1MH4A

Maltose binding-a1 homeodomain protein chimera, crystal form ii
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
molecule keywords maltose binding-a1 homeodomain protein chimera
total genus 136
structure length 418
sequence length 418
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh4A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A01
4NF8B 3GLBA 3PMWA 1UMQA 4P11A 5JTYB 2H25A 1TT1A 2QS3A 2V93A 3I5OA 2E0SA 4F39A 3ZKKA 3O97A 1IEJA 1X2MA 3U8QA 5H8NB 4G77A 2R5YA 2DE4A 2GLOA 3HOUJ 1TXFA 1VFCA 3OSFA 2R71A 4PETA 2F8DA 3MVWA 3TW6A 1H44A 3D4GA 3HHFA 2O7UA 4EF2A 5HPQA 2OCUA 5M2VA 1JTYA 3MPLA 5CC2A 1LLSA 3WAEA 3IH4A 4XRSG 1B1HA 2DWAA 5ICQA 3HSTA 3HGYA 4QFOA 3M3LA 2ANJA 2HQ5A 3K1PA 4IO5A 3N6UA 2VGQA 1VFEA 3MN2A 1S7EA 1U78A 3SDFA 2ECCA 3JR9A 4R75A 2FJ1A 3IR1A 1IXIA 3HOVJ 2DJNA 2MW8A 2VUMJ 3SEUA 2P2AA 1P1UA 3GTKJ 1H43A 3R7XA 2X7QA 4R2FA 2O7OA 4QTRA 4LATA 1R6ZA 3RY3A 3OEMA 1VSOA 1FEXA 3TZAA 1FQEA 1P1WA 1A7LA 5GP9A 1IDZA 1JUPA 4NF4B 3FJGA 5F08A 2WAQN 3PUYE 1LFUP 2HOTA 4OWDA 5JTYA 1FQDA 4L17A 4XIDA 4UUSB 5M3FJ 3UK4A 3KEIA 3CQZJ 2B65A 3BG5A 3RTWB 5H8NA 2XXVA 1L5TA 2NOGA 2R93J 3ZQHA 1WH5A 5M5XJ 1A6IA 5TPAA 1UTBB 2V3TA 4V2GA 3FVGA 2QS2A 3HDDA 3IOVA 2EQRA 4JYKA 4DW6A 4PQJA 1D9YA 1N04A 1JVXA 1M5CA 1O63A 4H6DA 1MBEA 2YPNA 2O69A 2VKVA 1ZKGA 5AA2B 1BA5A 4F1UA 1B7ZA 1IXGA 4EDPA 3SFIA 4EQ9A 2A5TA 4KD5A 1US5A 1Z0XA 4RXLA 3PUZE 1ETXA 2R5ZA 3A02A 2BJJX 3FXUA 1GDTA 4QFKA 5L8DA 3A09A 1M5DA 1GV8A 2HXIA 4IHWA 1OMPA 5JLXA 3LSJA 4LONB 1B72A 3W15C 4LZ7A 4JX5A 4KYSA 1TWCJ 2XGCA 1N3WA 1MPBA 3IH3A 4BDOA 2R7ZJ 1GUUA 4R74A 3SEYA 2JA5J 1TWYA 1DTZA 1II5A 1QW0A 4FORA 4YZZA 1FTMA 4UACA 4OENA 3TCHA 3C31A 2XRLA 4XRMA 1MH3A 5DYHA 3IAZA 1A54A 1Y4CA 4F29A 4PFWA 4F3PA 4K3FA 4X9TA 4NF5B 5F27A 2LD5A 1VE4A 4P0GA 3BBRA 2HXOA 4IHYA 4OHNA 4XXUA 1TFDA 1MG1A 3Q26A 1NTCA 4WKMA 1JVYA 5IYDJ 4ELOA 1QVUA 5AA2A 5IKBA 1W0UA 4Y7NJ 4I76A 5FKNA 1IV6A 3B6CA 2X26A 4IB2A 1B0LA 4BBRJ 3FATA 1ETWA 4G4PA 2LY9A 4ZE8A 4GRKA 1B8IA 2HOSA 3M8UA 1JW5A 4M3BA 1T0KA 4DYCA 1PUFB 2LVSA 1IUDA 2QRYA 2UVJA 3MAMA 3MVXA 3S9EA 3O28A 1GVDA 4L5EA 5C4JJ 1B5HA 5IPAA 3OEKA 4GFRA 1SFOJ 1A40A 3R6UA 5FLMJ 3OSQA 3B6WA 4AC0A 3TCGA 4G8NA 4LVQA 4NMYA 3WAFA 1A5JA 4F3GA 2PBWA 1MBGA 3EN3A 1MY2A 2OK2A 1AOVA 2G29A 4MH5A 1UTHA 4FECA 1X2NA 2N8GA 3HM5A 2FNCA 2I0BA 2Z8EA 4X1EA 4OVJA 3JRDA 4POWA 3MBPA 3E4RA 5DVFA 3MKLA 1WODA 4DZ1A 5AA1A 1HSJA 1SI1A 2HAVA 2NVXJ 3PMXA 1RR7A 3GTJJ 3VDFA 3TEPA 3MP1A 3QIMA 5BNGA 2NUVA 2O9LA 3IOUA 4R2BA 5CM6A 2DN0A 3UP9A 3FIWA 3LSLA 1OCPA 4RK9A 1D5YA 2IA4A 4NF8A 