1MH4A

Maltose binding-a1 homeodomain protein chimera, crystal form ii
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
molecule keywords maltose binding-a1 homeodomain protein chimera
total genus 136
structure length 418
sequence length 418
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh4A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A01
1PBQA 5FHMA 4FISA 3PUVE 3FIWA 4NF5B 2Y31A 3TP0A 2NS8A 2PMZN 5C3EJ 4M3FA 1LFGA 3CSBA 4RY1A 4ZECA 3HHGA 2M34A 1XG1A 1M5DA 2XGDA 2PMSA 2R93J 1IEJA 4KPTA 2DA2A 3SEWA 1BW6A 2I3WA 3JRDA 1D3KA 3C2BA 5I57A 4D7MA 3MC2A 2Z22A 1LCTA 4R6YA 4KCCA 4ZEFA 3GTMJ 1ZR2A 3KN8A 3FV1A 3H6TA 2FYIA 3MZBA 3GTLJ 2R5ZA 1QVTA 2DWJA 2HAUA 3MWBA 2UYFA 1B8IB 2ZYMA 3QPSA 4YKIA 3CFXA 2Y0SN 3ZQGA 3I4NJ 5ITPA 4YB6A 4MIMA 4G68A 4R2FA 3M3KA 4LZ5A 3E9XA 4DZ1A 3T96B 1GDTA 3HBLA 2CMOA 4ELQA 3TQLA 3TEPA 5IP9J 2Y9ZA 2YUSA 1XC1A 2X7PA 3K0VA 3OOAA 5H8SA 5HM4B 5M3MJ 1NK3P 4WXJA 1ZGWA 3V89B 2O51A 2ZNSA 3TAJA 5JTYA 1LE8B 1N7XA 3LSPA 4F22A 4YMAA 2FJ1A 3WHCA 1JT0A 1SFOJ 4ABZA 2DJNA 4I76A 1Y4TA 3HM5A 1A40A 2LP0A 4PFUA 1B2HA 3SFIA 1P1WA 5J1DA 1PUFA 5I2KA 3JRFA 2I0CA 4R6KA 4LONB 2DS9A 3OO9A 4IO6A 4YAHX 2HXOA 1IQ7A 3VFJA 4NF8A 5F0CA 1OFCX 1N04A 2NOGA 5JLXA 1FTMA 5AA2A 2HEUA 1FIAA 5AE4A 3Q0VA 3TTLA 3TW6A 4N13A 4EEFG 1UQWA 1P1OA 4LVQA 3RPWA 3IH4A 1JVYA 2H5YA 2XXRA 4OZ9A 1ETQA 5K2YA 2DE3A 3UN6A 4G8MA 2G93A 1O7TA 3G1OA 3UP9A 3H06B 3VXBA 3O28A 3O97A 4U23A 1Z7ME 1ZLQA 1MBEA 2NWJA 1B40A 2DVCA 1B46A 1JKRC 3G3JA 5IYBJ 2RAEA 1H45A 3K6UA 4JDFA 4QSHA 2LTPA 2M8GX 1VF9A 1ETWA 3IO4A 1YTVA 4C0RA 1LAHE 1I6QA 3B6AA 4GFRA 1R6ZA 5E3MA 1QUKA 1A55A 4O3CA 1UMQA 2RF1A 4IGRA 4M4GA 5FLMJ 1YRNB 4G4PA 1A5JA 2YS9A 4QRZA 2DA4A 2XXQA 4O3BA 4FCYA 1O64A 5H8QB 1B3GA 2HOAA 2V93A 4BDMA 4N07A 3CVGA 1MBHA 2HQ5A 1DTZA 3TELA 2FX0A 3TTKA 4C3IJ 1PC3A 2L7FP 4G8NA 4ZEKA 4OENA 1S7EA 1GV5A 1ZJLA 3G1LA 5F0FA 4R72A 4XK4A 1B58A 4JSDA 4Q30B 2EZHA 2MGQA 3EF7A 4X6AJ 5M2VA 2XHDA 4RBOA 3JRAA 4NE4A 3SERA 1OCPA 1TT1A 4C1TA 1MXXA 4DYCA 3S1RJ 1US5A 2UVIA 3KSJA 2MW8A 3T9UA 4IGTA 2CUEA 3IORA 3DP8A 1HCRA 3BFUA 3DEWA 2RC9A 3PUYE 5LOMA 1IG7A 1APLC 5EG0A 3GBGA 2HDDA 2DWIA 3Q0WA 3OO8A 1QJMA 1ENHA 2DWHA 4OMBA 2PX1A 3K7AJ 2Y7RA 1QKBA 4H8IA 2P81A 3O8GA 3LSLA 1ZKBA 2HOTA 3OD7A 5HBCA 4KHZE 1H3DA 4FE8A 1F43A 1MRPA 1EZ9A 3H6VA 5IOYA 3OXNA 5TP9A 4ISUA 3VPRA 2CQQA 1SI0A 5I58A 1NTCA 5F08A 2O6AA 1PB9A 1RYXA 2XXUA 3FISA 2XB5A 1I6BA 4R73A 2OWTA 2L0KA 2GRVA 4MBPA 4K3FA 3SDFA 3A09A 4BLAA 1NNPA 1LAGE 2Q89A 1MBFA 2Z8DA 1JKQC 1Y3PA 1ORKA 3G7WA 1VNDA 4IY6A 2VGQA 1GR2A 4LUBA 1A54A 2TRTA 2QS2A 5FKNA 3B6WA 3S2VA 1B8IA 2THIA 4KYEA 1MY1A 3BTLA 2AL5A 3ZQIA 4C1UA 5IYCJ 2Y9YA 1EF4A 2I4BA 1QKAA 4OETA 3GTPJ 1D5YA 1MQJA 3FJGA 1BA5A 2I58A 3VLWA 4H5FA 1JVXA 3DM0A 4DZPA 1UTBA 3RNNA 4KI0E 3G3FA 2D21A 3ONMA 1W0TA 1MH3A 5I2NA 1N0TA 5E3LA 2ALUA 4OWDA 3I6VA 4ELRA 4PP0A 1AKHA 1VE4A 2UVJA 3GBBA 2OJTA 4RK9A 2F35A 4AYBN 3CQZJ 2DMPA 2QS4A 3O66A 4THIA 3G3HA 3HOVJ 4ONYA 2Z8EA 1NMUA 2F6GA 5CBSA 4OYVA 3HGYA 2EBIA 3E7LA 3RTFB 3NAUA 5F0HA 1N3WA 3IJXB 1JW1A 3GTOJ 3TCGA 3PUWE 4G77A 1VFDA 3ZOBA 4G12A 1OVTA 4GD5A 1MY4A 2ZYKA 4ECFA 3Q26A 5KCJA 4CYCB 4F3PA 1BKAA 1FCKA 4TOZA 2RC7A 2LR8A 2V25A 3TMGA 2DYXA 5IP7J 1MXYA 4RPOA 2E1OA 1FQAA 1JT6A 1B4ZA 3GTQJ 4NTLA 1ZTYA 3C33A 1OCTC 2Y30A 4KCDA 1II5A 1B72B 4A3CJ 2VHAA 4D7NA 1R9QA 1PBPA 3KGCA 3L6GA 1LAFE 1SYHA 3K6VA 2E0SA 2DP8A 5FHOA 1HSLA 4EF1A 3MP1A 4DCYA 4I6ZA 1MBGA 1MM6A 1AL3A 2LAOA 3H03A 2HI3A 5CRYA 1AOVA 3K02A 4L5EA 2ABHA 1CE2A 4MFEA 3S15J 2GLOA 1JETA 5IOZA 3K2DA 1EU8A 3R6UA 1D9YA 1ZIUA 2O7IA 2I49A 2AIXA 1YRNA 3BT9A 2JMWA 1FIPA 4DYRA 3FK6A 3CIJA 2REGA 2A5SA 2H1KA 2PT1A 3JRHA 4UUSB 3R7XA 1JUPA 2UVHA 3HO7A 1I6HJ 2DXYA 2XRLA 3T93B 1SW4A 1VSOA 3FIRA 4I62A 1GVCA 4TLMB 3SKPA 1B7UA 2F7BA 2DA7A 2NUVA 2DMUA 5DEXA 4LQ2A 4D5FA 4QIWN 4R6HA 3MZ9A 3LSXA 1B1XA 4QFKA 4H6DA 3OSRA 3H3GA 4MFDA 3FVGA 4S0HB 4RNSA 4PFWA 3RQIA 2KT0A 1OMPA 2H4IA 3MN2A 2NXOA 3PMWA 1IRZA 1IXCA 2H8RA 4R74A 4OTEA 3ECRA 1FQBA 2KLFA 2CJJA 3HB9A 5C4XJ 1Y1WJ 3EHTA 3GTKJ 3IOTA 4NF8B 3S17J 3U92A 5CMMA 3IX1A 4IO7A 4BY7J 4H67A 4BY1J 3VLUA 4F39A 1IC8A 3C34A 3QYTA 2WV1A 5BUUA 2JA7J 2I0BA 4OHNA 3FVOA 4GVOA 3C36A 3MVPA 4BDOA 2I4CA 5DTBA 1NL5A 1Z7NE 1N7WA 1FJLA 4DCXA 1W0UA 3VVFA 4U1OA 3T9HB 3FK7A 3PM1A 1JKOC 3PMXA 5AA2D 5I58B 1IUFA 3B6CA 4XKPA 3O9PA 5CI5A 4AQ4A 2GHBA 3I3VA 3FXQA 3LOCA 4TQUQ 2VOZA 4B4CA 5DS9A 3HPIA 2K40A 1B9JA 2R6GE 2XXTA 1FTOA 4AB6A 4MLVA 5DVFA 1A8FA 1OVBA 3JRBA 1Q35A 3HDDA 3OENA 4YKJA 1QW0A 2WKYA 2Q2AA 4DW6A 1HOMA 3MP6A 5H8QA 3EHUA 4XKNA 1LFUP 2JJ7A 3PV0E 4A3IJ 5A5XA 3JRIA 5C44J 1ZKGA 2A5TB 2F5XA 5F04A 1DPPA 3JYRA 3PD9A 1XT8A 5CC2A 1BP5A 1JTYA 1TWCJ 2EZKA 2DQVA 3H7MA 2N8GA 2OBGA 3SETA 5CMCA 3SEVA 4XRSA 1JUMA 4DXBA 3HV1A 4X1EA 3KBRA 2DE2A 3BBRA 5H8HB 1B05A 2H9BA 5TPAA 4D5CA 2QS1A 1QPIA 1OJLA 1Y1MA 1BTJA 4HTGA 4ZE8A 3ZQLA 1MXWA 2B65A 3KJTA 1M5CA 4G68B 3BTJA 4F1UA 4Q5TA 3RKQA 3U94A 4DE8A 2X48A 1UIVA 2R9JA 1ZR4A 1FQEA 2ID3A 1LB9A 1SD3A 3DELB 1RPWA 5I56B 4NF4A 3ZSFA 3IOWA 2OK2A 2Y7KA 2DOJA 3P7IA 4ZDMA 2O68A 4M3GA 