1MH4A

Maltose binding-a1 homeodomain protein chimera, crystal form ii
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
molecule keywords maltose binding-a1 homeodomain protein chimera
total genus 136
structure length 418
sequence length 418
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh4A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A01
1B3FA 3DLNA 3WHBA 3WHCA 4A69C 5TP9B 1QKBA 1LCTA 2VPRA 5IOZA 3QPSA 1ETVA 4ABZA 4IO3A 1IRZA 5TPAB 3H3VK 2VKVA 4OENA 3L6GA 4MFIA 5LOMA 4V2GA 3PPQA 4ESWA 3VFJA 3MZ9A 2R5YA 1JT6A 2ZYKA 1JUPA 1Y1WJ 3HPIA 1TWGJ 1WODA 3DELB 2QS3A 2CUFA 5IOYA 4NF4A 3HM5A 2I48A 4DW6A 2XGEA 2F97A 4DDDA 1JUMA 1SDXA 3QYTA 1BA5A 4M1VA 3W15C 4BBSJ 1ZMGA 1TFDA 5I57B 5C44J 1I6HJ 1J1NA 4FEDA 1BW6A 1N7XA 2DMTA 4DYRA 1IXCA 3C4MA 1DSNA 1SQYA 4E0WA 2LLKA 1LB9A 2R9JA 4DXCA 3OSFA 4EQBA 4BLAA 2RKMA 3FGSA 3Q26A 1TFAA 4HCYA 2ZNTA 3BR5A 3Q0WA 3TTNA 3UORA 1B9JA 4EF1A 2QPQA 5M2VA 2P1SA 5AA1A 4UA8A 3PMXA 4PE5B 2NVYJ 5AA2B 2IA4A 4PP0A 1MXYA 3RTFB 1P1OA 2Y7KA 1X2NA 1E3OC 3A01A 4GXSB 1Y1VJ 4YKIA 3RGYA 3ODBA 3TQWA 2PMSA 1ZU0A 4NF8A 4I62A 3KG2A 3QPLA 4IHWA 4IB2A 4H65A 1F9BA 2A5SA 4FATA 3MVYA 2H98A 2HDDA 5IP9J 4XKPA 5I2KB 3SERA 3CFZA 2V3TA 4BDQA 3LSLA 5CMMA 5EHSA 1B72A 3B6QA 3PO3J 4H5FA 3VVFA 4GLIA 2ME0A 2AIXA 1JVYA 4MFEA 4RK9A 2WAQN 5I57A 2ONKE 2REGA 2DA3A 1QPIA 5EGOB 3ZQGA 3C33A 1B51A 2V84A 3JV9A 2EH3A 2PMZN 2XXWA 2TCTA 4W1UA 2IEEA 2OJTA 3VDFA 3S1MJ 5E3NA 3TCFA 1B0LA 4NF4B 2VKEA 5HPQA 4XRSA 3Q28A 4A3KJ 5AE4A 1H88C 5DVFA 1A8EA 4X1DA 2FJ1A 3SJMA 1MBGA 3GTPJ 2KLFA 3FV2A 1Z77A 2JA7J 3TAJA 1X2MA 2V3QA 2L0KA 5E3OA 5IYBJ 1SD3A 4DLDA 1ZR4A 2MW8A 2DN0A 3OOAA 3TCHA 2P2AA 3RLFE 5ELVA 1FTKA 2Y2ZA 2UVJA 4YU0A 3N26A 1JKRC 3KSXA 4DE8A 3IORA 4G12A 1ZQ3P 3VV5A 4QFLA 5GP9A 4TQUQ 1P1QA 2LTPA 5FLMJ 2PVUA 3RQTA 3O6HA 2X48A 2CQXA 1AHDP 1I69A 1XT8A 3BG9A 1SW2A 1VI0A 3MPLA 2QSXA 4GF8A 3JR9A 3C35A 1JTYA 1MPDA 2XXVA 3GTMJ 4JYKA 2VP1A 4U4XA 5F08A 3U94A 5HBCA 3M3FA 1KWHA 1EZPA 4A3EJ 4UUSB 2QS4A 3H7MA 1NL5A 4LOCA 4YZZA 1PB8A 2L7ZA 4WEDA 2NS8A 3I4NJ 3JRFA 3I3VA 1Y4TA 3SEUA 5B70A 1VFEA 3UGWA 2Y7RA 1NK3P 4FE4A 4JX4A 2HFBA 2JWTA 4G4PA 4BY7J 3U93A 4JWOA 1S7YA 4IHYA 3IOWA 1GVCA 3PUVE 1CE2A 3RTWB 2XSDC 3JREA 2XD3A 3QAXA 1ZR2A 2JN6A 3RN8A 4LA9A 3Q25A 3FV1A 2Z8DA 1SI0A 4THIA 2A5TA 4HTGA 2REJA 5FHOA 1XS5A 2F6PA 4A3LJ 4R9GA 2E1OA 3R6UA 5FHMA 3RNNA 1MQHA 2OBGA 4O3AA 4KQPA 1IUDA 2VGQA 1LE8A 4JX5A 3FIRA 4B1RA 4EEFG 1AU7A 2ZNUA 5C4JJ 4MIMA 3UP9A 5AA2A 2EZIA 2NVUB 5FTHA 1QUIA 2DMUA 4M3BA 1MXWA 4F18A 2V25A 4IGRA 1UG2A 3LOCA 1MQGA 3RY3A 4R2FA 5A5XB 2XXPA 2E19A 3Q27A 2Y9ZA 3PM1A 3FVOA 1FW0A 1ELJA 5L9MA 2CUEA 1SANA 1BLFA 4RPOA 3H6WA 1MQJA 3ZKKA 3MP6A 4JBZA 1DTGA 1IEJA 1P1UA 1Y9UA 3O66A 3CFLA 3HGYA 1UTBA 5JTYA 3T96B 3C32A 2KDZA 3IAZA 5H8FB 4TOZA 2XGDA 3ILTB 4M6VA 3HSTA 1RKMA 4FECA 3IJXB 3MW0A 4DZ1A 2MGQA 5BUUA 4ZECA 3T93B 5HM4B 2I49A 4NWCA 3MVZA 2EQRA 3M3KA 1GR2A 2O6AA 2O7UA 4BDOA 3JRGA 1ENHA 1OLCA 5IYDJ 4OVJA 3K1NA 3W6VA 2XHDA 5EEAA 1BIYA 2GHAA 2B3FA 4RA1A 4C3JJ 3MC2A 3TZAA 1ORKA 1TWFJ 2LK2A 2LKXA 2HAUA 1AOVA 1AH5A 2B65A 4U21A 2OPTA 2AHQA 4YAHX 3FUZA 2NWJA 2F35A 5DEXA 3IOTA 2NS7A 2Z23A 3VXCA 3DP4A 1TT1A 2PT2A 1ZK8A 2LY9A 4NF5B 2D5VA 5DVJA 4ZEKA 1LFHA 1B52A 3IOUA 1H89C 5I58A 5J3LA 2ANJA 2V93A 4F1UA 1PC3A 3Q0VA 1B05A 1GT0C 4UUSA 1LBBA 2E0SA 4ZZEA 2DQVA 4FAJA 3T9UA 3HB9A 5EF6A 4IO6A 3TP3A 2R5YB 1FEXA 4R75A 4WEPA 1SI1A 3MN2A 4ELOA 1FQEA 4Q0CA 3E3KA 4OTEA 2DWJA 4OXVA 1GDTA 5CM6A 5M5YJ 2XXXA 1B1XA 2O1MA 3N94A 2DA6A 4EDPA 1A8FA 1IGNA 1ZTRA 3CG3A 2Z8EA 1XC1A 3R26A 2K9QA 1AIVA 1LBCA 5F1QA 1CQTA 1FTJA 5K7FA 1USYE 2JA6J 1IXHA 1QVSA 5K2XA 1W0TA 3MJNA 4LQ5A 3OMBA 3MZBA 2Y31A 3S14J 2O69A 4G8HA 3QQAA 5JLWA 5DT6A 4JDFA 3BG5A 4FISA 2E2JJ 2I3WA 2O7IA 3GTGJ 1R6ZA 1TC3C 1PB7A 3B6WA 3FATA 4POWA 1NMUA 3ZQCA 3H06B 4LVQA 1YPNA 1Y20A 2THIA 2F7CA 2R6GE 2GLOA 2YLNA 1P7IA 1H3DA 2LFBA 3HDDA 3KOSA 1FQFA 1YRNA 5H8HB 1F43A 4N6PA 3IO6A 2ESNA 4AYBN 1JQFA 3E9XA 3TUSA 4OFLA 1U78A 2ID6A 1RPWA 1PDAA 2DA4A 2UYFA 1SW4A 1OLAA 5CMKA 3OEKA 5FKLA 1ZGWA 2PX1A 1MS7A 4IY5A 1HF0A 4MF3A 5L8DA 1M5EA 4WXJA 1LLSA 5I59B 1NFTA 3K2DA 3S16J 1UTHA 3FK6A 4U4SA 5K7ZA 2R92J 1XOCA 2R7ZJ 1QRYA 4FCYA 1MDQA 3IR1A 3TTKA 2ALUA 1QUKA 4BDNA 3LSPA 4ONYA 1NNTA 3GTKJ 2HZLA 2AO9A 2P0SA 4GWOA 2N8GA 2XB0X 4AQ4A 4KYDA 3GLBA 5I59A 1AKHA 1JGGA 1EZ9A 3U72A 3MPKA 4QFNA 4I76A 2EZLA 1MQIA 3IB1A 1JKOC 3C9HA 3TTMA 3MWBA 4H1XA 1UTHB 2GBYA 4GD5A 4BY1J 3S9NC 4RNSA 4OYVA 4ZDMA 3LSRA 2IAIA 2L9RA 4DXBA 1ZTYA 2B3BA 2H25A 1MXZA 4AB5A 3CSBA 4OFOA 2QJEA 1NH8A 3IX1A 3PU5A 2XXUA 1WDNA 4LONB 1US5A 1NKXA 2CU7A 1MRPA 2VOZA 3BG3A 4A3DJ 4FIMA 4NF8B 1Z0XA 1WPKA 4AB6A 4NMYA 1A5JA 1ETWA 1QUJA 3KEIA 1B5HA 1MM6A 1LFGA 5I56B 3EQ1A 1Q35A 1RYXA 3QK6A 3O8HA 4X1EA 2I3VA 5FKMA 4QHQA 3BBRA 2YS9A 4Y52J 1D9VA 2K40A 1OQHA 2RC7A 1VNDA 1ANFA 2R93J 2ABHA 3TDJA 3CI8A 1UTBB 3S15J 2H1KA 2HAVA 1GV8A 3CFXA 5E3MA 3A09A 1LGBC 1MY4A 4AUXA 2DMNA 1ZJLA 4F39A 2AL4A 1QVUA 4N07A 5EYFA 5CBRA 3K4UA 4QSDA 1N7WA 3QUJA 2CRGA 3RKQA 4F19A 4A93J 2ZB9A 2XX8A 1JNFA 3K6VA 4DCYA 1ZKBA 