1ETKA 1JT6A 3DELB 3I4NJ 3W6VA 1FW0A 2Y31A 4UA8A 5K2YA 3MP6A 2Y0SN 3VLVA 1ZMGA 2DMTA 3C34A 1XS9A 3S2VA 3G1MA 5I56A 1QUIA 4OZ9A 5J1DA 1Y3PA 1I3QJ 5F04A 1NK3P 3T66A 3TMGA 3LR1A 2GRVA 1GGGA 3T9HB 5C3EJ 2YU9J 3SEXA 4JXIA 5EYRA 3QYTA 4OFJA 2LFBA 2I4BA 3C32A 5H8FA 1QUKA 2XXPA 4C0RA 4F1YA 5L9MA 4GD5A 3K6WA 2E2HJ 2XXUA 3VLWA 3Q28A 4DZPA 4ISUA 1BW5A 5B7DA 1DU0A 3KN8A 3IB1A 2O7IA 3B6AA 1JNFA 2Q9TA 2Y7IA 1PBQA 3DP6A 3Q27A 5DT6A 4B3AA 2NVQJ 5DEXA 1IZ1A 2HZLA 3SERA 3O6GA 3T9XB 2XXYA 5ITOA 3CSBA 4OFLA 3T9UA 3U1OA 1BIYA 5TP9B 2XB5A 3BG3A 5ICTA 3JRAA 1B3EA 2HOAA 4FEDA 4YB6A 5FKLA 5DVIA 3BTLA 4HCWA 1W0TA 4LP2B 1DU6A 2R5YB 1M5BA 1ZR2A 2DA3A 1Y3QA 2Z23A 5H8SA 3PPRA 4EEFG 1WCMJ 1P7JA 1BP5A 4QHQA 3UKGA 1K83J 3S9MC 4ZEDA 1LAGE 1LAFE 2ALUA 2O84X 4BDMA 4MFIA 1UHSA 3S16J 3LUYA 1AMFA 5EG0B 1GT0C 4DXCA 3TCFA 1Y1ZA 4QSHA 4EUOA 4G68B 4DXBA 4G12A 4PFYA 5I59A 1LFIA 1ZR4A 1XVXA 2XXTA 3DM0A 2NS7A 9ANTA 1XG1A 4PP0A 4LUBA 5IP9J 2XGDA 4FIMA 4Q8RA 1R9LA 4OERA 1FIAA 5CMMA 2E1SA 5EYFA 5EZHA 3FXQA 1DPEA 3RLFE 2HI3A 3S17J 4GVOA 3HOXJ 4M6VA 3DP8A 4TLMB 3UN6A 1SANA 1PB7A 4BY1J 1NNFA 2X7PA 2XXIA 1OQHA 3K00A 3TELA 1DPPA 3IB0A 4LQ2A 4DLDA 1GR2A 2CUFA 1JKOC 3S2DJ 3A3UA 3FD3A 2V25A 2EZIA 4ZS9A 1G2HA 4MLVA 5GPAA 4IO7A 5EEAA 5EDNA 3VXBA 4U4XA 1MY0A 4H65A 2V84A 2XPWA 1ENHA 5FKMA 2I58A 3TP3A 4YKJA 3K2DA 3L6HA 1UTBA 4ZEFA 4U23A 3RZDJ 2MG4A 1MY1A 3H6UA 1ETVA 3IV5A 4A3GJ 4LZ8A 3JV9A 3MZBA 1OQGA 5FHMA 5CBSA 1IGNA 4N13A 5K7FA 4QRZA 5A5XA 2DA7A 4XTCQ 1B3GA 4DYRA 4XKQA 2LTPA 2LP0A 2Y9YA 1POGA 3Q0WA 4G68A 4Q30B 2LK2A 2AO9A 3P7IA 1B6HA 1EU8A 4D5CA 4OXVA 1B8IB 3G3GA 2UYFA 4XICA 1B3LA 2Y7PA 3ZQCA 1HDDC 1BJZA 1HOMA 1A99A 4W1UA 3OO6A 4EXLA 5E3MA 4OESA 4QSCA 3CI8A 5F7VA 1OLAA 1IDYA 4C2MJ 4F31B 4ZEIA 3PUXE 4XKRA 2OJTA 1HF0A 1N7WA 1Y1MA 1XVYA 4KFQA 1JW4A 2GHAA 4G8HA 1N76A 3KJTA 4IHXA 1QPIA 1ZBMA 3EF7A 1CQTA 2ONRA 3K6VA 1ETYA 1NFTA 3MQ9A 3BR2A 1UTHB 3G1LA 2LLKA 4R6HA 2F36A 2ESNA 1JEUA 4UUSA 4FTHA 3SKPA 2NVUB 3QUJA 2EZHA 4QFLA 1MBKA 3TQWA 2I49A 1MXVA 4GF8A 4DCXA 3JYRA 2QCOA 3IB2A 4H67A 3S9NC 4RK2A 3G3IA 5FLVA 1IITA 2V3QA 5I2NA 2B3FA 1O64A 1PBPA 2RC8A 4A3DJ 1B1XA 2OZZA 3ECRA 2ECBA 4QFNA 3K1NA 4R9FA 4F3BA 5DS9A 1A55A 2KLFA 3TTMA 1AH5A 3LC8A 3JRIA 3N26A 2XGEA 3GTOJ 2ZNTA 4N6PA 2XD3A 4JDFA 1QVSA 5L9SA 3S15J 1Y4TA 3CR9A 2XX7A 2R5ZB 1TWAJ 4AUXA 3FVOA 1LAHE 3OELA 1YPNA 3OOAA 2DA6A 4U2RA 1U9OA 4TQUQ 2YUSA 3GXAA 3MVYA 3V83A 2MGQA 4X1BA 3T93B 2E19A 4KCDA 1RKWA 3FK6A 3F0CA 3S1RJ 5K7ZA 3W9VA 1LE8B 3M4OJ 2PX1A 2NWJA 4BDRA 3A03A 3IJOB 3BTIA 4OFOA 2LR8A 4NEDA 1MBHA 3TW7A 3KSXA 1DTGA 1OVTA 