2WAQN 4R9FA 3ZQCA 4I9DA 3KN7A 4LZ8A 1ETVA 2GHAA 1CQTA 2DN0A 3DP4A 1FTKA 3N26A 3DLNA 4XTCQ 4GOTA 4W97A 2V3QA 2Y84A 4H1XA 4FE7A 1GT0C 2XSDC 4KYDA 4Z7EA 3CFZA 4HS7A 2QRYA 4XXUA 2B3FA 1PB8A 2YU9J 3HOUJ 4A3EJ 5KDTA 1BJZA 1IGNA 3LSJA 5EYRA 3F0CA 1ZQ3P 1WH7A 1SANA 2GFEA 4X48A 3FKIJ 5EGOB 5M3FJ 5FTHA 3T66A 3K01A 1EZOA 2VI6A 3OSFA 3K1MA 1UG2A 4BBSJ 1YAEA 2ONRA 2DA6A 4HCYA 3S16J 4E0XA 5A5XB 5AA4B 4EDPA 1JW5A 5GPCA 3M3YJ 2F7AA 1LLSA 1TWGJ 3LC8A 4UUTA 1UTBB 1P1NA 3CR9A 2K9SA 4OFOA 2YLNA 3MVZA 5H8NB 2JWTA 4A69C 1SBPA 1Y9UA 3MKLA 1GTKA 4C3HJ 1CB6A 3O8HA 4FTHA 3FXUA 5F1QA 4MH5A 1PB7A 2ECCA 3PPNA 2XD2A 3GBAA 1M5EA 4GWOA 3MAMA 3FJMA 2DA3A 4FEDA 1MQDA 1BIYA 3TCHA 1H8AC 4JSOA 3OSQA 2COBA 3VDFA 3TP3A 5L9OA 2Y2ZA 3SDGA 1MH4A 1ATGA 4AB5A 3H6WA 2DSFA 4F3SA 4ZEBA 3Q3SA 1NH7A 1SW5A 2LVSA 5HPQA 5CM6A 4ZZAA 1EH3A 2XGEA 3THIA 1MDQA 4EQ7A 1MBJA 1URDA 2OCUA 1IXGA 1TWYA 4MO7A 3IAZA 1QVSA 1SYIA 4A3BJ 4PE5B 4RPNA 4IHYA 3PUXE 1P7IA 1FTJA 3ILTB 1N76A 2PBWA 3OO7A 4ELOA 4LQ5A 1ITYA 4JXIA 3W9VA 3ZS6A 5IPAA 2B63J 1TWFJ 4GFBA 3TODA 1H43A 3IR1A 3MW0A 2FA7A 2ZMBA 3E13X 3RY3A 3GTGJ 1U78A 4MFIA 3USDA 2W7YA 1B0HA 2VD3A 1RKWA 4KR5A 5H8FA 3MP8A 2CZLA 3ZQFA 1G2HA 3MVXA 3K6WA 1Q1KA 4PETA 5CBRA 2CUFA 3TQWA 2XX7A 3PPQA 5ITOA 3S9NC 2F36A 5IKBA 4NMYA 3IB1A 4A3FJ 4E0WA 2ID6A 4A93J 5M5YJ 2YPNA 5F27A 4DXUA 3U72A 3IL1B 3WHBA 5K7FA 3HKZN 3BQZA 3WAEA 4IHWA 3QK6A 2JA5J 4H8JA 3RT6B 2XXHA 3HHFA 2L7ZA 1MXVA 1SW1A 5JK4A 3CSGA 1I50J 2R71A 5EGOA 3FZVA 3E3KA 3SEXA 9ANTA 3HGGA 5EHSA 3V5AA 4GRKA 4RJZA 1AH5A 1ZMGA 1MQHA 3H4ZA 4XKQA 4QTRA 1WH5A 3FGSA 2ZNUA 1IITA 5H8HA 5AA4A 5L9SA 4V2GA 2LFBA 4IO2A 1S9TA 2ONKE 3M3LA 1X2NA 5TU0A 3VE1B 4OEUA 1IV6A 3A3CA 4DYQA 1PUFB 1POY1 3AXFA 4YU0A 5KZTA 3I5OA 5EEAA 1OIBA 1DU6A 3GTJJ 3IH2A 5FLVA 2CRGA 4TLLB 1JNFA 5KCJB 1VFCA 3V8XB 1S50A 1A99A 4R2BA 1AKHB 4ZEIA 2ZYOA 2IA4A 3ILUB 1FEXA 3GZGA 1DMBA 2IBDA 1HLVA 3LBSA 3O2AA 2ESNA 3UK4A 1F9BA 4A3JJ 4H65A 5IYDJ 1ZU0A 3S1QJ 1N84A 1NNFA 4EF2A 4UACA 3IH3A 1AHDP 4U22A 2Y7WA 3MPKA 5B70A 1QUIA 5AA2B 3EPEA 3HOZJ 3DP6A 2K9QA 1XS9A 3FXRA 4CYCA 1WODA 3HCQA 1MY0A 4ESWA 3G3KA 2UYEA 2FD5A 1LFBA 1RKTA 5CMBA 1FTLA 4BXXJ 1XS5A 1VFEA 4IO5A 3UA8A 4DDDA 1B7ZA 3K6XA 3OMBA 1P7JA 3N6UA 3MUQA 2ECBA 4QSEA 4IHXA 1NK2P 4NWDA 3LSGA 4GF8A 4XIGQ 2QMXA 1BL0A 2UVGA 1B3EA 4OVJA 3HEFA 1MM7A 3LSRA 3UGWA 5EYFA 3A02A 4U4XA 3S1MJ 4Y52J 5TPAB 1GVDA 2LY9A 1POTA 1B0LA 1JJ6C 5JTYB 3K4UA 1U9OA 2O1LA 3HSTA 1QRYA 3M8UA 3T9VA 4KD5A 4JWXA 4F1YA 1FQCA 4IO3A 1U9NA 1MY2A 1HSEA 1SQYA 2X26A 3UIFA 2B3BA 5M5WJ 2YJPA 1US4A 1Y1ZA 1HDDC 1RR7A 2XPVA 1T0KA 5DVJA 3VXCA 5EG0B 2DMNA 4NF4B 4OEVA 2H98A 1JKPC 1NFTA 1UIUA 1EZPA 2QMWA 3L6HA 3UORA 1GUUA 1B32A 2FQ4A 2JA6J 2LLKA 1IIWA 2VUMJ 2DE4A 3QAXA 3RUMA 1GV2A 2VKEA 4QHQA 3S4UA 1B51A 2OZZA 1B4HA 3MZ1A 3O29A 3B6QA 1WCMJ 4JX4A 3HOXJ 2RINA 4QSCA 1WDNA 1R1NA 3PPOA 4FEBA 2NVXJ 4BDNA 2L7MP 4JBZA 3BR2A 4XKRA 1IDZA 5ICTA 2UXAA 2X7QA 1HSJA 3OOUA 1Z0XA 3IV5A 3QIMA 4IO4A 3JRCA 1YPNA 3PU5A 2Q88A 4MF3A 1B6HA 3BG5A 1XVYA 4BKXA 2TCTA 2NS7A 3PO3J 4PFTA 2F34A 3IOUA 5JEIA 2M2EA 4EQ9A 3CG3A 3IB2A 4QFNA 4F2OA 2D3IA 3OEMA 1NNKA 1DPEA 1N3XA 3BR0A 5J3LA 2P0SA 2M0CA 3CRBA 4M1VA 3NARA 5FKOA 4RYAA 1B5IA 1D9VA 5CMKA 2XD3A 4JX6A 1USYH 3KZGA 3FD3A 4ZZEA 1NNTA 3C9HA 1ETKA 3TFLA 2EH3A 1Y20A 3KFMA 2Q9TA 3CCYA 4NEDA 3FASA 1LBCA 3C31A 1BLFA 4NDLA 3PPPA 1LFIA 1TWAJ 3VLVA 4U21A 1Y3QA 3KN3A 4ND9A 4R75A 5ISUA 4FATA 2QF7A 1NH8A 2HZKA 1XOCA 2E2JJ 2I10A 3U1OA 1USYE 4F3GA 3L1PA 2HQ0A 5EZGA 1FQFA 2O7UA 2Q2CA 5EDNA 1AMFA 2O9LA 2CQXA 4F19A 1LSTA 4NF5A 4EQBA 2HXWA 3CFLA 1Y3NA 3ODBA 4BBRJ 1ETYA 5I56A 2XX9A 1IDYA 1LBBA 3B7DA 1Y4CA 3TDJA 3Q25A 1GGGA 4C2MJ 2BJJX 2V3UA 4ELPA 5J1YA 4FAJA 3TYHA 4GQOA 1GV8A 2ANJA 5F1JA 3Q27A 4NF6B 1AIVA 1B72A 2XGCA 3IO6A 1TWHJ 3E4RA 2M8CA 1B3LA 1MY3A 1YCJA 3IK6B 2QS3A 5J1RA 3TEDA 5FTIA 3B6TA 3U8QA 2HXIA 4JWYA 4YKPA 4POXA 5DT6A 4B3AA 3OSGA 5I84A 5IP6A 3SJMA 3KSXA 2RCAA 5L8DA 4R9GA 2OF7A 1VI0A 4LA9A 3RT8A 1ETXA 2IEEA 3Q28A 1A8EA 1QULA 4DLDA 4EUOA 4A3GJ 1MG1A 5J1UA 3FV2A 2HYJA 4JX5A 2PT2A 2HOSA 5I57B 4LZ7A 4KQPA 5FKMA 2HCAA 1HF0A 1RYOA 3C4MA 5FHNA 1A6IA 5KDTB 1I6AA 1RESA 4IEJA 3S9EA 4F2QA 3RTWB 2R0QC 4A3MJ 1DU0A 3VVDA 4W1UA 3QPLA 3MVYA 1TXFA 4KFQA 2NVQJ 3PMVA 5BWJA 5I2NB 4P11A 4M3BA 5FKLA 3BTCA 4YB5A 2E2HJ 2O8KA 2O84X 4JWOA 3SESA 3KJ7A 2O69A 2RCBA 2EZLA 1D4NA 1POGA 4XIDA 1H89C 2ME0A 1ZTRA 1T56A 2XPWA 2D5WA 4QFPA 3PPRA 1MXZA 4YKKA 4YZZA 2DA1A 1O63A 5F7VA 2F7CA 2QPQA 1PDAA 2NVYJ 1IXIA 3OIOA 1MXUA 2AL4A 3BR6A 2F78A 5L9MA 1SW2A 4FORA 2I3VA 2WB1N 3H6UA 3W9WA 3KEIA 1FTZA 5DEXB 2ONSA 1JQFA 1DTGA 1SVXB 1X58A 3JREA 2AHQA 1XHYA 4YB7A 3RGYA 3JR9A 4PQJA 1VR5A 4OFLA 1P1UA 5K7ZA 3K1NA 2Q8JA 2L9RA 1OQGA 2K9NA 3BR5A 1Z77A 4A3KJ 2Z8FA 1FQDA 5I2KB 3W15C 4EXLA 5E3OA 5K2XA 2DXRA 2O7OA 3N5LA 1J1NA 1OLCA 3RQTA 4UA8A 1XVXA 2DWAA 2XPUA 4GLIA 2CU7A 3SEYA 2XXIA 3HN0A 2E2IJ 4ESXA 2G29A 3TTMA 3F11A 5DTDA 3O6HA 3IJOB 1IJWC 3UKGA 1X2MA 1SDXA 2ZYNA 3TKDA 1K83J 2F6PA 5GP9A 3PGFA 4BDRA 2JA8J 3CG1A 4UUSA 1ZBMA 3CMYA 3WAFA 4OERA 3TW7A 4LOCA 2DA5A 4IY5A 3TTRA 3MVWA 