2DJNA 3E7LA 3HOWJ 5FTIA 5H8SA 1NNFA 3K1PA 2PBWA 3FKIJ 1F36A 3RZOJ 2XX7A 1B7UA 4R73A 2RCBA 4YMAA 2X9DA 2R5ZA 3GXAA 2RAEA 1MXVA 1RYOA 3OELA 4D5FA 1JJ6C 4QSEA 4G68C 4EF2A 2B63J 5K7HA 2YJPA 5FKOA 1DU6A 1MBEA 1GV5A 5F7VA 4XTCQ 1B3EA 3B6CA 4U2RA 5H8NB 2M9HA 3E13X 3JRBA 1P1NA 4G8NA 1R9LA 3BT9A 5DYHA 3QXMA 1IG7A 2E2IJ 3JRIA 3KOTA 2DMPA 3OO9A 4H6DA 1GVDA 1SFOJ 2FYIA 1URDA 4F3GA 5H8HA 1XVYA 3CMYA 3FIWA 1LCFA 4EXLA 3G3IA 1HOMA 3PMVA 4RYAA 3SFIA 4P0IA 3KGCA 2JK3A 4PFTA 2ZYNA 3TELA 4IO4A 2XPVA 4F22A 4F31B 1EF4A 1DOTA 2EBIA 4O3CA 1FTOA 4I8CA 4KHZE 5JTYB 4H0WA 4XICA 5EGOA 3M3YJ 1FQDA 2XXRA 5L9SA 2XRLA 4ELPA 2NOOA 4MH5A 1N0TA 3PUWE 4GOTA 5DVIA 1UQWA 5ICTA 4KFQA 1A6IA 5EG0A 3EN3A 5M3FJ 3HCQA 1FIAA 5A5XA 4R6KA 2NOGA 5AA2D 5F04A 1B3HA 4C2MJ 3LSXA 1PUFB 1BP5A 4FORA 3LSWA 3TYHA 3PUZE 1WH7A 4R2BA 2ME6A 2LR8A 5CRYA 4C3HJ 4D7NA 3HBLA 2XX9A 2H9BA 4ECFA 3EF7A 1XHYA 2UVGA 1IDYA 1M5BA 3WAFA 2Y30A 1AKHB 1TXFA 4H8IA 1LSTA 3OENA 1HDPA 1Q1VA 4XKRA 3S9MC 1K61A 2R71A 1QW0A 2O84X 4QSHA 2NVTJ 5KCJA 4RJZA 4OEVA 1LE8B 2M0CA 3THIA 2I58A 3W9VA 4IO7A 4P11A 1QULA 3L1PA 1WH5A 1ETXA 1VF9A 1N84A 2YUSA 3MP1A 3FVNA 3M8UA 4D5CA 1Y3NA 3OSQA 3DP8A 4KI0E 1MSEC 3LSFB 4HNVA 2V3UA 4ELQA 5TP9A 2Y84A 1MPBA 2Y7PA 4FE7A 2I0CA 4D7MA 1II5A 4OFJA 1L5TA 1PUFA 2P81A 3IJOB 4CYCB 1O63A 1SBPA 1A40A 3HV1A 3BQZA 2XXIA 1Q1KA 1BW5A 1B7ZA 5EG0B 3ZQHA 4P0GA 3SEWA 1LAXA 3TKDA 2WV1A 4F29A 3G3HA 3SEXA 5IYCJ 1Z7NE 2ELKA 4X1BA 3PGFA 3T9VA 2ZXTA 3LNQA 1A55A 4Z0IA 4ZEDA 3S2DJ 5ITPA 3G7WA 3FJ7A 1MY2A 4MLOA 4BDMA 1FIPA 1MG1A 3C36A 3KN8A 5J1YA 1LAGE 4W97A 2HQ0A 3BKIB 4FE8A 1H43A 5ITOA 4DIGA 1MY3A 5FJ8J 4YKKA 1FCKA 2DWHA 3M3LA 4NE4A 1D9YA 1LAHE 4OMBA 4YB5A 2Y7IA 2DOJA 5DS9A 1S9TA 4A3IJ 2VUMJ 2D3IA 1JTXA 1ZBMA 1US4A 2O68A 4FTHA 4GQOA 2X6OA 2IBDA 4ISUA 2QRYA 1B40A 3EHSA 4MLVA 2M34A 5F0CA 3GTLJ 1I6QA 1EH3A 5CC2A 4TLMB 2R5ZB 1Y1ZA 3PD9A 1WI3A 3SKPA 4XKQA 4ESXA 4G68B 3BR0A 3VLWA 1CB6A 3IOVA 3G3GA 5FKKA 1NTCA 2ECBA 5M5WJ 3HHFA 2ECCA 3JRHA 4XRMA 1IDZA 1IUFA 2Q2CA 2QF7A 1FJLA 4XXUA 3H03A 3GTOJ 4HW8A 3VLVA 3M4OJ 2WB1N 5M3MJ 2FQ4A 1OCPA 1B72B 3LC8A 9ANTA 2BJJX 3O6GA 2DTZA 3K6XA 2F78A 3K0VA 4MLQA 5DTDA 1URSA 1ZKGA 3OO7A 3TTRA 4LZ5A 3V5AA 4A3CJ 4HCWA 4O3BA 4LATA 3TEDA 1OVTA 1HDDC 1JW5A 3E4RA 1POGA 3JZJA 4C3IJ 2EZHA 3P7IA 2CMOA 3I6VA 5DEXB 1B32A 3KJ7A 3HKZN 3L6HA 1MXXA 1MXUA 2FA7A 1X58A 2HOTA 4KYEA 4KR5A 3Q0UA 1FTMA 2Z22A 2OF7A 3IH4A 1NH7A 4JSOA 1BJZA 3VE1B 4RPNA 2KT0A 2W48A 1B8IA 1IXIA 2D5WA 2VI6A 1N3XA 1UMQA 1R9QA 4YKPA 4PFUA 2AL5A 1LB8A 1VR5A 3U92A 1FQCA 1LAFE 4BXXJ 1JKQC 4DCXA 1N04A 3KFMA 3IO4A 1B4HA 3DEWA 3A3CA 4OESA 3TTLA 1XC5A 3MQ9A 3K02A 1ZIUA 3OO8A 2XD2A 4U1OA 5KZTA 2DA5A 4R9FA 2FNCA 4H8JA 4QTRA 3C34A 4M3DA 4UUTA 4EQ7A 2QMWA 3OSRA 1YRNB 5FKNA 3D4GA 1OIBA 1JW1A 5I2NB 2Z8FA 2DWAA 4OERA 3S1QJ 2DE3A 1ITYA 3PO2J 2M2EA 2HQ5A 4ZZAA 3BR3A 4NEDA 3KSJA 5FLVA 3F0CA 5KDTB 2E1SA 5C3EJ 2GH9A 4K3FA 3PUXE 3CRBA 1SVXB 4Y7NJ 2GRVA 3O2AA 3TFLA 1B46A 4OZ9A 1TWCJ 3DCFA 3OEMA 4OQOA 3GBAA 3HOXJ 1NNKA 1B6HA 4KCCA 4BDRA 3CVGA 1RR7A 2F8DA 3OD7A 3H6UA 4R74A 1EZOA 2O8KA 2H8RA 1MBFA 1H45A 3G1MA 4F2OA 1IQ7A 3ZQLA 2DXYA 4JSDA 2MG4A 3FK7A 1JEVA 1UIVA 4RDUA 2XXTA 4I9DA 1R9TJ 5ISUA 5E3LA 2CJJA 1BKAA 2DSFA 3O6IA 3ZQFA 3AXFA 1JT0A 3MKLA 1XG1A 5F0FA 3SDGA 1DMBA 4MBPA 3OO6A 4LUBA 5AA4A 3CCYA 3HOUJ 4XIGQ 4RY1A 3RQIA 3USDA 3HN0A 2FX0A 1IIWA 1MNMC 2DMQA 2PYYA 4POXA 3PPRA 3LSJA 2H99A 3ONMA 2WKYA 4JXIA 3LBSA 1ETKA 5EDNA 2Q89A 1AMFA 3U1OA 2Y7WA 1P1WA 3GBGA 4C0RA 1TWAJ 1DPEA 5K2YA 1FQBA 2L7MP 1B2HA 3LSGA 4DYQA 1MSFC 1PBQA 1P7JA 1EU8A 4KCDA 4M4GA 2Y0SN 5FHNA 4TLLB 4H5GA 1MBJA 4ZEBA 3RUMA 3CDLA 5EZHA 2OZZA 4IO2A 4IHXA 5JEIA 2X26A 3S4UA 3HEFA 2H4IA 3S9LC 4HS7A 2GM4A 2LAOA 3H0GJ 2Q8JA 4CYCA 2LVSA 3FISA 3C2BA 5CMBA 2ONSA 1S7EA 1A54A 1M5FA 1MH4A 1PBPA 3MVWA 4R72A 1W0UA 3UA8A 2DA7A 1N76A 3C31A 3SETA 2JJ7A 4EUOA 3IL1B 5J1RA 4EQ9A 1A99A 3K1MA 3MUQA 2DE2A 4F3SA 3FXUA 3GTQJ 2QS1A 5H8NA 3FJGA 3ZOBA 4PFYA 2TRTA 3UK4A 1VSOA 3T22A 1SW1A 5BNGA 3O29A 5KDTA 4KPTA 5I56A 2F7BA 1OVBA 4N13A 4IGTA 4G68A 1M5CA 1DU0A 3SEYA 3G1OA 5H8QA 1R1NA 3K6UA 4GVOA 3N6TA 2DWIA 1HCRA 1MBKA 4U22A 1B3LA 3BFTA 5HODA 1VFCA 3PD8A 4GXAA 3ZSFA 3BQYA 2CQQA 3VXBA 3CR9A 1HSJA 3MZ1A 3PPOA 3BFUA 1URGA 1S50A 3QSLA 5B7DA 3KBRA 5F1JA 3FD3A 1TWYA 3JRCA 2M8CA 3QUFA 3KZGA 1GGGA 4ZE9A 2FD5A 4IEJA 3G3KA 5BWJA 4FJPA 3TW7A 1XS9A 1SW5A 2I4BA 1NNPA 1QJMA 3S9EA 3H6VA 4Q8RA 4M3EA 3OSGA 3S1NJ 4G77A 3O97A 3JYRA 2DA1A 1BTJA 2YU9J 5J1DA 4Q30B 4AC0A 2HXWA 3RPWA 3SESA 5I58B 4A3MJ 1B0HA 4YICA 2YPNA 1IJWC 2XXYA 3GBBA 1VFDA 2RINA 2PT1A 1APLC 3NAUA 4H67A 3O8GA 4RBOA 2IEKA 2ONRA 3VPRA 1B3GA 5J1UA 4ZE8A 4NF6A 1I6AA 1B5JA 3BR6A 4QRZA 2DYXA 4QSCA 2NUVA 2I10A 1O4XA 3TPAA 2GHBA 4S0HB 4X9TA 3MVPA 2Y9YA 4IHVA 2OK2A 5JLXA 1JKPC 3HGGA 4ZEIA 3ECRA 1WCMJ 3IV5A 2DVZA 2HXIA 5I84A 3OOUA 3RZDJ 4U1ZA 5M5XJ 4PQJA 3KJTA 3D4CA 2UVIA 5H8FA 2EZKA 2OCUA 3UKGA 2LP0A 3BTJA 4QFPA 4B3AA 3MAMA 1YTVA 4LZ7A 5F27A 3FJMA 3IK6B 1N3WA 4A3JJ 2UXAA 2ID3A 4Q5TA 4GFBA 2XPUA 5AA3A 1USYH 3T9XB 1HSLA 3WAEA 3ZS6A 4QFKA 1Y3QA 3GZGA 2ZNSA 4BKXA 