3BFUA 3SEVA 3FV2A 3N6TA 1FTZA 3TUSA 2OPTA 2QF7A 4NF5A 2XX8A 4TLLB 1R9TJ 5H8QB 2FX0A 1LAXA 3CG3A 3T22A 3H6WA 2D5VA 3UA8A 2ZB9A 5IYCJ 1RYOA 2AHQA 3CFLA 1LCFA 1I6AA 2I3WA 3IOTA 1Z77A 5ELVA 3FUZA 1MQDA 5AA3A 1NNKA 3MPKA 3OD7A 3IL1B 3LBSA 2A5TB 4GL0A 5HM4B 4QF9A 2NS8A 4BKXA 4Z0IA 2XD2A 2WB1N 3LSWA 1RETA 4Z7EA 2PMZN 3D4CA 3OIOA 2XPVA 3OO8A 5I84A 3VVDA 3KOTA 3B7DA 2X6OA 3B6QA 5ITPA 1JTXA 3OENA 3WHCA 5I58B 2GH9A 2Y7WA 3JREA 4ZE9A 4XRSA 3K02A 5KCJA 3HCQA 1P1NA 1K61A 3K6XA 4JSOA 4Q0CA 1LBBA 3FASA 2O6AA 2VHAA 1BTJA 2ZMBA 3QK6A 3Q0VA 1EZ9A 2XXQA 2DWHA 4AYBN 4PFUA 3TFLA 1VNDA 4KHZE 5F0CA 3OSGA 3ZQFA 4YICA 1MDP1 3TKDA 5FKKA 3H3GA 3S2HJ 5AA2D 1AHDP 3PV0E 3MJNA 4IO2A 2K9SA 2FA7A 3GTGJ 4EQ7A 1Q1VA 2G93A 3DLNA 4IO3A 3IOWA 3K7AJ 3ZQGA 4KI0E 2ME0A 2F97A 3CRBA 3MUQA 5F1JA 2Y7KA 4YAHX 4NF4A 1BLFA 3JRGA 1X58A 4I8CA 4EF1A 2M2EA 1IRZA 3BFTA 5LOMA 3HN0A 1MY3A 3KG2A 3U72A 4JX6A 1XOCA 5AA4A 1YRNA 2CQQA 1JUSA 3JRCA 1ANFA 4D7NA 1B3FA 1FIPA 1IXHA 4POXA 1OCTC 3S1NJ 2DVCA 1P1QA 3PPQA 4MLQA 5CMCA 1Q1KA 3VXCA 4BY7J 4JBZA 3MP8A 3NAUA 3MVPA 1LB9A 4DIGA 4FE4A 4A3EJ 2Q2AA 2ZXTA 1S7YA 5K7HA 2HCAA 1MH4A 1P7IA 2B63J 2A5SA 1SW4A 5CMKA 1LE8A 2F6GA 3DEWA 2RC7A 3LSGA 3K6UA 3WHBA 4QFPA 1RKTA 3TQLA 5I59B 3VVEA 2O8KA 2EH3A 3KN3A 4YKPA 1JKRC 4IO6A 1XC5A 1USYH 3C36A 3PGFA 3PU5A 4PE5B 5FHOA 2VD3A 1N3XA 2DA1A 2K9NA 2L9RA 4CYCB 4ZEKA 4C3IJ 2QJEA 4JSDA 3KSJA 1GVCA 2DXYA 2UVIA 1N84A 2UVHA 4EXKA 2RC9A 4DYQA 3BQYA 1Q35A 3RGYA 1Z7ME 4F3SA 1WDNA 1MXUA 4YU0A 1WPKA 4FCYA 3S1MJ 2O68A 1UIVA 1B58A 4H1XA 1MQIA 2EZKA 2THIA 2DOJA 5IYBJ 2NXOA 3N94A 1IXCA 1ETOA 1R9QA 2H8RA 4HNVA 1PC3A 3TP0A 4RNSA 1U8BA 5I56B 4ABZA 2PT1A 5E3NA 4BDQA 3GBGA 4WEPA 4I6ZA 1HSLA 2VP1A 5TPAB 2FQ4A 1I50J 2F5XA 3C4MA 3HO7A 4X6AJ 1E3OC 1S9TA 4IY5A 1NNPA 1OJLA 5CRYA 2AIXA 3EHSA 2YLNA 1APLC 1HLVA 2IEEA 4R9GA 3E9XA 3H4ZA 3C9HA 2XSDC 4KQPA 5IP6A 1JKPC 4DXUA 5CBRA 4C3JJ 1VF9A 3MZ9A 1ATGA 2P0SA 3MW0A 3PUWE 2TRTA 2FD5A 3L1PA 3FK7A 4O3CA 1ZQ3P 4DDDA 1PUFA 3S1QJ 1O7TA 1U9NA 1WH7A 1B72B 3U93A 4H8IA 2Q8JA 5EHMA 1MM6A 2Z8DA 3BT9A 2XX9A 1XT8A 5F0FA 5FJ8J 2O1LA 2F34A 4FE7A 4KR5A 1RESA 3GTQJ 4RDUA 2GHBA 2XHDA 1JEVA 2DVZA 3O8HA 2X48A 1NL5A 3PPNA 4NF6A 1D4NA 4NWDA 3ODBA 3OMBA 1ELJA 5C4XJ 1B7UA 2F7AA 3PO2J 2H5YA 2CU7A 2X9DA 4F1VA 1B32A 2QPQA 4A69C 2L7MP 3JRFA 5H8QA 4C1UA 2Q88A 4E0WA 4G68C 1MXWA 1JW1A 2W48A 2HQ0A 3HPIA 4OEVA 1HDPA 2MSYA 1H8AC 1MXZA 1SW2A 4C3HJ 2QSXA 2Z8FA 5F1QA 2R0QC 4U21A 5K2XA 2XXXA 4DE8A 4JWXA 4IY6A 2JA6J 1Y1WJ 1QRYA 4A3BJ 1RPWA 4ZEBA 2COBA 2UVGA 3IO6A 1MBFA 3OO7A 1NH7A 3Q25A 3ZSFA 4D5FA 4OQOA 