1ANFA 3FVKA 4Q0CA 2R5ZB 2W48A 4X1BA 4B1RA 4PFYA 3OEKA 2Z23A 5BNGA 2XXYA 1MSFC 2R5YA 3C35A 5JLWA 5IAIA 5C4JJ 4GIZA 4J19A 2P1SA 2R92J 1MNMC 1IXHA 4RXLA 3A03A 2M9HA 3FATA 2AYSA 2IEKA 1B5HA 1JW4A 4WKMA 3ZQHA 4U1ZA 5DYHA 3BG9A 1JEUA 4C3JJ 3VV5A 2I48A 3PUZE 2ZXTA 4OESA 1B5JA 2LD5A 1JUSA 3OELA 3S2HJ 2LKXA 4XRSG 2XXPA 3TUSA 4I1DA 2F8DA 3DCFA 1I3QJ 3BR3A 3S2DJ 1P99A 3A3UA 3T22A 4RK2A 4M3DA 4F31B 4RA1A 3BR1A 4DZJA 2KDZA 3BQYA 1JGGA 4X9TA 2E1SA 2MG4A 1WVJA 4YICA 5AA3A 5B7DA 4RDUA 1F36A 4HNVA 4H0WA 2ZNTA 5DVIA 1MPBA 5I59B 2Y7IA 1H44A 1MQIA 3HOYJ 1I69A 4M3EA 4HW8A 1WI3A 2RKMA 1FW0A 2OPTA 1MS7A 2HFBA 4OXVA 3I4MJ 2V84A 2XXWA 2IAIA 2I6EA 5M5XJ 1NKXA 1OQHA 1R9LA 2P2AA 4M6VA 5HODA 1LB8A 2H25A 2FNCA 1Q1VA 4JYKA 2QJEA 5TP9B 1DSNA 4MLQA 3IOVA 4OQOA 3ZKLA 1E3OC 4L17A 4GL8A 3TZAA 3KOSA 3KG2A 2QL3A 2A5TA 4I8CA 4QFLA 1K61A 2X6OA 5AA1A 1B7HA 1IUDA 1UHSA 4P0IA 1ZK8A 4U4SA 4AC0A 1ETOA 3RN8A 4QSDA 4AUXA 1MBKA 1MPCA 2VD2A 3S1NJ 3CI8A 4QFOA 3D1NI 4IHVA 1TFDA 3M4OJ 5GPAA 1UTHA 3C32A 3S14J 1B3HA 3RZOJ 1B52A 3A01B 1RKMA 2OLBA 2GM4A 1MPDA 4NWCA 3U93A 5EZHA 2ZB9A 2ME6A 2RC8A 3BTIA 4U2RA 3Q0UA 2VPRA 2NOOA 5EHMA 1JJ8C 4F18A 3G3GA 2NVTJ 3K1PA 3T9XB 2DMTA 4LATA 3JRGA 3PD8A 3W6VA 2Y7PA 1SI1A 2E19A 5E3NA 2D5VA 3H3VK 2O1MA 4XICA 4EXKA 1URGA 3MPLA 1MSEC 3PO2J 2R5YB 1PEBA 1QUJA 2MSYA 3LNQA 1HDPA 3N6TA 3ZKKA 4O3AA 4NF6A 3GXAA 3MBPA 4ZEDA 3G3IA 1A7LA 4F29A 2JK3A 3LUYA 3TPAA 2V3TA 3QQAA 2DTZA 3MQ9A 2X9DA 1LCFA 2GBYA 2XXXA 3M3FA 4GXAA 4Q8RA 3H0GJ 3GLBA 4GL0A 1AU7A 3VVEA 4X1DA 4N6PA 4YMBA 2DVZA 1XC5A 1TFAA 1R9TJ 4P0GA 4JP0A 1DOTA 3QUFA 5FKKA 3JV9A 3QXMA 3HOWJ 4HCWA 3TCFA 5ICQA 3OO6A 2EQRA 3N94A 5FJ8J 3BKIB 1ELJA 2F97A 5EF6A 4KYSA 3D4CA 4BDLA 5ELVA 2VKVA 1JEVA 1M5BA 2G0EA 2JN6A 1BW5A 3LSFB 3LSWA 3TTNA 2PYYA 4G68C 3MJNA 5I59A 2ELKA 5K7HA 1KWHA 4DIGA 1Y1VJ 3QUJA 1H76A 5H8FB 3S9LC 3QSLA 4LP2B 1L5TA 4G8HA 2H99A 4F3BA 2AO9A 1S7YA 1O4XA 1OLAA 4FIMA 4ZE9A 1URSA 3EN3A 4V2FA 3FVNA 4A3LJ 3S9MC 1RETA 4MLOA 3O6IA 3SEUA 1B3FA 4ZS9A 1UTHB 2XX8A 1QVUA 1LAXA 3LR1A 4FJPA 1B1HA 3A01A 3D4GA 3R26A 3IB0A 3G1MA 4BDQA 2EZIA 1U8BA 4Y7NJ 3CDLA 3KOTA 4QF9A 3FUZA 4OFJA 1P1QA 2HZLA 1WGXA 1TC3C 1T33A 1IZ1A 1LFHA 5H8NA 3FJ7A 4F1VA 3V83A 4Z0IA 2PVUA 1LGBC 1MQGA 1WPKA 3O6GA 2NVUB 2QCOA 1JTXA 4G2ZA 2LK2A 4JB7A 3RLFE 3Q29A 3K00A 3K2AA 3BG3A 1LE8A 3RZDJ 1H88C 4GXSB 2VP1A 2XB0X 4FE4A 4A3DJ 1MDP1 3EQ1A 2QSXA 2REJA 3JZJA 4IB2A 4FECA 3BFTA 4H5GA 4WEDA 4WEPA 1M5FA 2HAVA 4POWA 4DXCA 2DMQA 2R7ZJ 2GH9A 3EHSA 2OWSA 1FTTA 4XRMA 2XXVA
chains in the Genus database with same CATH superfamily
1QGPA 2P5LC 3OYKA 5JVTA 1PBQA 4XN3A 4A6EA 1A31A 5FHMA 2ZCWA 4FISA 1F5TA 2BXZA 5LRRA 3PUVE 3FIWA 4RAFA 1KU7A 1VQ8I 1FBEA 4NF5B 1YI2I 2Y31A 1WRJA 1M1EB 3TP0A 1L3LA 1J59A 2W00A 2NS8A 2PMZN 5C3EJ 2NOJB 5LGTA 4M3FA 1D0ZA 1LFGA 3P7NA 1W5TA 5IZZA 1MIJA 3CSBA 4A5NA 4RY1A 4ZECA 4I98B 3HHGA 2M34A 1XG1A 2XC7A 1M5DA 1VQ9I 3OL3A 2XGDA 1IEJA 4GYIA 3ZN1A 2R93J 2ZBKA 4DNCA 1IMCA 2PMSA 3IFCA 3G3ZA 2DA2A 4KPTA 2OX3A 2A5WA 3SEWA 3CJQB 2QUFA 3ZN0A 1BW6A 3P5JA 2I3WA 4LK1F 2XVCA 3JRDA 4HF2A 1R5HA 3HIFA 4XF5A 1D3KA 3C2BA 5I57A 4D7MA 3MC2A 2Z22A 3HJEA 1LCTA 4R6YA 3Q9VA 5FLXZ 4KCCA 4ZEFA 3W2WA 3LA7A 5DEQA 2IVMA 2DO7A 3SZTA 3ABLH 3M1CA 3GTMJ 1ZR2A 4AIDA 3KN8A 5EYHA 2FUG2 2DLLA 3FM3A 1XB4A 1Z3YA 4J01A 3FV1A 3ROJA 3LFKA 3HHHA 3H6TA 4XLAA 2FYIA 3MZBA 3GTLJ 4I0AA 4LMYA 2R5ZA 4BH9A 3VODA 4QPQA 4XKVA 1QVTA 4NQWB 4LG0B 2DWJA 2HAUA 1OR7A 1XDUA 2F5VA 2QENA 3CJTB 2W7NA 2ZNZA 1H9TA 1X1AA 3MWBA 4JVCA 3CP8A 2UYFA 3FMRA 1B8IB 1YX5A 2ZYMA 3QPSA 1K6OA 2DQRA 1XSDA 4YKIA 3CFXA 3ZPLA 3V7CA 4L18B 4HBLA 2KRCA 5CPRB 2Y0SN 3K4JA 3ZQGA 1T2KA 3I4NJ 1Z21A 1P4AA 5ITPA 1YIOA 3GF2A 4YB6A 4MIMA 1DP7P 4G68A 1AWCA 3M3KA 4R2FA 1HW5A 1IN4A 4PFRA 1BM9A 3A0BC 5B1BH 4Q47A 3E9XA 4LZ5A 4M6XA 3T96B 4DZ1A 4HF0A 5D6FA 4F91B 1GDTA 3HBLA 3LMMA 4RGUA 4KMUX 4A0YA 1MJ9A 1S9HA 3ESWB 3QPHA 1QU3A 2CMOA 3TQLA 2BXYA 4PGHA 3KC1A 3TEPA 3ZCOA 1B6AA 5IP9J 3G73A 2YUSA 2Y9ZA 1YFHA 1VQKI 1XC1A 2X7PA 3K0VA 3OOAA 1MNEA 1X4OA 3FBPA 1R1VA 2VASA 2MD0A 1V5FA 5H8SA 3FDYA 5HM4B 5M3MJ 1NK3P 1XDSA 4WXJA 3EDPA 2EFOA 4IPAA 1Q1HA 1ZGWA 4YZZA 4LN5A 3V89B 3G2BA 2O51A 1LEVA 3QOEA 2ZNSA 3TAJA 1TQIA 5JTYA 1LE8B 4XSXF 1N7XA 5BQTA 3LSPA 5ET6A 1YYVA 4F22A 4YMAA 2FJ1A 3WHCA 1JT0A 1SFOJ 4ABZA 2DJNA 2Y69H 3OWTA 4I76A 1Y4TA 2CZKA 4OAZA 3C2HA 4HX4A 3HM5A 1A40A 2LP0A 1W7PA 5GAEJ 1B2HA 4PFUA 5HS7A 1G3SA 2ELJA 2HDCA 3SFIA 1P1WA 5J1DA 1PUFA 2HVQA 3JRFA 5I2KA 2I0CA 4R6KA 4KIFA 4LONB 2DS9A 2QGUA 4EJVA 3HPGA 3OO9A 4CCLA 4IO6A 4YAHX 2HXOA 1IQ7A 3VFJA 1FPFA 4U7DA 4OFOA 4NF8A 1OFCX 3FXLA 3HC7A 5F0CA 3SFZA 4ETSA 1N04A 1S5LC 2NOGA 5JLXA 4BNCA 1FTMA 5AA2A 2HEUA 1FIAA 1XCBA 5AE4A 2H1LA 2DFEA 2XWVA 3Q0VA 3EKIA 3TTLA 4IKFA 3TW6A 2Z1DA 4N13A 2DW4A 3TO9A 1J2XA 5BOXA 4EEFG 1UQWA 1ON2A 4BHBA 1P1OA 5JR3A 4LVQA 1V3FA 3RPWA 3IH4A 1JVYA 2H5YA 2XXRA 4OZ9A 1R7JA 4DI3D 1ETQA 1PP8F 5K2YA 3MKZA 2P6SA 1HKTA 2E1CA 1DPRA 2DE3A 4GX4A 2XIGA 3UN6A 4G8MA 1SD4A 1J7KA 4UB8C 2LG4A 2L5VA 1SMTA 4OWRB 5KVRA 1H9GA 3AL0B 1O7TA 2G93A 1WJFA 4PCDA 5FBPA 5LGNA 3VB2A 