1B58A 4A3FJ 1RESA 2I4CA 3G1LA 1BL0A 3CQZJ 4I6ZA 1O64A 3UN6A 3MVXA 3IH3A 2ZYOA 2QS2A 3K01A 1UIUA 3TEPA 4MFDA 3UIFA 1PB9A 2VHAA 4ND9A 4A3GJ 4ZS9A 3FVGA 1RKTA 2F6GA 1GV2A 2HZKA 3HOVJ 4OETA 2XPWA 3FZVA 1UHSA 2XB5A 3SDFA 3K2AA 5IPAA 1LFIA 1RETA 1IZ1A 2DP8A 4UACA 4OWDA 3RT6B 2R0QC 2UYEA 2F36A 2G29A 3IB2A 5H8QB 2DS9A 4XK4A 2XXHA 4BBRJ 3S2HJ 1JJ8C 4C1UA 4L17A 4L5EA 1VE4A 3HHGA 1POTA 2OWSA 2K9NA 4X6AJ 4F1YA 4NWDA 3T9HB 4E0XA 2DXRA 3I4MJ 3FASA 4NDLA 2M8GX 1RKWA 4M3GA 3K00A 1XVXA 2QMXA 1Z7ME 3N6UA 1FTZA 5EHMA 4GL0A 3TODA 2HCAA 3N5LA 3S17J 4A3BJ 1MM7A 4F3PA 1FTTA 1JW4A 5GPAA 2Q9TA 2O1LA 1JETA 3VVDA 2G0EA 4ZEFA 3A02A 3LUYA 3PMWA 2JMWA 4LQ2A 1JUSA 1WVJA 1MY1A 1Y1MA 1ZLQA 1ETOA 3B6TA 3CSGA 3EHTA 4QF9A 3TCGA 4QIWN 4JWXA 4OEUA 1B1HA 2ZMBA 5CI5A 2XXQA 4YB6A 4RXLA 5EYRA 1OMPA 2HOAA 3VVEA 1T0KA 4JWYA 5IAIA 3S2VA 5AA4B 1JVXA 4ELRA 3H3GA 3A3UA 3O9PA 2RC9A 1Y4CA 4F2QA 3PPPA 2JA5J 1B4ZA 5IP6A 2O51A 3O28A 2AYSA 2NXOA 3H4ZA 2DA2A 3LR1A 5F0HA 5I2KA 2F5XA 1GTKA 3V8XB 4R6HA 3EHUA 4B4CA 2O9LA 4J19A 1U9NA 2VD3A 5GPCA 3K6WA 2HOSA 1FTLA 1MY0A 3FXQA 3HO7A 1H76A 1IITA 3HOYJ 1YCJA 1GUUA 3ZQIA 4JP0A 1H8AC 2DE4A 2F34A 4NF5A 2UVHA 1WGXA 2NVQJ 5TU0A 3A01B 3VLUA 3RT8A 4RK2A 3PV0E 4JX6A 3R7XA 4KD5A 4YB7A 2OWTA 3H6TA 1HSEA 5CBSA 4M3FA 5EZGA 3FVKA 2RC8A 3D1NI 4F3BA 1NK2P 3TQLA 3W9WA 4KYSA 4MO7A 1MQDA 4DXUA 1MH3A 2G93A 4WKMA 3Q3SA 1FQAA 3KN7A 3BTLA 2QL3A 1MBHA 4JB7A 1B5IA 1I6BA 1POY1 3U8QA 3NARA 1D4NA 2A5TB 3TMGA 1ATGA 3B6AA 2X7QA 1IXGA 4G8MA 4F1VA 2COBA 3HOZJ 1DTZA 4OHNA 1ETQA 5IP7J 2X7PA 4LP2B 5C4XJ 1PEBA 4DYCA 3BR2A 3MBPA 1I50J 1LFUP 2DVCA 3TW6A 3DP6A 1QVTA 4YKJA 5ICQA 2HI3A 1OJLA 2Q88A 2O7OA 3CG1A 3BTCA 5IKBA 2LD5A 3OXNA 1D3KA 2Q2AA 3Q29A 2XGCA 3F11A 4BDLA 3K7AJ 3BR1A 1LFBA 1AL3A 3V83A 1ETYA 5JK4A 1G2HA 2GFEA 3EPEA 2HXOA 2E2HJ 2L7FP 1Y3PA 4C1TA 1P99A 4QFOA 2I0BA 2RCAA 3G3JA 1D5YA 4IY6A 3G3FA 4XKNA 5L9OA 4EXKA 1B7HA 1MDP1 4XIDA 2RF1A 1SYIA 4DZJA 1T56A 5KCJB 4G2ZA 3SEVA 1B8IB 3ZKLA 2VD2A 3FXRA 4FEBA 3CIJA 4R6YA 5I2NA 1OFCX 3TP0A 4U23A 3ILUB 1HLVA 4GRKA 1H44A 4GIZA 4NTLA 4X48A 4DZPA 3B7DA 1O7TA 2H5YA 3DM0A 3QIMA 3KN3A 3BTIA 4YMBA 2K9SA 1I3QJ 5DTBA 2OLBA 2D21A 1OQGA 2ZYMA 3PPNA 3PUYE 3JRDA 2HYJA 1YAEA 3V89B 3MP8A 2F7AA 3A03A 1A7LA 4IO5A 1JEUA 4Z7EA 4PFWA 3OIOA 1IC8A 4XRSG 3IH2A 1MPCA 1U9OA 1IV6A 1TWHJ 2CZLA 1OCTC 1QKAA 5TPAA 4I1DA 1K83J 2W7YA 5CMCA 4V2FA 1U8BA 4GL8A 1T33A 3IB0A 3GTJJ 3T66A 2I6EA 3S1RJ 2NVXJ 2QCOA 1SYHA 2MSYA 2JA8J 1M5DA 4LZ8A 2HEUA 3JRAA 4GFRA 1DPPA 4PETA 3I5OA 4NF6B
chains in the Genus database with same CATH superfamily
2ZC2A 4XKCA 1B3FA 3GVAA 3DLNA 3WHBA 3WHCA 1BOBA 4A69C 4LG3A 2GQQA 2HOEA 3MSTA 2R92J 3H5RA 4ENKA 5TP9B 2BHYA 1U2WA 2Q0OA 4WF2A 1LCTA 1QKBA 2TDXA 2VPRA 4C9YA 4UVCA 3QPSA 2Q8KA 3E0JB 5IOZA 4G7OF 2BJIA 2E71A 1FBEA 3HHHA 5DUKA 1PJRA 5GTIC 5FB2A 2LREA 1T2KA 1ETVA 1ZRFA 2LF8A 4ABZA 4IO3A 2NS0A 1IRZA 1TBXA 2DT5A 1T39A 5TPAB 3H3VK 4FBPA 2VKVA 4UXNA 4OENA 1UCRA 1UFMA 2OC6A 3L6GA 2VBZA 4MFIA 4V2GA 5LOMA 4E7SA 3W2VA 4HEA2 2Q2EB 3PPQA 4ESWA 3VFJA 3MZ9A 5F6FA 4M9ZA 1S72I 2R5YA 4ZH4F 1JT6A 2QUFA 3EUHC 3MZ8A 2NNNA 4LN5A 2KJBA 2VE8A 1YHQI 2O5RA 4MX6A 1IRXA 4I7HA 1DQUA 5D6FA 3EQLF 1WJEA 5TISC 2ZYKA 5IZ1A 3R61A 2VBYA 1JUPA 3BIGA 2ZMEB 1Y1WJ 3HPIA 5ET6A 1TWGJ 1XI6A 4I0BA 1WODA 3DELB 1TT5B 2CUFA 3OL3A 4ESJA 2QS3A 1OYWA 4CZZA 5IOYA 4PJMA 4HLYA 2PCRA 3HM5A 1P4WA 4DW6A 3PSIA 1WJ5A 2XGEA 2F97A 2DLLA 2I48A 2CFOA 4DDDA 3JW4A 5DM7F 1K9ZA 3GLLA 4RB2C 3BC8A 1JUMA 4KJZA 3OYAA 4RGXA 4KA4A 1BK4A 1SDXA 1V5GA 3AL0B 3JCUC 2F3BA 3FBNB 3C2HA 1BA5A 4GX4A 4M1VA 1I1SA 5IT9Z 4MJOA 1R1TA 3W15C 3K4NA 4BBSJ 1ZMGA 2PFBA 1TFDA 5I57B 5C44J 2STTA 1I6HJ 1OISA 2O0YA 4RGRA 4AYBA 1OQYA 1RIOH 1J1NA 4FEDA 4RGUA 4HYEA 1BW6A 3R4KA 2BY1A 5DCMB 1N7XA 2DMTA 4PZJA 1IXCA 4DYRA 3C4MA 5KAIC 1DSNA 1SQYA 3ASNH 3ZMSA 1RDZA 3T0YA 4E0WA 3S2WA 2LLKA 1LB9A 2R9JA 3S8PA 2K4JA 3HL2A 4DXCA 5FROA 1R49A 3OSFA 3E78A 4CCOA 4EQBA 3CHGA 4BLAA 2OJED 2RKMA 4XKVA 3FGSA 3CCLI 1TFAA 3Q26A 1FBQA 4HCYA 2ZZXA 2E36A 2ZNTA 3BR5A 3Q0WA 2ZO4A 5BPDA 4IL6C 3FXLA 1VQKI 4MHFA 3TTNA 4U88A 3ZCOA 3UORA 1B9JA 2E1NA 4ZDPA 2OCEA 4EF1A 2QPQA 1OR7A 5M2VA 2P1SA 5AA1A 4UA8A 3PMXA 2P4WA 2NVYJ 4PE5B 5AA2B 2IA4A 4PP0A 4BACA 3H5AA 4HLXA 1MXYA 2OWZA 3RTFB 1FWZA 3CCMI 1IRFA 3KIOA 4HOBA 3FBPA 4PFOA 1BI2A 1P1OA 2A61A 2Y7KA 1X2NA 2PBIA 1E3OC 3P9CA 5HLGA 3A01A 4GXSB 4HQEA 1Y1VJ 2E7WA 4P47A 4XR6A 2L4AA 4YEJA 4YKIA 3RGYA 1YJNI 2QVUA 4U0YA 3M07A 2RVCA 5L3BA 3ODBA 3TQWA 1IV8A 3DBHB 2PMSA 1LUJB 1ZU0A 3DF8A 2KHMA 5B66C 3ABUA 3DPUA 3KG2A 3TGNA 3QPLA 4HE1A 4I62A 4NF8A 2YSRA 3EPZA 4I02A 3K4LA 3F8NA 3D0SA 5B5EC 5D4SA 4CCKA 4IHWA 2WYKA 4IB2A 2CQKA 3I0TA 4H65A 1DPUA 1F9BA 2A5SA 4FATA 3H0DA 3IP4B 4IO9F 3MVYA 2LMDA 2LBFA 4ASNA 4B48A 3VSLA 2HDDA 2H98A 5IP9J 4XKPA 5I2KB 4L5IA 3SERA 2HPGA 3CFZA 2V3TA 3CJTB 1FSAA 4BDQA 3LSLA 5CMMA 4L0ZB 5EHSA 1B72A 3B6QA 3PO3J 3CESA 4H5FA 3VVFA 4GLIA 5H6RA 3REOA 5E18F 2ME0A 2AIXA 3HUGA 1W7PD 2LOOA 1JVYA 3PNYA 4XMYA 4MFEA 2D1HA 4RK9A 5LFAA 2WAQN 2Z9OA 4II3A 2ONKE 2REGA 3W6KB 5I57A 2DA3A 4BH9A 1QPIA 5EGOB 3M8FA 