1MH4A

Maltose binding-a1 homeodomain protein chimera, crystal form ii
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
b'KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords maltose binding-a1 homeodomain protein chimera
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
total genus 136
structure length 418
sequence length 418
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh4A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A01
3KGCA 1DU6A 1OFCX 1A55A 1B5IA 1DTZA 2NS7A 1EZ9A 3QIMA 3TFLA 4YICA 3ZKLA 1I69A 2O7OA 3ILUB 3OMBA 4B4CA 3GBAA 4NF5B 2K9QA 3K2AA 2HAUA 2EH3A 2A5TA 3PU5A 3GZGA 2M8GX 1M5BA 1LSTA 5I56A 3G3IA 1B1HA 2DJNA 3CMYA 1BL0A 1QULA 3FK7A 4F3GA 3NAUA 3LSGA 4C3JJ 1TWFJ 1UTBB 1EF4A 2H4IA 1B3FA 1POTA 4JSDA 2UXAA 1LLSA 2Z8DA 4U4XA 4YB6A 5FHOA 2NXOA 4KYEA 4ISUA 1BTJA 3Q0UA 4V2FA 1I50J 2AIXA 3HKZN 3LSPA 4YB7A 3TCFA 2DMTA 3K6UA 2G0EA 4A3LJ 4X1BA 4G4PA 1MY4A 4FE4A 4AC0A 3CVGA 2UVHA 2XX9A 4RDUA 2Y84A 2VD2A 2VPRA 3C4MA 4PQJA 4KR5A 3FXQA 3WHBA 3IB2A 4ZECA 1MBJA 1PBQA 4JBZA 4A3FJ 3EHSA 2QSXA 5CBSA 3A3CA 1SI0A 3TTRA 5J1RA 2ZYKA 4DXCA 4OWDA 2LVSA 5ICTA 3DP6A 2DOJA 2PYYA 3H6UA 4YAHX 1Y4CA 4LZ7A 1HOMA 3I5OA 3BG3A 2ALUA 3PUXE 4LONB 3JRAA 3JR9A 4IO4A 4OENA 3JRDA 1JJ8C 3A02A 1B72B 3UGWA 1UQWA 3HHGA 3BG5A 3H0GJ 2ZYNA 1ETWA 5F04A 1W0TA 1U9NA 3BR0A 1MXVA 3QYTA 1T33A 2HFBA 2XXXA 1BW6A 4ZEDA 5TPAA 1H45A 1B3GA 4OFOA 2Y7WA 1U9OA 1VE4A 4D7MA 5AA4A 2COBA 2XXWA 2I4CA 4ESWA 3BTIA 1IITA 3KJTA 4XXUA 3S2DJ 5L8DA 2PMZN 4IHVA 1SDXA 1JUPA 1FQDA 3KJ7A 4F1UA 1VI0A 1O4XA 3QK6A 1SW2A 5LOMA 3D1NI 3S9LC 4XTCQ 4Q8RA 2UYFA 4PETA 1FCKA 1M5DA 3O6IA 2O51A 3OEKA 1I6HJ 1NK3P 4IO5A 3TQLA 4M3FA 2VKEA 2L9RA 3PUZE 3C33A 5ICQA 4W97A 5M3FJ 3GBBA 3SESA 4DCYA 5H8HB 1FW0A 2PBWA 1LFIA 2RAEA 1RKMA 1WI3A 4H0WA 3CRBA 4QFKA 2RC7A 1WDNA 4C1UA 2DXYA 2XXIA 4ABZA 2ZMBA 1UTBA 3SEWA 2XSDC 1IXIA 2LR8A 4BDLA 4ZZEA 5H8FA 1RETA 1OLAA 3H6VA 1NNPA 1MBGA 3K6WA 2PX1A 4YB5A 2H1KA 4QF9A 3M4OJ 2CU7A 3K2DA 1ETKA 1Z7NE 5JK4A 1PDAA 4YKKA 4POXA 3IB1A 2PVUA 3FJMA 3O9PA 5IYDJ 1B6HA 2LKXA 4OHNA 1J1NA 1URGA 2CRGA 3RN8A 3RTWB 2NWJA 3G3GA 4YMBA 2XGDA 2L7FP 3Q3SA 4QSDA 3PPRA 3LSRA 4DZPA 4KCDA 1IV6A 1R6ZA 5IP7J 2R5YA 2EZHA 4XICA 2CUEA 2Y30A 1AOVA 1AH5A 3U92A 3V89B 3FZVA 4JYKA 4KYSA 3JRCA 1MBHA 2FD5A 2KT0A 4BBSJ 1H44A 1FIPA 4F18A 1Y1VJ 1FTLA 5I2KA 3T9VA 4G68C 3C36A 3C9HA 4NTLA 1S9TA 1N84A 3ZS6A 1B7HA 4E0XA 4EUOA 1T56A 3MVYA 3JZJA 1LGBC 3OO7A 3HOWJ 1BW5A 2O6AA 2QMXA 3MP1A 4B3AA 2ZNSA 1MH4A 4BDNA 1WODA 2WV1A 1UTHB 2XXYA 1P7JA 3SEUA 2JJ7A 4R6KA 4J19A 4LZ5A 4U1OA 2GLOA 1DPPA 1SI1A 1U8BA 2OK2A 2Q2CA 1USYE 2OWSA 2LY9A 5I59B 1B3LA 3RPWA 4WEDA 4IHWA 3G1OA 4F2QA 2QPQA 4OQOA 1TC3C 2I0CA 5GP9A 2ZNUA 5BUUA 1MM7A 3IL1B 3BBRA 4NE4A 2M34A 3BTLA 1IJWC 4FORA 3S14J 1B7UA 3MP6A 5TU0A 1PC3A 3TP0A 1R9TJ 2AHQA 3O29A 3T9HB 2LK2A 3OSRA 1EZPA 2DA5A 3PMXA 2XX7A 5KCJA 1ORKA 1URSA 1O63A 2P1SA 4WKMA 2XX8A 5FKMA 1OJLA 2HZKA 4BDOA 4NEDA 2OPTA 5FHNA 3LSJA 2AYSA 4GRKA 3MC2A 4L5EA 1LFHA 3IJOB 3MPLA 1AKHB 1SVXB 1XOCA 3ZSFA 5ISUA 5C3EJ 3USDA 5F0CA 4IO3A 2I58A 3LSFB 1DMBA 3K7AJ 4OTEA 4I62A 3OD7A 5IOZA 1ZU0A 4UUTA 5M3MJ 4F19A 1YTVA 3FKIJ 1AMFA 1ETXA 4DDDA 1ETQA 1I3QJ 3UKGA 5E3LA 2E1SA 1IXCA 3TEDA 4GL8A 2NVUB 4E0WA 3KN7A 1TFDA 4A3JJ 2LD5A 5F7VA 1JETA 4IY6A 3TTLA 1ITYA 2YU9J 4ELPA 3TYHA 3QPLA 4H5FA 4H8IA 4XRSG 5B70A 1FTTA 2RINA 5DTBA 2JA8J 2UVIA 3PUVE 2FYIA 3OO8A 2DE3A 4DCXA 3K01A 3JRGA 3VLVA 5CMCA 3BR6A 1NKXA 3G3HA 3ZQIA 3KBRA 1PB9A 2LTPA 2R93J 4NWDA 1JKPC 5JLWA 3FIWA 4KHZE 3RQTA 4IY5A 1MQDA 1FQBA 4RYAA 4KD5A 3JRFA 4EQ7A 3ILTB 2HOTA 5HODA 2Z22A 3WAFA 2NVQJ 5IPAA 3BFTA 1Q35A 2EZLA 2QL3A 2B65A 4O3BA 4QFNA 1HF0A 1AL3A 2H98A 1SYIA 2MW8A 4M3GA 2OCUA 4Y7NJ 4MO7A 1TWCJ 3TEPA 2ONSA 1ETVA 4LP2B 3OEMA 3A01B 3UN6A 4DXBA 1Z7ME 3S4UA 4RPOA 1Z0XA 3CG1A 2OWTA 1LE8A 5M5WJ 3B6AA 4BDMA 4S0HB 3MZ9A 1VR5A 3RUMA 1H3DA 4ZDMA 1FQFA 1PBPA 2P81A 4I76A 1A54A 2CQXA 4ND9A 1CE2A 5GPAA 3S16J 3B7DA 1FJLA 4GL0A 4NMYA 5M5YJ 4X6AJ 1M5CA 2DVZA 4ELQA 2E1OA 1DPEA 4ZE8A 4F3PA 3IB0A 3Q27A 1XHYA 3KZGA 1JVYA 2Z23A 2JA6J 3HOXJ 2GH9A 4EF1A 4XKQA 3RZDJ 5L9OA 3Q26A 3KG2A 2N8GA 3LOCA 2MG4A 4FISA 1H43A 5AA2D 3HN0A 3PD8A 1IRZA 4NWCA 1AIVA 3VV5A 3ZQCA 1JTXA 2ID6A 3IORA 2XGEA 1SBPA 4FEDA 4P0IA 1ZJLA 3AXFA 1JGGA 4LVQA 3VPRA 4JDFA 1N3XA 3MVXA 1Z77A 5IYBJ 4OVJA 2HI3A 2OJTA 1SQYA 4WXJA 3Q29A 3V83A 4GIZA 2JA5J 1QKBA 3QSLA 4OFJA 1L5TA 1M5EA 3OOAA 5EYFA 3T9XB 1UIUA 3C31A 3LNQA 3UIFA 3GTLJ 2YLNA 3IOUA 5DS9A 4EDPA 3CFXA 1D4NA 2DMUA 4JSOA 3HOVJ 1LAXA 4Z0IA 4EQBA 1OCPA 4F1VA 5ITOA 1MBKA 4C0RA 4IHYA 1H76A 1MPCA 2IEEA 1UIVA 4XRMA 1IDYA 4C3IJ 3KSJA 1ZBMA 4IHXA 4FE8A 1NK2P 1Y1ZA 3VLWA 4BXXJ 3RNNA 2DA1A 4QFPA 3CQZJ 3A01A 2NVTJ 4JP0A 4GWOA 3D4GA 3HHFA 2YPNA 4YU0A 2DE2A 3CI8A 5EG0B 1QVSA 2R5ZB 4TQUQ 4PFWA 3VVDA 2WKYA 4LQ2A 1MRPA 2AO9A 2R71A 1SD3A 3W9WA 3FXUA 3ZKKA 3IOTA 1GR2A 2V3TA 1OVTA 2QJEA 1BP5A 4ONYA 2XXVA 2Y0SN 2JN6A 3HO7A 4M1VA 1GTKA 1LBCA 2QMWA 1U78A 4ZS9A 1ZTYA 3MWBA 2DP8A 1FTMA 2GRVA 1NH7A 2ZNTA 3KOTA 2DWAA 3H3GA 3LSXA 2ECCA 4M3DA 5F1JA 4H67A 3FVOA 4GF8A 4M4GA 1P1OA 