3G1OA 1Z9CA 3UP9A 4MGRA 4BQNA 5HDGA 3H06B 3VXBA 3J81Z 3O28A 3FMQA 3WE3A 3O97A 1Z7ME 4U23A 2F4MB 1R23A 1ZLQA 1MBEA 3WTZA 4ZH4F 4QWQA 3W6JB 5ILVA 1B40A 2CW8A 5ILUA 2P6TA 2P2AA 2DVCA 2NWJA 3CF2A 3ERMA 5CLSA 2DDBA 1EJ9A 5A5XB 1YOVB 3NWTA 1B46A 1JKRC 3G3JA 4OVPA 1D8KA 5IYBJ 2K4BA 2RAEA 1H45A 3K6UA 1NV3A 4P9UA 4JDFA 4QSHA 2LTPA 2M8GX 1SAXA 4CSWA 3FF5A 2XAFA 1VF9A 1ETWA 1ZARA 5ILSA 3F6VA 3IO4A 4CCKA 1YTVA 2JT1A 2F2EA 2OQRA 4PSWA 1RR8C 4C0RA 1LAHE 1SC7A 1I6QA 5DDGA 2B0LA 4LITA 3B6AA 1XGOA 4GFRA 2HZDA 2RNGA 1R6ZA 5E3MA 1QUKA 1A55A 5DM6F 4O3CA 1UMQA 2JA2A 2RF1A 4IGRA 2X1CA 5FLMJ 4M4GA 1YRNB 2HKXA 1TZLA 4G4PA 3R4KA 1A5JA 2YS9A 3M8JA 2A3SA 3MKYB 4RGXA 3A0HC 2VQLA 4NWCA 4QRZA 4OIRF 2QKLB 1RRJA 3OYHA 2DA4A 2XXQA 4NN3A 3KCCA 4FCYA 1O64A 4O3BA 5H8QB 2G7UA 1B3GA 2HOAA 5TGTA 4EJTA 2V93A 4BDMA 3MAJA 4CICA 3DV8A 1EYJA 3F72A 4UY8I 4N07A 3GFMA 2M7AA 1SAUA 3CVGA 1MBHA 5ET7A 2HQ5A 1MJBA 5EEGA 1DTZA 3BLYA 4XLFA 3TELA 5LBQA 2FX0A 3D5SC 3TTKA 2XAHA 4C3IJ 4NHJA 5E8IA 4E4HA 3QU6A 3GFLA 5EQAA 3DF8A 2VBXA 1D9QA 1PC3A 1K7AA 1HKSA 2EFPA 2L7FP 4G8NA 4ZEKA 4OENA 4LG0A 1S7EA 2NRAC 1GV5A 2WA0A 1ZJLA 3G1LA 5F0FA 4R72A 4XK4A 1B58A 4JSDA 5TJJA 4Q30B 2EZHA 3H9GA 4N0BA 2MGQA 4IJAA 3O3KA 5DCFA 2BEOA 3TKYA 3ZMVA 2DFIA 3K4BA 4X6AJ 3EF7A 5M2VA 1ZGAA 4XKWA 5I3SA 2QM3A 4O6JA 2XHDA 3QRFF 4RBOA 3J7AY 1USTA 3JRAA 4G6TB 3CCSI 4NE4A 1LBZA 3SERA 1HA8A 3BJ6A 1OCPA 1TT1A 1FP1D 4C1TA 3RKYA 2XASA 2RNJA 3AKZA 3C3WA 4OIOF 1MXXA 4OVQA 4DYCA 3S1RJ 5LHGA 4BEHA 3QYBA 1US5A 2KIFA 1LDKB 2UVIA 3KSJA 3Q9SA 4XLEA 2CUJA 3F3XA 2MW8A 2HQRA 4RGSA 1A35A 3T9UA 1WKMA 2W85A 4LJZF 4BHCA 5H6QA 4DQ2A 3L2RA 2HR3A 3FHZA 4IGTA 2CUEA 3IORA 4HEA2 2W4SA 3DP8A 3ECHA 4A5MA 1HCRA 4PK4A 3DEWA 3BFUA 1VQOI 1EH7A 5F1RA 2RC9A 2EILH 1Z1DA 1SFEA 1TTYA 3LSMA 3PUYE 1TQMA 5LOMA 1FPIA 4BQAA 1SFUA 3PUBA 1IG7A 2M3AA 1APLC 3F8FA 5EG0A 2V6CA 2M30A 3GBGA 2HDDA 2DWIA 3WE2A 3Q0WA 3FMSA 3PIPF 5E1XA 2VPNA 4PGPA 3OO8A 1QJMA 4PBHA 1ENHA 2DWHA 4OMBA 2PX1A 3EUKL 3K7AJ 1QKBA 2EIKH 2Y7RA 1LFPA 1BR2A 2P81A 3O8GA 1FLIA 1ZKBA 3LSLA 1S7OA 2HOTA 3SDBA 2WBDA 5EYGA 3RPLB 2P3VA 3OD7A 5HBCA 4KHZE 2J5PA 1H3DA 4FE8A 1F43A 4IO9F 3OR1C 1EZ9A 1MRPA 3H6VA 2LH9A 5IOYA 6PAXA 3OXNA 3SEQA 3ULQB 5D5XB 5TP9A 2XAQA 3VPRA 2CQQA 3R61A 4ISUA 3I64A 1SI0A 4XKCA 1PDNC 5I58A 1NTCA 4I99C 5F08A 2IRFG 2O6AA 1YYZA 1PB9A 1RYXA 1R49A 4RGRA 2M8EA 2XXUA 4MNUA 3FISA 2XB5A 1I6BA 4R73A 2OWTA 2L0KA 2GRVA 4MBPA 4K3FA 1YITI 3SDFA 3A09A 2A07F 1O3QA 1IRGA 4HOBA 2PJPA 2B7EA 4BLAA 1NNPA 3IL2A 4Y4RA 1LAGE 2Q89A 3H1CA 4N4UA 1MBFA 3M7GA 2JVHA 2Z8DA 1JKQC 4HDVA 1Y3PA 3EYYA 3O6BB 4PUSA 1ORKA 2VQCA 3G7WA 1VNDA 3CUQC 2IJLA 2JPBA 3CDHA 2O03A 4A2UA 2OJED 2OBPA 1ZH5A 1DPUA 2PMUA 1A54A 2TRTA 2QS2A 5FKNA 3B6WA 4F93B 3S2VA 1B8IA 2KMUA 2LF7A 2THIA 3F22A 1MY1A 4KYEA 3BROA 3BTLA 1CNQA 2AL5A 3ZQIA 2XV4S 1BIAA 4UV8A 5IYCJ 5A2QK 4C1UA 2Y9YA 1EF4A 2I4BA 2X6XA 2O8XA 1QKAA 3H3ZA 1TLHB 3SYTA 1R6RA 3DEUA 2FIEA 3GTPJ 3MWMA 2LNBA 3BPVA 5FO5A 2E1NA 1D5YA 3DBHB 1MQJA 3FJGA 3BY6A 2JPCA 4NQ8A 1NUYA 2NNNA 2DCEA 1T95A 1BA5A 2I58A 2PFZA 3VLWA 2VBYA 4H5FA 1F1ZA 1JVXA 1QZYA 3DM0A 1YHQI 2FMYA 4Y13A 4MNCA 4DZPA 1UTBA 3RNNA 4KI0E 5HS9A 3G3FA 2PFYA 2D21A 3ONMA 1W0TA 2UXNA 1MH3A 5I2NA 4E7LA 1N0TA 5E3LA 2L02A 3H9QA 2ALUA 1BI2A 1VDWA 1L0OC 2FNPA 2FMLA 3I6VA 4OWDA 4PP0A 1AKHA 3HYIA 2R7XA 1VE4A 5KDTB 2UVJA 3GBBA 1J09A 3ECOA 5FGMA 4TV7A 2OJTA 4RK9A 2F35A 2MH9A 4U88A 2X0LA 3VYUB 4AYBN 5JHFA 3EUAA 3GUDA 3CQZJ 2DMPA 3RQ4A 5I7IA 1W4MA 2Q1ZB 3DBLB 4ESJA 2QS4A 3G3HA 3HL2A 2VODA 3O66A 4THIA 3HOVJ 4ONYA 2AXTC 1DGRM 5F24A 3FBNB 1P9QC 2Z8EA 3PFYA 2KIQA 3BCAA 2E34A 5E1WA 1NMUA 2F6GA 4OYVA 5CBSA 3HGYA 2ISZA 4UVAA 4EGYA 2EBIA 1MZBA 1AOYA 2CO5A 3E7LA 4ZDLA 3CCQI 3RTFB 3ELKA 3NAUA 5F0HA 3J81K 2OCCH 2UWMA 1N3WA 5BPDA 3IJXB 1ZG3A 3S3OA 1JW1A 4Y17A 1SEUA 3ZMUA 2E7WA 3GTOJ 3TCGA 5CVUA 3HTUA 3PUWE 2KLOA 3OYJA 3J7AO 3ZMTA 2R7UA 2JRTA 4G77A 1VFDA 3ZOBA 4G12A 2CFOA 1GXQA 3GWZA 3E97A 5KK1A 2O0YA 3SEZA 1OVTA 4GD5A 1MY4A 2ZYKA 4ECFA 1QA6A 4M71A 3Q26A 5KCJA 4RM3A 4CYCB 4F3PA 3K4NA 1JI8A 4HLXA 1BKAA 4HE1A 1WJCA 1D5VA 1FCKA 2GOXB 4TOZA 4GX6A 3VSKA 4WCGA 2RC7A 1S29A 2LR8A 4M9SA 5EEHA 4XLPF 1YJ9I 4I3EA 2P8TA 4LG3A 2V25A 3TMGA 3H9JA 3ZMDA 2DYXA 5IP7J 1F9NA 4N81A 2FBIA 1MXYA 4MEVA 3F8CA 1DK4A 4RPOA 1IN5A 3PQJA 2E1OA 4XKBA 5J4VA 1FQAA 3DPUA 1X19A 1JT6A 1CF7B 2STWA 1B4ZA 1QHGA 1TL8A 3GTQJ 4GWYA 4NTLA 4HSTA 4XLNF 4MTEA 1ZTYA 1LVKA 3IAM2 1OCTC 3C33A 2H6BA 2Y30A 1Y8RB 4HDUA 1II5A 1B72B 3OS0A 4A3CJ 4KCDA 5DD4A 4D7NA 1R9QA 2VHAA 3IHUA 1PBPA 1QPMA 1VQ6I 3KGCA 3IKVA 2F6CA 1LAFE 3L6GA 1OYIA 2RQQA 1SYHA 1IN8A 3HUGB 3HFUA 3K6VA 5HLHA 2E0SA 2WV0A 5F7VA 3D0SA 2DP8A 5FHOA 4G6DA 1HSLA 4EF1A 2VOPA 3MP1A 4NG7A 4N6KA 2DOEA 4DCYA 4I6ZA 4ZZLA 1MBGA 2F4IA 4ZYAA 1MM6A 1AL3A 1WWXA 4ZJZA 4PFOA 2LAOA 3H03A 3HTSB 1YW8A 2HI3A 5CRYA 2HYGD 2XF6A 1DGWY 3IP4B 1AOVA 4M74A 4D0PA 2ZJRF 3K02A 4L5EA 2ABHA 4AVZA 1CE2A 4MFEA 3X2QH 3S15J 2GLOA 1JETA 3DKYA 5E17F 2VIXA 2K86A 3E1SA 2V1DA 5IOZA 4BS9A 3ZR8X 1VQ4I 3K2DA 1EU8A 3R6UA 2TDXA 1D9YA 1ZIUA 2O7IA 2I49A 2AIXA 1YRNA 2ADUA 