3ZQGA 3C33A 4F1YA 4PFPA 1HQCA 1OMIA 3GZ6A 1B51A 2DU9A 2V84A 3JV9A 2EH3A 2PMZN 2XXWA 2TCTA 3H92A 4W1UA 2IEEA 2X0LA 2OJTA 3VDFA 3RYPA 4OIOF 3S1MJ 5E3NA 3TCFA 2ZJRF 1B0LA 4NF4B 2VKEA 4OVRA 1FC3A 4ZTJA 1PP8F 4N15A 3DKYA 3QPTA 3MKZA 2R7QA 2BYVE 5HPQA 4I09A 2EWNA 1SD5A 1HKSA 3HRSA 1EKEA 3A4CA 2IS4A 4XRSA 1FBPA 2EFPA 3Q28A 1Z05A 4IHTA 3M7GA 4A3KJ 1LEBA 4CZCA 5AE4A 2LH9A 1H88C 2CS3A 3ABKH 3CC4I 1KYWA 1U8RA 1UHWA 2QVVA 2G7HA 4HDVA 1T0FC 5DVFA 3JAMZ 3KP3A 1A8EA 3LAPA 1EH6A 4NUBA 4X1DA 2FJ1A 3SJMA 4O7IA 1MBGA 3H9JA 3GTPJ 2KLFA 3QP6A 3FV2A 1YIOA 1YTYA 3EDPA 2JSPA 2CZHA 2VOPA 1Z77A 2A5YB 2JA7J 2H94A 3TAJA 1X2MA 4MTEA 1JXSA 1FNNA 2ZBKA 4RAFA 2V3QA 2L0KA 5E3OA 1V55H 5IYBJ 2ZSHB 4U7BA 3TKYA 1SD3A 4DLDA 1ZR4A 4HPQA 2MW8A 1LPQA 2DN0A 2PFZA 3OOAA 4OVTA 1Z6RA 4B43A 2P2AA 3RLFE 3TCHA 3TOBA 2F4OB 5ELVA 1FTKA 4P96A 2Y2ZA 2UVJA 4YU0A 2PLYA 3N26A 3VYRB 1JKRC 3KSXA 1FZPB 4OOIA 2BY2A 4G12A 1ZQ3P 3IORA 3EYIA 5ESYA 5HNFA 4QFLA 2ZXJA 2K85A 5GP9A 4TQUQ 2JT1A 2ZFUA 2HR3A 3F9KA 4MEXF 1P1QA 3FHZA 2LTPA 2H27A 5FLMJ 1MPCA 2PVUA 3RQTA 3O6HA 2X48A 1KQ0A 2CQXA 2ZMEA 4EGZA 2X51A 5HS7A 1AHDP 1I69A 2KFDA 3JSPA 3BLYA 1XT8A 3BG9A 5CQEA 2DT6A 3AAFA 1SW2A 2JVHA 2VT5A 3QYBA 2IJLA 1VI0A 3MPLA 2QSXA 3FX3A 1RC9A 4OA4A 1EV7A 4GF8A 3JR9A 3VYSB 3C35A 1JTYA 1MPDA 2XXVA 4Y13A 1XMXA 2F5EA 2QSFX 3CCEI 3GTMJ 1HC8A 5EQ9A 4JYKA 4BQOA 3DQVC 1FMVA 2QQ9A 2VP1A 1Z1DA 4U4XA 5F08A 2DK8A 3U94A 3H5NA 3DP7A 3DU6A 3M3FA 1KWHA 5BPIA 5HBCA 1EZPA 1FPFA 2P6SA 4R8HA 4F93B 1XX5A 1MMNA 4A3EJ 4UUSB 2QS4A 2M0MA 3BPVA 3MKYB 1NL5A 1R5GA 3H7MA 4LOCA 2RREA 4YZZA 1ZREA 5CPRB 4RAZA 1PB8A 2L7ZA 4WEDA 2NS8A 3I4NJ 1BI1A 3JRFA 3I3VA 3BZCA 1Y4TA 5DM6F 3SEUA 4L9TA 1KZ8A 3W2WA 1VFEA 3FKJA 4P56A 5B70A 3UGWA 1ZLJA 2V7FA 3DPLC 4XONA 2Y7RA 3HJEA 5JVTA 1NK3P 4FE4A 2V4JC 4IRIA 4JX4A 2HFBA 2JWTA 5IT3A 4F55A 4P1WA 4G4PA 1XCBA 1ZLKA 4HV6A 4C2UA 1R4NB 4BY7J 2V79A 3U93A 3FXOA 1MD0A 2KR0A 4UY8I 4JWOA 1S7YA 3V8JA 4IHYA 3IOWA 1Z9CA 4F92B 1GVCA 3ZMTA 3PUVE 1IW7F 1VQ6I 1CE2A 3RTWB 2XSDC 3JREA 4G8XA 4HQMA 4ON0A 2IRFG 2XD3A 2E60A 2MLGA 2RN7A 4U0WA 4D1QA 3QAXA 4S04A 1XMKA 2F5FA 5JI6A 1ZR2A 2PJRB 2EV6A 3DKWA 1J5YA 2JN6A 2CV1A 3KC0A 3RN8A 1YLFA 2LSOA 3HTUA 4LA9A 2EFNA 1F1ZA 2QA4I 3E6CC 3FV1A 3OR2C 3Q25A 2ZCWA 3LQQA 2Z8DA 4LK1F 1SI0A 5TPAA 3EETA 4THIA 4PFIA 2L5VA 2A5TA 1J75A 4HTGA 4NF4A 4D0PA 2REJA 5FHOA 1YX5A 3GFIA 1XS5A 2F6PA 4A3LJ 4R9GA 2E1OA 2ZMEC 1MJBA 5HLIA 3CP2A 3R6UA 5FHMA 3RNNA 3F6OA 1XGNA 1MQHA 2OBGA 4XN3A 1QHGA 3GZNB 4O3AA 1LVKA 3FXBA 4KQPA 1IUDA 2VGQA 1OCOH 1LE8A 4JX5A 4B1RA 3FIRA 4EEFG 4E7ZA 2VC1A 1I39A 2I5UA 4TV7A 1ODDA 1YJWI 4C30A 1BR4A 3SXYA 3OS2A 2Z1DA 1AU7A 4KITB 5C4JJ 4MIMA 5LLQA 2ZNYA 2ZNUA 3UP9A 3K6GA 1LKXA 5AA2A 2EZIA 2DXIA 2WB1A 2NVUB 5DYMA 1QUIA 5FTHA 2DMUA 1FJ6A 4M3BA 1MXWA 4AIDA 4F18A 5A5LA 5FRMA 1FBGA 2KKOA 2V25A 5DW8A 2ZFWA 1VQMI 2Z33A 1K6OA 4BJ6C 1FX7A 1SFKA 2W00A 4IGRA 2VT3A 2LY1A 1UG2A 3LOCA 2F4MB 5L3EA 3LAJA 1MQGA 3RY3A 2EB7A 1ZG1A 4BE0A 1YS6A 1LDDA 4R2FA 5A5XB 4M74A 2XXPA 2E19A 3Q27A 2FF4A 3CO7C 1T0FA 1A31A 4BDZA 3RKXA 2Y9ZA 1X3UA 2YX4A 2DQLA 3ECOA 3PM1A 4CCNA 3WTUC 2PI0A 3J7AY 1FW0A 3FVOA 1ELJA 4NG7A 3T0JA 5L9MA 2CUEA 1SANA 2P7VB 1BLFA 3H6WA 4RPOA 4YIIA 1MQJA 4P9KA 1DPRA 3U21A 3ML6A 3ZKKA 2DO7A 4B3XA 4NAPA 4IF4A 5CVJA 1J0RA 3J81Z 3MP6A 1SI1A 1DTGA 4B09A 5A2QK 1IEJA 1P1UA 1Y9UA 3CFLA 3O66A 4JBZA 3HGYA 1UTBA 4LIUA 2GWRA 1LBXA 3HKZA 3WTWC 5HLHA 4KISA 5JTYA 1LDKB 1U5TA 3T96B 3OYIA 2KDZA 3C32A 2OTJI 3G4SI 3IAZA 5H8FB 5D8LB 4TOZA 2XGDA 1KYZA 1XGOA 3ILTB 2RNGA 3PQKA 3QP5A 4M6VA 3R0JA 3HSTA 2E7XA 2YPRA 1RKMA 4FECA 3SHFA 3IJXB 4EM1A 3D1RA 3MW0A 4AIJA 4OVSA 2CO5A 2MGQA 3O6BB 3T93B 3QMFA 3OYEA 4DZ1A 4ZECA 5BUUA 2P3VA 1S5LC 5HM4B 2I49A 4NWCA 2DODA 5LGTA 1UG0A 3MVZA 2EQRA 2V9PA 5EQ8A 2PMHA 3M3KA 2XF5A 2ISZA 1GR2A 2O6AA 2O7UA 4BDOA 4OWRB 3RPUD 1ENHA 3JRGA 1OLCA 4GCVA 5IYDJ 3U65A 3A0HC 4OVJA 3K1NA 3N97A 3BWGA 3W6VA 2XHDA 2ZZWA 5EEAA 1BIYA 2GHAA 1LQ1A 3FMRA 2B3FA 4C3JJ 3MC2A 4RA1A 1ORKA 1TWFJ 2DYRH 2LK2A 5E1XA 2WWYA 2LKXA 1FBDA 2HAUA 1AOVA 1AH5A 2B65A 4U21A 2OPTA 3KYLA 2AHQA 4E4HA 5LHIA 3GCMA 3F23A 4YAHX 2COMA 3C1DA 3FUZA 1W4MA 4XRFA 2ZXIA 2NWJA 1Y6IA 4LG0B 2F35A 5DEXA 3KP2A 4GWWA 3NRVA 4B44A 3IOTA 2NS7A 3K9TA 2PN6A 1WFXA 4DBRA 2Z23A 1QZZA 3HC7A 2K3FA 3IWZA 3VXCA 1N75A 3DP4A 3MCZA 1TT1A 4RAGA 2PT2A 3C2GA 2XHKA 2J5PA 4JK1X 1ZK8A 2LY9A 4NF5B 2FE3A 2XC7A 2D5VA 5DVJA 4ZEKA 2DOEA 3FBIB 5DCFA 1LFHA 4FASD 2K86A 5TGTA 5HNHA 2CQ7A 2J5OA 1B52A 1FYLA 3IOUA 4HBLA 2BZTA 1H89C 2XAJA 4EJOA 1OYYA 3BG6A 3H3ZA 5J3LA 2VKDA 3HSFA 1PDNC 2ANJA 4KXPA 1YITI 4LJZF 2V93A 4F1UA 4ZS9A 2VXZA 2OX3A 1XSVA 1PC3A 2EA2A 2Z99A 3Q0VA 4XLAA 5EJCA 5KK1A 1B05A 3L2WA 1GT0C 4UUSA 1LBBA 5BMZA 5K5OA 2E0SA 4ZZEA 2DQVA 4FAJA 1XDUA 2JVGA 2X6XA 3T9UA 3HB9A 5EF6A 4IO6A 4NNJA 3SFZA 4HV5A 3ZMVA 3C18A 3TP3A 2R5YB 1FEXA 3OYBA 2WV0A 4PCDA 3MZYA 3WTTC 4R75A 1P4AA 3IKTA 1OCRH 4WEPA 2VODA 2FQ3A 2JRMA 3MN2A 3EYYA 4RS8A 3I55I 2KISA 2KIUA 1A35A 4BL0B 1FQEA 3WGIA 4Q0CA 3E3KA 1W36C 2HQNA 4ZYDA 4OTEA 4UNOA 2M1BA 1LDJA 2VL8A 1SAUA 1GDTA 2UV1A 2V9VA 3I71A 