA 3FZGA 1JIXA 1P3DA 4G0UA 2PGXA 3KK0A 2ERYA 1KBZA 2OYCA 3WKEA 4JCOA 4XIIA 3WB1A 4K40A 4G1MB 1C4OA 4UM8B 2NACA 3RFVA 3T3DA 1MFPA 2GYVA 3DE6X 1NDQA 3I1JA 2LKDA 5C8YF 3QOWA 1KDOA 2YWGA 3HY3A 3DBLA 2DTEA 1NU8A 4MGEA 5FXMA 5CA1F 2LCQA 2FEWB 1KS2A 3TF5A 4JU9A 4JR0A 3IEMA 1U9JA 4GNRA 5KOJB 1WHSA 1Y6QA 1U1CA 5FTJA 2IHZA 3HDYA 5BRAA 1ZK2A 2BI7A 3U5ZB 1X7ZB 1EFVA 1JH8A 1G5RA 1XTIA 3IJEB 3NHLA 3D2AA 1C1DB 4HV4A 2DUJA 3N8GA 5D84A 4MOWA 2B78A 1NMZA 4FHFA 1J9ZA 4TKUB 1T9HA 2X6TA 3QP9A 1E99A 5HMLA 4JLOA 3CBGA 3IDAA 4LRQA 4MUHA 1SIWA 3AHCA 3BK7A 4QPJC 4YJHA 4RS4A 1UEJA 4A27A 2P41A 2W0MA 5KSOA 4JI4B 1KGSA 1IATA 2MMGA 2BFMA 3F3MA 3GX1A 3I04M 1O94A 3KQWA 5DKFA 3BIJA 2VUSA 1CDEA 1G7CA 3W2IA 1G8YA 3NBMA 3BL6A 4ALJA 1OYOA 2XODA 1TC1A 4ZZ0A 2XADA 3NV7A 4GVPA 3UC9A 2OUKA 1ACJA 1SIUA 2WD8A 4O08A 1C0EA 4O4JB 1JKIA 3LJKA 3LUGA 5CIWA 3KQKA 3N2KA 3AONB 1QO0A 2FSGA 2QQ0A 3DLCA 4R3NA 4RHEA 4YBZA 5HRAA 5HGXA 1YQDA 3LBHA 2AF4C 1RBZA 1W96A 1JQEA 3BWBA 1TEZA 5GJBA 3BF7A 5H1YA 4C88A 1NV8A 1F4VA 2ZB2A 4CDNA 5HKKA 4RH1A 5AJTA 1VE3A 3U81A 3LU1A 3LQ1A 3EW9A 3SQXA 1YQEA 5FHRA 1NF8A 3AR3A 3PE3A 5HX7A 2R7LA 1F3OA 2O1EA 3L0ZA 1TM3E 4H0NA 4BNXA 2XECA 3R6WA 4N47A 5EIOA 4D3DA 4D3SA 5JTTA 1HFWA 1KO8A 2Q27A 3TMAA 4A92A 4H3VA 5IKEA 3KL2A 3MTIA 3VC7A 4HQ0A 4AUMA 4EWLA 1NLMA 2QW0X 1GAJA 3V1UA 3G5UA 3LKDA 1WW8A 4GE0A 5ALOA 5LQKA 3NB0A 2O8DB 2BM1A 2ONYA 3H87A 2E2WA 2VQ3A 3WGVA 1NFFA 5IJ9A 2GJSA 1FFSA 2YWHA 3HA5A 5CDYA 3RIXA 4LF4B 2CSXA 1CG6A 3CZ9A 1BE1A 4BVAA 1U0HC 5GJWC 1CDDA 5IK2A 4TS3A 3ZE6A 2VDMB 3VSDA 1DMSA 1KJNA 2R1TB 5ALMA 5B6JA 3F49S 1AV6A 2M2IA 3WO1A 1OVGA 4PO1A 1C4WA 3CSDA 3URMA 2P77A 3EVZA 3DA8A 4TYPA 2CCKA 1GUAA 1OT3A 4H18A 4LTDA 4BX3A 2HQOA 4MW7A 3TLAA 3QPWA 2VLBA 3EC2A 2CDCA 3G5TA 