3BT9A 2JMWA 1FIPA 4DYRA 3FK6A 1W5SA 3CIJA 1OYYA 2REGA 4OAYA 2A5SA 3QU3A 5L3DA 2WEFA 4KIBA 2H1KA 2PT1A 4PAFA 3J80K 3JRHA 1NHAA 2K4JA 1HSTA 3LA2A 4UUSB 1W36C 1C0WA 3R7XA 1JUPA 2H09A 3K9TA 2UVHA 1UZCA 3HO7A 1I6HJ 1KYZA 5D8KB 1KYWA 2DXYA 3N97A 2XRLA 3CMAI 5LHIA 3T93B 4XM3A 1SW4A 2MLKA 1VSOA 3OIPA 4ZYHA 3FIRA 1XTAA 1ZHFA 2OQGA 1DDNA 4I62A 1GVCA 4TLMB 3SKPA 1B7UA 4EJUA 2F7BA 2DA7A 5B1AH 2NUVA 1BJAA 3IWZA 2W82A 3B73A 3OMYA 3JSPA 3KP6A 1UELB 2BHZA 3DKWA 5HDNA 5ESYA 2DMUA 5DEXA 4XQFA 4LQ2A 1MGTA 1KZ8A 4HW0A 4D5FA 4QIWN 4R6HA 1P2FA 3MZ9A 2BJIA 3LSXA 1B1XA 2ZJ2A 4QFKA 4H6DA 3OSRA 5FD6A 3H3GA 1LDJA 1K6YA 1WVRA 4MFDA 4UVBA 4S0HB 3FVGA 2P0WA 3HPHA 3LUZA 4PFWA 3RQIA 3HG9A 3WG9A 2KT0A 1IAWA 3DWLE 1OMPA 2KJBA 3OS1A 2ZFWA 4A12A 2H4IA 3LSIA 5LEJA 2KDOA 3MN2A 2NXOA 3PMWA 1VQ7I 1IXCA 1ZRDA 2H8RA 1IRZA 4PAKA 4R74A 5LFAA 3KYDB 4OTEA 4XRFA 3ECRA 1FQBA 3KP3A 2XWOA 2KLFA 2DYSH 3D5RC 3NRVA 3OYEA 5IZ1A 2CJJA 3HB9A 5C4XJ 1Y1WJ 1ERDA 3EHTA 2A6TA 3GTKJ 3IOTA 4NF8B 3OYGA 3GX4X 2VONA 3S17J 3E3VA 2QZ8A 1W1WE 4N4OB 2V84A 1MMAA 4KT6A 2Y48A 4B3XA 4BGDA 1IMBA 3IX1A 5CMMA 3U92A 1SPIA 4IO7A 3TGNA 1S8NA 1YQAA 2V1XA 4BY7J 4YFXF 5IT9K 4H67A 1X3ZB 2JZYA 1YX3A 4EM2A 4BY1J 3VLUA 4F39A 4P9KA 2EIJH 5ICEA 4NBQA 1IW7F 1BI0A 1IC8A 3C34A 3IUOA 2LY2A 3ZXSA 2FBPA 3QYTA 4NF0A 4P8BA 5CQEA 2WV1A 3AG1H 3M8EA 4WX9A 5GTIC 3RYRA 5BUUA 2JA7J 4IXAA 2I0BA 4OHNA 2A68F 2FU4A 3FVOA 4GVOA 3C36A 4H45A 3MVPA 1PJRA 1J5YA 1S6LA 4BDOA 3JSOA 2I4CA 5DTBA 4Y33A 1NL5A 1Z7NE 4PJ0C 3IKTA 3PNYA 1N7WA 3P9KA 1S7AA 4MEYF 1FJLA 5FD5A 3V7SA 4HRIA 4PC9A 4DCXA 4BE0A 2DPUA 3T8RA 1W0UA 3VVFA 3O2PE 4P9FA 1O7FA 4IRGA 3FK7A 3WU1B 3PM1A 4U1OA 3T9HB 3CTAA 4N6DA 4QBAA 2FA5A 2KJCA 1JKOC 2HXRA 3PMXA 5AA2D 5I58B 1O3SA 5DCMA 1IUFA 3LAJA 1WJDA 3B6CA 1YJNI 5L3BA 1YXIA 3O9PA 3VSLA 4O8MA 4XKPA 4LLNA 5CI5A 4AQ4A 5L3CA 1SVOA 1Y8QB 2WWYA 1INPA 2GHBA 3CDIA 2HTSA 1XMKA 3I3VA 3FXQA 1XHYA 3LOCA 4TQUQ 3FXMA 2VOZA 1R1TA 3K6GA 2UXXA 4B4CA 2DOFA 5E20A 2H6CA 3F8MA 4BUPA 3V8JA 5DS9A 3HPIA 2K40A 1FPJA 1B9JA 4GBVA 2M4KA 2ZXJA 4B8XA 4HLYA 2R6GE 2XXTA 1FTOA 4AB6A 2FF4A 1OPCA 4MLVA 5DVFA 3JTGA 5BS6A 1A8FA 1G8XA 1OVBA 3JRBA 1Q35A 3HDDA 3OENA 1O3TA 4YKJA 3TOBA 2QKMB 3L2VA 1FJ9A 1T0FA 1QW0A 2WKYA 4ENMA 1WFXA 2Q2AA 4BQOA 4DW6A 4LGWA 1IN6A 1HOMA 3MP6A 3T0YA 4GGGA 3KLOA 3EHUA 5H8QA 4XKNA 1LFUP 2JJ7A 2BY3A 4L0YB 2F48A 1JXSA 3PV0E 1IV8A 4XOTA 5D5WB 4A3IJ 1VQ5I 1WZ2A 3FXKA 5A5XA 1JE8A 1YLFA 2L54A 4C30A 3JRIA 3BZCA 4N8GA 4N91A 1ZLJA 5C44J 1ZKGA 4D1QA 2A5TB 4OVSA 2F5XA 1YZ0A 1BR1A 2MYSA 5CKTA 5F04A 1DPPA 2MKZA 3JYRA 5B66C 1D8JA 3PD9A 1XT8A 5CC2A 4PCQA 1BP5A 1JTYA 1G3YA 1TWCJ 2EZKA 4UV9A 4YIFA 3K70D 2DQVA 3H7MA 4PFBA 3E6MA 3HRTA 2N8GA 4QLCU 4IR8A 2R7QA 3K4KA 3RPUD 2OBGA 3SETA 5CMCA 3SEVA 1KQ9A 2D45A 2LY1A 3E5UA 4I3YA 4XRSA 4BXUA 1JUMA 4DXBA 3PNTA 3HV1A 3KLNA 4JBAA 2E5NA 4X1EA 4A0ZA 3GFIA 3KBRA 1FTAA 2DE2A 3V4GA 4BJTA 1QQIA 2DQLA 3ROUA 4FX0A 3CCUI 1FBSA 2LOOA 3T8TA 3BBRA 4MNIA 5H8HB 1B05A 2H9BA 1FBCA 5TPAA 1N25A 4D5CA 4F92B 1WI9A 4DOZA 3ZQ7A 3OIQA 1QPIA 2QS1A 1D1CA 1OJLA 1Y1MA 1BTJA 2RREA 4HTGA 4PAIA 4ZE8A 3ZQLA 1MXWA 2B65A 1HBXG 1M5CA 4ITVA 3KJTA 1W7PB 4MAGA 5IM2A 4NC6A 2KP6A 4MQ9F 4G68B 3BTJA 1U0JA 4F1UA 1MKMA 4Q5TA 4IY6A 1FPGA 2X6YA 2FNAA 1FMWA 2DODA 5DM7F 3RKQA 1PUEE 3U94A 2R4GA 4DE8A 1USSA 2X48A 3D5LA 4GDFA 3K69A 4BU2A 4CUGA 3DPLC 4NNJA 1UIVA 1ZR4A 2QBYB 2R9JA 3I59B 4XL9A 1FQEA 1V4RA 4Q4ZF 3GZ5A 2QQBA 1RUOA 3KEQA 1NV0A 4NHBA 2ID3A 2FVZA 2DT7B 3F9KA 2OC6A 2V9PA 1FBQA 1LB9A 3ABTA 1SD3A 3OY9A 3ZMZA 2QLZA 3DELB 1RPWA 2VKHA 3L9FA 5I56B 1OCRH 4NF4A 3ZSFA 3IOWA 1HXDA 3VYSB 3TO7A 2R8TA 5IZ3A 2OK2A 2CZHA 5KAIC 4S05A 2QSGX 2Y7KA 3G4SI 2DOJA 3P7IA 4ZDMA 2O68A 4M3GA 1A04A 5TRDA 1FNNA 2WAQN 4R9FA 3ZQCA 4I9DA 3KN7A 4LZ8A 1ETVA 4P5OA 4UHTA 3R0AA 1CQTA 2GHAA 2DN0A 1KZHA 4IL6C 3DP4A 4QPOA 3RKXA 1FTKA 3BZKA 3N26A 3DLNA 4XTCQ 4GOTA 4W97A 5A5LA 2V3QA 3HRSA 2V4JC 2Y84A 4RS8A 3DLLF 4H1XA 4FE7A 5B5EC 5EQ7A 2WBMA 1GT0C 2XSDC 4A0XA 1YW9A 2OV7A 2CZIA 4KYDA 4Z7EA 3CFZA 4HS7A 1I5ZA 4AWXB 3LQRA 2B3FA 5BPIA 1PB8A 2QRYA 4XXUA 2YU9J 3HOUJ 4O3MA 3HZJA 4A3EJ 5KDTA 1BJZA 1IGNA 1FBUA 4KNYA 4ZE9A 3ZQQA 3LSJA 4BJ5C 5K5RA 2D1VA 2VJ5A 4LIUA 2V79A 3AFHA 5EYRA 3WGHA 1TNSA 3F0CA 3FX3A 3OV8A 1ZQ3P 1RDZA 3PTYA 3OYDA 1FP2A 3HOSA 1WH7A 1S3JA 1SANA 2GFEA 2ZJQF 4X48A 3GLXA 3FKIJ 5EGOB 5M3FJ 5FTHA 2DFHA 2GOMA 2XUBA 3T66A 3GZNB 3K01A 3EUHC 4MNPA 3MSTA 3A29A 1EZOA 1NG6A 2KZGA 5EQ9A 1FBDA 2Q2EB 2D2WA 2L4MA 1KA8A 2PFBA 2VI6A 3FWEA 2COMA 4YEJA 3OSFA 1JP4A 3K1MA 2OAZA 1UG2A 4E6KG 2ICWG 2DTRA 2XF7A 4BBSJ 1YAEA 2MABA 2DA6A 3V8LA 5DUIA 3S16J 2ONRA 4H8IA 4HCYA 4E0XA 4EDPA 3HRMA 5AA4B 1JW5A 4ENJA 2F5EA 3BJAA 1U2WA 5GPCA 2A6HF 3M3YJ 1ZRFA 1LBYA 1RDXA 4ELRA 3L09A 2F7AA 3MQ0A 1FSEA 2IP2A 3L2QA 1TWGJ 1BN5A 1XGNA 1LLSA 3LC8A 2RC4A 1G0IA 4UUTA 5E18F 2O5RA 3DPTA 1MMDA 2DT5A 4AIKA 1XSVA 1Z6RA 4BACA 2K9SA 1P1NA 1UTBB 2YLNA 3CR9A 2JWTA 3NQOA 4A69C 1SBPA 4FT8A 3MVZA 1Y9UA 3CHGA 3MKLA 4LIVA 1GTKA 1NV1A 3WTXC 4C3HJ 1N75A 1CB6A 2EPFA 3O8HA 2ZXHA 4FTHA 2HVRA 1HW2A 3DTEA 3OYBA 4EATA 2PCRA 3DFGA 3FXUA 