5L9OA 1AKHB 3G1OA 1FTJA 1OVBA 2RF1A 1Y9UA 3ONMA 1B46A 3QXMA 3PMVA 4D7MA 3D1NI 3LSXA 4A3FJ 3DP4A 2DE3A 3AXFA 3RQTA 2W7YA 2P81A 3OO9A 1N7XA 1B5JA 5IAIA 3OSRA 1SDXA 4M4GA 1MXYA 4GXAA 4A3CJ 1B40A 4A3IJ 4HTGA 1MY4A 3QPLA 4G2ZA 1Z7NE 4JWYA 1JQFA 3PD9A 3HOYJ 3K01A 3QSLA 4KYEA 5M3MJ 1J1NA 1B05A 4LQ5A 1XHYA 4FJPA 3FJ7A 3TEDA 2HAUA 2REGA 4BLAA 4A3KJ 3FKIJ 5I2NB 1TWFJ 2KDZA 4Q5TA 3USDA 2DYXA 1WI3A 3CSGA 5CI5A 4BXXJ 3G3JA 5HODA 1D9VA 2PYYA 1M5FA 4MBPA 3HOZJ 3PO3J 1FTKA 2Z22A 1ZTYA 3A3CA 1FQCA 3PD8A 1Y1VJ 1XS5A 3LSFB 3MVZA 1SYHA 4M3DA 2AL4A 3O29A 2UXAA 5JLWA 4RY1A 1AKHA 4MLOA 4A3MJ 2L7ZA 1B51A 3CG1A 4LA9A 4R6YA 2P1SA 3QQAA 4EQBA 1B3HA 1MXXA 3I3VA 1VI0A 2UYEA 3GBAA 3L6GA 1I6QA 4ESWA 5H8HA 1OFCX 3SESA 1B7HA 5IOYA 2NOOA 3H7MA 5CMBA 5DTDA 4J19A 1SYIA 1LFGA 1JETA 2AL5A 3H6TA 4NF6B 5I57B 2D5WA 5EGOB 3G3FA 2H9BA 2F6PA 5JK4A 4X48A 4CYCA 3S4UA 3UGWA 1VFDA 2DXRA 2E2JJ 4ZZAA 4HS7A 1O4XA 2DMUA 2V3UA 4NE4A 2XXHA 4GL8A 3U92A 4ESXA 1F9BA 2IAIA 1FQBA 3CIJA 4W97A 2OF7A 1B0HA 1EF4A 3O6IA 5FKOA 1USYE 4V2FA 2CJJA 1YRNB 3TDJA 1BW6A 3HV1A 2DMPA 2M0CA 2TCTA 4U4SA 2E2IJ 2M8GX 2CMOA 3BR0A 2VOZA 3C35A 1ZTRA 1MNMC 1ZKBA 1SW1A 2D21A 2D3IA 2JJ7A 4YB7A 2XPUA 4B4CA 5M5WJ 5KCJB 2F78A 1EZPA 5KDTB 5EG0A 3QUFA 1B4HA 4JP0A 4R73A 2DA5A 3U94A 2NVTJ 1LBCA 3KJ7A 3PPPA 1QJMA 3ZKLA 3NARA 1TWHJ 3S14J 3Q29A 4G8MA 4GLIA 1NKXA 4YMBA 3ZQIA 3Q3SA 5EGOA 3EHUA 3MWBA 4GWOA 3O9PA 4MFEA 1AL3A 1I6HJ 3GTLJ 2L0KA 3MZ1A 2Y2ZA 2F7BA 1FJLA 4H0WA 2PT2A 4RBOA 4RJZA 2PMSA 1JKQC 2I3VA 2M9HA 4S0HB 2OBGA 2VD2A 2DTZA 2JK3A 2I10A 1SVXB 1Y20A 1GV5A 2LAOA 1I69A 1JJ8C 4PFTA 4ELPA 2ID6A 4FAJA 5DVJA 4YKIA 2QS1A 1NH8A 3A01B 3HEFA 1SW5A 1SQYA 5E3LA 3TTRA 5IP7J 4ELRA 3BR1A 3QPSA 4H5GA 1H76A 1JJ6C 3LSPA 1P99A 4MIMA 3ZS6A 4F22A 3BR5A 1ITYA 5H8HB 2IBDA 2ONSA 2EZLA 2HFBA 1QULA 1Y3NA 1PDAA 1PB9A 1MQJA 4JWOA 3IH2A 1CB6A 3M3YJ 1NMUA 4NTLA 5E3OA 1OLCA 3O2AA 1WGXA 2KT0A 4M1VA 1ZIUA 4IEJA 2ELKA 4H5FA 3BQZA 2ZYOA 2XXRA 3THIA 3SDGA 3RN8A 1TFAA 2RCBA 2ZYNA 5ISUA 2FYIA 2JWTA 4E0XA 3KZGA 2ZYMA 3EHTA 3MC2A 4AQ4A 2ME6A 2DP8A 1P1OA 2ZNSA 4OMBA 4JB7A 2DA4A 1MRPA 4MO7A 1RKMA 1SI0A 3RQIA 3EQ1A 4ZDMA 3VLUA 5C44J 2M34A 1LSTA 1FQAA 2K9QA 3HBLA 5BUUA 2HEUA 2JN6A 1MDQA 4YB5A 3CFZA 3JRHA 1A8EA 3W9WA 2VPRA 1B5IA 4O3AA 4DZJA 4FEBA 2WV1A 4A3JJ 2R9JA 2RKMA 3BR6A 3G3KA 4LZ5A 2OWSA 4RPOA 3SJMA 4QSEA 2ID3A 2JA8J 4F18A 1NNTA 2JMWA 4AB6A 3TTKA 3C33A 3K0VA 3I4MJ 2QL3A 4RA1A 1B2HA 5J1RA 4RPNA 1B9JA 2F35A 4OTEA 3S9LC 3IK6B 3OXNA 2H99A 2WKYA 4FISA 3T9VA 2R6GE 1ETQA 3E7LA 3VPRA 2AYSA 4P0IA 1IC8A 2XXWA 1R1NA 5HBCA 1GV2A 1T33A 