2JWTA 3MBPA 4U22A 3PO2J 1K83J 2G29A 2ZYOA 4HS7A 2E0SA 4W1UA 3BT9A 4MFDA 1Y9UA 2DWJA 3I3VA 5E3OA 4R72A 3QQAA 2H8RA 2VP1A 1UG2A 2I49A 3O6GA 1ATGA 3CSGA 4MBPA 3IOVA 2ZB9A 1I6AA 3JV9A 1ENHA 3PUYE 1TFAA 1PB8A 3FATA 1CQTA 3THIA 4QIWN 3DM0A 1I6BA 2XXTA 1Q1KA 2L7ZA 2I4BA 3S15J 3PGFA 1HCRA 3A3UA 2RKMA 3RGYA 3S1MJ 1MDQA 4GQOA 3LUYA 3O66A 4A3EJ 2ME6A 1Q1VA 3U72A 2D5VA 3ZQGA 1PUFB 1US5A 1FQCA 2DSFA 3N26A 4WEPA 1A7LA 2V3UA 3IH2A 1BJZA 1ZKBA 3WHCA 1P1QA 4NF5A 1WH5A 1H88C 1F43A 2X7QA 2ANJA 3PUWE 2NUVA 3LSWA 5IP9J 3BR1A 4JX4A 4KI0E 4FEBA 3EPEA 1MNMC 2TCTA 1B4HA 1NNFA 3MPKA 1P1NA 2H99A 5EG0A 2YUSA 3H7MA 3LR1A 1ZQ3P 3O28A 2IEKA 4F3SA 1B8IB 3PO3J 1N04A 2AL4A 3IOWA 3Q0WA 2NVXJ 3HM5A 1RPWA 2B3BA 3H03A 1WVJA 4RA1A 4LOCA 3IJXB 1ZMGA 4X1DA 2HCAA 2F6GA 3IO4A 3UORA 3VE1B 4NF4B 2E2HJ 1H8AC 3IK6B 5ELVA 1IQ7A 4OXVA 1GDTA 5EDNA 1IXGA 3EF7A 1B40A 2O9LA 1JT0A 3B6TA 1EU8A 2DVCA 1HDPA 1R9LA 1IDZA 1MQGA 4G2ZA 5EF6A 3TELA 3S17J 3VLUA 1MSFC 3ZQHA 3HOZJ 3TQWA 4A3BJ 1XT8A 2H9BA 5C4JJ 1G2HA 3MVZA 2DWIA 3S9MC 2NVYJ 3CR9A 2ZYMA 2HDDA 4GXAA 3MQ9A 1RKTA 5J1DA 4M3BA 1B72A 3G1LA 2FA7A 3MZBA 2RF1A 4OYVA 3I4NJ 4C2MJ 4QSCA 5K7ZA 1LB8A 3C32A 1OIBA 1D9VA 4R9GA 3RTFB 4KCCA 3L6HA 4HCWA 2FNCA 1XVXA 2RCAA 5GPCA 3PM1A 4LZ8A 3NARA 3Q28A 5I58B 4R2FA 2XRLA 3TW7A 2OF7A 4G77A 1S7EA 4TLLB 1FTOA 1X2MA 1RR7A 4RY1A 2X6OA 3VVEA 3E3KA 1TT1A 3OSQA 4P11A 1SFOJ 3RT8A 3VXCA 3CFZA 4U23A 4BKXA 2CZLA 4B1RA 5AE4A 1B5HA 5H8SA 1NMUA 2DS9A 5DVIA 4EEFG 1B0HA 5H8HA 4BBRJ 4MIMA 4DZJA 4UACA 3B6WA 2RCBA 5E3NA 2HAVA 2V25A 3G3FA 1GVCA 2I6EA 2I10A 2I3VA 4BDRA 1K61A 2Z8FA 2MGQA 2GM4A 4UA8A 4DYRA 4IEJA 3E4RA 2R6GE 2W7YA 4D7NA 4H8JA 1N76A 1WH7A 1A99A 3Q25A 4BY1J 1MH3A 1Y20A 5K2XA 2FX0A 1MQHA 1CB6A 4NF4A 1DOTA 2F97A 3TUSA 4N07A 1MDP1 1H89C 1LCFA 3O8HA 2XB0X 4RXLA 2H25A 5CC2A 2M9HA 5I2NB 3A09A 4U2RA 1JKRC 2BJJX 2LAOA 3O97A 1JKOC 3G1MA 2E19A 3OSFA 4NF6B 3TKDA 2D5WA 4YKJA 2UVGA 2V93A 3S9EA 5F27A 1WGXA 2JK3A 4R9FA 4MLQA 2FQ4A 1TWGJ 1LBBA 1N7WA 3JRBA 1B2HA 2M8CA 5AA1A 1LAFE 1FQEA 3ECRA 1P7IA 4AQ4A 2ECBA 3SEYA 3H06B 1A40A 3S1QJ 2DA4A 4GXSB 3EN3A 4BY7J 1Y3QA 4C3HJ 4FE7A 3V5AA 3R7XA 1Y3NA 1EH3A 1IGNA 3JRHA 2XPUA 1D5YA 5FKNA 2CUFA 5C44J 3HV1A 4XKRA 1QUIA 3K1PA 3GTOJ 4JXIA 4MH5A 4QFLA 4F31B 4ZE9A 3FVGA 1VF9A 4TOZA 1XC5A 3IV5A 2NOOA 1UTHA 2GBYA 5EGOB 4QRZA 4A3MJ 4FJPA 5M2VA 4BLAA 4GOTA 3V8XB 1JEVA 1MSEC 5A5XB 4XIDA 1QJMA 5JEIA 1FEXA 5I59A 1RYOA 2DA7A 4ZZAA 5E3MA 3RLFE 5AA3A 1IIWA 3P7IA 1DTGA 2DXRA 3MZ1A 4DIGA 3ZQLA 4EXKA 2Y31A 2K9NA 2REGA 3BTCA 2KLFA 4ELOA 4QTRA 2K9SA 1W0UA 4G8HA 4A3IJ 3VDFA 3JYRA 2IA4A 3HOYJ 2QS3A 3FV1A 3C2BA 2V3QA 3ODBA 2Q88A 3GTPJ 5I57B 2FJ1A 4G8NA 3UA8A 2DMQA 5I56B 1JW5A 2VHAA 3EHUA 1Y3PA 4R75A 4GD5A 5CMBA 2L7MP 3GTJJ 4KFQA 3C35A 4EF2A 1UHSA 5F0HA 1GUUA 4ESXA 2VD3A 2X7PA 3MP8A 2AL5A 2Y9YA 2O1MA 5FHMA 1GT0C 3PMVA 5HM4B 5JTYB 1AKHA 4JWXA 1ZK8A 1RESA 4AYBN 2QS4A 1OCTC 4PP0A 3RZOJ 1TXFA 3E7LA 2KDZA 5I2NA 1F9BA 1Y1WJ 3U1OA 1N7XA 4NF6A 3MVPA 3PPPA 4ZEBA 1SW5A 1VFCA 3FD3A 2F8DA 2O7IA 4FIMA 4JWYA 1YAEA 2O1LA 2R9JA 3KOSA 2B3FA 2I48A 1XC1A 2HOAA 1FIAA 4EXLA 2REJA 2W48A 1HLVA 4DZ1A 2LFBA 1IUFA 4K3FA 1S7YA 2D3IA 3TP3A 1B1XA 5FTIA 1GVDA 3M3LA 2CJJA 4CYCB 1D9YA 4KYDA 4Z7EA 2DE4A 3G3KA 3T93B 3RQIA 1GV5A 2LP0A 5C4XJ 3OELA 4BDQA 4XK4A 4DYCA 3O6HA 1MM6A 2M0CA 3FXRA 2PT2A 2VOZA 3TDJA 3MJNA 5IKBA 5EGOA 5H8NB 2MSYA 3I6VA 5EHMA 1QW0A 3T96B 5H8QB 3DEWA 4N6PA 1XVYA 5AA4B 2Y7RA 4I6ZA 1ZGWA 5FKOA 4YMAA 3S2HJ 3PPNA 1MXYA 4A3CJ 1M5FA 3BR2A 1ZR4A 3F11A 4N13A 1XS9A 1B4ZA 3ONMA 2UVJA 1ETOA 3IH3A 1OQHA 3SDFA 4XKPA 1NTCA 3OO6A 4UUSB 5F1QA 4POWA 3WAEA 4OZ9A 3O2AA 1YCJA 2HQ0A 3ZQFA 4RBOA 3SEVA 1VFEA 5IOYA 2V84A 4PFUA 3Q0VA 1ANFA 4EQ9A 3CG3A 2F7AA 4D5FA 3FGSA 1JW4A 3TW6A 1B46A 5CMMA 3SETA 4OESA 1BKAA 5L9MA 3UP9A 2XXPA 2X48A 1B5JA 3OIOA 5I57A 5TP9B 4U4SA 3EHTA 4THIA 2O84X 4IO7A 1T0KA 5K7HA 2K40A 3T9UA 4M3EA 1MG1A 2ONRA 4FATA 2D21A 2PT1A 1SANA 3QAXA 1POGA 5H8FB 5JTYA 2WB1N 1HSEA 4RPNA 1MQJA 4R6HA 3M3FA 1OQGA 2Y9ZA 3MUQA 5B7DA 3S1NJ 4I1DA 4RK9A 3MN2A 2DN0A 4U21A 4A3DJ 2GHAA 1FTKA 3PD9A 1Y1MA 1BIYA 4H6DA 5EEAA 3HGYA 4H65A 3H6TA 1P1UA 3K6XA 1LCTA 1B58A 2IAIA 3TMGA 4U1ZA 2RC8A 5KDTB 2XHDA 2WAQN 1PEBA 5EZHA 2EZIA 2R5YB 1YRNB 1VFDA 1X58A 2A5SA 5K7FA 4CYCA 4G68B 1MY2A 2EBIA 4R6YA 3C34A 1VNDA 2M2EA 5EHSA 1PB7A 5I2KB 2ZXTA 2Y7IA 3PMWA 1GGGA 4F22A 3HEFA 3QPSA 4PFTA 3I4MJ 1NNKA 4QFOA 4GFRA 2QRYA 1TWAJ 1JW1A 1R9QA 5H8NA 2XXQA 1QVTA 3FASA 2IBDA 5H8QA 4LATA 3S1RJ 3DP4A 2HOSA 5FLMJ 3FJGA 4DXUA 2XXRA 4HNVA 2LLKA 5JLXA 3U94A 4F3BA 1JTYA 2QS1A 1WCMJ 3MAMA 4AB6A 2NOGA 4QHQA 5CMKA 2ID3A 2DQVA 4UUSA 2E2JJ 2NS8A 5FLVA 3HB9A 4H5GA 1QUJA 1X2NA 3KSXA 5KZTA 1RYXA 3HOUJ 1MY0A 4G12A 2TRTA 1MBEA 3B6QA 4FECA 4IGTA 2R5ZA 4OEVA 4PFYA 2X9DA 3DCFA 2QS2A 5I84A 3W9VA 4F29A 3CSBA 2R0QC 2XD2A 5TP9A 1IXHA 4JX5A 1IG7A 3RT6B 4JB7A 2ESNA 1ZR2A 5KCJB 4TLMB 3HCQA 3BTJA 5BWJA 1HDDC 3SKPA 3CDLA 3RY3A 1QUKA 3DP8A 1B51A 3BQZA 3OO9A 5J1YA 3OSGA 4OEUA 3U8QA 4QSEA 1A5JA 3K02A 3MVWA 2EZKA 3G7WA 5L9SA 1DU0A 2HQ5A 2G93A 3IX1A 1B3HA 4L17A 3SFIA 1JT6A 2O8KA 3K6VA 4FCYA 1P99A 3QXMA 