1CGPA 3T0JA 4CCOA 5F1QA 3BWGA 2E1MB 4MH5A 1PB7A 2ECCA 4CHUA 3PPNA 3OYFA 2BE5F 4M73A 2Q74A 1M5EA 5KHDA 2XD2A 3GBAA 4LUBA 2OZUA 1ZG5A 2ZJPF 4GWOA 1YJWI 3MAMA 3FJMA 2DA3A 2RKHA 2EWNA 4FEDA 1MQDA 2NS0A 2IS4A 1BIYA 4P1LA 3TCHA 4G6QA 3LAPA 4KICA 1H8AC 1FBPA 4JSOA 1ZG1A 1YO5C 2COBA 4UVCA 5ICFA 3TP3A 3OSQA 3VDFA 5D6EA 4G7OF 5L9OA 2LRDA 2Y2ZA 3SDGA 3RDIA 1MH4A 4DBQA 2PLYA 3M8FA 1ATGA 2R7VA 4AB5A 3H6WA 2K7LA 2DSFA 4F3SA 4ZEBA 1E3PA 2XKOA 3Q3SA 4B47A 1NH7A 2FE3A 2K02A 2LVSA 1SW5A 5HPQA 4B09A 4IOCF 4DIQA 4ZZAA 5CM6A 1D0XA 1UFMA 1EH3A 2XGEA 3THIA 3DLAA 4B43A 1MDQA 4EQ7A 2LF8A 4B44A 3E0JB 4CCMA 1MBJA 1URDA 2RN7A 2OCUA 1DUXC 1XMAA 4KT5C 1Z91A 1V54H 1IXGA 3FKJA 1TWYA 2K27A 2W25A 3A4CA 3SZPA 4MO7A 2KQRA 2IXSA 4RB0A 1QVSA 3IAZA 1JHHA 1SYIA 1MMGA 4XONA 3CCEI 4A3BJ 1OR7C 3WTVC 4PE5B 2OLBA 5GAGJ 3GLLA 4RPNA 3CUQA 4IHYA 1P7IA 2KRFA 2M45A 1FTJA 2F3DA 3PUXE 1FX7A 4GXOA 2VJJA 2BVMA 5LTCA 4CZCA 1YIJI 2ZZVA 3ILTB 4PFIA 1T8IA 1N76A 5KAFC 3RPLA 2G7HA 2PBWA 3OO7A 4ELOA 1XD7A 3CZ6A 5LGUA 1ITYA 1RI7A 1T38A 3K0LA 4LQ5A 3GYYA 4JXIA 2BHYA 3PSIA 3KP7A 3W9VA 2CW7A 4YG2F 3ZS6A 4KN7X 2JSCA 5HNFA 5IPAA 2B63J 2P5KA 2WB1A 1TWFJ 3D1RA 3BOQA 4GFBA 1FYMA 3TODA 3N4MA 1H43A 1D3YA 2WYPA 3IR1A 3MW0A 1FPBA 4UNOA 3HKZA 3KC0A 4RA2A 5F64A 3DU5A 1KA0A 2FA7A 3GTGJ 2FIXA 1U78A 2ZMBA 3E13X 3RY3A 4MFIA 1YTYA 3USDA 2W7YA 3I9V2 4MEXF 1B0HA 4ESBA 4CXFA 2VD3A 3MZ8A 1RKWA 1FYKA 4KR5A 5H8FA 3MP8A 2CZLA 4Q5SF 3ZQFA 2XDVA 3A1YA 1G2HA 3MVXA 3K6WA 1X3WB 1Y6IA 1Q1KA 3OYNA 4PETA 5CBRA 1WJEA 2BV6A 2CUFA 1P4WA 3IAS2 3TQWA 1NV6A 3MKWB 1R1UA 2GAUA 1LBVA 2XX7A 2O6GE 3PPQA 4E7JA 5ITOA 2F36A 3S9NC 2HWVA 5IKBA 4XN0A 4LLLA 4NMYA 2CMPA 1IMEA 3KP2A 4A3FJ 1WHUA 3IB1A 4X04A 4IQJA 2ZZWA 4E0WA 4HQEA 3S3MA 2ID6A 2EINH 2JUGA 4YIRX 1YE9A 4A93J 5M5YJ 4OIQF 5D4RA 2ETHA 2BYVE 1OKRA 3AG2H 2P5VA 5F27A 2FOKA 2YPNA 3S8PA 5ET8A 4DXUA 3I3LA 3T1BA 2MA3A 3DQVC 3U72A 3IL1B 2DOAA 3WHBA 5K7FA 3HKZN 2L3DA 3CC2I 3BQZA 1FSHA 4IZZA 2ZXIA 2CV0A 3WAEA 4KJZA 4IHWA 1IO2A 3QK6A 2JA5J 3K4LA 4RB3C 4H8JA 3CCMI 3RT6B 2XXHA 2WBBA 3E78A 1R71A 3H5RA 1Q9DA 4IOAF 1T0FC 2QA4I 2L7ZA 1MXVA 3G71I 1SW1A 2WYKA 3HHFA 5JK4A 3CSGA 1I50J 2R71A 5EGOA 4OETA 1DQUA 4XBFA 5J4YA 4OMZA 4KYWA 3I71A 4GWUA 4NUBA 2EFNA 4WWCA 3FZVA 3I55I 3E3KA 2JVGA 3SEXA 9ANTA 3HGGA 3EYIA 3ML6A 5EHSA 3NEUA 3V5AA 1X1BA 4GRKA 4RJZA 1AH5A 1ZMGA 1MQHA 3H4ZA 2M1BA 3JAMZ 3H0DA 2FSWA 2HKOA 5ET5A 1WJ5A 4XKQA 2Y5KA 4QTRA 1WH5A 2ZNUA 3FGSA 1IITA 5H8HA 1IXRC 5AA4A 3SXYA 5L9SA 4V2GA 4L5IA 2LFBA 4IO2A 2CSOA 1S9TA 2ONKE 2RDPA 3M3LA 1X2NA 5TU0A 3CC7I 1Z7LA 2XROA 4OEUA 3M1EA 3MCZA 1IV6A 3A3CA 3VE1B 4DYQA 1PUFB 2HPIA 2ELHA 4ON0A 1TW3A 4R8HA 2MBFA 1POY1 4P1EA 3AXFA 4YU0A 3RKWA 2EFWA 3E5QA 5KZTA 2J5OA 3I5OA 1TT5B 4DI4B 2Z2SB 5EEAA 1OIBA 2YSRA 3GMEA 1IF1A 2M87A 1DU6A 1GLNA 4II3A 2Z3YA 3K4MA 1A6QA 5E79C 2VQGA 5LHHA 4YFKF 3GTJJ 4H0EA 1FOXA 3IH2A 2CEXA 3Q5FA 4PDDA 2JTVA 5FLVA 1KU3A 2CRGA 4TLLB 3WGIA 1JNFA 1VFCA 5KCJB 1K4TA 2Q0OA 2VB6A 2E1MC 3V8XB 1S50A 2UZKA 5CVVA 1A99A 1LB2A 4L9JA 1ZELA 4R2BA 1AKHB 4ZEIA 2ZYOA 4HPQA 2IA4A 2K3FA 1W36D 2YX4A 4IRHA 3ILUB 2Z9OA 1KQ8A 1FEXA 3T5XA 2ZO4A 3GZGA 4FBPA 2CYYA 1XMXA 2FXAA 2FBKA 1IRFA 1DMBA 5LDZA 2PBIA 3MZYA 2IBDA 1HLVA 2QVUA 3REOA 2ZMEA 3LBSA 3O2AA 3ERED 2Q8KA 1Z05A 2ESNA 2X1EA 1G3WA 3UK4A 1FOYA 1RC9A 2PX9A 2EIMH 2IS1A 4A3JJ 1F9BA 4WF2A 2RV8A 3P9CA 2B4LA 4H65A 5IYDJ 4AS5A 1ZU0A 1Y0NA 1YW7A 1ZN2A 3RYPA 3S1QJ 3BIGA 4O94A 1LBXA 1KGSA 1UG0A 4HQMA 1N84A 1NNFA 1VQPI 4PGNA 2EV6A 3R0JA 4P56A 4UACA 3IH3A 4EF2A 3KIOA 1AHDP 3RPQA 4U22A 1VQLI 2Y7WA 3MPKA 5B70A 1QUIA 2XAJA 2JJKA 4CGZA 5AA2B 3I56I 1G3TA 3HOZJ 3EPEA 3DP6A 2K9QA 1XS9A 3FXRA 4KDPA 4CYCA 3A2KA 1WODA 3HCQA 1MY0A 4U0YA 1RNLA 4I02A 4ESWA 2R7OA 5J8CA 3G3KA 2X4HA 3OS2A 2FD5A 2UYEA 1LFBA 1A36A 1RKTA 4UXNA 4O7IA 5CMBA 4ANJA 1N77A 1FTLA 2HFHA 2LC2A 3KP5A 4BXXJ 1XS5A 4IF4A 1VFEA 1XGMA 4G7HF 1ACIA 4IO5A 4UABA 4P1WA 4HZFA 2OZ6A 3UA8A 4DDDA 1FC3A 1SFKA 1E17A 1XCVA 3MZHA 3J80Z 1B7ZA 1MMNA 2DJIA 4I01A 1K9ZA 2LKPA 3K6XA 1LEAA 3IWFA 3OMBA 1P7JA 1ZREA 3N6UA 4BJ6C 4CCJA 3MUQA 4ZYDA 2CQKA 2ECBA 2QSFX 2D1HA 4HE2A 4QSEA 4IHXA 1NK2P 4AM3A 3LFUA 2EK5A 4NWDA 3HUGA 3LSGA 4GF8A 2H8WA 4XIGQ 2QMXA 3FXOA 4MTDA 2DK8A 4YELA 2F4OB 1BL0A 1NV7A 2UVGA 2KPMA 1BOBA 1B3EA 1P4XA 4OVJA 3HEFA 5B3SH 1MM7A 3LSRA 1XX5A 5H8NB 3UGWA 3GVAA 4P55A 4HF1A 5EYFA 2E71A 3ZMSA 4N17A 2MLGA 3A02A 4U4XA 4KISA 3S1MJ 4XFEA 1X4PA 1YS6A 3SZGA 4Y52J 3EUHA 3L2WA 1SVMA 2I8DA 2W57A 3CO7C 2HNHA 1GVDA 3QOPA 5TPAB 2DT6A 1IMDA 1QZEA 2LY9A 5TP9B 4ZC3A 1B0LA 1POTA 5I5PA 1H0MA 1JJ6C 5JTYB 3K4UA 1U9OA 2O1LA 2Y7PA 3CF5F 4J00A 3HSTA 1QRYA 3M8UA 4PF6A 3T9VA 4KD5A 3W2AA 2K3PA 5AIQA 1U6GA 2CQNA 4KUMA 1FQCA 2QSHX 1U9NA 4IO3A 4JWXA 4F1YA 3QP6A 1MY2A 1HSEA 1SQYA 2ZSHB 1TP4A 1SVLA 4PBQA 1HW1A 2X26A 5IGAA 3I59A 3LSHA 5ERIA 2DDKA 3UIFA 2B3BA 1BI1A 2DPDA 4MMPA 5M5WJ 2DYRH 2YJPA 1X1CA 1TBXA 1US4A 3BPXA 1G4DA 2E60A 1Y1ZA 4ENNA 4Z6YA 1QO0D 1HDDC 2K9MA 4KN4X 3TMOA 1RR7A 2DBBA 2XPVA 1T0KA 2V9KA 3WTTC 5DVJA 3VXCA 5EG0B 4BQQA 4HNTA 2DMNA 3F8BA 3HRUA 4L9VA 2OD5A 1B59A 2Y5LA 4NF4B 4NGUA 