5IOZA 1JT0A 3BKIB 3HKZN 2YJPA 3Q0UA 4IGTA 1MPCA 1FQFA 2DSFA 4WEDA 1VR5A 5KZTA 1YCJA 4F2QA 4R6KA 5I58A 2H98A 4YMAA 3KFMA 1POTA 3JRBA 4GIZA 3KN7A 5FTIA 3FISA 2GM4A 2RCAA 4NWCA 1YAEA 3IORA 2OLBA 1POY1 2H1KA 4I9DA 1D3KA 2I0CA 1US4A 4LOCA 4M3GA 2ABHA 1IIWA 2I48A 4HW8A 1IQ7A 4ECFA 4M3EA 1PEBA 3O66A 5GPCA 2Q2CA 3IX1A 1WVJA 3RT8A 5EHSA 1IUFA 3N5LA 4H8JA 3K1MA 4DCYA 4TOZA 3RNNA 2O1MA 3CCYA 2K40A 1S50A 5DTBA 1LB8A 4GFBA 4WXJA 3HOWJ 3BTJA 4Y52J 5B70A 4GOTA 5EF6A 3QAXA 3V89B 2REJA 3UORA 1FTTA 2O51A 2IEKA 2VKEA 4ONYA 4I1DA 1UG2A 3H6VA 1ZLQA 5J3LA 1DOTA 4AB5A 5F0HA 1TWGJ 3H03A 3IJXB 1OIBA 2L7FP 3E13X 1SD3A 2G0EA 5J1YA 3K2AA 4BBSJ 3ZQLA 4BDNA 3LSRA 2DMQA 4XK4A 2I4CA 3FGSA 3ILUB 2LKXA 2QMWA 1H45A 3LNQA 4R72A 3TYHA 3RKQA 2M8CA 1URSA 1I6BA 1RYXA 4IHVA 5KDTA 5H8FB 2VI6A 4ZECA 5EZGA 4ELQA 3HGGA 1B52A 3HB9A 3KBRA 2DMNA 1N0TA 4B1RA 4U1OA 5M5YJ 3FV1A 1GTKA 2QMXA 1YTVA 2F7CA 1FCKA 2DWIA 1QKBA 2GBYA 3H3VK 1H3DA 4F19A 1UQWA 3OOUA 1EH3A 3O6HA 1MSFC 3M3FA 4A3LJ 4X1DA 1PB8A 3V8XB 3H0GJ 1F43A 2DA2A 5FTHA 1LFHA 1ZK8A 4IGRA 4XKNA 3RT6B 1DSNA 3K4UA 2EBIA 2PVUA 5AA4B 2E1OA 3M3KA 3G3HA 3VFJA 4M3FA 4KPTA 3TTLA 3A01A 1B4ZA 1H88C 1AU7A 1XC1A 4KCCA 3FZVA 4RYAA 4F2OA 1BKAA 2Y30A 4OEUA 2CUEA 1MQHA 4MFDA 1HCRA 3JZJA 3BTCA 2HZKA 3PUVE 2CZLA 2DQVA 5TU0A 5JEIA 5I2KA 1A8FA 2DE2A 1FTOA 2Q89A 4QSDA 4U22A 1URGA 3DCFA 1KWHA 2YS9A 1TC3C 4OETA 4OYVA 4QIWN 3BR3A 3RZOJ 3FXRA 2ZNUA 3C2BA 1FTLA 2H4IA 3IO4A 1CE2A 3B6TA 5DEXB 3SEWA 4ND9A 1T56A 3G7WA 2HYJA 1ZGWA 1DMBA 1HSEA 3T96B 2I6EA 3VE1B 3F11A 3RUMA 3KGCA 3CMYA 3ZOBA 3UIFA 4KYDA 2Y9ZA 1MM7A 3V5AA 1MPDA 4NDLA 4GQOA 5TP9A 3TODA 3GBBA 2OWTA 1AIVA 3BG9A 5J1UA 2JA7J 2DWJA 2CQXA 1JUMA 4A93J 4HCYA 4GXSB 1ZJLA 3FJMA 1IJWC 3E3KA 3RTFB 1M5EA 3FVKA 2Y84A 1MSEC 1JGGA 2ONKE 1NK2P 1LCTA 1F36A 1EZOA 3HHGA 5FHNA 2QS4A 4MF3A 2B3BA 4N07A 5AE4A 2RAEA 3PPOA 1ZU0A 2R92J 1MBJA 3GZGA 3CDLA 1LGBC 3RPWA 3VVFA 1QUJA 2NVYJ 3GTPJ 1QKAA 3TTNA 3H06B 3SETA 3FIRA 4XKPA 4U1ZA 1UIUA 4IO4A 2Y7RA 2CRGA 4THIA 3TPAA 5A5XB 4FATA 1SBPA 3CFXA 3R26A 3KOSA 5I2KB 4I62A 4YKKA 3PM1A 3FVNA 5I57A 1IG7A 2XB0X 1ORKA 4BDLA 3I6VA 4O3BA 1LFBA 5BWJA 2RINA 1BL0A 2DS9A 2HDDA 3ILTB 2GFEA 1MQGA 1QVTA 3VV5A 2HXWA 3CVGA 4ZZEA 1MS7A 4JX4A 1URDA 3LOCA 3GTMJ 1H89C 4XIGQ 4FE8A 4C1TA 3EPEA 3TAJA 2ZYKA 4UUTA 3O8GA
chains in the Genus database with same CATH superfamily