2JA7J 3F0CA 4V2GA 2P0SA 1MS7A 3LSLA 1GV8A 2F7BA 1OMPA 1RKWA 1JEUA 3GTKJ 1HSJA 2GHBA 4GVOA 1LB9A 4XKNA 5BNGA 1MXWA 5KDTA 3KFMA 5IYCJ 2Q9TA 3S2VA 5DTDA 1YRNA 2Q89A 2ABHA 1ZKGA 3GTGJ 2F5XA 4G68A 2O7UA 2DMNA 2Q8JA 3R6UA 2VKVA 1FQAA 1B0LA 3E13X 1LFBA 2F6PA 2CQQA 2PMSA 3N6UA 3PPOA 5HPQA 1E3OC 3KEIA 2Z8EA 5FJ8J 1BA5A 1N0TA 1P1WA 3LBSA 3SERA 2XXUA 1SW4A 2L0KA 1JUMA 1I6QA 1O64A 3SJMA 5IAIA 3TTKA 1PUFA 1LAHE 3BR3A 1LFGA 1SYHA 3VFJA 1NL5A 2F78A 4MLVA 5J3LA 1B32A 3BG9A 3OOUA 5DEXB 2XB5A 4YKIA 5CBRA 4GFBA 3GTQJ 4R2BA 4QSHA 1WPKA 3T22A 4O3CA 4ECFA 3BKIB 1ELJA 4X48A 3HBLA 1UMQA 4R73A 4ZEFA 1B05A 4LUBA 4AUXA 3CFLA 2F7CA 1XG1A 2XPWA 1QVUA 2EQRA 1APLC 2R92J 4Y52J 1TWHJ 4X1EA 3N94A 1B8IA 3MW0A 3OXNA 1MPBA 4C1TA 2VI6A 3H4ZA 4F39A 3JREA 1GV2A 1R1NA 3GXAA 3SEXA 3M8UA 3GTMJ 1LE8B 3ZOBA 5FKLA 3GLBA 4MLOA 2HZLA 1JNFA 4IO2A 4KPTA 2O68A 1A8FA 1ZLQA 5CM6A 3CCYA 4Q5TA 4Q30B 4HTGA 5DVJA 3K1MA 1IEJA 1KWHA 4ELRA 1JJ6C 3FIRA 1MXZA 1II5A 4LQ5A 4MFIA 3UK4A 3W15C 1LFUP 1JQFA 4HCYA 4YKPA 2F36A 3OENA 4PE5B 4A3GJ 2OLBA 3E9XA 1ZIUA 2Y2ZA 4YZZA 3TTNA 1TWYA 5DVFA 1HSLA 5CRYA 2B63J 2R7ZJ 3TCHA 2DWHA 5AA2B 3FJ7A 1URDA 1EZOA 1LAGE 1SW1A 1YPNA 4F2OA 4FTHA 4D5CA 5F08A 3M3KA 5ITPA 4XRSA 1MY3A 1B7ZA 3TPAA 3JRIA 1POY1 2RC9A 4ZEKA 1AHDP 4MFEA 1F36A 2QCOA 3TCGA 1NH8A 4RJZA 5I58A 3BFUA 1S50A 4OETA 4MF3A 3HSTA 3K4UA 1JUSA 3VVFA 1QRYA 4KQPA 5EYRA 4RK2A 1ETYA 2XXHA 3IAZA 3H6WA 4H1XA 4NF8B 2HXWA 3D4CA 1MPDA 2F34A 4F1YA 4NDLA 4JX6A 3A03A 1MQIA 5DEXA 1QPIA 3QUFA 2ONKE 1FTJA 4DLDA 3BR5A 3DLNA 3FVKA 2E2IJ 5M5XJ 1US4A 3H3VK 1A8EA 2XPVA 1IUDA 1MXUA 3EQ1A 1QKAA 1Y4TA 3HDDA 1USYH 4X9TA 5EZGA 4O3AA 4M6VA 3MKLA 3IO6A 2A5TB 3HGGA 2THIA 4DYQA 3RKQA 1NNTA 1A6IA 4JWOA 4A69C 1IZ1A 2DA3A 1B9JA 4HW8A 2ME0A 3FISA 3FVNA 4OERA 1OLCA 2DTZA 2XGCA 3W6VA 3IR1A 4OFLA 1MBFA 1N3WA 2HXOA 4P0GA 3SDGA 1BLFA 2F35A 2P2AA 3O8GA 4GLIA 4Q0CA 1ZTRA 3QUJA 2DYXA 2HXIA 1JVXA 3N5LA 1DSNA 4R74A 5FKKA 5FTHA 1XS5A 3FUZA 2X26A 3TZAA 2YS9A 4DW6A 2XD3A 4FAJA 2O69A 4IGRA 3R26A 4LA9A 2DA6A 1O7TA 9ANTA 3CIJA 1FTZA 5IP6A 1D3KA 4AB5A 2Y7PA 3FK6A 3K1NA 2Q2AA 2OZZA 4ZEIA 3PPQA 2CMOA 3L6GA 5CI5A 2Y7KA 2ELKA 1NFTA 2QF7A 1MY1A 3S9NC 3PV0E 2I3WA 5DT6A 4OMBA 5DYHA 3U93A 5AA2A 5HBCA 1B3EA 2GFEA 3FV2A 2VGQA 5K2YA 4DE8A 3T66A 3L1PA 2VUMJ 3VXBA 4G8MA 1VSOA 4IB2A 4A93J 3B6CA 3BQYA 3TAJA 2I0BA 4I8CA 3K00A 3GBGA 3TODA 5F0FA 3KN8A 4XIGQ 1JKQC 2JMWA 1IC8A 2YJPA 2OBGA 4A3KJ 3G3JA 4RNSA 5J1UA 5TPAB 2HEUA 3IH4A 3DELB 1B52A 4NF8A 5A5XA 3LC8A 4I9DA 3M3YJ 4IO6A 2DMPA 3K0VA 2HYJA 2H5YA 1AU7A 3N6TA 3TTMA 1MXXA 1OVBA 3HPIA 2UYEA 3KN3A 2DA2A
chains in the Genus database with same CATH superfamily
3KGCA 5HDNA 4XNFA 1OFCX 5JI6A 1DU6A 1A55A 2NS7A 4I0BA 1B5IA 1DTZA 1EZ9A 3F72A 3QIMA 1CF7B 2OCEA 4B44A 2V4JC 4N4NB 3LV0A 4YICA 4P9FA 1I69A 3TFLA 3ZKLA 2O7OA 3CC4I 2K02A 3ILUB 5H20A 3OMBA 5H6QA 4B4CA 3DBLB 3GBAA 4NF5B 1T95A 2RQQA 2E7XA 2K9QA 3VWBA 4XONA 2WBBA 1WZ2A 3K2AA 4KIBA 3GZ5A 1KA0A 2HAUA 2EH3A 2A5TA 3PU5A 3GZGA 1YZ0A 2M8GX 2JUCA 4J00A 1M5BA 1QHGA 1LSTA 1P4AA 2E71A 2ZSIB 3G3IA 4PAFA 5I56A 1B1HA 2CYYA 2DJNA 1RUNA 1IRXA 4A0XA 2PBIA 1YG2A 4DIQA 3EPZA 3CMYA 1BL0A 1QULA 2QFLA 1K78B 5IZZA 2G7UA 3CP2A 3FK7A 3NAUA 1VQ9I 4NF0A 4F3GA 1D0YA 3LL7A 3OWTA 3LSGA 3VYSB 3T0YA 4C3JJ 1TWFJ 3WTYC 4HYEA 1UTBB 1EF4A 4IHSA 2Y48A 1B3FA 2H4IA 1POTA 4JSDA 3RSNA 2UXAA 4GX3A 1LLSA 2Z8DA 4U4XA 4YB6A 5FHOA 3OYNA 4FX0A 1Y56A 1TNTA 2W1OA 1HXDA 2A68F 2NXOA 4KYEA 4LG3A 4CHUA 3GFLA 3AG2H 3PNYA 4ISUA 1K9YA 1BTJA 5DYMA 1XI6A 5F24A 1I39A 3Q0UA 4V2FA 3FXOA 1I50J 2AIXA 3HKZN 3LSPA 2GA2A 2MD0A 4YB7A 3TCFA 2DMTA 3K6UA 2G0EA 4EJWA 4A3LJ 1YW9A 3DEEA 4X1BA 1P2FA 1P92A 2A5YB 4FE4A 4AC0A 2D1VA 1MY4A 2UVHA 2XX9A 2ZXWH 4RDUA 3CVGA 2Y84A 4L5JA 2VPRA 2VD2A 3C4MA 4IF4A 4KR5A 4PQJA 3FXQA 3WHBA 2KP6A 5FRNA 3IB2A 4ZECA 1MBJA 1PBQA 4MAGA 4JBZA 4A3FJ 1LEVA 3PSFA 3EHSA 1P4XA 3QYEA 1S29A 2VQGA 1LEBA 2QSXA 1SFXA 3D5SC 3MZYA 2Z9OA 5CBSA 3A3CA 1YITI 2M4KA 1SI0A 3TTRA 5J1RA 2QSFX 5LDZA 2ZYKA 4DXCA 5B3SH 4C2UA 4OWDA 2LVSA 4PFBA 5ICTA 2Z1DA 3SQNA 4GX4A 3DP6A 1E3HA 2DOJA 2PYYA 3H6UA 3SEQA 4KITB 4YAHX 1Y4CA 4LZ7A 1DUXC 3GO5A 1HOMA 1Z1DA 3I5OA 3I9V2 1PJRA 3BG3A 2ALUA 2F48A 3PUXE 4JBAA 1JHFA 3JRAA 3JR9A 4IO4A 4LONB 4OENA 3F8BA 3CCEI 2L4AA 5FLXZ 3JRDA 1QGPA 1SAUA 3CP8A 4FHTA 4BJ6C 4C9YA 3A02A 1JJ8C 1Y0NA 4ASNA 2LC2A 3HSEA 4EGYA 1B72B 4XFEA 1QGXA 1MY0A 1ZREA 3TYHA 1UQWA 3HHGA 3C2GA 2EIJH 3BG5A 3H0GJ 1R5HA 4LITA 4CCJA 3OS2A 4ESJA 5TRDA 2ZYNA 1FBPA 4XLEA 4B8XA 2XDVA 1ETWA 5F04A 1KU2A 5HDKA 1W0TA 1U9NA 3BR0A 3L9FA 4OIPF 2HPIA 4IQ4A 1MXVA 4NQWA 3QYTA 4XEQA 4BE2A 1T33A 2IVMA 4LLGF 4ZZLA 2VE9A 2HFBA 1S3JA 2XXXA 1BW6A 2A61A 1USTA 1T39A 4ZEDA 5TPAA 1H45A 1B3GA 3A29A 4OFOA 1T2KA 2Y7WA 4BXUA 2O61A 2F5FA 2BYVE 2OQRA 3RCOA 1U9OA 5B5EC 2QEXI 1KA1A 1VE4A 4N0BA 1V5GA 5E79C 2COBA 2F2EA 5KCMA 2IGMA 4D7MA 2XXWA 5AA4A 2I4CA 4ESWA 1BIBA 3BTIA 1IITA 1BBYA 2X0LA 4D9JA 4A0ZA 3KJTA 4XXUA 4PJMA 4GWZA 5HS9A 3S2DJ 2QENA 5L8DA 2PMZN 5HOOA 4IHVA 1SDXA 2E60A 1JUPA 3FXLA 3IKVA 1A35A 1FQDA 2L02A 2PQ8A 3GFMA 1KZHA 3KJ7A 4F1UA 1VI0A 1O4XA 4XORA 3QK6A 