2HGCA 4N9IA 3OL4A 4OEVA 2H98A 4WXCA 1IMAA 2X1DA 1JKPC 1NFTA 3GYHX 2CUZA 4DJAA 3BCBA 1REPC 3DP7A 4L9NA 3HXLA 1UIUA 4MHFA 1EZPA 3W3CA 3RTRA 3V42A 2QMWA 3L6HA 3UORA 3K2ZA 1GUUA 1XGSA 5KNLA 2LBFA 1B32A 1FPEA 2FQ4A 4RAYA 4LB5A 2JA6J 2LLKA 3KX2A 4FQGA 3RJPA 2V6EA 1IIWA 4BEHB 5GAHJ 2VUMJ 2DE4A 4H4KC 2GA2A 3QAXA 5J47A 3R60A 3QMFA 3RUMA 1GVJA 1GV2A 2VKEA 2W24A 3GZ6A 2H27A 2V4CA 2PJRA 2LREA 4QHQA 3S4UA 2XXKA 4F3QA 2HU9A 1OLTA 1B51A 1GR2A 2OZZA 1B4HA 5HS8A 1FBGA 1BK4A 3MZ1A 2HQNA 3O29A 3B6QA 4EMSA 1NUWA 5DCMB 1WCMJ 4JX4A 1BC8C 4F52A 2QQAA 4M9ZA 3HOXJ 2RINA 4QSCA 1BR4A 1LQ1A 1R1NA 1WDNA 3PPOA 4FEBA 4PTKA 2NVXJ 4BDNA 1KU2A 2L7MP 1ZYRF 3RPUA 4JBZA 3BR2A 4XKRA 4LD5A 1IDZA 3ONQA 5ICTA 2VT2A 2UXAA 1Y56A 3U65A 2X7QA 1HSJA 4Q48A 3DKXA 3OOUA 1P92A 1Z0XA 2JSPA 3CMMA 4C2UA 1SD7A 3IV5A 3QIMA 2QQ9A 4IO4A 3JRCA 1YPNA 3PU5A 2Q88A 4MF3A 3F6OA 3FXJA 2IA1A 4HNUA 1B6HA 3BG5A 3MD2A 1XVYA 4BKXA 4LK0F 4OINF 1GXPA 2TCTA 5DYMA 2NS7A 4L5JA 4NC8A 3PO3J 3FBIB 2NAZA 4PFTA 2F34A 1HQCA 2ZSIB 3KZIC 5A2QZ 3IOUA 1UHMA 5JEIA 2M2EA 2XAGA 3CG3A 4EQ9A 1X1DA 3RCOA 2XWKA 3IB2A 4IB2A 1VZ0A 4QFNA 4F2OA 2D3IA 3B50A 3OEMA 5LD2C 1XI6A 1NNKA 5ICCA 2CH0A 2XSJC 1DPEA 3BR0A 3KPHA 3U1KA 1N3XA 2XWIA 5LEKA 4AD9A 2R7RA 4K2EA 3QAHA 4M9XA 5J3LA 2R7WA 2M0CA 2P0SA 2DDAA 3CRBA 3NARA 4M1VA 2HDWA 5FKOA 3VFZA 4UUVA 1B5IA 4RYAA 1D9VA 4IRIA 5ICGA 2MD5A 1JHFA 4BXFA 3H35A 4CDGA 2GXAA 4RAZA 5CMKA 3AG4H 2XD3A 2EFQA 3AAFA 4JX6A 3E5XA 4GO1A 1USYH 3WTUC 3KZGA 3FD3A 4ZZEA 1NNTA 2JRMA 3C9HA 1ETKA 3TFLA 4ELQA 3KZZA 3W2VA 2EH3A 1Y20A 3KFMA 2Q9TA 3CCYA 4NEDA 3FASA 1LBCA 2GA1A 3C31A 3FM5A 3QYFA 1W5CC 1BLFA 4NDLA 4ASNA 3PPPA 1UCRA 1LFIA 4U0WA 1TWAJ 2VC1A 5HLTA 2RVCA 3VLVA 4U21A 2F3BA 4P47A 2PMHA 3SHFA 1Y3QA 3KN3A 4ND9A 4R75A 5ISUA 2WY8Q 4U87A 4FATA 2QF7A 1NH8A 2MC4A 2HZKA 2EB7A 1XOCA 2E2JJ 2I10A 2PEXA 4A6DA 3U1OA 1Z67A 2LMDA 3MMYB 1USYE 3AL0C 4F3GA 3LA3A 1B9MA 3L1PA 1QGXA 2VXZA 5EZGA 2HQ0A 1FQFA 4OA4A 2IGMA 1DCUA 3C2GA 2PN6A 4PJJA 2O7UA 3LSTA 1LPQA 2JUCA 2Q2CA 1Y0UA 5AIPA 4HXVA 5EDNA 1AMFA 1JGSA 4ESFA 2VKDA 3IRQA 2O9LA 1HC8A 4MCOA 2Z33A 2CQXA 1VQNI 4MJOA 5DV5A 4F19A 2JQ7A 1LSTA 3OYLA 3CMEI 2QEXI 2OUMA 1OISA 4NF5A 3CP2A 2HXWA 3CFLA 2HOEA 1E0EA 4EQBA 4YRVA 1Y3NA 4BBRJ 1ETYA 1EH6A 2V26A 1FBFA 3B8BA 2F5DA 4RAGA 3ODBA 1R22A 2AS5F 5I56A 2XX9A 5DW8A 1IDYA 2GQ1A 2IGOA 1LBBA 3B7DA 1G0HA 2IGNA 3BC8A 1Y4CA 3TDJA 2HZTA 2EV0A 3Q25A 4D9JA 3ZGKA 1X3UA 1GGGA 1BBYA 4C2MJ 2BJJX 3PNVA 2V3UA 4ELPA 5J1YA 1STZA 2O61A 2EV5A 4PE3A 3TYHA 4FAJA 4GQOA 1GV8A 2OCEA 1E3HA 5F1JA 2ANJA 3Q27A 1EA3A 1ZAOA 3WODF 4NF6B 1AIVA 2PG4A 1B72A 2STTA 4ZDOA 1D1BA 2XGCA 2VT3A 3IO6A 1TWHJ 2YX7A 1PVEA 3E4RA 3HSRA 3L7WA 3PQKA 2M8CA 3BG7A 1B3LA 3L2CA 3TL4X 1MY3A 1YCJA 3EPZA 3K10A 5L3FA 3IK6B 2BW3B 4ZTFA 3VYTB 3WU0A 1KU9A 2GIVA 3ZP5A 4KFCA 3QPTA 2QS3A 4GWXA 5J1RA 3TEDA 5FTIA 3B6TA 2PQ8A 4OANA 4G94A 2A6EF 3S32A 1VQMI 3U8QA 2HXIA 4JWYA 4HE0A 4YKPA 4POXA 5DT6A 3GEZA 5DUKA 4B3AA 3OSGA 4X0GA 5IP6A 2CV1A 5I84A 2ZFUA 4NQWA 2YPRA 3SJMA 4XSZF 3KSXA 1LBWA 3MFKA 2VPLA 2RCAA 5L8DA 1R36A 4R9GA 2VQHA 4R1HA 2FEZA 3OYAA 4XMYA 2OF7A 1QBJA 1VI0A 3BZ6A 4LA9A 1ETXA 1Z3XA 2WC2A 1FOKA 4WXDA 2ACJA 1A8EA 1QULA 2IEEA 3Q28A 1FY7A 4DLDA 4EUOA 1V55H 3H3UA 3N05A 5J1UA 4A3GJ 1MG1A 3TQNA 2KRHA 3FV2A 2B9SA 3ZRGA 2HYJA 4JX5A 2PT2A 2HOSA 3H5NA 5I57B 1TW2A 4LZ7A 2VT5A 4KQPA 5CVRA 2HPGA 5FKMA 4RLFA 4O7MA 1X1PA 2K9LA 4RB2C 1XN7A 2HCAA 1HF0A 3J7ZI 1RYOA 3C4MA 1A6IA 4H46A 1RIOH 1KQ0A 1I6AA 5FHNA 1RESA 4XLHA 3KEOA 4CCNA 4IEJA 4MQVA 3S9EA 4F2QA 2CV2A 2G9WA 3RTWB 3KZYA 2EA4A 2R0QC 4A3MJ 2AXLA 1DU0A 3VVDA 4W1UA 3QPLA 3MVYA 3UNGC 3S3NA 1TXFA 4KFQA 2QYOA 2NVQJ 1I1SA 3PMVA 4ZZDA 2MFZA 1NH3A 1VTNC 5BWJA 5L3GA 4IHTA 1I3AA 4P11A 5I2NB 1MDMA 4M3BA 1FMVA 5FKLA 3BTCA 4YB5A 2E2HJ 2O8KA 1FT9A 3PFIA 2O84X 4JWOA 3SESA 2O69A 2EZLA 1D4NA 1POGA 4XIDA 4EGZA 2RCBA 3KJ7A 1WJBA 1H89C 4OU0A 3VOEA 2ME0A 3U1DA 1ZTRA 4JQFA 1T56A 2V1UA 2XPWA 5D5UB 4RMNA 2D5WA 4QFPA 1W7PD 1FYLA 3IRRA 1OCZH 3WU2C 1MXZA 4AIHA 3KBZA 3PPRA 4YKKA 2DA1A 3CLOA 2CWEA 5FFXA 5K5OA 2HS5A 1O63A 1PDAA 2F7CA 2QPQA 3OR2C 2NVYJ 1IXIA 1IN7A 3OIOA 4IVNA 5T3JA 1TNTA 1MXUA 2AL4A 3BR6A 4E7KA 2HTJA 2F78A 5L9MA 1SW2A 2CEYA 4FORA 2L4AA 2WB1N 2I3VA 4EVIA 3H6UA 3W9WA 3LWFA 3KEIA 3DU6A 1FTZA 5DEXB 2ONSA 2DK5A 3DEEA 1JQFA 2L9VA 4L9TA 3W6KB 4PDHA 1DTGA 3CCRI 1K9YA 1J0RA 1SVXB 3PSFA 1K78A 1X58A 3JREA 2AHQA 1O3RA 1NUXA 3GW2A 3JR9A 2FBHA 2ZMEB 1FJ6A 4MIJA 4PQJA 4YB7A 1VR5A 3U9GA 4EM0B 4PJLA 4OFLA 1P1UA 5K7ZA 4CYDA 3K1NA 2XRNA 2H94A 2L9RA 4JVIA 2Q8JA 3I54A 5HVQC 5HOOA 2FHYA 2GZWA 2K5CA 1U3EM 4BL0B 1OQGA 2K9NA 3BR5A 1D0YA 1Z77A 1IXSB 4A3KJ 2IA0A 2FRHA 5HLIA 1FQDA 2Z8FA 5I2KB 3W15C 4BYYA 5HLGA 4XEQA 4EXLA 5E3OA 4F55A 2HHMA 4II2A 2IS6A 2BW3A 3AG3H 5K2XA 1AWBA 1LEBA 2DXRA 2O7OA 4HX7A 3CC4I 1J1NA 1OLCA 3N5LA 2ZC2A 1NV2A 4UA8A 5JI6A 3RQTA 4OMYA 2R7TA 1XVXA 2DWAA 3WG7H 2XPUA 4GLIA 2CU7A 3SEYA 2BOLA 4Z2YA 5D8LB 1SFXA 4IX7A 3V8KA 2XXIA 3HN0A 2E2IJ 4ESXA 2OTJI 4PSXA 3TBIA 2G29A 3TTMA 2Y75A 4JK1X 3KEYA 1S72I 3F11A 2A69F 1OCOH 5DTDA 1I39A 3O6HA 3IJOB 4P0GA 1IJWC 