4TV7A 4L5IA 4NF8B 5B1AH 3FBPA 3GLBA 2R7XA 2HVRA 5TJJA 1UMQA 3PMWA 4P11A 3F3XA 5JTYB 2H25A 1IW7F 3SXYA 1YFHA 1TT1A 1HSTA 2QS3A 2V93A 4PFPA 3I5OA 2E0SA 4F39A 1SVMA 3O97A 4UV8A 3ZKKA 4EF1A 1IEJA 1X2MA 3FWEA 3U8QA 4MHGA 2XWVA 3CCUI 2R5YA 1IMAA 1F5TA 2DE4A 4G77A 3CUOA 1HW5A 1VQ7I 2GLOA 4ZC3A 2VPNA 2KRHA 3HOUJ 1TXFA 1VFCA 3OSFA 2OWZA 2R71A 1UCRA 4PETA 2F8DA 3DTKA 2JRMA 1YG2A 3ZQQA 3QPTA 3TW6A 3OYKA 1H44A 3D4GA 1LFPA 2ZXIA 3MVWA 3HHFA 2O7UA 1FWZA 1HXDA 4EF2A 4LLGF 5HPQA 1FSEA 3X2QH 2EB7A 3RPUA 2OCUA 4CXFA 2WY7Q 2B0LA 5M2VA 1KONA 1JTYA 2KDOA 2O0YA 4HDVA 3MPLA 5CC2A 3LSHA 1LLSA 2VPOA 3NQOA 4BYYA 4UUVA 3WAEA 3IH4A 1YS7A 4XRSG 2AQFA 3FMQA 1B1HA 2DWAA 3M8JA 4HX4A 3L2RA 3HSTA 1MNDA 2FA5A 2K7LA 3HGYA 5ICQA 4ESFA 4QFOA 3M3LA 5HLHA 2HQ5A 2W1OA 3K1PA 2R7RA 5K5RA 4P55A 2ANJA 4G61A 4IO5A 3N6UA 2VGQA 1VFEA 3DV8A 3MN2A 1S7EA 1U78A 1ZG5A 4GDFA 3SDFA 2ECCA 4MQ9F 5E8GA 2JPBA 3JR9A 3LQQA 2FJ1A 4R75A 4PJLA 2E5ZA 1K6OA 3IR1A 1IXIA 3L2QA 3HOVJ 2DJNA 2MW8A 1YYVA 2VUMJ 1KZ8A 3SEUA 4NC8A 3SZGA 3TBIA 2V9KA 4HX7A 2P2AA 4P9FA 1P1UA 2ACJA 3WTWC 3BIHA 3GTKJ 1H43A 3MKZA 3WGGA 3J7ZI 5LTCA 3R7XA 2X7QA 1FPFA 2WAEA 2A05A 2O7OA 4R2FA 4QTRA 4LATA 3ZMTA 1R6ZA 1RDYA 3RY3A 1S7OA 1XN7A 3FXOA 3OEMA 4F92B 1VSOA 4BACA 1FEXA 3TZAA 3BZ6A 2RNGA 1FQEA 1P1WA 3KP5A 5E1ZB 5BS6A 3U1DA 4UVCA 1A7LA 5GP9A 3O3KA 2KRFA 4NNJA 1IDZA 4ZYAA 4EM0B 2M0MA 2YX4A 2DFHA 2IGOA 5E1XA 4YELA 1JUPA 1R22A 2VBZA 4HV6A 4NF4B 4HE2A 3FJGA 5F08A 4ZDOA 2WAQN 1QGPA 5ICGA 2FNPA 5GAEJ 3PUYE 3GYHX 3MQ0A 1X1PA 1LFUP 4LLLA 2HOTA 3R4KA 4OWDA 5JTYA 1ERDA 1FQDA 4BH9A 4L17A 4XIDA 1SEUA 4UUSB 5M3FJ 1MMDA 2VASA 3KEIA 3UK4A 3CQZJ 2B65A 3BG5A 4MNCA 5H8NA 2EV6A 2E60A 2XXVA 3RTWB 2W82A 1L5TA 2FSWA 2HTJA 2NOGA 1N78A 4LK0F 2R93J 5HOOA 4XEQA 4BAYA 4CSWA 3ZQHA 5ICCA 4Y15A 2R7TA 2K27A 3GLLA 1WH5A 3IFAA 5M5XJ 1A6IA 5TPAA 1UTBB 3OYFA 2Y5KA 3C2GA 1XDSA 2V3TA 4V2GA 4UNOA 3WTZA 3FVGA 4N8YA 4QPQA 3QP5A 2QS2A 3HDDA 3RYDA 3IOVA 2HXRA 2EQRA 2P4WA 4JYKA 2X1EA 1AWCA 2BZTA 4DW6A 4PQJA 1D9YA 3DU6A 1N04A 1JVXA 5IZZA 2LC2A 1M5CA 1O63A 4OIRF 4H6DA 4P1LA 4GWUA 3AFHA 1MBEA 2YPNA 2X4HA 4Z2YA 2O69A 3RI4A 2VKVA 4NHJA 1ZKGA 1LDDA 5AA2B 1BA5A 4F1UA 4P9KA 1B7ZA 2XF6A 2FF4A 4BHCA 3CF5F 4XORA 2V4CA 1IXGA 4PDDA 4HSTA 4EDPA 3SFIA 4EQ9A 2OZUA 3DTIA 3I9V2 2A5TA 4KD5A 1US5A 1Z0XA 2BY1A 4RXLA 3PUZE 2R7FA 1QHHD 1ETXA 3P9IA 2R5ZA 1RC9A 4JBAA 3A02A 4P8BA 1R36A 1P6RA 2BJJX 5I57B 5E17F 3FXUA 3V8JA 4EJVA 1GDTA 2IP2A 2HEOA 5JR3A 4QFKA 5FB2A 3S8PA 3A09A 5L8DA 1YOVB 3S32A 1M5DA 1GV8A 2HXIA 4IHWA 1OMPA 5JLXA 3LSJA 4AS5A 3BIGA 4LONB 3IRRA 3ZRGA 2STTA 2K86A 2X1CA 1B72A 2BY3A 3W15C 4LZ7A 4JX5A 4MNIA 2JVHA 4XM3A 3F9KA 2C6YA 4KYSA 4PFIA 3R6SA 1YQAA 5D8LB 1UELB 1A31A 1J0RA 1TWCJ 2M4KA 2PG4A 3CCJI 2XGCA 1N3WA 1MPBA 3KFWX 3LSIA 3IH3A 1QU3A 4BDOA 2R7ZJ 1GUUA 