3V4GA 1EYJA 1SW2A 5LOMA 3MSTA 3D1NI 3S9LC 4XTCQ 1LEAA 3K70C 2JSPA 4Q8RA 2XV4S 2UYFA 4CCOA 4PETA 4G6TB 1FCKA 1M5DA 2B7EA 1IN4A 3O6IA 2M7BA 1B9MA 2O51A 4B09A 3OEKA 4MNUA 1NK3P 1I6HJ 3DWLE 4JK1X 2WX9A 4IO5A 3OL4A 4M3FA 2VKEA 2L9RA 1CF7A 3TQLA 2KQRA 3PUZE 3FMSA 3TMOA 3C33A 5ICQA 4W97A 5M3FJ 3GBBA 4I09A 3SESA 4DCYA 3FXKA 5H8HB 1JGSA 3OYIA 1FW0A 2PBWA 3OYKA 1LFIA 2RAEA 3DPLC 3HTUA 1LVKA 2PJRA 5D5VB 1ZG1A 2HOEA 1RKMA 5FO5A 1WI3A 4H0WA 4PSXA 2STWA 1VDWA 3MMYB 3KZIC 3CRBA 4EQQA 4QFKA 3EETA 5HLGA 1K78A 1MZBA 1S7AA 3LSTA 1SFEA 4MEVA 4I2OA 2RC7A 3DTKA 1UHMA 1D3YA 1WDNA 2DODA 4C1UA 2CQKA 2LSOA 4ABZA 2DXYA 2V1DA 5D5UB 1UTBA 3G73A 2XXIA 2ZMBA 4PDDA 2XSDC 3SEWA 3IRRA 4MNCA 3ZCOA 1IXIA 5ET7A 4CICA 2LR8A 2MA3A 4ZZEA 4BDLA 5H8FA 1RETA 1HA8A 1AA7A 1OLAA 4GBVA 3H6VA 1NNPA 1MBGA 1W4MA 5LD2C 1IN6A 3K6WA 2PX1A 1J75A 4YB5A 1V5EA 2HTJA 1KYZA 2IT0A 3ECHA 3T8RA 2H1KA 1IMAA 1V5FA 1IRFA 4RA1A 4QF9A 5GAGJ 3HHHA 3M4OJ 4MNIA 1ZN2A 2OZUA 2CU7A 3GX4X 1NV5A 3V42A 3IL2A 3K2DA 1ETKA 5FFZA 1Z7NE 5ET8A 4GXOA 5I3SA 5JK4A 4U0WA 3TOBA 1K6OA 4ZTFA 1PDAA 2PLYA 4YKKA 2XSJC 3REOA 2P7CB 3ML6A 3IKTA 4POXA 3IB1A 2PVUA 3NEUA 3TO7A 3FJMA 1B4AA 4XSZF 5IYDJ 3O9PA 3WTWC 1B6HA 5AIPA 4IKFA 3BJAA 2LKXA 4CXFA 4OHNA 1J1NA 2MLKA 2CRGA 3S93A 1URGA 3RN8A 3RTWB 3AG3H 2M87A 1FBFA 4NQ8A 2NWJA 3Q9VA 3UR3C 3G3GA 4YMBA 4EGZA 2EV5A 3C1DA 2XGDA 4WXHA 2L7FP 2L3DA 3Q3SA 2Z5UA 4NB5A 2NNYA 4QSDA 3PPRA 1VQNI 3LSRA 4DZPA 2OV7A 4KCDA 3KP6A 2MH9A 1IV6A 2R7DA 1R6ZA 5IP7J 5A5LA 2R5YA 2EZHA 3WU1B 3EYYA 4XICA 2CUEA 2Y30A 3K4BA 3B73A 1AH5A 2CZKA 1AOVA 4XN3A 2IP2A 3U92A 1VQPI 4CZCA 3FZVA 3V89B 3CESA 4JYKA 4KYSA 3JRCA 2O0YA 1MBHA 2FD5A 2KT0A 2D2WA 4BBSJ 3CCLI 1H44A 1FIPA 2Y0SA 3ZMZA 2JUGA 3L2VA 4F18A 1Y1VJ 1F5TA 1FTLA 4LB5A 4IR8A 5I2KA 2E36A 3T9VA 4M71A 1XMKA 1HKQA 4G68C 4ENJA 4WX9A 3TOAA 2E5NA 3C36A 4Y33A 3C9HA 1K6YA 4PUSA 1WJCA 4NTLA 1S9TA 2KKOA 4PC9A 1T38A 3K2ZA 1N84A 3ZS6A 1B7HA 4HF1A 4P9KA 4E0XA 4EUOA 1T56A 4PF6A 1MD0A 3FX3A 1ONVA 3MVYA 4U7BA 1W36C 3JZJA 2WEFA 4BQOA 1LGBC 2ETHA 3OO7A 4G8XA 3HOWJ 1BW5A 2O6AA 1YW7A 2QMXA 3MP1A 3RKXA 2CQ7A 2VKDA 4HX7A 4B3AA 2ZNSA 1MH4A 4BDNA 1WODA 5LTCA 2WV1A 3M8EA 1D1BA 1UTHB 4XLNF 3ZN0A 2XXYA 2X6WA 1P7JA 1DP7P 1ZGJA 1DDNA 3EDPA 3SEUA 2ELHA 2HQRA 2JJ7A 4R6KA 3FDYA 4J19A 5T3JA 4LZ5A 3ABTA 1B59A 4U1OA 2GLOA 2OZ6A 4I40A 1DPPA 4YELA 4BDZA 1U8BA 1SI1A 2OK2A 2Q2CA 1USYE 2E1CA 4KXPA 2OWSA 4PBQA 2LY9A 1KQ9A 2VXDA 4UXNA 5I59B 2ESHA 3O3KA 3WTXC 1B3LA 2X6XA 3RPWA 4WEDA 4UB8C 1VQLI 2P5VA 5B1AH 4IHWA 5CQGA 3G1OA 4F2QA 2ZSHB 4DI4B 2QPQA 1W7PD 4OQOA 3PIOF 1TLHB 1TC3C 4O3MA 2I0CA 3G4SI 5GP9A 2ZNUA 5BUUA 3WGHA 1MM7A 1DQUA 2M4GA 3BBRA 3IL1B 4NE4A 2M34A 1FC3A 3BTLA 3MFKA 1IJWC 2QWWA 1EYIA 5DD4A 3S14J 2H09A 3QOPA 1B7UA 3MP6A 4FORA 5DD8A 3EKIA 5TU0A 2CW0F 4YIIA 1PC3A 3UGWA 3SKPA 4KISA 3LA3A 3TP0A 1R9TJ 2AHQA 3O29A 3T9HB 2LK2A 3OSRA 1EZPA 1LUJB 4OU0A 2DA5A 3PMXA 1WJFA 2VQHA 2WA0A 1ORKA 2XX7A 5KCJA 2V1NA 2XAQA 1URSA 3RDIA 5ILUA 1O63A 3SYTA 2P1SA 4WKMA 4LK1F 2FQ3A 2XX8A 1WJ5A 2QSHX 5FKMA 1BC7C 2VIXA 4EJTA 5E8GA 1OJLA 1ZRFA 2HZKA 4BDOA 3OYJA 4NMYA 1X1BA 3PQKA 3CUOA 1PUEE 4NEDA 3RPLA 2FBKA 1BI0A 2OPTA 3LSJA 3DQVC 2AYSA 4GRKA 5FHNA 2O6GE 2HDWA 3MC2A 3LWFA 1BJAA 4L5EA 4BAYA 1LFHA 3PQJA 2Q2EB 3R0JA 3IJOB 3MPLA 4Z6YA 1AKHB 1SVXB 1XOCA 3ZSFA 5ISUA 5C3EJ 3I53A 3LSHA 5F0CA 4LB6B 2JRTA 4IO3A 2I58A 1K79A 3LSFB 3BOQA 4ENNA 2OCCH 4UVBA 5CVVA 1V3FA 3KBZA 1DMBA 1LJ9A 1TTYA 2DT6A 3DXJF 2KR0A 3K7AJ 1QZZA 2IS6A 4OTEA 3NWTA 3ABLH 1USSA 4I62A 4HZFA 3ZPLA 2YU3A 1FBDA 5IOZA 1ZU0A 1I1GA 2EINH 3OD7A 2ZXIA 4UUTA 1KU7A 5M3MJ 3PIPF 4F19A 1YTVA 2IGNA 3FKIJ 1AMFA 1ETXA 3BLYA 1LDDA 2AS5F 4DDDA 2K85A 1J5YA 3CJRB 3ABMH 1ETQA 4NN3A 1R6RA 1I3QJ 2PX9A 3UKGA 3CC7I 4G4PA 5CJ9A 2FNPA 3BCBA 1IXCA 5E3LA 3RKYA 4BEHA 4G7ZF 3TEDA 2E1SA 2NVUB 4GL8A 4GX6A 2YSRA 4E0WA 2Y5KA 2J5PA 4E7ZA 3KN7A 3T0JA 1P9QC 3OYEA 1TFDA 1BI2A 4A3JJ 1U5TB 2FNAA 2LD5A 4PAKA 1QZYA 1JETA 1ODDA 5F7VA 1AWBA 2LBFA 1B9NA 1XTAA 2H27A 3MD2A 1ACIA 3ABUA 4IY6A 4XSXF 3TTLA 1ITYA 1FPGA 1XX5A 2YU9J 4ELPA 1YS6A 2VC1A 3QPLA 3K6GA 4EVIA 2HPGA 2F4MB 3BZ6A 4XRSG 1LBWA 4H5FA 1YYVA 1WJAA 4H8IA 5B70A 1JP4A 2XKPA 1FTTA 1PYVA 2R3SA 1G59A 2RINA 2JA8J 5DTBA 3ROUA 4Y13A 4ZC3A 2UVIA 3PUVE 3V8LA 1OR7A 3LA7A 2FYIA 2PFZA 2Y5LA 3OO8A 1O57A 2DBBA 2DE3A 1DGRM 1D1AA 3JRGA 3K01A 3VLVA 4DCXA 5CMCA 3BR6A 3CJTB 3FMQA 5HDGA 3M1EA 1NKXA 4F92B 4GO1A 3G3HA 1TNSA 3ZQIA 2M8EA 4I7HA 1PB9A 3IFAA 4PGHA 3KBRA 1YLFA 2LTPA 4ZTJA 2R93J 3ABKH 1MMAA 1JKPC 4NWDA 5JLWA 3FIWA 2B4MA 4KHZE 3RQTA 3W2WA 1G0HA 4IY5A 3A0HC 4A6EA 1MQDA 2OAZA 3DBRB 1O3RA 2VOPA 2EK5A 1LBZA 1SVOA 1FQBA 2QVOA 2K4JA 1X1PA 2Q8KA 1BR2A 4RYAA 4KD5A 5ET5A 3JRFA 3OL3A 1Z9CA 1FYLA 1OISA 1H9GA 4ZH4F 4EQ7A 3ILTB 5J40A 2HOTA 3F3XA 4CCLA 5HODA 2Z22A 3WAFA 1RI7A 2NVQJ 2MLGA 2OJED 1DK4A 5IPAA 2ZMEA 4OAZA 3BFTA 1Q35A 2EZLA 4RB3C 2QL3A 3BJ6A 2B65A 2HKOA 1ZLJA 2QGUA 1X4OA 4O3BA 4RM2A 4G9YA 4QFNA 1HF0A 2DDKA 4ZDOA 3IRQA 1AL3A 5A2QZ 3D0SA 2R7WA 2H98A 1SYIA 2MW8A 2MABA 4M3GA 2OCUA 2ZMEC 4N4OB 4Y7NJ 5IZ3A 3TDUC 4N9IA 4MO7A 1TWCJ 3TEPA 2IA2A 4GDFA 2ONSA 