2GWRA 2ZXWH 3UKGA 1X2MA 2P7VB 2DI3A 2UUZA 4FASD 1K4SA 1SDXA 4HV5A 4PGGA 3RSNA 2ZYNA 3TKDA 1K83J 2F6PA 4GX3A 5KCMA 1CF7A 4JVDA 1NG7A 2KR0A 5GP9A 3PGFA 2K85A 2ZKZA 2KHMA 3LQQA 2BY2A 5J8FA 1LNWA 3SQNA 4BDRA 4AU7A 2JA8J 2BVLA 1OYWA 3H92A 4I7HA 3CG1A 4UUSA 4LLGF 2CQ7A 3DTIA 5FROA 3CMYA 1ZBMA 3WAFA 2UV1A 4S04A 2YU3A 5J40A 4OERA 3TW7A 2X85A 2GXGA 3KYCB 1Z7UA 4XR6A 1LJ9A 3E6CC 4LOCA 3IFAA 2DA5A 4IY5A 4F7ZA 3TTRA 2M5WA 2KFDA 2P1SA 3MVWA 4BE1A 1U8RA 1F4KA 2IT0A 1ANFA 1T6SA 2LYCA 2OU2A 5FB2A 3FVKA 4ENKA 4LB6B 2HPMA 5J6XA 2LSOA 4Q0CA 2XGXA 2ZZXA 2R5ZB 2DU9A 2L7KA 2RQPA 1OCCH 2W48A 4N9HA 4X1BA 4B1RA 4AS4A 1QZZA 3IC7A 4PFYA 3OEKA 2Z23A 2A5YB 2R7FA 2XA5A 3RT8A 3DTKA 2RGVA 5BNGA 1EYIA 2XXYA 3G6EI 4GWZA 2NXNB 1MSFC 3FHNA 2R5YA 1TFAA 3C35A 4N8YA 1U5TC 5GTHC 5JLWA 4PFPA 5IAIA 2VBZA 5C4JJ 2QVRA 4GIZA 1T08B 3QWLA 4J19A 4BDYA 2O3FA 2R3SA 1O57A 4I09A 5CVIA 3U21A 3CD6I 2R92J 1LUJB 5EQ8A 1MNMC 1IXHA 4RXLA 2M4GA 3U2RA 4KMFA 3A03A 3NWSA 2M9HA 3CLQA 4Y3OA 2E7XA 3S2WA 2VOOA 2AYSA 3FATA 2IEKA 4NC7A 4DGWB 1B5HA 1FPLA 4U7BA 3GCMA 1JW4A 1O7LA 4WKMA 1IUYA 3ZQHA 4U1ZA 5DYHA 3BG9A 3J7YJ 1JEUA 2WX9A 4C3JJ 5D5VB 2A05A 4E7SA 4G8XA 2V9VA 1FRPA 3VV5A 4MX6A 5H2FC 4R79A 2CGPA 2KZVA 5IY5H 2I48A 3PUZE 2KIMA 2ZXTA 4EV0A 1ODDA 3RGYA 2L01A 4I0BA 2X51A 4I40A 2LDUA 3F21A 2VC0A 3KP4A 3QODA 1U5TA 2AQFA 2F5FA 5JFRA 1HKQA 2HYFA 2HVSA 4OESA 4HAMA 1B5JA 1V5EA 2LD5A 4PF8A 1R5ID 2IA2A 1JUSA 3OELA 3S2HJ 2LKXA 4XRSG 2XXPA 2QVVA 3TUSA 4I1DA 2F8DA 1I1GA 3DCFA 3EQLF 2L5QA 1I3QJ 3BR3A 3DXJF 4E70A 3K70C 3S2DJ 1P99A 3A3UA 1EV7A 2E36A 2NNYA 4RK2A 3T22A 3BJOA 3OYMA 4M3DA 2EA2A 4F31B 3KFWX 4RA1A 3BR1A 4DZJA 5E8GA 2KDZA 2V1NA 3BQYA 1JGGA 1RZ4A 4P3LA 3WTSC 2E1SA 4X9TA 3CCJI 4ZDPA 3JAMK 2MG4A 4OVRA 2BGCA 1WVJA 4YICA 2GIZA 4NX1A 5AA3A 5ED4A 5B7DA 4RDUA 2QVOA 3I4PA 3JW4A 1F36A 4HNVA 4H0WA 2ZNTA 4KA4A 1MPBA 4E7ZA 2IW5A 5DVIA 2Y7IA 5I59B 1OMIA 1DP3A 1H44A 1WJAA 1MQIA 4GWWA 3HOYJ 1I69A 3K4CA 4M3EA 4HW8A 2XHKA 1WI3A 2WADA 3HSEA 2RKMA 1FW0A 2OPTA 3PL8A 1MS7A 4PJMA 3QYEA 2HFBA 2P3NA 5IZ3B 1B1BA 2QWWA 1QHHD 1SD6A 4NB5A 3CCVI 4OXVA 2HQAA 5CJ9A 3PJRA 4G7ZF 1K79A 1G59A 2IGKA 2IAIA 2KISA 3I4MJ 5D4SA 1N78A 1GHCA 2WAEA 2I6EA 2XXWA 3BIHA 4LFUA 2P7CB 5M5XJ 4HG2A 1NKXA 1OQHA 1R9LA 4M72A 4C2TA 4M6VA 4C9YA 4ZYGA 5HODA 5TISC 4RM2A 3COAC 1LB8A 1RDYA 2H25A 3JCUC 2FNCA 2L2OA 1Q1VA 1I6XA 3PUFA 3QP5A 4JYKA 3OOPA 2QJEA 2R7DA 2WAFA 3UR3C 5IT9Z 5L3EA 1BOAA 2A61A 5JHUA 3OYIA 1DSNA 2KQZA 4KITB 4PDKA 4ZTJA 4MLQA 3IOVA 4OQOA 3JTHA 1E3OC 1J75A 3EETA 3M9AA 3ZKLA 2VLAA 4L17A 4GL8A 1BC7C 3TZAA 3KOSA 2VGQA 5F6FA 1MMSA 3KG2A 3P9IA 4X8RA 4O5VA 2QL3A 2WAQA 2A5TA 4I8CA 4HA8A 4QFLA 1QNTA 2ISYA 3GO5A 2X6OA 1K61A 2W1OA 1IMFA 2BY1A 2QQ8A 4XLCA 1LDDA 3ASNH 3I53A 1B7HA 1IUDA 4QXDA 1V5GA 1UHSA 2OTLI 4P0IA 5AA1A 3CESA 1ZK8A 3E6DA 4OVTA 4U4SA 4AC0A 3PIOF 2EJRA 2HEOA 2L9NA 2FOWA 1ETOA 3RN8A 5K1YA 4PZJA 3LV0A 4QSDA 1WQ2A 2KKOA 2ZNYA 4AUXA 1FPQA 3CUOA 5E1ZB 1MBKA 4NAPA 3I5UA 1MPCA 4RNSA 3F23A 1XSXA 2VD2A 3S1NJ 5AONA 3CCLI 3CI8A 4N15A 4EJOA 4QFOA 1LVAA 2KL4A 2MC3A 2Z16A 3D1NI 4IHVA 3VEPA 1TFDA 2VE9A 4I2OA 3M4OJ 5GPAA 1UTHA 4HV6A 1D1AA 1OQYA 4G9YA 2MH2A 3CJRB 3S14J 1J9IA 3C32A 3VDXA 2BZTA 3RZOJ 1B3HA 3A01B 1B52A 1RKMA 1T39A 2GM4A 2R7SA 1MPDA 5EZHA 2ZB9A 4G61A 2ME6A 3U93A 2RC8A 3I0TA 2V7FA 3BTIA 3KETA 2DXIA 1DBZA 1NI9A 4U2RA 3ISPA 3Q0UA 2DAOA 2VPRA 4AYBA 2NOOA 5EHMA 1JJ8C 3CJNA 4GWSA 4GRIA 4F18A 3G3GA 4YFNF 4UB6C 2NVTJ 1FOWA 3K1PA 3T9XB 5CYVA 3RI4A 2DMTA 4WXHA 4LATA 3JRGA 2YR2A 4M6YA 4E7HA 1ZGJA 3PD8A 1KONA 3GFJA 3C18A 3R6SA 1EKEA 1U5TB 4EM1A 1FZPB 2E19A 3W6VA 5E3NA 1PP7U 3ABKH 2D5VA 3H3VK 3TO6A 1SI1A 2O1MA 4XICA 4EXKA 2LKSA 1WSUA 1ZLKA 1URGA 3MPLA 3E6BA 1MSEC 3PO2J 1FPDA 2R5YB 2QFLA 1PEBA 4FETA 3KE2A 2BBYA 2PI0A 3GXOA 1KA1A 1QUJA 2CFXA 2MSYA 3LNQA 1HDPA 3L2UA 3N6TA 3ZKKA 4O3AA 4NF6A 5FLXK 2LBFB 4AVPA 3GXAA 3MBPA 4ZEDA 3G3IA 1TT0A 1P6RA 1R5GA 1R4NB 3ASOH 3TDUC 4IQ4A 4P96A 5EJCA 1A7LA 4DBRA 3H36A 4F29A 2JK3A 2I5UA 3LUYA 3TPAA 2NYXA 2V3TA 1YG2A 3QQAA 2DTZA 5LLQA 3MQ9A 2X9DA 2VJ4A 3CO6C 5FRNA 1ON1A 1LCFA 2GBYA 2XXXA 5CQGA 3ABUA 3BDDA 3FXBA 3M3FA 4GXAA 3H0GJ 4Q8RA 1FSAA 4HSRA 1MW7A 2XAUA 4CZZA 5BMZA 2QBYA 3GLBA 4WK8F 4GL0A 1MNDA 1B9NA 2CG4A 1AU7A 4RLQA 1FPKA 4XOPA 4OOIA 1RUNA 4L0ZB 3VVEA 4X1DA 4N6PA 1MD0A 4YMBA 2IPQX 2GQQA 4ZYEA 2DVZA 1XC5A 4IHSA 1NV4A 2CS3A 2X6WA 2C6YA 2M0MA 4Y15A 1R9TJ 5JVGF 3WTWC 1R4MB 1E2XA 2Y0SA 2XF5A 4HYEA 4JP0A 1DOTA 3QUFA 2XKPA 5FKKA 3JV9A 3QXMA 3HOWJ 3F8NA 4HCWA 3TCFA 3C1DA 3BP8A 5HNHA 3E79A 3OO6A 2EQRA 3N94A 5ICQA 5H6RA 5FJ8J 5GADJ 2Z5UA 2M7BA 3BKIB 1ELJA 4GYGA 1AA7A 2F97A 1MJAA 2FQ3A 3WTYC 5EF6A 2VL8A 1FWZA 3LL7A 4OIPF 4KYSA 3D4CA 1BIBA 1XPXA 4RB1A 1SMYF 4BDLA 5ELVA 2VKVA 1JEVA 1NV5A 2PJRB 1M5BA 2G0EA 4FX4A 2JN6A 1BW5A 3LSFB 2VBWA 3S93A 3LSWA 1I27A 3TTNA 2PYYA 4G68C 3MJNA 2VN2A 5I59A 3L00A 2ELKA 5K7HA 5K5QA 1KWHA 4DIGA 4U0VA 1Y1VJ 4CA0A 3QUJA 2CW0F 4BDZA 3MYUA 1YS7A 1H76A 2P4WA 1R00A 2ESHA 3C7JA 3VWBA 2ZMEC 5H8FB 3S9LC 3QSLA 4XORA 4MHGA 5CVJA 3NOHA 4LP2B 2GXBA 1L5TA 1MDMB 3M07A 4V19K 2BY0A 4G8HA 1FBHA