5M5YJ 1VQ9I 2XXXA 5CM6A 1B1XA 2O1MA 1Y8QB 2K27A 3N94A 1E2XA 1I27A 2DA6A 3PNVA 4EDPA 2YX7A 4LK0F 4DQ2A 1A8FA 3BCAA 2IXSA 4D9JA 4JVIA 2JPBA 1IGNA 1ZTRA 1I6XA 2L02A 1VZ0A 3CCRI 1XSDA 3ZPLA 3CG3A 2Z8EA 1FPQA 5E8GA 2DBBA 3QWLA 2JQ7A 1XC1A 3R26A 2K9QA 2P6TA 1WVRA 4EMSA 1LBCA 3PUFA 3IFAA 1AIVA 2H1LA 2IVMA 4EQQA 4FX4A 4NGUA 4NQ8A 5F1QA 2NRAC 2WY8Q 2P3NA 3DKXA 4V19K 1B9NA 1CQTA 1FTJA 5K7FA 1USYE 4KN7X 3ABTA 2JA6J 3BP8A 3BCBA 1IXHA 4FHTA 5LRSA 5E20A 1QVSA 4N91A 2EV5A 3QU6A 2CMPA 5K2XA 1K79A 4E7IA 1W0TA 3MJNA 4LQ5A 3QRFF 1U3EM 2LKSA 4IKFA 3OMBA 3MZBA 2Y31A 3S14J 2H09A 2O69A 4II2A 2XA5A 4G8HA 1CNQA 4RB3C 3QQAA 5ED4A 5JLWA 4QPOA 4XLNF 5DT6A 5FD5A 1MDMB 4MIJA 4JDFA 3BG5A 4FISA 1IXSB 2FOKA 1YX3A 2E2JJ 2W57A 1O3RA 2I3WA 2O7IA 3GTGJ 1R6ZA 2LDUA 2QQBA 3NWSA 4WXCA 4XN0A 3N4MA 1TC3C 1PB7A 2HQRA 2EFOA 2M4GA 2W7NA 3B6WA 1QGPA 3G3ZA 1QO0D 1ZAOA 1U5TC 3FATA 4PE3A 4POWA 2R4GA 4O5VA 3ZQCA 1NMUA 3H3UA 3H06B 2W24A 4LVQA 1YPNA 4GXOA 1Y20A 2THIA 2L01A 4P5OA 1YW9A 2Z3YA 2F7CA 2R6GE 2GLOA 2YLNA 3BZKA 5CVVA 2PFYA 3GUDA 1P7IA 1H3DA 2LFBA 2R8TA 3HDDA 1D8JA 4HNUA 3KOSA 2A6EF 4BYYA 3RCOA 1FQFA 1YRNA 5H8HB 1F43A 4N6PA 3IO6A 1O3SA 2ESNA 3H1CA 4AYBN 2ESHA 1JQFA 3E9XA 3CC2I 2V1NA 3TUSA 4PJNA 5GAGJ 1DGWY 2OCCH 5D5UB 4OFLA 1U78A 2ID6A 2Y5KA 5LTCA 4KT5C 3I56I 5FRNA 1RPWA 1PDAA 3RPLA 2DA4A 3VDXA 3A2KA 3V7RA 2UYFA 1SW4A 2AS5F 1RRJA 1Z6TA 3I59A 1OLAA 4GWSA 5CMKA 3OEKA 1V54H 5FKLA 1ZGWA 2PX1A 3HRUA 4Z6YA 1MS7A 4IY5A 1HF0A 4MF3A 4MNCA 4U4SA 5L8DA 1M5EA 4WXJA 1G3YA 1KA8A 1LLSA 4RA2A 5I59B 1NFTA 2L5QA 2ZXWH 4E7KA 3K2DA 4F7ZA 3S16J 4A0ZA 3FK6A 1UTHA 3AG1H 3V8LA 4A12A 3FXMA 1XSXA 1XB4A 2XKOA 3WE2A 4YFNF 5K7ZA 5LD2C 1QRYA 2BXZA 4MGRA 4FCYA 2R7ZJ 1MDQA 1XOCA 1QUKA 2ALUA 3IR1A 4MQ9F 2CQNA 3OL4A 4BDNA 5FFXA 3LSPA 1W5CC 4ONYA 1NNTA 3GTKJ 1IN8A 4U0VA 2M45A 3RYDA 2HZLA 2AO9A 1R00A 2P0SA 4GWOA 2N8GA 2XB0X 1MJ9A 4AQ4A 1LVAA 2BY3A 3GLBA 4KYDA 5I59A 1YO5C 3ZN0A 1AKHA 1JGGA 2FBPA 2IPQX 1EZ9A 3U72A 3MPKA 1FY7A 4QFNA 4I76A 2EZLA 1MQIA 3VV5A 3IB1A 1JKOC 3C9HA 3TTMA 3MWBA 2B0LA 2L54A 4H1XA 2CYYA 1UTHB 3K69A 2GBYA 4GD5A 1Z3XA 3U1KA 4BY1J 3S9NC 4RNSA 2PEXA 3CTAA 4OYVA 1O3TA 4ZDMA 1TZLA 3LSRA 2IAIA 2O3FA 2L9RA 1FMWA 6PAXA 1ZTYA 4IOCF 2B3BA 4DXBA 3RPUA 2H25A 1MXZA 4AB5A 1O7FA 1KZHA 2GOMA 4G6TB 4DBQA 2IGKA 1W36D 2QJEA 3CSBA 3PTYA 4OFOA 3LA2A 1NH8A 3IX1A 2BW3B 2Y48A 3PU5A 1TQPA 1U6GA 5D4RA 2XXUA 2Y0MA 2MLKA 3FXKA 3RQ4A 3G73A 1WDNA 2H8WA 2X6WA 4BJTA 1US5A 4LONB 1NKXA 2CU7A 1MRPA 2VOZA 3BG3A 2AXLA 4A3DJ 2HZDA 4QLCU 4FIMA 3LFKA 4GX3A 1YYVA 2MC4A 1V4RA 3E6MA 1F4KA 4NF8B 1Z0XA 2JTVA 1WPKA 4ZTFA 2BW3A 4AB6A 4NMYA 2XVCA 3OYLA 1A5JA 1ETWA 1QUJA 3KEIA 1B5HA 1D1CA 1FBSA 1XN7A 1MM6A 1Q9DA 3SEZA 2VONA 1LFGA 5I56B 2VJ5A 3EQ1A 1Q35A 1RYXA 3QK6A 3O8HA 3LSIA 1T08B 4X1EA 2L9VA 3C7JA 2I3VA 5FKMA 2LNBA 4BHBA 3JSOA 4QHQA 1FJ9A 3BBRA 2OQRA 2Y69H 2HPIA 5EYHA 2YS9A 4Y52J 5HS8A 2P5LC 2EJRA 1D9VA 1MZBA 3CO6C 4OIPF 1MGTA 2K40A 4WXDA 1OQHA 2OZUA 2RC7A 2OAZA 3LWFA 5L3FA 2VQLA 5IM2A 4UB6C 2JA2A 1LJ9A 1VNDA 4HAMA 2DQRA 4IHSA 4CA0A 2R93J 1ANFA 2ABHA 4GBWA 3TDJA 2VJIA 3F8MA 3TBIA 3H9GA 3CI8A 2OA4A 3CJQB 1UTBB 2OD5A 3S15J 2H1KA 2HAVA 1GV8A 5CQGA 3CFXA 5E3MA 3A09A 1EYJA 4RMNA 1LGBC 2ZZVA 1X3ZB 1EYKA 1MY4A 1FSHA 4AUXA 2G9WA 2DMNA 1ZJLA 4F39A 2AL4A 1Z67A 1QVUA 4ANJA 2KRCA 2VQGA 1TT0A 4N07A 3K4UA 5EYFA 5CBRA 3TO6A 1INPA 4QSDA 4HE0A 1N7WA 1WZ2A 3QUJA 3Q5FA 3BJ6A 3AFHA 3E3VA 2NXNB 2AQEA 2FBHA 5CJ9A 2CRGA 3G2BA 2DDAA 2XF7A 3MAJA 4PGHA 5IY5H 3RKQA 5K5QA 5EQ7A 4F19A 3OR1C 4P9FA 4IOAF 4A93J 1Z21A 5LEJA 2ZB9A 4Q47A 1Y0NA 4HDUA 3TDZC 4BGDA 3HPGA 1BI3A 2WC2A 4LB6B 2XX8A 4NF0A 1JNFA 3K6VA 4DCYA 4YELA 2CW7A 2DPDA 2DJNA 4LLLA 3E7LA 1ZKBA 3HOWJ 3H36A 1OKRA 2PJPA 5FO5A 5H8NA 1DCUA 4N8GA 5DEQA 2HPMA 5FTIA 5H8SA 1X3WB 3K1PA 1NNFA 1EH7A 2PBWA 2IS6A 4PAIA 2MD0A 3DV8A 3EUKL 3KLOA 4M73A 1FPGA 3FKIJ 1F36A 3NQOA 3RZOJ 1GLNA 2XX7A 1B7UA 5AIQA 4R73A 4KDPA 1W1WE 4NC6A 2RCBA 4YMAA 2X9DA 3ZXSA 1S3JA 3LSHA 4EM2A 4QPQA 3HOTA 2R5ZA 2QVRA 3GXAA 2RAEA 1MXVA 3SZGA 4I0AA 3BROA 1VQPI 1RYOA 4FT8A 3OY9A 3FMQA 2ZKZA 3OELA 1KU3A 4D5FA 3OS1A 1JJ6C 1FLIA 4QSEA 4G68C 4EF2A 2MH9A 4HSTA 2B63J 5K7HA 3LV0A 2YJPA 2FUG2 5FGMA 5FKOA 1DU6A 1MBEA 3GFJA 4BXUA 1HA8A 4AD9A 1B4AA 1GV5A 1R1VA 5F7VA 4O8MA 1B3EA 4XTCQ 1QQIA 1MDMA 2KIMA 3TTKA 5LGNA 3B6CA 5ILVA 3ZQQA 4U2RA 5H8NB 2L2OA 4AIKA 2R7UA 5JFRA 2M9HA 3AKZA 3E13X 4PGPA 3CLQA 2QKMB 4OAYA 3JRBA 1YE9A 3RPLB 3WE3A 1P1NA 1BR2A 3K70D 4G8NA 2M7AA 4XL9A 1R9LA 2EK5A 4FETA 1S9HA 3BT9A 5DYHA 2GAUA 3QXMA 1IG7A 4XM3A 1V3FA 2E2IJ 1YOVB 3OIQA 3JRIA 3KOTA 2DMPA 4ITVA 3OO9A 4H6DA 1GVDA 1SFOJ 2WTEA 4XBFA 2FYIA 4XEQA 1URDA 4F3GA 5H8HA 2VN2A 1FSEA 1XVYA 1BC7C 4UV9A 1FYMA 1NG7A 2DAOA 3FIWA 3CMYA 1AOYA 1LCFA 4EXLA 1Y8RB 3LL7A 4N0BA 2CEXA 3G3IA 1NV6A 4G7HF 3IWFA 4HW0A 1HOMA 1KA0A 4F52A 3PMVA 3WTYC 1QZEA 4J01A 4RYAA 2AXTC 3SFIA 3M1CA 3KGCA 1X1AA 2JK3A 2ZYNA 4P0IA 4PFTA 3TELA 1D9QA 5K5RA 4IO4A 2VQHA 2XPVA 4HRIA 2HTJA 1USSA 4F22A 2GIVA 1YQAA 5ICGA 4F31B 3TO7A 1DBZA 1OPCA 1MMGA 2DK5A 1I3AA 3QOPA 3RJPA 1EF4A 2XWOA 1DOTA 2EBIA 3KEQA 3VSKA 