4PJMA 1L0OC 4R74A 2MYSA 2JA5J 2F6CA 3SEYA 1TWYA 1DTZA 1VQ5I 2NXNB 1II5A 1QW0A 4FORA 1WJEA 4J00A 2DPUA 4YZZA 1FTMA 4BEHA 5KNLA 4UACA 4OENA 3TCHA 5LGNA 3C31A 2XRLA 5KAIC 2A69F 1FPJA 3JW4A 4XRMA 3HPGA 4IO9F 2K3PA 1MH3A 2VE8A 5DYHA 2PMHA 3IAZA 4KIGA 5IZ3A 1A54A 1Y4CA 4F29A 4PFWA 3H9JA 4F3PA 4K3FA 3T1BA 1YX5A 2QGUA 2VBXA 4FBPA 2VC0A 4X9TA 4I7HA 4NF5B 2K3FA 5F27A 5EQAA 1T95A 2LD5A 1VE4A 2G9WA 4KXPA 1B1BA 4BHPA 4P0GA 3BBRA 2HXOA 4JOMA 3U21A 4IHYA 3MFKA 4OHNA 2XUBA 2W00A 4OIPF 2L7KA 4Q47A 1KQ9A 4A0ZA 4NF0A 1YJ9I 1TFDA 1MG1A 4PAFA 4XXUA 1ZYRF 4JVCA 3MKYB 2V7FA 3DKXA 4MIJA 4UB6C 5L3FA 1TQMA 2VONA 2F3BA 4WXDA 3M1CA 4BQNA 4CCOA 1NTCA 4MQVA 1BK4A 3Q26A 1JVYA 4WKMA 3H9QA 4U88A 3CJQB 1FMWA 1BOBA 5IYDJ 4ELOA 1QVUA 3HG9A 3OYBA 3FHNA 5AA2A 1W0UA 4Y7NJ 5IKBA 3LL7A 3BLYA 4I76A 5FKNA 1IV6A 3ABUA 3B6CA 3HOTA 2X26A 1INPA 1B0LA 4IB2A 5KHDA 4BBRJ 4E7ZA 1FJ9A 2P3NA 3FATA 4I98B 4Q4ZF 4XRFA 3WTXC 3REOA 2LH9A 1ETWA 2CYYA 3JTGA 4G4PA 2LY9A 4ZE8A 4GRKA 4CCMA 1B8IA 2HOSA 4B09A 3GEZA 1E3HA 1JW5A 3M8UA 2FXAA 2FHYA 4A12A 5J16A 4F91B 2MLGA 2V4JC 4M3BA 1T0KA 4DYCA 1PUFB 4QPOA 2LVSA 1IUDA 2QRYA 2ESHA 2UVJA 3MAMA 3MVXA 3S9EA 4XN0A 3RPLA 2HZDA 4L5JA 1SMYF 2CGPA 2V6CA 1GVDA 4BUPA 3O28A 3KBZA 2FBPA 4E7SA 4L5EA 5C4JJ 1B5HA 5IPAA 4J01A 3OEKA 4GFRA 1ZG3A 1SFOJ 1NG7A 1A40A 3R6UA 3G73A 1HKQA 5FLMJ 3OSQA 4LMYA 3B6WA 4AC0A 4U7DA 3MCZA 3TCGA 2K9LA 4G8NA 4LVQA 4NMYA 3EUAA 3WAFA 5FD6A 3CMMA 4DQ2A 3F8FA 3AKZA 1A5JA 3S93A 2EFOA 3ZXSA 4F3GA 2PBWA 1MBGA 2DLLA 2BY2A 1MY2A 3EN3A 2OK2A 1XGSA 3IWZA 3H5RA 1AOVA 2G29A 4MH5A 1UTHA 4FECA 1BR1A 1X2NA 2N8GA 2AS5F 3HM5A 2DDKA 2FNCA 2I0BA 2Z8EA 4X1EA 3ZCOA 3HTUA 4OVJA 3JRDA 4POWA 4HV5A 2FMLA 4BXUA 3MBPA 3E4RA 3TKYA 4GBWA 4HF0A 5DVFA 2DOFA 2V1XA 1QBJA 2M1BA 2IVMA 3MKLA 4G6TB 1WODA 4XLHA 2JJKA 1HSJA 5AA1A 4DZ1A 1SI1A 2HAVA 3UR3C 2A07F 2NVXJ 3PMXA 1EH8A 1RR7A 4XR6A 3GTJJ 1O7LA 1YITI 3VDFA 2VBYA 1JGSA 1Z3XA 2ZFUA 3ABMH 1W7PA 3MAJA 3ONQA 3ZMVA 2V1UA 2QKMB 3MP1A 3QIMA 4WK8F 5BNGA 2NUVA 2O9LA 3QWLA 2P6SA 3B50A 3IOUA 2X0LA 1LEVA 1DCUA 2DN0A 4IOAF 1MD0A 4GWZA 4R2BA 2EILH 3GYYA 3UP9A 1IN8A 5J47A 1SMTA 3FIWA 3HIFA 1N75A 3LSLA 4MEYF 4IHSA 1OCPA 1USSA 2KL4A 4Y3OA 5DEQA 2IT0A 1XSVA 2DJIA 3TEPA 3I64A 1W36C 4RK9A 3DKWA 1D5YA 4OMYA 2IA4A 1TZLA 3CJTB 3DEEA 4NF8A 2LKPA 3JSPA 3BG7A 1ETKA 1JT6A 2LDUA 4N4NB 1A35A 4KISA 3I4NJ 3W6VA 3DELB 2PJRA 1MIJA 2M7BA 3K69A 1R00A 2A68F 1YJNI 1FW0A 2Y31A 2QVVA 3E78A 1WZ2A 1D0YA 4ESJA 2M30A 2RC4A 2J5PA 1GVJA 3K10A 3NWTA 4H4KC 2XA5A 3MP6A 4UA8A 2Y0SN 5K2YA 3VLVA 1ZMGA 2DMTA 4FX4A 2L4MA 4ZYDA 3E6CC 1WSUA 