3KHTA 4WZAB 4FZ5A 3TX6A 3SVTA 3T5MA 4JMPA 3CV3A 3ZNOA 5JQGF 4FI3F 2J48A 4MKIA 2IF0A 1J23A 1FNNA 1YGYA 2NU6A 4GWLA 1U3TA 4X93A 1XD9A 2GCPA 5CVJA 3NM4A 3HKDB 1RHMA 2ZPUA 4UCXA 4IGAA 4UOZA 2VA8A 4BEWA 3QE9Y 4J16A 1N36B 3GRKA 4YJGA 2ZSUA 4CLOA 1YA6A 1GSOA 2FF7A 4NBNA 3U31A 2AJTA 2CJWB 5I8ZA 4MDFA 3ICPA 3EDYA 4E1AA 5JPIA 3CVVA 4DIMA 1W5BA 1JLLA 3OIWA 1TXGA 1Q14A 4LV6A 1RS0A 3JYHA 3K8OE 3ND8A 3SYMA 1YA8A 3K2BA 1DIGA 3L6CA 3IUPA 3WR5A 4AO6A 4EYOA 4BBPA 3DL2A 3UJHA 1RPTA 4ZO9A 5JPCA 2V6IA 4H77A 4HYQA 2IIPA 3CPSA 3ECSA 4M98A 3TGWA 1JR6A 3NVAA 1W4AA 5EE1A 1CJKC 3F74A 2ZWPA 4ZQBA 3EWAA 2HWKA 1Z16A 4WZAA 4FD2A 1X7YA 3HCPA 4K6HA 1AKVA 2E3JA 3DQZA 5TQVA 4DR6B 4PX3A 1R0RE 2B30A 3TPFA 3D6JA 3UO8B 1TIBA 4KR0A 3O1HB 6REQA 4QPDA 3LTNC 3E22B 3L01A 1SIOA 1NYRA 2ANBA 2HF2A 1CE8A 3CBQA 4FKBA 2A86A 4JNKA 4K05A 4K9KA 1GXSA 1X1QA 4X85A 4LYHA 1CUCA 2JIQA 2CVFA 2ZIAA 3UENA 1A96A 2NSLA 3RYHA 4C2UA 2GAOA 1N2JA 4FHCA 1X7ZA 4JXKA 4QYSA 5BVHB 4XEUA 2CVQA 1B43A 3EGWA 3PQFA 4Y3UA 3HKCB 2QNBA 3AXTA 4BFUA 1GZ7A 4BDSA 4CKCB 1TEXA 3GA7A 2OCLA 3QVXA 4ZVMA 1XNGA 1XC7A 4DQXA 3LF1A 1W6RA 3IB6A 4EG6A 2VRNA 3KDPA 4RF5A 5TMPA 1EBFA 1O95C 3AVPA 3PQ5A 5E7JA 4OJTA 2FPMA 1QO7A 2IRWA 4NFLA 3EQ2A 3G5AA 1NUQA 1M66A 1L7RA 1D4OA 3C43A 1Q1QA 2FXIA 1MC5A 2NO4A 4P38A 3GIWA 2HCRA 3R44A 3SFVA 3WYNA 4AQ7A 5ICSA 3CEAA 3NT5A 4P80A 3TFWA 4AJOA 4EHHA 5BR8B 4JP5A 4U39A 4BMPB 2RHGB 3RIYA 1J6UA 2FRXA 2G9RA 4MMXB 1YZFA 3G2LA 1QZ3A 1RP1A 4CKXA 1KYVA 5BN4A 2PDAA 3KB6A 3PFNA 3DZGA 1PFUA 5FFMA 2OHXA 4RIIA 3I6BA 2VPXA 1D1PA 4ID3A 4ZGBA 1JSRA 4JVMA 2XNDD 5EMMA 1WMFA 2I62A 3T1YB 3CUWA 1P2FA 3FZYA 3W2HA 1FQWA 1XN1A 4I1OA 4HDSB 1JDJA 4QL3A 4OQMA 2GEUA 5DP1A 3GR6A 4YRZA 3AIKA 3SGLA 2DG2A 2PQMA 4JJ4A 5HOEA 1V6AA 2C7BA 