1FTOA 4I8CA 4KHZE 3RIRA 4O3CA 2W82A 4H0WA 4XICA 5EGOA 5JTYB 1E3PA 3M3YJ 1FQDA 2XXRA 1SD4A 2XRLA 4ELPA 2HHMA 2NOOA 5L9SA 4MH5A 1N0TA 5J8CA 3PUWE 4GOTA 3CCQI 5DVIA 1UQWA 5HDKA 5ICTA 3L2RA 1OYIA 4KFQA 3QPHA 2W84A 2V1DA 5AONA 4E7HA 4HF0A 1ONVA 1E0EA 5JR3A 1A6IA 5IZ3A 5EG0A 2CSOA 3EN3A 5M3FJ 2DOAA 4GO1A 2R7RA 4ZZDA 4IQ4A 4P1LA 3HCQA 1FIAA 5EQAA 5A5XA 4R6KA 1DDNA 2NOGA 3CMEI 2LC2A 3E5XA 5F04A 2PJRA 5AA2D 4DIQA 3W3CA 4PDHA 1B6AA 1B3HA 4C2MJ 3LSXA 1ZELA 1PUFB 1BP5A 4FORA 3PIOF 5GADJ 3LSWA 1F9NA 4BQQA 4JQFA 5EYGA 3TYHA 3OYHA 2Z16A 3H9QA 4UVAA 5E1WA 3PUZE 1WH7A 3CUQC 1IO2A 4R2BA 2ME6A 3DEEA 1FBUA 3KETA 2LR8A 2DDKA 5CRYA 4C3HJ 2E1MB 4D7NA 2NNYA 4N17A 3CUQA 5KNLA 1LBZA 3ZGKA 3HBLA 3L9FA 2XX9A 1HXDA 2DCEA 2H9BA 4M9XA 4ECFA 3EF7A 3RPQA 2LY2A 4GYIA 1TLHB 1SEUA 1KA1A 3HOSA 1IDYA 1HW2A 4R1HA 1M5BA 1XHYA 2UVGA 1S8NA 3T1BA 3WAFA 1S29A 3GFLA 2Y30A 4RB0A 3MP1A 1AKHB 1TXFA 1WKMA 4H8IA 2X1DA 1LSTA 3OENA 2JUGA 1HDPA 1Q1VA 4XKRA 3S9MC 2EPFA 1K61A 3T8RA 4CICA 2R71A 1DP7P 1QW0A 2UUZA 3CZ6A 2CZKA 2O84X 4QSHA 4KMFA 1FOKA 2FIXA 2NVTJ 2CFXA 2XDVA 1FYKA 5KCJA 2R7SA 4RJZA 1F5TA 3F8FA 1LE8B 4OEVA 2M0CA 5E1ZB 1R1UA 5TJJA 3THIA 2I58A 3EUHA 3W9VA 1WWXA 5IT9K 2QWWA 4IO7A 4CSWA 5CVUA 4HF2A 5F1RA 4P11A 1XTAA 1FPJA 1QULA 3L1PA 3KX2A 1WH5A 3DLAA 1ETXA 2VXDA 1VF9A 3AL0C 2NAZA 3ZMZA 1N84A 2DYSH 1IN6A 2YUSA 1BI0A 2KZVA 3CCJI 1FP1D 3QYEA 3CP8A 2EILH 2MABA 1FTAA 1NUXA 3FVNA 3M8UA 4D5CA 1Y3NA 1S6LA 3OSQA 3DP8A 4KI0E 1MSEC 3LSFB 2KPMA 4HNVA 2V3UA 3S3MA 1D0YA 4ELQA 4DI4B 5TP9A 2QFLA 2Y84A 4PGGA 1MPBA 2L9SA 2Y7PA 4FE7A 2I0CA 4D7MA 1II5A 4OFJA 2FBKA 2IGNA 2DI3A 3HSRA 3WG7H 3MWMA 5FD6A 3ZP5A 5ICCA 1L5TA 5EEGA 2X1EA 2P81A 1PUFA 3IJOB 3PFYA 2RQPA 4CYCB 3CCUI 1QHHD 3WU0A 1O63A 2P5VA 1FOYA 2IA1A 2R7DA 1SBPA 3RI4A 1A40A 3S3OA 4HA8A 3RKWA 4G9YA 3BQZA 5J4VA 1MNDA 1Q1KA 1O57A 3VFZA 2IGOA 1BW5A 1B7ZA 2XXIA 4GWUA 5EG0B 3ZQHA 3FF5A 3D5SC 2A07F 4PFBA 4PSXA 1CGPA 4P0GA 3LSMA 3SEWA 3D5LA 4PC9A 1LAXA 3HFUA 1ZHFA 1O3QA 1SVLA 4G7ZF 2QQAA 3TKDA 4BQAA 2M87A 2BEOA 3J80K 2WV1A 2HQAA 4F29A 3G3HA 3SEXA 5ET7A 5IYCJ 1Z7NE 1B59A 4Q5SF 3KE2A 2ELKA 1EA3A 2A5WA 4X1BA 3PGFA 1QA6A 4LGWA 5L3GA 2ZXTA 3T9VA 1ERDA 4Y3OA 2CEYA 1HBXG 3OYDA 1K6YA 1QU3A 1B9MA 2X1CA 1WQ2A 5F64A 5L3CA 5LGUA 4XKBA 3LNQA 4QWQA 1A55A 2VC0A 3K10A 1FOXA 4Z0IA 4Y4RA 3S2DJ 4MMPA 4ZEDA 5ITPA 4H0EA 3GYYA 1QGXA 3G7WA 3FJ7A 2L4MA 2A69F 1MY2A 4MLOA 5F24A 4BDMA 4CYDA 3AG2H 5I7IA 3TOAA 1FIPA 1MG1A 3C36A 4K2EA 4GWYA 3B8BA 2E5NA 5H20A 2F4IA 3VWBA 3KN8A 5J1YA 4PDKA 1LAGE 1SPIA 3ESWB 4W97A 2HQ0A 3BKIB 1H43A 3PUXE 2L3DA 2OQGA 4FE8A 1MY3A 5ITOA 4DIGA 5FJ8J 4L18B 4YKKA 1FCKA 2DWHA 2EIJH 4A0YA 1PYVA 2Q2EA 3M3LA 3ERMA 4NE4A 4ESFA 1D9YA 1LAHE 4KFCA 1IMBA 4OMBA 4YB5A 2I8DA 3AG4H 2BV6A 2E1CA 3G71I 2Y7IA 4BHPA 3K4CA 4Z2YA 2DOJA 5DS9A 1S9TA 1YW7A 5LBQA 4A3IJ 2ZNZA 3WTXC 1G0IA 3PJRA 2ADUA 4FX0A 1ZG5A 2VUMJ 3L2CA 1JTXA 2D3IA 1ZBMA 4N4UA 1US4A 3K4BA 2O68A 4FTHA 3ERED 4GQOA 4NX1A 1JGSA 2IBDA 2X6OA 2FSWA 4I3YA 1ZG3A 4ISUA 2QRYA 1B40A 4BXFA 1SFEA 3EHSA 4MLVA 2M34A 5IZZA 1R5HA 4IPAA 3HYIA 1JHHA 2M5WA 2KIFA 2PX9A 5F0CA 2JJKA 1S7AA 4KT6A 3GTLJ 1I6QA 1G0HA 1YJ9I 2GXAA 1EH3A 5CC2A 2WA0A 4GRIA 4TLMB 2R5ZB 1Y1ZA 4B8XA 3DLLF 3PD9A 4XOTA 2FXAA 1WI3A 2QEXI 1HKQA 4ENMA 4XKQA 1IMCA 3SKPA 4ESXA 4G68B 3BR0A 2UXXA 1CB6A 3IOVA 1SFUA 3VLWA 3G3GA 5FKKA 2W4SA 1D5VA 1NTCA 2ECBA 5M5WJ 2K4BA 3HHFA 3E1SA 3GX4X 3A29A 4UVBA 5J40A 2ECCA 3JRHA 2R3SA 2IA2A 4XRMA 4X0GA 2XIGA 3F8BA 4XLCA 4PJJA 2ZSIB 1IUFA 4GYGA 1IDZA 2Q2CA 2QF7A 1FJLA 4XXUA 3SEQA 3J80Z 2JZYA 3GTOJ 3H03A 4OINF 4OANA 2VJJA 4HW8A 2XXKA 3CF2A 3ZMUA 4CXFA 4E7JA 3DTKA 1FP2A 3LA3A 4Y33A 3M4OJ 1N25A 2WB1N 3EUAA 5M3MJ 1BJAA 2FQ4A 1OCPA 4N4OB 1B72B 3PL8A 3TQNA 9ANTA 2BJJX 3LC8A 3O6GA 2DTZA 3K6XA 2F78A 4BUPA 3K0VA 4RM2A 4MLQA 4AU7A 3HRMA 2Y0SA 5DTDA 3HUGB 1URSA 3CC7I 4GWXA 1RUNA 1ZKGA 3NWTA 4G61A 3HIFA 4B47A 3OO7A 1GVJA 3TTRA 2O61A 1Z91A 4LZ5A 4IRHA 2XROA 2XAFA 2IP2A 3V5AA 4A3CJ 3MFKA 4HCWA 3DFGA 1D3YA 3WTSC 3A1YA 4LATA 2DW4A 3TEDA 4O3BA 1OVTA 3WGGA 3U2RA 1YFHA 1HDDC 4LLNA 1HSTA 1JW5A 3KCCA 3E4RA 4EJWA 1POGA 2ZJQF 3F72A 3JZJA 4C3IJ 2BOLA 4L9JA 2EZHA 3M9AA 3P7IA 2CMOA 3I6VA 1WJAA 5DEXB 1B32A 2FNAA 5J8FA 2M7BA 1Z7LA 4MHGA 3KJ7A 2K9MA 3HKZN 3L6HA 4BAYA 1MXXA 3LMMA 1MXUA 2FA7A 1J7KA 1X58A 4XLFA 5HLTA 2HOTA 4OU0A 4AIHA 4KYEA 2WY7Q 2B9SA 4QXDA 4KR5A 3Q0UA 1LBWA 1FTMA 4F3QA 2V4CA 2Z22A 4UV8A 2OF7A 3QYTA 3TZAA 3IH4A 1NH7A 4JSOA 1BJZA 2WADA 4PK4A 2RDPA 3VE1B 4N6DA 5D5WB 1OLTA 4PJLA 4RPNA 2KT0A 2W48A 4P55A 1B8IA 1IXIA 4LFUA 2VI6A 1ZGJA 1N3XA 2D5WA 1UMQA 1R9QA 4YKPA 4DOZA 4PFUA 2AL5A 1LB8A 1VR5A 4S05A 3K2ZA 3U92A 1DGRM 1NHAA 3OIPA 3J7ZI 3L2QA 4CO8A 4IZZA 1FQCA 4OAZA 1LAFE 3QYFA 2ZJPF 5D5VB 1VQ7I 3I54A 4GX6A 1QBJA 4BJ5C 4U87A 1JKQC 4BXXJ 4DCXA 1WRJA 4L9VA 1PVEA 1XGMA 1N04A 1T98A 3KFMA 3IO4A 4KIGA 4BEHA 1BN5A 1B4HA 2NOJB 3DEWA 3A3CA 4OESA 3TTLA 1XC5A 4EM0B 3K02A 3MQ9A 2EFQA 1LBVA 1ZIUA 3OO8A 2PG4A 5B1AH 2XD2A 1LFPA 4U1OA 5KZTA 2QLZA 4KMUX 2KZGA 2DA5A 2HTSA 4G6DA 1QNTA 4ZYEA 2KQZA 3R60A 4BHCA 2FNCA 4H8JA 4QTRA 5DD8A 4XKWA 3OYGA 4ENJA 