The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
136
|
sequence length |
418
|
structure length |
418
|
Chain Sequence |
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb |
molecule tags |
Sugar binding, dna binding protein
|
source organism |
Escherichia coli
|
molecule keywords |
maltose binding-a1 homeodomain protein chimera
|
total genus |
136
|
structure length |
418
|
sequence length |
418
|
ec nomenclature | |
pdb deposition date | 2002-08-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF13416 | SBP_bac_8 | Bacterial extracellular solute-binding protein |
A | PF00046 | Homeodomain | Homeodomain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Homeodomain-like | ||
Alpha Beta | 3-Layer(aba) Sandwich | D-Maltodextrin-Binding Protein; domain 2 | Periplasmic binding protein-like II | ||
Alpha Beta | 3-Layer(aba) Sandwich | D-Maltodextrin-Binding Protein; domain 2 | Periplasmic binding protein-like II |