1ETVA 4LP2B 4IRGA 3OEMA 3ISPA 3C18A 2ZXJA 2DYSH 3A01B 4X04A 5ICEA 3UN6A 1PDNC 4DXBA 5DUIA 3UNGC 1FSHA 4YIFA 3K4LA 2J5OA 1Z7ME 3S4UA 4RPOA 5FB2A 1Z0XA 3ZMTA 2DFIA 4MEYF 4I0AA 4HPQA 4LIUA 3CG1A 3TO6A 2OWTA 5ICCA 1LE8A 5FROA 5M5WJ 3B6AA 1BI1A 1RNLA 4S0HB 4BU2A 2RGVA 3MZ9A 4BDMA 1VR5A 3RUMA 1H3DA 5FFXA 4ZDMA 1FQFA 3FXJA 2P81A 3GEZA 1PBPA 4I76A 1A54A 2CQXA 1Z21A 2L01A 4ND9A 1CE2A 1ULYA 5GPAA 3S16J 3B7DA 4DBQA 2M5WA 3HPHA 2CG4A 1KYWA 1FJLA 3KEYA 5M5YJ 1FBCA 2LYCA 1WVRA 3TQNA 4X6AJ 1M5CA 2W84A 2HZTA 2VPLA 2DVZA 4XF5A 4ELQA 3FHNA 1WWXA 5AONA 4GWYA 2E1OA 1DPEA 4ZE8A 1UJ8A 2XRNA 1FPLA 2BGCA 3IB0A 4F3PA 2YX7A 1Z3XA 1XHYA 3Q27A 3KZGA 4I99C 1JVYA 3LSKA 2GQ1A 4WCGA 2Z23A 2XAHA 3PL8A 2L9VA 1XPXA 2JA6J 3HOXJ 4P47A 2GH9A 4EF1A 4IL6C 4XKQA 1XSDA 3RZDJ 1O3QA 3U9GA 2Q0OA 5L9OA 3RPUA 4RAZA 3KG2A 3Q26A 4PE3A 2N8GA 1INPA 3LOCA 2MG4A 2W00A 4FISA 4HAMA 1H43A 2WY7Q 5AA2D 4A5MA 3HN0A 3WU0A 3PD8A 5IT3A 5KAIC 4E7HA 2E7WA 4KN4X 1W5SA 1XSVA 4JQFA 4KMFA 1IRZA 4NWCA 1UZCA 4A6DA 1AIVA 2W7NA 3J81K 2OTJI 3VV5A 4F7ZA 3O6BB 2XAFA 3ZQCA 1TL8A 3DKWA 2XF5A 1JTXA 3H1CA 2ID6A 1WFXA 3IORA 2XGEA 4NX1A 3EQLF 3HXLA 5D4SA 3U1KA 1SBPA 4FEDA 2LKSA 2P0WA 4P0IA 3BZCA 3E5QA 3C2HA 3KLOA 1ZJLA 3AXFA 3JW4A 2JTVA 4ETSA 2WAFA 3GZ6A 1JGGA 4UVAA 2R7FA 4LVQA 3IAM2 3VPRA 1MDMA 1XGNA 1LDKB 3K69A 4JDFA 1N3XA 1NV4A 4F93B 1Z67A 1U5TA 1Z77A 3F8FA 5IYBJ 2VJIA 4A0YA 1C0WA 3CHGA 4OVJA 2HI3A 2OJTA 1SQYA 4WXJA 4BXFA 1YJ9I 5ILVA 1NUXA 3Q29A 4Z2YA 1EH8A 2FOKA 2W25A 1FP1D 2GOMA 4PK4A 2DQLA 3TBIA 4YIRX 2JA5J 4GIZA 3V83A 3P9IA 1QKBA 1V54H 3QSLA 3FM5A 4OFJA 5H6RA 1L5TA 1YX5A 3JAMK 1R7JA 2OUMA 2XASA 4MTDA 2VJ4A 1OCZH 4TV7A 1YJWI 1FOKA 1M5EA 2ZFWA 2Q74A 3OOAA 5D6EA 4P1LA 2WADA 5EYFA 1N25A 3T9XB 2ZZWA 2DDAA 4NHJA 4OMZA 1UIUA 2JSCA 3PUFA 4BHPA 5J6XA 3LNQA 2OTLI 3C31A 1PVEA 5IT9Z 3UIFA 4P1WA 3GTLJ 2KLOA 2YLNA 3IOUA 5DS9A 3ZP5A 3CFXA 4EDPA 4I3EA 3I58A 1OLTA 2JPCA 4RMNA 4MEXF 3M1CA 2DMUA 3HTSB 1D4NA 2XWKA 4JSOA 2CGPA 3I0TA 3ASOH 3HOVJ 1LAXA 4Z0IA 3IFCA 2HHMA 5IM2A 4EQBA 1OCPA 2OC6A 4MMPA 4F1VA 4IJAA 4IRIA 1N78A 5ITOA 1CGPA 1J09A 1MBKA 4OMYA 2ZO4A 4C0RA 1NG7A 3KC1A 4U21A 4IHYA 1H76A 1MPCA 3H3ZA 3AL0C 2IEEA 1FSEA 4LG0A 1UIVA 4XRMA 4MCOA 5IGAA 5LBQA 2M45A 1IDYA 4C3IJ 3KSJA 1ZBMA 4IHXA 4FE8A 3O2PE 4RAFA 4MGRA 3HOTA 3J80Z 2JT1A 2E1MB 2DPUA 1NK2P 1Y1ZA 3VLWA 2BHZA 4BXXJ 3K4NA 4ON0A 4E7SA 1LQ1A 3RNNA 4UNOA 2DA1A 3MKYB 2EA4A 4X8RA 1T8IA 1TW2A 3VSLA 4AU7A 3HSFA 4AVPA 4QFPA 3CQZJ 2V9KA 3HIFA 2CFXA 2NNNA 3A01A 3L2QA 1GXPA 3DKXA 2XAUA 4JP0A 2NVTJ 4GWOA 3D4GA 3HHFA 1L3LA 1NG6A 2VKHA 2DXIA 2YPNA 1SD4A 4YU0A 2EILH 4HXVA 2DE2A 1T0FA 3CI8A 1R5ID 3TDZC 5EG0B 2R5ZB 1N77A 1QVSA 2FHYA 4PFWA 4TQUQ 1MJBA 3VVDA 3IHUA 2WKYA 4AIKA 2LH9A 1BI3A 3CJQB 3DFGA 1TT5B 4LQ2A 1Y8QB 1MRPA 4LD5A 2AO9A 2VBXA 1OYIA 5D6FA 3WTUC 1K4SA 2R71A 4HDVA 4M6XA 1SD3A 4ESFA 2Z2SB 3W9WA 3FXUA 5LGTA 3ZKKA 3IOTA 1GR2A 2V3TA 4RA2A 1OVTA 2QJEA 1BP5A 4ONYA 2VJJA 2XXVA 4K2EA 1U0JA 3EUAA 2L4MA 2Y0SN 4KYWA 3SZPA 5LEJA 1D8JA 2JN6A 3HO7A 4CCMA 4M1VA 3DPUA 1EKEA 2JVHA 1DCUA 1GTKA 5DDGA 2FUG2 3G71I 1LBCA 2QMWA 2ZFUA 1U78A 3KZYA 4FT8A 2UXNA 4ZS9A 4RB2C 1ZTYA 3WE2A 3MWBA 2K5CA 2HQNA 2DP8A 3AFHA 1FTMA 2GRVA 1IV8A 2PI0A 1NH7A 2AQEA 2EV0A 2BBYA 2ZNTA 3KOTA 2FOWA 2X4HA 2WWYA 3RPQA 4KT5C 1FSAA 2DWAA 3H3GA 1FMWA 2ECCA 3LSXA 4M3DA 2DI3A 5F1JA 4H67A 3FVOA 4GF8A 2A6HF 1KQ8A 4M4GA 1P1OA 2O3FA 3ERED 2JWTA 3BPXA 4BH9A 2HEOA 2IRFG 3MBPA 4OVRA 4U22A 5H2FC 2UV1A 2X85A 3PO2J 2E1NA 1K83J 2W82A 3CMAI 2G29A 1KQ0A 1RC9A 5HLIA 2DPDA 2ZYOA 5DCMB 1SMYF 2CO5A 1FPIA 4HG2A 1Z05A 1NV1A 4HS7A 1X19A 4BE0A 2E0SA 4W1UA 3BT9A 2DOFA 2VE8A 3DTEA 1VQMI 4MFDA 1Y9UA 2DWJA 2PFYA 4M74A 4PAIA 2R7RA 3I3VA 1UELB 3EUKL 5E3OA 4R72A 3QQAA 1OYYA 2H8RA 2VP1A 3RYDA 4KUMA 1UG2A 4Y4RA 2I49A 3O6GA 2KRCA 2O5RA 3HSRA 1ATGA 3CSGA 5LHIA 4MBPA 3IOVA 2EIMH 4HE2A 2ZB9A 1I6AA 3MVXA 3SHFA 3SZTA 3JV9A 3N05A 1ENHA 2FIXA 2RNGA 2KJCA 3PUYE 1QQIA 3K70D 1XGOA 1TFAA 4ENMA 1PB8A 3FATA 4AYBA 1XB4A 2VB6A 3S8PA 1CQTA 3THIA 3DKYA 4QIWN 3DM0A 1I6BA 1S8NA 4RGSA 2XXTA 1FWZA 2HU9A 1A36A 1Q1KA 2L7ZA 3WODF 4A2UA 4AVZA 2I4BA 3S15J 3FXBA 3PGFA 1HCRA 4BNCA 3A3UA 5D5XB 4MHFA 3GYYA 2RKMA 3RGYA 3S1MJ 1MDQA 1OMIA 3LUYA 4GQOA 5TISC 3F21A 3O66A 5LHHA 2WBDA 1HW1A 3CUQA 4A3EJ 1QHHD 3ZMVA 2ME6A 2F5VA 1Q1VA 4KFCA 3U72A 5K1YA 2D5VA 3ZGKA 3ZQGA 3WTVC 1PUFB 3QPTA 2XF7A 5GTIC 1FQCA 1US5A 3ZRGA 3SZGA 1HKTA 1FP2A 3QP5A 2DSFA 3N26A 1BC8C 4WEPA 1A7LA 2V3UA 2XUBA 5KVRA 3HFUA 1D8KA 2ZCWA 3IH2A 1BJZA 1ZKBA 3WHCA 4M6YA 2KIQA 1P1QA 4NF5A 1WH5A 4RM3A 1H88C 1F43A 4OA4A 2X7QA 3E79A 2RVCA 2ANJA 2K7LA 2CQNA 3MWMA 3PUWE 4QXDA 4IO9F 1JE8A 2NUVA 1KU9A 3LSWA 5LRSA 4N8GA 5IP9J 3BR1A 4JX4A 4KI0E 4FEBA 3CJNA 5I5PA 3W2AA 5JR3A 1YI2I 4CO8A 3EPEA 1MNMC 1ZYRF 2TCTA 1B4HA 1Z3YA 4KN7X 1NNFA 3MPKA 5FRMA 1P1NA 2H99A 5E18F 4GWXA 5EG0A 2YUSA 3H7MA 3LFUA 3WTTC 3LR1A 5TJJA 2A6EF 1ZQ3P 3QAHA 3PNTA 3O28A 2IEKA 4F3SA 4P55A 5I7IA 1B8IB 3PO3J 1YOVB 1N04A 1JXSA 2AL4A 3B6QA 3IOWA 4RGXA 3Q0WA 2NVXJ 3HM5A 4II3A 3J7ZI 1RPWA 1FPBA 5LRRA 1WVJA 1YS7A 1EA3A 4LOCA 2B3BA 1ZMGA 3H03A 3IJXB 2HCAA 2F6GA 