4XQFA 4IVNA 2FEZA 3C34A 4EGYA 4M3DA 4UB8C 2M30A 4UUTA 4EQ7A 1OR7C 2RV8A 1LEVA 2QMWA 5KCMA 1YRNB 5FKNA 3OSRA 3F8CA 3QOEA 2GZWA 3D4GA 1OIBA 5IZ3B 3OOPA 1MMDA 3WG9A 1NH3A 1JW1A 5I2NB 3HZJA 4X8RA 1I5ZA 2Z8FA 2DWAA 4OERA 4DI3D 3S1QJ 1FPBA 2WBBA 3KFWX 1R5ID 5DV5A 2LG4A 2DE3A 2XAGA 2B4MA 4IQJA 1ITYA 3PO2J 2M2EA 3F21A 2HQ5A 3K4KA 4E6KG 4UHTA 2W1OA 2D1VA 2OTLI 4ZZAA 1A36A 2YU3A 3BR3A 2CW8A 1UAAA 4NEDA 3KSJA 4NBQA 3F0CA 5FLVA 5KDTB 2E1SA 4O6JA 1FPDA 2MD5A 5C3EJ 1RDXA 1IF1A 2GH9A 4K3FA 2O03A 3TDUC 4JOMA 2HVQA 3KPHA 1TNSA 3O3KA 1SVXB 4Y7NJ 2GRVA 3CRBA 1TW3A 1K4SA 3O2AA 1GXQA 3TFLA 3LFUA 1B46A 4OZ9A 1TWCJ 1R6RA 2MBFA 3KC1A 3DCFA 3OEMA 4OQOA 3T5XA 4DJAA 1SC7A 3GBAA 3HOXJ 1NNKA 1B6HA 5HDGA 4U7DA 2CZIA 4KCCA 4BDRA 3S3NA 5BS6A 1T95A 3MKWB 3CVGA 1RR7A 2F8DA 1VQNI 2XAQA 1DP3A 3ASOH 2L7KA 3J81K 3GZ5A 3OD7A 3H6UA 4R74A 1XPXA 1EZOA 1EJ9A 2O8KA 2H8RA 1MBFA 4LB5A 3G1MA 1J9IA 1H45A 3M8JA 4F2OA 1N77A 1IQ7A 4G6QA 4PF8A 1S7OA 1YYZA 2F5DA 1D1BA 3ZQLA 4HZFA 2DXYA 1TNTA 4JSDA 2MG4A 3FK7A 4Q48A 1JEVA 1UIVA 4RDUA 2XXTA 1ON1A 4I9DA 1R9TJ 2M3AA 1R22A 5ISUA 4RLFA 2DWJA 5E3LA 2CJJA 3LA7A 4PJ0C 2VQCA 1DUXC 3MQ0A 3RKYA 4XFEA 5CVRA 4RM3A 1BKAA 4KUMA 2DSFA 5EEHA 3O6IA 1J59A 5J16A 3ZQFA 1JT0A 1DMBA 2QQ8A 1XG1A 3MKLA 5F0FA 3SDGA 3AXFA 4H46A 1GXPA 4MBPA 3OO6A 1REPC 4IRGA 1WHUA 2R7TA 5DD4A 4LUBA 1IAWA 1NG6A 3CMMA 3CCYA 5AA4A 3HOUJ 1NV4A 3LUZA 4XIGQ 2GA1A 3DTIA 4RY1A 1X1DA 3RQIA 3HN0A 1J09A 2FX0A 3K0LA 4N9HA 4YRVA 2CUJA 1MNMC 1IIWA 2DMQA 5FFZA 1G3WA 1K7AA 2PYYA 3ZR8X 3IAS2 4POXA 4RGSA 4BE2A 4G94A 3VLVA 3FDYA 3PPRA 3LSJA 4ZC3A 3OYMA 2H99A 1G3TA 3ONMA 5B1BH 5HDNA 3EKIA 4HF1A 5D8KB 5ET8A 2WKYA 4ZZLA 4MNIA 1AWCA 1BBYA 4MEVA 4JXIA 2EINH 3LBSA 5LDZA 1ETKA 5EDNA 3BG7A 2OU2A 2Q89A 1UELB 1AMFA 3U1OA 2WAEA 1P1WA 2Y7WA 5JHFA 4KIFA 2A05A 3GBGA 4A5NA 1YIJI 4C0RA 3L7WA 1TWAJ 1H9GA 4XLEA 1FPIA 1DPEA 5K2YA 3U9GA 1I1GA 3PQJA 1R23A 3VYUB 2VLAA 1FQBA 2L7MP 4R79A 3L00A 1B2HA 3LSGA 4DYQA 1MSFC 5LHGA 1PBQA 1P7JA 1EU8A 4KCDA 3VOEA 4M4GA 2Y0SN 5FHNA 5LRRA 1Z7UA 2QBYB 4TLLB 2XAUA 4Q4ZF 1MBJA 4H5GA 4ZEBA 2ETHA 4CUGA 5DCMA 3RUMA 3CDLA 5EZHA 2OZZA 4IO2A 4IHXA 5JEIA 3HPHA 2X26A 3S4UA 3HEFA 3GWZA 5B3SH 2H4IA 3NOHA 1D8KA 3S9LC 1P6RA 2GIZA 2GM4A 3VEPA 4HX7A 3H0GJ 2EA4A 2LAOA 4HS7A 2Q8JA 3KYDB 4MCOA 4CYCA 2LVSA 3FISA 5ERIA 3L2VA 3C2BA 2CZLA 5CMBA 2ONSA 5H6QA 1S7EA 1A54A 1M5FA 1OCZH 3IKVA 1MH4A 1PP7U 1PBPA 2FHYA 3MVWA 4R72A 3I5UA 2CGPA 3OYJA 1W0UA 2BE5F 3UA8A 2DA7A 4DNCA 3KZZA 1VTNC 4EJTA 1N76A 3C31A 2W85A 3M1EA 2WBDA 4BE1A 3B50A 4OVQA 3SETA 2JJ7A 2P7CB 4BDYA 3SDBA 4EUOA 1R58A 4WK8F 3IL1B 3CJNA 5J1RA 5I3SA 4EQ9A 1A99A 2H6CA 3UNGC 1FBCA 3K1MA 2MFZA 3MUQA 4PCQA 2A3SA 2DE2A 4F3SA 3FXUA 4M71A 3OYFA 2ICWG 2PMZA 3GTQJ 1R36A 2UXNA 3IAM2 3ZOBA 2QS1A 2XWKA 2XWVA 3FJGA 3DEUA 2TRTA 4CCLA 4PFYA 1VSOA 3WU1B 3KBZA 4MNPA 3UK4A 3T22A 1ZYRF 1SW1A 1V5EA 3ROJA 1ULYA 5BNGA 3O29A 3K70C 5KDTA 4C2TA 5LHHA 4KPTA 3JTGA 3KP5A 3KYCB 4GWZA 1FRPA 5I56A 2BVLA 2F7BA 1OVBA 3I53A 2GQ1A 3CF5F 4IGTA 2X6YA 4N13A 4L9NA 1KU9A 4G68A 2EIMH 4PF6A 2MA3A 1M5CA 2R7FA 2HNHA 5TRDA 1DU0A 3G1OA 3BJAA 5H8QA 3SEYA 1TP4A 3CD6I 4CH7A 2RNJA 4EJUA 4MAGA 4LG0A 3VYTB 1MJAA 3M8EA 2EFWA 4I2OA 1R1NA 4MQVA 3K6UA 1RI7A 3N6TA 4GVOA 2DWIA 1UJ8A 1HCRA 1MBKA 2MC3A 3FMSA 4NN3A 4HX8A 3OYKA 4U22A 1B3LA 2XV4S 4LMYA 1IXRC 4I98B 3S32A 3BFTA 5J4YA 1RNLA 2F3DA 2FVZA 3FM5A 5HODA 1VFCA 1ZN2A 3PD8A 4GXAA 3ZSFA 1OCCH 1G59A 3BQYA 3Q9VA 2CQQA 3VXBA 2UZKA 3CR9A 1HSJA 3SZTA 2CH0A 3MZ1A 2VT2A 3CDHA 2DJIA 1H0MA 1S50A 1URGA 3BFUA 3PPOA 3QSLA 5B7DA 3KBRA 5F1JA 3FD3A 1TWYA 3JRCA 2M8CA 3ZMDA 3QUFA 5ET5A 3ZQ7A 3KZGA 1GGGA 3GYHX 4ZE9A 3DBLB 3USDA 2FD5A 2LBFB 4IEJA 1KU7A 2V6EA 3G3KA 4FJPA 5BWJA 3TW7A 4IR8A 2KP6A 4ENNA 1XS9A 2V26A 4N9IA 2VBWA 3ONQA 1SW5A 3I64A 2I4BA 1KQ9A 4I01A 1NNPA 1U5TB 5CKTA 1NV5A 1QJMA 3F6VA 1G3SA 5FLXK 3S9EA 3H6VA 2DTRA 5BQTA 1QZYA 4M3EA 3OSGA 2BY0A 2FMYA 4Q8RA 3S1NJ 4G77A 3IL2A 4OXVA 4KN4X 1BC8C 4Y17A 3PSFA 2V1UA 3O97A 2DA1A 3JYRA 2FBIA 4NHJA 1BTJA 2YU9J 5J1DA 1HW5A 2KIQA 4PFRA 4AC0A 4Q30B 1X1PA 2EV0A 3I4PA 2HXWA 4NF5A 3FXJA 4PDDA 3RPWA 3SESA 5I58B 5FLXZ 4A3MJ 2IA0A 1B0HA 4H45A 4YICA 1MKMA 2YPNA 5E79C 1IJWC 2XXYA 3GBBA 2R7XA 1VFDA 2RINA 4HXVA 3W2AA 1E17A 2PT1A 3H35A 1APLC 3NAUA 4PUSA 4H67A 4Y15A 2VASA 1TL8A 3O8GA 4E7LA 1P92A 1USTA 5H2FC 4RBOA 2IEKA 2ONRA 3VPRA 5ICEA 3MMYB 4LIVA 2VOOA 5L3DA 1B3GA 5J1UA 5JHUA 4ZE8A 2EIKH 4NF6A 4P8BA 2QM3A 3L09A 2QGUA 1I6AA 3OYNA 2BVMA 3TO9A 1MMSA 1B5JA 1P9QC 4ZYAA 3BR6A 4QRZA 2DYXA 4QSCA 5D6EA 3PIPF 1Y39A 2NUVA 4NHBA 2D45A 4ZYHA 2I10A 2HDCA 1VDWA 4P9UA 1AA7A 1O4XA 4AS5A 1Q1HA 1WJFA 3E5UA 2XWIA 3TPAA 2GHBA 4PTKA 4S0HB 4X9TA 3MVPA 5IGAA 4HSRA 1MW7A 3GF2A 5GAHJ 4F91B 2Y9YA 4IHVA 2OK2A 2A6TA 3KLNA 1Z3YA 2K7LA 5JLXA 3IFCA 1JKPC 3HGGA 4CCJA 3HRTA 4ZEIA 1BR1A 1LEAA 4WCGA 4A2UA 3ECRA 1A04A 1ZRDA 5LEKA 1SMTA 1V5FA 5FBPA 4IXAA 1WCMJ 3IV5A 3B02A 1U0JA 2DVZA 3DU5A 1XMAA 3F3XA 5ICFA 2HXIA 1O7LA 3OOUA 5I84A 3RZDJ 1UB9A 4UABA 4L5JA 4U1ZA 2CWEA 3RSNA 1IRGA 2M8EA 3KEYA 5M5XJ 1C0WA 2STWA 1NV1A 5T3JA 4PQJA 3DXJF 3T8TA 4AM3A 3KJTA 