1QTNA 2YV1A 3NAMA 2VAXA 1SOMA 3AB7A 5BN3A 1EP9A 2R11A 2W11A 2X0IA 3NH6A 2G04A 2BLLA 4C4ZA 2NO7A 1FLVA 1X8JA 3L4SO 3WB9A 3L7BA 4OX9B 1ADBA 2GCOA 3DLBA 1PBNA 3L4EA 3GK3A 3HU3A 5KOJA 4UNSA 4IJQA 4FXOA 3U44A 3VOAA 2TS1A 2O5VA 5SZJA 3DMNA 2Q2NA 3TM4A 2QU8A 4M1QA 1C50A 2LUOA 3F96A 4LNHA 5FBKA 3MSCA 3UKJA 5B3KA 3GJ4A 3V6MA 2N1MA 4K9RA 3K6SB 2NLOA 1L5LA 5HIMA 2B2CA 3JPYA 3AVVA 2P3OA 3PA8A 3EMVA 3PHIA 4H7PA 4G8CA 4D9GA 4DCSA 4DRZA 3JAKA 1DXHA 4WX2B 1B3BA 1IY9A 5L7YA 1NOJA 4OHFA 1EAMA 2PG3A 1CEQA 5JYCA 5JS1A 5IAAA 2QI9C 1KSJA 5KDLA 4FR2A 1RM0A 5A62A 3GDGA 4Y18A 5JS8A 2FETA 3K0SA 4B3IA 1OBHA 4AI6A 4Q9HA 4GM1A 1SC1A 1JKJA 5TRTA 1DE0A 1U9IC 3QFCA 3IDOA 4MVJI 1PAUA 1S02A 1D6JA 2J7PD 3HNPA 4JA2A 5IFKA 3F90A 2E1RA 4H27A 2O8BA 3I4CA 2D1QA 2OVFA 2UZAA 3KVNA 2Z9BA 4LJ9A 4B09A 1IWBB 1J2EA 3LBAA 4R8RA 3TZHA 1ZMOA 2C3UA 2KHZA 5JEEA 5ITWA 1MGOA 3F7OA 3TJRA 3QPCA 3GT4A 4RAQA 4QDZA 3BGSA 1A5TA 1DIOB 1FYWA 1HTTA 1PW7A 3JQ7A 3TRKA 4B7AA 4CEIB 1CW2B 2OOKA 4N82A 1USIA 3E1GA 2O9JA 4CKWA 3STXA 2GCEA 1IUPA 4MCIA 1UAYA 3T7KA 2OFPA 4DM7A 4BLVA 2VQDA 2LIVA 5F2EA 1J25A 2FP4A 4X7RA 5HBGA 3SHTA 1SVOA 1HOXA 2O2DA 3MT9A 4N3GA 3O3NB 3N0VA 3O9ZA 4FQ5A 3PR3A 1BYUA 2MYTA 5CYGA 3O47A 2KB0A 2C8KA 4AL4A 2X2EA 5DB4A 2HZ7A 5DW0A 4JV5B 3FPSA 4QYXA 3PBKA 4X3CA 4MH0R 3W5VA 1SHTX 4QGFA 2R1VB 1EGAA 2WFZA 3G2PA 3I5UA 1FZQA 4Q7EA 2AHRA 2BTQA 3LUDA 4N5MA 1WE2A 2GEBA 4QBIA 5ALPA 2V6BA 4B74A 5IT9A 2LTAA 2Q2QA 1EM8A 2XCRB 3CS3A 3EVEA 3ANMA 4IHJA 4BNVA 1L4EA 2D74A 4P2BA 2EJWA 2GCOB 2J41A 3F8SA 3QLTA 4RH0A 5TXGA 2VO1A 4I9NA 4AYTA 4B73A 4Z1MD 1E20A 4QTTB 4IEFB 1PYDA 2IEIA 4EI2A 2QNIA 1J4AA 4RXMA 2J3MA 5F9MA 1NY6A 2PQ2A 1FXSA 2IHJA 1SCKA 4QXQA 5KCMA 2DH5A 4ZO6A 1ISSA 1UBFA 5I01A 1QKIA 3MEQA 4FILA 4RORA 3AL2A 