1TW3A 5JVTA 1EJ9A 4IRHA 3H3UA 1IRGA 4LLLA 4XKCA 3JAMZ 1ZG5A 2DO7A 2EFQA 3IO4A 4G7HF 3UORA 3VE1B 4JOMA 4NF4B 2E2HJ 1H8AC 3IK6B 5ELVA 1IQ7A 4OXVA 1GDTA 4DOZA 2QKMB 4BQNA 5EDNA 5BOXA 1IXGA 1LVAA 3EF7A 1B40A 3G3ZA 4KNYA 2O9LA 1JT0A 4ZDPA 4IOAF 3B6TA 1XGSA 1ZHFA 3PNVA 1EU8A 1HDPA 2DVCA 1NV3A 1VZ0A 4ZYGA 4EJVA 2VXZA 4WXDA 1R9LA 1IDZA 1MQGA 4G2ZA 4Y17A 5EF6A 4GRIA 2F5CA 3OS1A 4O7IA 3TELA 3S17J 1BR4A 4G61A 2F3DA 3L2UA 2KIUA 3VLUA 3OMYA 1HSTA 1MSFC 3CDIA 3HUGB 4P5OA 3L00A 3ZQHA 3HOZJ 2XWIA 1YQAA 4A3BJ 2IS1A 1XT8A 2VT5A 2HDCA 2H9BA 3TQWA 2FRHA 2QYOA 5C4JJ 2NS0A 1G2HA 3OYDA 3MVZA 1FOYA 2DWIA 1QPMA 2GIZA 2BZTA 4KT6A 4L0YB 1KU3A 3RI4A 1I1SA 3S9MC 2NVYJ 3CR9A 1R49A 5DCMA 5L3DA 2ZYMA 2HDDA 4GXAA 1W36D 4CGZA 3LFKA 1RKTA 4AM3A 3MQ9A 4PTKA 5J1DA 4M3BA 1B72A 3M9AA 1LB2A 5ERIA 1LNWA 3G1LA 3K4CA 3CDHA 2FA7A 3KYCB 4M9ZA 3MZBA 1S9HA 1J9IA 4N81A 5EQ8A 3I5UA 5D5WB 3T1BA 3B02A 1F4KA 2VQLA 2VPNA 3M07A 2FSWA 2RF1A 4OYVA 3I4NJ 4C2MJ 4QSCA 5K7ZA 3MAJA 1LB8A 1XMXA 1D1CA 4RB0A 3C32A 1OIBA 1D9VA 2WC2A 2LNBA 3MZ8A 2WB1A 2COMA 1K9ZA 3QYBA 3VYUB 1FTAA 4GWSA 4R9GA 1IUYA 1RDYA 4KCCA 3RTFB 4P1EA 2FA5A 3ULQB 3ZXSA 1XGMA 2M30A 3L6HA 1ZAOA 4H0EA 4HCWA 2FNCA 4DJAA 2OWZA 3ZMDA 1XVXA 2RCAA 2QZ8A 5GPCA 3PM1A 3ROJA 4LZ8A 3NARA 3NRVA 1O7FA 3Q28A 5I58B 5L3CA 2ZJPF 2BY0A 5BPDA 4YG2F 2FU4A 5J16A 3D5LA 4R2FA 2XRLA 5LGNA 4DBRA 4XOPA 3TW7A 2OF7A 5L3BA 2Z33A 1S7EA 3RKWA 4S04A 2P6TA 3DLAA 4UV8A 4G77A 4TLLB 1FTOA 2LY1A 1X2MA 1RR7A 1E0EA 4RY1A 2X6OA 3VVEA 1N75A 3BZKA 3MZHA 2R4GA 3F8CA 4XLPF 3E3KA 1TT1A 3OSQA 4P11A 2BW3B 1SFOJ 3RT8A 2XF6A 3CFZA 3VXCA 3JTGA 4BKXA 4U23A 5IZ1A 4MTEA 2RKHA 4O5VA 3BG7A 2HTSA 1Z6TA 4B1RA 3DU6A 2CZLA 2NAZA 1SVMA 4Y3OA 5AE4A 1R5GA 3F8MA 2ELJA 3V8KA 1B5HA 1XDUA 1LBXA 1NMUA 2DS9A 5DW8A 5DVIA 4EEFG 1B0HA 5ESYA 3QYFA 3KCCA 3X2QH 1LFPA 4HOBA 2HR3A 2WAQA 3FBIB 4BGDA 3TO9A 4RS8A 4UB6C 4GWWA 5H8HA 4E4HA 4BBRJ 5H8SA 4MIMA 2P7VB 4DZJA 3B6WA 2P8TA 4UACA 2VL8A 2RCBA 1O3TA 1NHAA 4II2A 4N6KA 2IJLA 3RJPA 5JFRA 2VBYA 3QODA 4I01A 3S2WA 4BYYA 1RZ4A 5E3NA 2HAVA 4JVIA 5K5OA 3FM3A 4YFXF 4OINF 2YR2A 2V25A 2I6EA 3G3FA 1GVCA 2I10A 2I3VA 4BDRA 1K61A 3E5UA 1OCRH 5E1ZB 2DW4A 2LREA 3BDDA 3I56I 2Z8FA 2MGQA 2GM4A 4UA8A 4DYRA 2QBYB 3ESWB 4LLNA 1R22A 4IEJA 3I64A 1Y8RB 1NI9A 2DOEA 3E4RA 2CEXA 1REPC 2R6GE 2W7YA 4D7NA 4H8JA 1N76A 4PFRA 5F1RA 1KA8A 1WH7A 2ZJRF 1WQ2A 4BQQA 1G3SA 1A99A 3Q25A 1QNTA 4B48A 3QU6A 4YRVA 2MC4A 4BY1J 1MH3A 1Y20A 2K4BA 5K2XA 2X1EA 3U1DA 2FX0A 3CLOA 1R4MB 3N4MA 1HBXG 1CB6A 1MQHA 4NF4A 3I55I 1DOTA 2A5WA 2F97A 3TUSA 3OYLA 2I8DA 2ZKZA 4NUBA 3KP3A 4CDGA 4N07A 1MDP1 2PMZA 3KIOA 1H89C 1LCFA 2H6BA 5CVJA 4P56A 2BHYA 2XB0X 3O8HA 2DFHA 3IC7A 2H25A 3WG9A 4RXLA 4AS4A 5CC2A 3RIRA 2M9HA 5I2NB 2LG4A 3W3CA 3A09A 4F3QA 4U2RA 3BIHA 1Z7LA 3KP4A 1JKRC 2BJJX 2LAOA 1YO5C 4E6KG 2CSOA 5J8CA 3G1MA 1VTNC 1SEUA 1SVLA 2E19A 4ZYEA 3OSFA 1JKOC 1UAAA 2B4LA 2P3NA 3F6VA 4NF6B 4HEA2 3TKDA 1MMSA 2GIVA 3GF2A 3HUGA 4ESBA 2D5WA 4YKJA 1D9QA 4N4UA 2X6YA 2UVGA 2VONA 2V93A 3S9EA 5F27A 1WGXA 2JK3A 3HRTA 4MQ9F 2QQAA 4OOIA 4D1QA 2W24A 3DBHB 1FRPA 3FBNB 4R9FA 1P6RA 4Q47A 4MLQA 2FQ4A 1VQ8I 2R7UA 1QA6A 1TWGJ 2IXSA 2OQGA 1GHCA 1LBBA 1N7WA 3JRBA 1B2HA 3HL2A 2M8CA 1LAFE 1MMDA 5AA1A 3CCJI 2IS4A 1FQEA 3ECRA 3HRMA 1P7IA 3CF2A 4PGPA 4AQ4A 2ECBA 4H46A 4L9NA 3K9TA 3SEYA 5EQ7A 3H06B 1A40A 5FGMA 3S1QJ 2FE3A 2CWEA 2DA4A 3CO6C 3E0JB 2XKOA 4BY7J 3EN3A 4GXSB 3ELKA 1OQYA 1Y3QA 4C3HJ 4FE7A 4OIQF 3V5AA 3R7XA 2Q1ZB 4UV9A 1FX7A 2QQ8A 1EH3A 2CUJA 1IGNA 3JRHA 1Y3NA 3P9CA 2XPUA 3E97A 3G2BA 1D5YA 4OANA 4XLAA 5FKNA 2CUFA 5E8IA 5C44J 1FJ9A 3HV1A 1QUIA 4XKRA 3DLLF 5EYHA 3IWZA 3K1PA 3GTOJ 1ON2A 4JXIA 4MH5A 4A5NA 3HYIA 1OR7C 3C3WA 4QFLA 4HQMA 4F31B 4ZE9A 3OYBA 3FVGA 1VF9A 4TOZA 3H36A 1XC5A 2BXZA 3IV5A 2DTRA 2P4WA 2NOOA 1UTHA 2GBYA 5EGOB 4QRZA 4A3MJ 2TDXA 4PJJA 2Q8MA 4BE1A 2AXTC 3CD6I 4FJPA 3CCUI 4WXCA 4P9UA 4GOTA 5M2VA 4BLAA 4BS9A 2MKZA 1V4RA 3SETA 5EQAA 3V8XB 1TQPA 1JEVA 1FY7A 2BW3A 1MSEC 2JQ7A 5A5XB 2VBZA 1MNEA 5FD6A 3BCAA 2VLAA 4XIDA 3B50A 1QJMA 3L2CA 3JTHA 4OVSA 4XOTA 1FEXA 5ED4A 5JEIA 5I59A 1RYOA 4HF2A 3KEOA 2DA7A 2L5VA 3VSKA 2L9SA 2Y75A 5E3MA 3EUHA 4KICA 1MMNA 2P5KA 2QVRA 4ZZAA 3RLFE 5AA3A 1IIWA 3P7IA 2GWRA 3HRUA 1VQ7I 4BUPA 1DTGA 2DXRA 3MZ1A 3ZQLA 2R7QA 4DIGA 2OU2A 4EXKA 2Y31A 2V9PA 2K9NA 3I59B 3J7AY 4NG7A 2HVQA 1G3WA 2W85A 2REGA 2X1CA 2DT7B 3P7NA 3BTCA 5EEHA 4P3LA 1X3WB 2KLFA 3GUDA 2VODA 2QQBA 2PCRA 1IO2A 2PN6A 3L2RA 1G6NA 4ELOA 4QTRA 2K9SA 2DFEA 1W0UA 4PJNA 2F5DA 1FOWA 4U87A 4G8HA 4A3IJ 3VDFA 3JYRA 4PDHA 2XXKA 2IA4A 3HOYJ 2QS3A 2DDBA 1VQKI 2QBYA 3FV1A 3C2BA 2V7FA 2PJPA 1E2XA 1RR8C 1FT9A 2V3QA 3ODBA 2Q88A 4E7LA 3GTPJ 3SFZA 4AIHA 5I57B 2FJ1A 4G8NA 3UA8A 2DMQA 2LMDA 1JW5A 5I56B 2VHAA 4ITVA 3EHUA 1Y3PA 4R75A 4GD5A 5FBPA 5CMBA 2L7MP 3WG7H 2I5UA 3GTJJ 4KFQA 3C35A 4EF2A 1UHSA 5F0HA 1GUUA 4ESXA 5JHFA 2VD3A 4QLCU 3CCMI 2X7PA 4IHTA 1G3YA 3PFIA 3MP8A 2AL5A 4N8YA 4LJZF 4E7KA 2Y9YA 3RPUD 1G4DA 2IGOA 5D8LB 4L9JA 1R4NB 2P6SA 3PSIA 5ICFA 2O1MA 3TGNA 1Q1HA 3E3VA 1FYMA 2UWMA 1DPRA 3CC2I 2WYKA 3E1SA 5FHMA 2Q2EA 1HC8A 1GT0C 3PMVA 5HM4B 2M0MA 