1JHFA 3D4CA 5AIPA 2E35A 2UVIA 5H8FA 1SD6A 2EZKA 2OCUA 2K02A 3UKGA 1PUEE 2LP0A 3BTJA 4QFPA 5GTHC 4B3AA 3MAMA 4LITA 3PFIA 1YTVA 4LZ7A 1IN4A 2P8TA 3A0BC 4O3MA 5F27A 4JVDA 3FJMA 2OZ6A 2WEFA 1X1BA 2JSCA 1JP4A 3IK6B 3DTEA 1N3WA 1IMEA 4A3JJ 2ISYA 2UXAA 4I3EA 2HZTA 2ID3A 1G6NA 2GXBA 4GFBA 4Q5TA 2XPUA 2K3PA 5AA3A 2DFHA 2DFFA 1EYIA 3SQNA 1USYH 4HE2A 3T9XB 1G8XA 1HSLA 3WAEA 3ZS6A 4QFKA 1Y3QA 1NV7A 3GZGA 2ZNSA 4I40A 4PBHA 2XRNA 4KIBA 3MEXA 4BKXA 5GAEJ 1B58A 4A3FJ 1RESA 2I4CA 2PMUA 2X85A 2CV2A 3G1LA 1BL0A 3BIHA 3CQZJ 3P5JA 1VQ4I 4XF5A 3GW2A 4I6ZA 1O64A 4XSXF 3IHUA 3MVXA 3UN6A 3IH3A 1FBFA 2ZYOA 2QS2A 1ZARA 3R0AA 2CV0A 2Q74A 3K01A 2HS5A 1UIUA 3TEPA 4MFDA 3UIFA 1PB9A 1RDYA 2VHAA 4A3GJ 4ND9A 2F5CA 5D5XB 1ACIA 2KMUA 3GMEA 1RKTA 3WU2C 1R7JA 4BEHB 3FVGA 4EVIA 5CLSA 3PUBA 2IGMA 2XASA 3ELKA 1MNEA 2F6GA 3HV1A 2C6YA 1GV2A 2HZKA 3ECHA 4YG2F 5ILUA 3HOVJ 2DOFA 3SYTA 4OETA 2XPWA 3FZVA 1ZGAA 1UHSA 2XB5A 3SDFA 3K2AA 5IPAA 3JAMK 1LFIA 1RETA 1IZ1A 2QVOA 3L2UA 2A6HF 4UUVA 2DP8A 4UACA 4XNFA 4OWDA 3RT6B 2R0QC 2UYEA 2F36A 2G29A 3IB2A 3IRRA 2Q1ZB 5H8QB 2UWMA 2DS9A 4XK4A 2XXHA 3P9KA 3V8KA 4BBRJ 3S2HJ 4M72A 4N4NB 2VIXA 1JJ8C 4R9FA 4C1UA 1NI9A 4L17A 4L5EA 1VE4A 3HHGA 2DFIA 2BGCA 4O94A 1IN5A 3LSTA 1POTA 2OWSA 4HX4A 2K9NA 1VQ8I 1W5SA 2LF7A 4BQNA 4X6AJ 4NWDA 3T9HB 2HVRA 4E0XA 1BM9A 2DXRA 2JRTA 3I4MJ 3BPXA 4XSZF 3FASA 1YI2I 2VB6A 4NDLA 2M8GX 3ABMH 1GHCA 1RKWA 4M3GA 2HFHA 4KICA 3K00A 3KP7A 3CJRB 1XVXA 2QMXA 2D2WA 1Z7ME 3LQRA 3N6UA 3X2QH 2DPUA 1FTZA 4OVPA 4AWXB 2HYGD 3CUOA 1STZA 5EHMA 4GL0A 3TODA 1KQ8A 1IMFA 2HCAA 3N5LA 3S17J 4A3BJ 1MM7A 1CF7B 4F3PA 4LLGF 1LBYA 1FTTA 1L3LA 1JW4A 5GPAA 3BOQA 3E5QA 2O1LA 2Q9TA 1NV3A 5I58A 2HU9A 3JTHA 1JETA 5BOXA 3VVDA 2G0EA 4ZEFA 3A02A 3LUYA 4XOPA 3E79A 3PMWA 4ZYGA 4P3LA 2JMWA 4LQ2A 1QPMA 3C3WA 3WODF 1JUSA 1ON2A 1MY1A 1WVJA 1FT9A 1Y1MA 3VODA 1ZLQA 1ETOA 2V9KA 1K4TA 2VKHA 3UR3C 2VPNA 3B6TA 4N6KA 2QSHX 4WX9A 3CSGA 3EHTA 4QF9A 3TCGA 2B4LA 3GEZA 4QIWN 4JWXA 3E6BA 4XLHA 2HKXA 1B1HA 4OEUA 4EJVA 1KGSA 2ZMBA 5CI5A 3G6EI 4ELOA 2XXQA 1BIAA 2R7VA 4AVPA 1RR8C 4YB6A 3QU3A 4RXLA 5EYRA 4YIRX 1OMPA 2HOAA 3KZIC 4OMYA 2HYFA 2QKLB 3VVEA 4OIRF 5K1YA 1T0KA 3E97A 4NQWA 1J2XA 4JWYA 1HW1A 2X4HA 3COAC 3KZYA 4MNUA 3S2VA 5IAIA 2R7WA 5AA4B 1MMAA 1JVXA 3HG9A 4ELRA 2KRFA 2CUZA 3A3UA 3H3GA 3D5RC 3MYUA 3BDDA 3O9PA 2WX9A 3KEOA 2V6CA 3V7CA 1E3HA 2W25A 4MTDA 2P5KA 3IUOA 1RUOA 2KLOA 1Y4CA 2RC9A 2F2EA 3HSEA 2FU4A 2O8XA 3PPPA 4F2QA 4OIQF 2FIEA 2JA5J 4XLPF 1B4ZA 5IP6A 1TQMA 2O51A 3O28A 2AYSA 2NXOA 1NV2A 2G7UA 3H4ZA 4L0YB 2DA2A 4CDGA 3LR1A 5F0HA 5I2KA 3DPTA 2F5XA 4EV0A 1GTKA 2CW0F 3V8XB 2GOXB 5DUIA 4R6HA 2IT0A 3EHUA 2KDOA 5KVRA 3I59B 4B4CA 2HKOA 1SMYF 4J19A 3WTZA 2O9LA 3V4GA 1VQ5I 1U9NA 2E5ZA 5GPCA 2ACJA 2VD3A 3K6WA 2HOSA 1FTLA 2Q8MA 4GBVA 1XCVA 1W7PB 1K9YA 1MY0A 3FXQA 3WTVC 1H76A 3HO7A 1IITA 2F48A 2KRHA 3HOYJ 4NC8A 1YCJA 1GUUA 3ZQIA 4JP0A 4BU2A 1H8AC 1P4XA 1FPKA 2DE4A 2F34A 2UVHA 1WGXA 4XORA 2NVQJ 5TU0A 3A01B 3VLUA 2YR2A 3RT8A 4RK2A 3PV0E 4JX6A 2V1XA 3R7XA 4RLQA 4KD5A 4PAFA 4YB7A 2Z2SB 2OWTA 2K5CA 3H6TA 1MIJA 1VQLI 1HSEA 5CBSA 1AWBA 4ETSA 1XDSA 4M3FA 3RTRA 5EZGA 1B1BA 4NB5A 3FVKA 2RC8A 1D0XA 1WJCA 3D1NI 2B7EA 2OBPA 2RKHA 3ABLH 3SZPA 1NK2P 4F3BA 4IJAA 2HXRA 3TQLA 3W9WA 1ZH5A 4KYSA 2F5VA 4MO7A 1MQDA 4DXUA 1TTYA 4FQGA 4O7MA 1MH3A 1XGSA 1JI8A 3GLXA 2G93A 4WKMA 2O6GE 1D0ZA 1WI9A 1YXIA 3Q3SA 1FQAA 4E70A 3KN7A 3HXLA 4N8YA 4YIFA 3BTLA 4A6EA 2QL3A 1MBHA 2LKPA 4NQWB 4JB7A 1B5IA 2Z5UA 4NC7A 2XGXA 3NEUA 2RC4A 1I6BA 1POY1 2BBYA 2OUMA 3NARA 1D4NA 2A5TB 1VQOI 3QAHA 3TMGA 3U8QA 1ATGA 2DDBA 3B6AA 4WXHA 1WJBA 2X7QA 1IXGA 1NUWA 3CUQB 4G8MA 4F1VA 4OMZA 1IMAA 2QENA 2ZXHA 2COBA 3GXOA 1A6QA 2RQQA 3HOZJ 2E1MC 3I58A 1DTZA 4OHNA 2JUCA 1ETQA 4QBAA 1N78A 3P7NA 5DDGA 5IP7J 3ISPA 2WYPA 1YS7A 3LSKA 2X7PA 2VBXA 4LP2B 1BOAA 1KONA 2FRHA 5C4XJ 1PEBA 3ZRGA 2HDWA 4DYCA 3BR2A 3MBPA 1I50J 4JBAA 1LFUP 1L0OC 4BS9A 1SD7A 1SFXA 2MYSA 2QSGX 2DVCA 3TW6A 3DP6A 2PQ8A 1QVTA 2KJCA 5JVGF 1T38A 4YKJA 2F6CA 5ICQA 3DWLE 3FHNA 1IN7A 2HI3A 1OJLA 3BY6A 2VE9A 3O2PE 2GXGA 5J47A 2Q88A 2O7OA 3CG1A 1WJDA 3BTCA 1T8IA 5IKBA 4ESBA 1WSUA 1X4PA 2LD5A 2VPOA 3OXNA 1D3KA 3J7YJ 1X19A 2Q2AA 3Q29A 2XGCA 3F11A 4AS4A 4BDLA 3TMOA 3K7AJ 3BR1A 1LFBA 1ZRCA 1NUYA 1AL3A 4M6XA 4CHUA 4JVCA 2FOWA 1SAXA 3S93A 2FA5A 3V83A 2NYXA 5HOOA 1ETYA 4GGGA 5A2QZ 1G2HA 2HVSA 2GFEA 5JK4A 3EPEA 3B73A 2HXOA 2E2HJ 2HEOA 2L7FP 1KU2A 3CLOA 1LNWA 1SVOA 3IRQA 3V7SA 1Y3PA 3OMYA 4C1TA 1P99A 4QFOA 2LRDA 2IW5A 2I0BA 2RCAA 3G3JA 2MH2A 5HVQC 1D5YA 3E6DA 4IY6A 2QYOA 3G3FA 2DFEA 5CVIA 4XKNA 2VPLA 2IS2A 1FOWA 1W5TA 5L9OA 4EXKA 1B7HA 1MDP1 4WWCA 1H9TA 4XIDA 2RF1A 1SYIA 4DZJA 1T56A 3I3LA 5KCJB 2Y75A 3ZN1A 4G2ZA 3P9IA 3R6SA 3SEVA 3MD2A 2XSJC 4J00A 2RGVA 1B8IB 4AVZA 3ZKLA 3OWTA 2OV7A 2H6BA 3FXRA 5E17F 2VD2A 3V42A 3Q9SA 1CF7A 4FEBA 4DE8A 4A6DA 4H4KC 3CIJA 4R6YA 5I2NA 1OFCX 2ELHA 3TP0A 1JE8A 2BHZA 4U23A 3IC7A 3GFMA 1UZCA 3ILUB 1FPLA 1HLVA 3U1DA 4GRKA 1Y56A 1H44A 3WGHA 4RAYA 1YZ0A 4GIZA 4PSWA 3CCSI 3MZHA 4NTLA 3W6JB 4X48A 3K4MA 4DZPA 1FPEA 3GO5A 3B7DA 2XKPA 1O7TA 2H5YA