1CVLA 1OXBB 2AA3A 3K4PA 4PGFA 3V8EA 1UPUA 3CH7A 4M89A 4RAOA 2Y0EA 2X8AA 1K5GA 3FTQA 4HFRA 4U2EA 5E6UA 1RXYA 2ZTVA 5FL7A 4MROA 1B6RA 5C5EA 1ORIA 2R00A 4DXAA 1LZKA 5ALSA 5CLLA 1OAOA 1FLDA 1E58A 1Y3DE 2Q6LA 1OV4A 5AICA 3BUSA 1PS0A 2VK4A 3N8DA 4OAPA 3ZXUB 5AESA 3A3PA 4ZICA 1E3DA 1Z6ZA 5DHRA 4NMLA 2X7JA 4G4SO 3KCNA 3KQQA 4NE7A 1EP3B 1CJBA 2HWUA 2X8BA 5C18A 2BGJA 1RE1A 2LIPA 2QN9A 4OB6A 4Q48A 1RYMA 3NTLA 4C1NA 4ISCA 5IT5A 2GAJA 5JCJD 5MF6A 1ISRA 1U94A 3DFMA 3A9WA 3OJEA 4UHCA 1D2AA 3RFUA 1E61A 1R1DA 1EFRD 4GLJA 3AEQB 2QTRA 2A5LA 1DOAA 2Q7XA 3QFTA 3VHQA 2TSYB 3DTNA 3A2NA 3FJYA 5K7SA 4BV2A 2QN6A 1O03A 5EYPB 4C20A 4P7JA 5EINA 1JAIA 5DK4A 3GFQA 4NECA 5JAMA 2OHFA 5DXJA 1ADCA 2AG8A 2ZTHA 2UVPB 5LQDA 2NO9A 1P4RA 3C5HA 3FVWA 3TSWA 1UFKA 3I32A 1NTOA 4OLFA 1I6LA 4E31A 1YDHA 2H4WA 3VBEA 2EVWX 4FSHA 1JMVA 2WWXA 3PD1A 2OCPA 4NPAA 4BFSA 3NBXX 4DLUA 2DQSA 3QJ5A 3PCXA 1DWPA 2CYBA 2VQFB 4INOA 4N41A 4LRXA 3W5AA 3LQKA 3ORRA 3TD9A 3TOVA 1KI6B 2PBLA 1DRWA 1KNXA 3L0SA 4KGXA 4PCLA 3U7JA 4KHPB 1W36C 3AEYA 3K09A 4K6GA 1X7HA 2XDWA 5CHYA 3C7TA 3ZDQA 1W85A 4NX2A 4A2WA 2H08A 4BFVA 5IT4A 4RD3A 3GVPA 4B6RA 3HXOA 2GPWA 2HO4A 3E4CA 2TECE 4IV8A 3A25A 3NIWA 2P79A 1RWMA 4TKVA 1I24A 3FUXA 4X91A 5FA6A 2C9ZA 2LR0A 5C46F 3CMCO 4WA8A 1D3AA 4MPRA 2XBUA 1P4HA 2WG1A 4R98A 1Z63A 4EG4A 1CZUA 2VCYA 1JMKC 1EXVA 1REQA 4LSMA 1PSZA 1G0NA 2WOOA 2IUSA 4W5WA 3Q5GA 1AK9A 3THYA 1G8HA 3A6DA 1W29A 2UU9B 4OJKA 5EP2A 4FHZA 4JBWA 3MRSA 1VPDA 1QBGA 2CDNA 2H17A 1P9LA 2P69A 3EGDA 4G0PA 4KXQA 4ZARA 3SZMA 2XEDA 4KYTA 3CFYA 4BAZA 3GD5A 2BIFA 5IAOA 3UZUA 1O7JA 4KWHA 4QECA 5TPZD 3BGOS 4FDTA 5HZHA 5EA2A 4OHKA 1G8GA 2J3QA 4CM1A 4V1CA 1XLUA 3OBIA 5IC6A 1ZRNA 3FRIA 2EBWA 5IASA 2B94A 5BV7A 5LOVF 1ZIOA 1GYQA 3E3LA 3DOEA 