5JTYB 3KP5A 1AKHA 2CFOA 3J7YJ 3HZJA 4JWXA 1ZK8A 1RESA 4AYBN 4HW0A 2QS4A 1ZRDA 4OVTA 1OCTC 4PP0A 2DYRH 3RZOJ 2BY2A 1TXFA 4OIOF 3KYLA 3E7LA 1UHWA 2KDZA 4DGWB 3CCVI 5I2NA 2IGKA 5GAEJ 1F9BA 3NWSA 5E20A 1Y1WJ 3U1OA 1N7XA 2HZDA 3GWZA 4NF6A 3MVPA 4CA0A 5J47A 3PPPA 4ZEBA 3GLLA 1SW5A 4GGGA 3COAC 1VFCA 1R1TA 2F4IA 4XLFA 3FD3A 2F8DA 2O7IA 4FIMA 3LSIA 2XA5A 2CH0A 3KEQA 3OR1C 1YAEA 4JWYA 1YIOA 2O1LA 4L5IA 2R9JA 3KOSA 2B3FA 2DLLA 2I48A 4BHCA 2LDUA 3MKZA 1YE9A 1KZ8A 1XC1A 3NOHA 2K86A 4E70A 1Y0UA 2HOAA 1FIAA 4EXLA 5L3FA 2W48A 2REJA 1HLVA 1ON1A 4DZ1A 2LFBA 1IUFA 1RRJA 5F6FA 4XKBA 1U6GA 2ZC2A 4K3FA 4QPQA 3H92A 4OAYA 1S7YA 3QOEA 4BACA 2D3IA 3ONQA 3TP3A 1B1XA 2UZKA 1I3AA 5FTIA 2XROA 2ISZA 2ZZVA 4PGGA 1GVDA 2L2OA 3M3LA 2CJJA 4HSTA 1ZRCA 1U5TC 2A05A 2QKLB 1BOAA 4CYCB 1D9YA 4MHGA 4KYDA 2R7OA 4OVQA 4Z7EA 2RN7A 3PJRA 2QVVA 2DE4A 1ZH5A 3G3KA 1R58A 3T93B 3I3LA 3RQIA 4GBWA 4EM1A 1GV5A 2LP0A 5C4XJ 4PCDA 3OELA 4BDQA 1A04A 4XK4A 4DYCA 3O6HA 4LMYA 1MM6A 4CUGA 4NQWB 2M0CA 3FXRA 2PT2A 1AOYA 2VOZA 4IPAA 3TDJA 4O94A 3KZZA 3MJNA 5CKTA 5IKBA 5EGOA 4N15A 1XN7A 3GFJA 1FPJA 2BJIA 2MSYA 3I6VA 1Z91A 5H8NB 5EHMA 1QW0A 2FVZA 1M1EB 3T96B 2F6CA 5H8QB 3DEWA 4F91B 4N6PA 5EQ9A 2M1BA 1XVYA 1LPQA 5AA4B 2Y7RA 4I6ZA 2XVCA 4LFUA 3OYGA 5FKOA 1ZGWA 2NRAC 4H45A 1TP4A 3S3MA 3S2HJ 3PPNA 4YMAA 1MXYA 4A3CJ 2VOOA 3LQRA 2EB7A 1M5FA 4IQJA 3PTYA 1FLIA 1G8XA 3BR2A 4MQVA 1ZR4A 4L0ZB 3F11A 4N13A 3F9KA 4FETA 4O6JA 5JHUA 1XS9A 1B4ZA 3ONMA 2UVJA 4O8MA 1D5VA 5E17F 3ZN1A 4EJUA 1ETOA 4B47A 1R36A 3IH3A 1OQHA 4F55A 4HNTA 4M9XA 3SDFA 4XKPA 3W6JB 3UP9A 1NTCA 3OO6A 4UUSB 5F1QA 4POWA 2RC4A 3WAEA 4OZ9A 3O2AA 1OCOH 1FBHA 1YCJA 1FPFA 2G7HA 2HQ0A 4AWXB 3DEUA 4XN0A 2DJIA 4UUVA 1NV2A 3AG4H 2WBMA 3JCUC 3ZQFA 4RBOA 1VFEA 5IOYA 3SEVA 1G0IA 2KJBA 1RUOA 5FD5A 2V84A 4PFUA 3Q0VA 2KIFA 1D0ZA 1ANFA 4XKWA 4EQ9A 3CG3A 2F7AA 3FHZA 3BWGA 2GA1A 5BMZA 4D5FA 2LY2A 1FBUA 4HSRA 3FGSA 4AIJA 1JW4A 3P9KA 3TW6A 1B46A 5HS8A 4OESA 1BKAA 1BK4A 5CMMA 2DT5A 2DCEA 2PJRB 5L9MA 3MQ0A 2XXPA 2X48A 1B5JA 2PFBA 5AIQA 4JVCA 3OIOA 2GAUA 3PFYA 5I57A 2F5EA 3GFIA 3GCMA 3EHTA 4U4SA 5ICGA 5TP9B 2WTEA 4THIA 1T0FC 3R0AA 4Q48A 2O84X 3VEPA 4IO7A 1T0KA 3GW2A 2K40A 5K7HA 2EIKH 5CYVA 1K7AA 4CSWA 3T9UA 1XCVA 2E34A 4M3EA 5BQTA 4J01A 1J0RA 1MG1A 4DI3D 3OS0A 2BY1A 2ONRA 4P8BA 4FATA 2D21A 5D8KB 2PT1A 1U2WA 1DPUA 1SANA 2RNJA 2HXRA 3H5RA 1BN5A 3QAXA 1POGA 5H8FB 4WWCA 5JTYA 2WB1N 3VOEA 1HSEA 1U3EM 3H35A 1V55H 5DM6F 4HF0A 2BVLA 4QBAA 4CYDA 5CVRA 3FXMA 1MQJA 4RPNA 4R6HA 4Q4ZF 5GTHC 3M3FA 1NUWA 1X3ZB 5CLSA 1ZLKA 3ASNH 1OQGA 2Y9ZA 3MUQA 2K9LA 4IX7A 2Y69H 3FF5A 4NC7A 5B7DA 6PAXA 4PDKA 3S1NJ 4I1DA 1XCBA 4RK9A 3BY6A 3RQ4A 4ZYDA 3WGIA 3MN2A 4XLHA 2DN0A 4HV6A 2IA1A 3ZMUA 4A3DJ 2DAOA 2KL4A 1FTKA 2GHAA 3PD9A 1CNQA 1Y1MA 1BIYA 4H6DA 5EEAA 3HGYA 3D1RA 2ISYA 4H65A 4EM2A 3H6TA 5TGTA 2GZWA 3H9GA 1P1UA 3CLQA 3K6XA 3KX2A 2VC0A 1LCTA 5K5RA 3I4PA 2K3PA 3WTSC 2QUFA 1B58A 2IAIA 5DUKA 2P5LC 3TMGA 4U1ZA 2RC8A 5KDTB 1FYKA 4BJ5C 2XHDA 3K4MA 3V7SA 2WAQN 4E7IA 5ILSA 1PEBA 2EFNA 3HC7A 5EZHA 2EFPA 2EZIA 2R5YB 1Y6IA 1YRNB 1VFDA 1X58A 1IMFA 2GQQA 2A5SA 2DOAA 5K7FA 3OYMA 4CYCA 4G68B 1MY2A 2CW7A 2A69F 2RDPA 2H6CA 1H0MA 2QVUA 5EEGA 2EBIA 1KONA 2CZIA 4R6YA 5CQEA 1WJDA 2ZJQF 4Q5SF 3W6KB 1J2XA 3KFWX 1IN5A 3BG6A 3C34A 1VNDA 2M2EA 2VT3A 3T5XA 5L3EA 5EHSA 4G7OF 1PB7A 1WRJA 5LEKA 3HRSA 5HVQC 1LKXA 5I2KB 2BVMA 2ZXTA 2Y7IA 3PMWA 1GGGA 3P5JA 1R71A 4F22A 3HEFA 1SD7A 3KP7A 3QPSA 4PFTA 2PEXA 2GOXB 2QQ9A 2CV2A 1ZARA 3I4MJ 2CS3A 1FMVA 4C2TA 1NNKA 2QRYA 4GFRA 4QFOA 2H1LA 1TWAJ 3E6DA 1JW1A 1R9QA 2AXLA 5H8NA 2DU9A 4FBPA 4I02A 3E5XA 2XC7A 2XXQA 1QVTA 4RLFA 5E1WA 3FASA 2HWVA 2M3AA 3GVAA 3R60A 5BPIA 1SD6A 2HKXA 2IBDA 5H8QA 5CVUA 3U2RA 5LGUA 5HNHA 3S1RJ 3DP4A 4LATA 2W57A 1E3PA 1ZG3A 4QPOA 3H5AA 2KRFA 3PUBA 2HOSA 4EJOA 5FLMJ 3FJGA 4DXUA 2XXRA 3KE2A 5DEQA 5KHDA 1DP3A 4G94A 3I54A 3VB2A 4HNVA 1SFUA 2LLKA 5JLXA 3U94A 4F3BA 2V6CA 3CUQC 1JTYA 1WI9A 1R1UA 2FEZA 4RAYA 2QS1A 1WCMJ 4PBHA 2F3BA 3MAMA 4AB6A 4IGTA 2NOGA 4QHQA 3U21A 1EH6A 4HBLA 5CMKA 2ID3A 3V8JA 3J81Z 1R1VA 2DQVA 1Z7UA 1B6AA 4UUSA 2XGXA 2E2JJ 3T8TA 5HNFA 2D1HA 2NS8A 1KGSA 2H94A 5FLVA 1DBZA 3HB9A 5J4YA 4H5GA 1QUJA 2JA2A 4OVPA 1X2NA 2DK8A 4DQ2A 3KSXA 5KZTA 3LA2A 3K4JA 1RYXA 3FKJA 1IN7A 2MH2A 3A1YA 3HOUJ 2KIMA 2E1MC 2TRTA 1MBEA 1S7OA 4G12A 4R79A 5J8FA 2E35A 1W5CC 1J59A 2V1UA 1YFHA 3D5RC 4FECA 2WV0A 2R5ZA 4OEVA 4PFYA 2KISA 2K9MA 2KPMA 2X9DA 4DNCA 1LBYA 2WYPA 3DCFA 2QS2A 3OYFA 5I84A 3QRFF 3W9VA 2HPMA 1W1WE 4F29A 1R00A 3CSBA 2R0QC 2BEOA 2XD2A 5TP9A 2IPQX 5DCFA 3CCQI 1W7PB 2BXYA 1IN8A 3AKZA 3Q5FA 1IXHA 2MFZA 4MNPA 4JX5A 1IG7A 3RT6B 5IY5H 4JB7A 3MKWB 1VQ6I 2ESNA 3E6MA 1VQ4I 3F22A 1ZR2A 2PG4A 3KP2A 5KCJB 4BL0B 4TLMB 3HCQA 3CCRI 3BTJA 1IMEA 3KPHA 2Y0MA 5BWJA 4L18B 3FBPA 1HDDC 2VJ5A 3CDLA 2D45A 1PP7U 3RY3A 1QUKA 3DP8A 1B51A 3MYUA 1BR1A 3BQZA 4S05A 3OO9A 5J1YA 1X1CA 3OSGA 4OEUA 3U8QA 4QSEA 4GCVA 2L5QA 4OWRB 1A5JA 3K02A 2K27A 3KC0A 3MVWA 2EZKA 2GXGA 3G7WA 4MX6A 3RPLB 5L9SA 1DU0A 2HQ5A 2EPFA 2G93A 1B3HA 1IMCA 3IX1A 4M9SA 4XKVA 4C30A 4L17A 3SFIA 1JT6A 1O7LA 2NYXA 2HFHA 5LLQA 1ZGAA 2O8KA 4I98B 3K6VA 4FCYA 2ACJA 1BOBA 4PJ0C 3NQOA 1O3SA 2JA7J 1P99A 2VPOA 3Q9SA 1FZPB 3QXMA 1ERDA 1YYZA 3F0CA 4V2GA 4EV0A 4RB1A 2OA4A 3IP4B 2P0SA 4B43A 1OPCA 3BPVA 1MS7A 3LSLA 3L2WA 1GV8A 2HQAA 2F7BA 3LUZA 5A2QK 1OMPA 1RKWA 1JEUA 3OOPA 3GTKJ 3HPIA 1HSJA 3F6OA 2GHBA 1LB9A 4GVOA 3SEZA 4XKNA 2BE5F 5BNGA 5EJCA 1LBVA 3KYDB 1MXWA 2LF7A 4L9VA 3V7CA 5KDTA 2L9NA 3KFMA 1K4TA 3ZQ7A 4R1HA 4BEHB 2X1DA 2QM3A 3OYCA 5IYCJ 1NV7A 3KETA 3QWLA 2Q9TA 3S2VA 5DTDA 4CCNA 1Y39A 1YRNA 2Q89A 3H5NA 1WJEA 2EWNA 2ABHA 1ZKGA 2V9VA 4FASD 2QLZA 1PP8F 3GTGJ 2DQRA 2HYGD 2F5XA 4G68A 2W4SA 2DMNA 4AD9A 2O7UA 2V6EA 2LKPA 3B8BA 3R6UA 2VKVA 2LBFB 2Q8JA 1FQAA 1B0LA 3E13X 1LFBA 2IA0A 3HKZA 2G9WA 2ZBKA 3GLXA 5L3GA 2LOOA 2F6PA 2OX3A 3QP6A 4OIRF 2NXNB 1MMGA 2CQQA 2PMUA 1FNNA 1R23A 2PMSA 3N6UA 4U0VA 3PPOA 5HPQA 1E3OC 3KEIA 4HE1A 2JZYA 4XMYA 2Z8EA 4L9TA 3AG1H 5FJ8J 1BA5A 2FF4A 4R8HA 1N0TA 4GL0A 1P1WA 4HLXA 2BV6A 3TKYA 3LBSA 1B1BA 4HA8A 1UB9A 1A31A 3SERA 2EFWA 2XXUA 4RGUA 1SW4A 1S72I 2KFDA 2L0KA 3J7AO 1JUMA 1W5TA 2EV6A 3VDXA 4CH7A 1I6QA 1O64A 2VBWA 3TL4X 1QO0D 3SJMA 3BP8A 3TTKA 2ADUA 5IAIA 1PUFA 1LAHE 3BR3A 1LFGA 1SYHA 3VFJA 1SMTA 3WE3A 2IS2A 3BROA 1NL5A 5J3LA 2CZHA 2F78A 4MLVA 1B32A 2YX4A 3BG9A 3BIGA 4NGUA 3OOUA 1OKRA 3CCSI 5DEXB 2XB5A 2KDOA 4H4KC 4KDPA 4YKIA 5CBRA 4GFBA 1SFKA 3L09A 4X1DA 3GTQJ 4R2BA 2CW8A 2QSGX 4PGNA 4QSHA 1WPKA 3T22A 4O3CA 4ECFA 3BKIB 1ELJA 4X48A 4ZDLA 3CTAA 3HBLA 2ZMEB 1UMQA 4R73A 4ZEFA 1B05A 3VFZA 1EYKA 1NV6A 4LUBA 4AUXA 3CFLA 3SXYA 1DGWY 2F7CA 1XG1A 2RQPA 2XPWA 3ZMSA 4P96A 1NH3A 1QVUA 2EQRA 5DV5A 1X1AA 3R4KA 2GXAA 2Z16A 3LMMA 3CF5F 4PSWA 4D0PA 1TWHJ 1APLC 2R92J 4Y52J 1XD7A 4X1EA 1IXRC 1FJ6A 5IZ3B 2B0LA 3N94A 4NC8A 5CPRB 4HRIA 1B8IA 3VYTB 5CVIA 1SPIA 4UHTA 5GAHJ 4XQFA 2O8XA 2CV0A 2A6TA 3MW0A 3OXNA 1MPBA 4C1TA 2VI6A 4HE0A 4IVNA 1W7PA 3H4ZA 1YTYA 4F39A 3ZQQA 3JREA 1GV2A 3GMEA 3GXOA 4XRFA 3VYRB 5J4VA 1WSUA 3HPGA 1R1NA 3GXAA 4IZZA 1EV7A 3M8UA 4XBFA 3GTMJ 5HLHA 3SEXA 5HLTA 3SDBA 1LE8B 3ZOBA 5FKLA 3GLBA 4MLOA 2HZLA 1JNFA 4IO2A 5IT9K 4KPTA 2O68A 2UXXA 1A8FA 3ERMA 3KLNA 1FOXA 4LGWA 1IF1A 2O03A 1ZLQA 5CM6A 2KHMA 3CCYA 4PZJA 3FMRA 1RDZA 4O7MA 1UG0A 4Q5TA 5JVGF 4HX8A 3K0LA 1MJ9A 4Q30B 4HTGA 4HV5A 2XAGA 2JPBA 2KZGA 2FXAA 2P3VA 2VQCA 5DVJA 2A3SA 3K1MA 4V19K 1IEJA 1KWHA 4ELRA 2KZVA 4X0GA 1JJ6C 3FIRA 2HYFA 3VODA 2RV8A 1NV0A 1MXZA 5GADJ 1II5A 4YEJA 4LQ5A 2MBFA 4GYIA 4MFIA 3UK4A 3W15C 1LFUP 1JQFA 4HCYA 1NUYA 4YKPA 4KIFA 2F36A 3OENA 1FPQA 4PE5B 2F4OB 1F9NA 4A3GJ 2FIEA 4UABA 3DP7A 1UCRA 2E5ZA 5EYGA 2OLBA 1XDSA 2KMUA 3WGGA 1MNDA 1S6LA 3BJOA 3J80K 1ZIUA 2Y2ZA 4GYGA 3E9XA 4YZZA 4UY8I 1TWYA 3TTNA 4G6DA 4LIVA 2C6YA 5DVFA 1HSLA 3QPHA 2WAEA 4BHBA 5CRYA 1TBXA 2ICWG 2B63J 2R7ZJ 3AAFA 3TCHA 2DWHA 5AA2B 2ZZXA 3FJ7A 1XSXA 2YPRA 4RAGA 1URDA 1YHQI 4NHBA 3A0BC 2L7KA 1EZOA 5LHGA 3USDA 1LAGE 1EH7A 2VASA 3HJEA 3WU2C 1FBEA 1SW1A 2R8TA 4MIJA 1ZELA 1YPNA 2OD5A 4F2OA 1MDMB 1YX3A 4D5CA 4HDUA 4FTHA 5F08A 4NC6A 2ZXHA 4E7JA 3M3KA 5ITPA 4CZZA 1QBJA 3S3NA 4XRSA 2JVGA 1MY3A 1B7ZA 2XWVA 3TPAA 3JRIA 1P4WA 1GVJA 2KRHA 1POY1 4KIGA 3BC8A 3JSOA 2RC9A 2K3FA 4CCKA 1QZEA 3DF8A 4MFEA 1AHDP 4ZEKA 1F36A 1TQMA 2QCOA 2GXBA 3TCGA 4WF2A 3A4CA 1NH8A 4RJZA 5I58A 3BFUA 1S50A 2EFOA 4BQAA 1FBQA 3I71A 4YFKF 4OETA 4FX4A 4MF3A 3QMFA 3MEXA 1UFMA 3IUOA 4KA4A 1FPDA 2R7XA 3HSTA 1IAWA 3K4UA 1JUSA 4U88A 3VVFA 1QRYA 1SAXA 4KQPA 2DK5A 1SD5A 4N9HA 1A6QA 5EYRA 2CEYA 2XAJA 4RK2A 1MKMA 1ETYA 1MW7A 3DV8A 3A2KA 2VN2A 1HKSA 2XXHA 3U65A 2BY3A 3IAZA 3H6WA 4H1XA 4I3YA 4NF8B 2HXWA 3D4CA 1MPDA 2XIGA 4EMSA 2F34A 4F1YA 4NDLA 4MJOA 5KAFC 3MCZA 4B3XA 4JX6A 3A03A 3DPTA 4AIDA 1BIAA 1MQIA 5DEXA 2Z99A 3AL0B 1QPIA 1I5ZA 4ANJA 1X4PA 4UVCA 3QUFA 2R7TA 3M8JA 2ONKE 5K5QA 1FTJA 3LAPA 3BR5A 4U0YA 2HNHA 3E6CC 3DLNA 3FVKA 4DLDA 2E2IJ 4XM3A 4YFNF 3F23A 5M5XJ 1U8RA 2ZJ2A 1T6SA 4A12A 1US4A 1I27A 3IWFA 3H3VK 2XPVA 3R6SA 1A8EA 1FPKA 2A07F 1IUDA 1MXUA 4PFOA 4M72A 3EQ1A 4HX4A 2ZNZA 1QKAA 4JVDA 2HS5A 1Y4TA 3EUHC 2CUZA 5HS7A 1G3TA 4LG0B 2M7AA 3S32A 3HDDA 3OIPA 3LAJA 1USYH 2KQZA 1OYWA 4X9TA 3C7JA 3OYAA 2MC3A 4XR6A 5EZGA 5FLXK 4O3AA 4M6VA 1RDXA 4HNUA 2FMYA 1LDJA 1FPEA 2MYSA 3MKLA 4Y15A 3QU3A 2PMHA 3IO6A 1MJAA 2A5TB 1MGTA 3HGGA 3OYHA 1JI8A 2THIA 4DYQA 3RKQA 1VQ5I 1NNTA 1VQOI 1A6IA 4JWOA 4A69C 1IZ1A 2DA3A 1D0XA 1B9JA 4HW8A 4ZZDA 2ME0A 3FISA 1L0OC 1IMBA 3FVNA 4N17A 4OERA 1OLCA 5D4RA 2DTZA 2XGCA 3W6VA 3IR1A 4OFLA 1MBFA 1N3WA 4WK8F 3M7GA 2H8WA 2EJRA 4PJLA 2JJKA 3ZR8X 2HXOA 5KNLA 4P0GA 3SDGA 2FBHA 3W2VA 3OY9A 3H0DA 3O8GA 1BLFA 2F35A 2P2AA 3G6EI 4GLIA 4NAPA 4Q0CA 2L54A 5KK1A 1ZTRA 4EATA 3QUJA 2DYXA 1I6XA 2XHKA 2HXIA 3CMMA 3OV8A 1S5LC 3WTZA 3JSPA 1DSNA 2X51A 5FKKA 1JVXA 3N5LA 3EYIA 4R74A 1X3UA 1TZLA 2BOLA 2UUZA 4G6QA 3M8FA 1XS5A 3FUZA 4M73A 2RREA 1FBGA 3DTIA 3GZNB 2R7VA 3CO7C 3OR2C 3HOSA 1IXSB 4ZYHA 2CV1A 1Q9DA 2NOJB 3N97A 2X26A 4LN5A 1F1ZA 2YS9A 4DW6A 3TZAA 2XD3A 4FAJA 1NUZA 3CZ6A 3H9JA 2O69A 2MD5A 4IGRA 3R26A 1J7KA 3RTRA 4LA9A 2DA6A 2QA4I 1O7TA 9ANTA 3CIJA 5BS6A 3R61A 2V4CA 3HG9A 3RYRA 3OIQA 2WY8Q 1TQIA 4PCQA 5IP6A 1FTZA 2CMPA 3L7WA 1D3KA 2ZNYA 1WHUA 4AB5A