1ECPA 4OGWA 4UARA 3TIGA 2H1HA 3C3JA 3TE7A 9ATCA 1V4VA 2ZSAA 4QJBA 3D4IA 3GLGE 3IA7A 1I3MA 4FCCA 3WTBA 2WLSA 2QBYB 4N7MA 2JFOA 1BEZA 2PQ6A 4LCJA 1XZDA 4A26A 3ZHTA 1TZ2A 1IBRA 4OD0A 3N74A 5G02A 3KOXA 5DHQA 3GV0A 3V34A 4AJ2A 1FDUA 3G5LA 3G89A 3JQAB 5CEFA 1VZ2A 3ASZA 2Q99A 3PCTA 1ZHOA 4LJYA 4I1IA 1BJRE 1ODCA 4LC1A 3KT0A 1N6NA 1KJQA 1ZMXA 2HYDA 2EZ9A 3M4ZA 3FTDA 3N59A 4HXFB 2P6OA 2VJOA 3AM3A 2FWPA 1XO1A 1R0BA 3B6EA 4QT0A 4BFWA 3ZHXA 1Z5PA 5FBQB 4EQZA 3LGXA 2EEZA 1IMJA 2V74B 3ELYA 1SQ6A 1CP3A 3Q72A 2A58A 3QBTA 5J2TB 2DZDA 2XCTB 1ORTA 4EUFA 1TRHA 2NADA 3TTWA 2MSEB 2UZ3A 3EHEA 4EA8A 4B71A 2I78A 1UBOS 2YZ7A 3X1XA 1EDBA 4GEKA 4QSHA 3CCBA 5EJIA 4BB5A 1IDN1 4LZOA 2FW1A 2V98A 1M34A 3CKYA 2OBFA 4RHUA 1SUIA 2HF8A 2G28A 1YS4A 1Z2DA 4Z9YA 1DKUA 2CVHA 1QRTA 2D0OB 2BONA 2I91A 4DUZB 3OZSA 3QPVA 4F2HA 4ENRA 5BRNA 5JNTA 1NQTA 2CDBA 2HV8A 5GP1A 3V42A 4X3PA 1V1RA 2P4UA 1XRLA 2ZRIA 1C7RA 1JZSA 3FR8A 4QDTA 3QU4A 4GM0A 4HDMA 5H3LA 3REGA 2R8XA 1YE8A 2VBFA 3W06A 3ZU4A 3ZZTA 4BASA 4LFAB 1U0LA 3FNFA 3BIFA 4J16C 3W9SA 3TNJA 3LXMA 2JKVA 4URHA 3T7AA 1Z22A 1SCBA 4N54A 5CA0A 1P39A 4YB8A 3MWGA 3TXXA 3WJ7A 3GEPA 5L53A 3A1EA 1IEWA 2QRJA 5ED4A 3MCWA 2PS3A 4M8NE 2QTTA 3TX2A 2QUJA 3O83A 1V7PC 4Y2UA 3EMKA 1A04A 3N6XA 3MJTA 3QFHA 3TYXA 4AKIA 2FQYA 3GZTB 3C6KA 4UJ3A 1ESZA 4BB6A 3I73A 1VSUA 1Z3CA 2C3YA 4JWTA 4F4UA 2R5NA 5C1PA 3KEOA 4AJLA 3E61A 1OU4A 4AN4A 1G3MA 4HPXB 4TMFA 5FFFA 1G59A 2ZBQA 4QASA 2HA3A 3FGNA 1TIKA 4KIUA 4UMVA 3IKVA 2GKSA 2UAGA 5JWOA 4KXUA 3EA5A 3WGQA 2J4CA 1Q3HA 1T1EA 1JYEA 1MOQA 3QITA 2I2BA 1V3VA 2QZSA 2V7XA 2ZJ3A 2A30A 4GICA 1ICEA 1G21A 4HLQB 4BMVA 3RI3A 3KUDA 3ZQ4A 4RMHA 4D81A 2EFDB 5TPWA 4CL8A 1TJ3A 3IO5A 3OZUA 4N12A 1SQGA 2I2AA 4OQDA 5CW1A 3B51X 2G5GX 4XWKA 1A8PA 1DJOA 2WKQA 2E4YA 1QTIA 1K5DA 1OSNA 1SCUA 2AE2A 3BJMA 5EHIA 4YMLA 1WABA 2YUTA 2OCYC 2X5OA 2UZ4A 3B3GA 2FTKE 1UMDA 1J20A 1E6UA 5FA8A 2QI9F 2YY7A 2IYWA 5KVSA 4D8YA 1XCBA 2W8BA 3LBYA 2JLWA 2R751 5AYVA 1TU0A 2WYUA 5GONA 4DIKA 2CLEB 2F1OA 2QTFA 4HDKA 3VJLA 3AGQA 3VFDA 1MH9A 1EHYA 1QX4A 2N75A 3FTEA 4XWOA 2VJYA 4R2JA 1QSGA 1I80A 2G9QA 3OD1A 5DWDA 4O2BB 1WHSB 2HU8A 3RF6A 4ZXFA 1JQKA 1RBQA 5BMVA 4BPBA 1A0OA 5ADWA 3P7MA 1PNQA 3H3FA 1AA6A 1P6QA 2QUIA 1RKXA 3EXG2 3B9BA 3CR3C 1PJZA 1Z06A 3FFAA 1Z2NX 1LSUA 2ZIVB 3PSHA 4WERA 2N42A 2PKYX 3S99A 3VX3A 4ALKA 5JXWA 3N1UA 2GARA 4G5HA 4N5LA 4D4HA 1Z8HA 3DPIA 3IEPA 4D26A 2QKYA 3HY6A 1YD7A 1SHKA 4OOEA 1J33A 2B34A 2Z2JA 3D3KA 4MS1B 1WG8A 4YCDA 3DLHA 2ZRMA 1VRCA 1ZL2A 3FCCA 5D5PA 4UU1A 1OWNA 4R1OA 3H1PA 4FD3A 5A03A 1PUIA 2Z4TA 3RW9A 3D3JA 4ILKA 1J70A 1GUFA 1Y98A 2EDCA 2ID8A 2R8EA 2IU6A 1DQYA 4IGEA 1DAFA 2VF7A 4ODIA 1KF0A 2ZS8A 2BH9A 3BFKA 4PQEA 3U7QB 2WJ6A 4K9MA 2AZ4A 1MQ9A 2W2TA 3BWYA 4N7BA 2WVAA 1M10A 1Y8AA 4LA4A 4HWPA 4N40A 4P92A 4PV7A 1S2OA 1RZUA 4ZVRA 3HR4A 1R6UA 3NOOA 2N0SA 1JEEA 4HNAA 2QTHA 4IINA 4MX8A 3BXGA 4BNIA 1DCTA 2B82A 1PG2A 2DBRA 2QHXA 3HZOA 4I5EA 4J90A 1EJBA 3LKVA 3DXFA 1NJSA 2RGUA 2PGJA 4N1AA 1I4EB 3RYCA 4CYMA 2QS9A 4IG4A 5IANA 4JN6B 5DGXA 2GHTA 1Y42X 1GZDA 1S2LA 1ZMBA 3GFGA 3BGDA 4QXMA 4FKZA 2OORA 3WQQA 4LF9B 2OLJA 2QUBA 3K1AB 5K0TA 2BGGA 1OLUA 3O1LA 3TLJA 2C0QA 2B69A 4HT3B 3ZWXA 3HN6A 2JJQA 3HB0A 3QVOA 3G0OA 2RK6A 3RT1A 3IV6A 1JAHA 1IOVA 1I2DA 1Z4IA 5G1NA 4UPEA 1HZJA 1XB2A 3HYSA 4NLLA 5JG7A 2PUTA 3I28A 3RAEC 3ETEA 3B1XA 3WX0A 5K8VA 1NXOA 1NHGA 2ZM5A 2VK8A 4F9GA 1O9BA 5IJ0A 5J4YA 3S70A 3RJMA 3OFND 4D3ZA 5CT5A 1NKTA 1U99A 1CF2O 1X80A 4MRRA 5KPJA 3BMOA 1J8YF 3TFOA 1LY1A 4MV9A 4NQZA 1W4RA 4UQOA 1FFEA 2DLNA