1R4MB 4BU2A 3CMAI 1R5HA 1XS9A 3C34A 5EQ8A 1NV3A 3S2VA 5B5EC 3G1MA 5I56A 1V5GA 5T3JA 3CESA 1QUIA 3OY9A 1WJAA 1E17A 4OZ9A 5J1DA 2MKZA 1BI1A 1Y3PA 3ERED 1I3QJ 3BPVA 1RIOH 2VQCA 3ZMUA 5GTIC 5F04A 3GFIA 1NK3P 2CZHA 3T66A 3TMGA 1ZREA 3LR1A 4XLPF 2GRVA 1X3ZB 4PCQA 1GGGA 2R3SA 3T9HB 1NV6A 5C3EJ 2DO7A 1WKMA 3J80Z 2YU9J 5J40A 3SEXA 1FOXA 1TW2A 1XMXA 2QWWA 4KT5C 4JXIA 2AXTC 4IRGA 5EYRA 4HF1A 3QYTA 4D9JA 3VYUB 4OFJA 2LFBA 2I4BA 4RAFA 3C32A 2XASA 5H8FA 1QUKA 5BOXA 2XXPA 2M7AA 5IY5H 1IUYA 1I1GA 4C0RA 4F1YA 5L9MA 4E7KA 1SFUA 2DU9A 2A6HF 4GD5A 4G6QA 5LHGA 2XROA 1KA1A 3K6WA 4BDZA 2W57A 2E2HJ 2WAQA 2I8DA 2Q74A 2FUG2 2XXUA 4RB1A 2LBFA 4GYIA 4EM2A 3VLWA 2RREA 4G8XA 3M07A 2CV1A 2MC3A 3Q28A 1YW9A 2QZ8A 4OAZA 4DZPA 4ISUA 5B3SH 2JUGA 1BW5A 5B7DA 1DU0A 3KN8A 3IB1A 2O7IA 3B6AA 1JNFA 2Q9TA 2Y7IA 3GF2A 1PBQA 3DP6A 1EH7A 3BY6A 3Q27A 5DT6A 4NQWA 3HYIA 4B3AA 2NVQJ 5DEXA 4MTEA 2OZ6A 1G3YA 1IZ1A 2HZLA 3SERA 1J5YA 4HE0A 3O6GA 4PBQA 1IF1A 3T9XB 2XXYA 1R1UA 5ITOA 4LB5A 4KIFA 1GXQA 3KP6A 3CSBA 4OVSA 4OFLA 1V5FA 3T9UA 3COAC 3U1OA 1ZGJA 1HQCA 1LKXA 1BIYA 5TP9B 2XB5A 3BG3A 5ICTA 3JRAA 1B3EA 2HOAA 4BHBA 4FEDA 4YB6A 5FKLA 2XAJA 4AIHA 4BXFA 2Q8MA 5DVIA 2BY0A 2XC7A 3BTLA 4HCWA 1W0TA 4LP2B 3IFCA 1DU6A 1DP3A 1W36D 2R5YB 1M5BA 2Q1ZB 1FBGA 2WY8Q 1ZR2A 4HEA2 4DBRA 4JVDA 1YJWI 2HFHA 2KZVA 3BZKA 3PNYA 3HZJA 3WG7H 1HBXG 1MDMA 2DA3A 1Y3QA 2Y69H 2Z23A 5H8SA 2KRCA 2DCEA 4PTKA 3PPRA 1RUNA 3TO9A 2DT7B 4EEFG 4BQOA 1WCMJ 3P9CA 1P7JA 1U5TA 1K79A 2ZXWH 1BP5A 1LBYA 1V4RA 2EFNA 2OU2A 3UKGA 1NV5A 4QHQA 1K83J 3S9MC 1X1CA 3H1CA 5DDGA 4ZEDA 3PQKA 1LAGE 1LAFE 5EJCA 1I1SA 2ALUA 2O84X 1OCCH 2BYVE 4BDMA 2L01A 2PLYA 2BVMA 2KMUA 4MFIA 4U0VA 1UHSA 4IRIA 1GXPA 1I5ZA 2BE5F 2GXBA 2KZGA 3PNVA 4ZTFA 1QZEA 3S16J 3LUYA 1AMFA 5EG0B 1GT0C 4HE1A 4DXCA 3CJNA 3EUHC 1EYIA 3TCFA 1Y1ZA 4QSHA 3K70C 1Q9DA 4EUOA 4G68B 1P9QC 4G12A 4MX6A 2D45A 4PFBA 4LG3A 4PFYA 4DXBA 3H5AA 2E1MC 3QOEA 1NV1A 5I59A 1WJFA 2UZKA 4ITVA 4KN7X 4RGUA 3K4BA 1BBYA 3H9GA 1ZR4A 3ZQ7A 1LFIA 1XVXA 2XXTA 3DM0A 2NS7A 1Z91A 5F1RA 5L3DA 9ANTA 2PEXA 1XG1A 2FIEA 4LUBA 5IP9J 2XGDA 4FIMA 4PP0A 4Q8RA 4CZCA 3KE2A 2HU9A 3RYRA 1FIAA 1R9LA 4OERA 5CMMA 2E1SA 4NN3A 3QU6A 2IS6A 5EYFA 3FXQA 1W7PB 5EZHA 1DPEA 2O8XA 2AQEA 3RLFE 2QQ9A 2FRHA 2HI3A 3S17J 3HOXJ 4M6VA 3DP8A 4GVOA 4TLMB 3UN6A 1SANA 4ZYHA 1PB7A 3N4MA 4BY1J 1NNFA 1H9GA 5LEKA 2X7PA 5ICFA 2CFOA 4AIDA 3QRFF 1OQHA 4IVNA 2XXIA 3K00A 4XOPA 3TELA 1DPPA 4LN5A 3IB0A 2ZJRF 2LF7A 4LQ2A 4DLDA 1B59A 4RGXA 1GR2A 2CUFA 1JKOC 5J8FA 2EV5A 1DBZA 1MJBA 5D4SA 4EV0A 3S2DJ 3OL3A 3A3UA 1D1BA 1QGXA 3FD3A 3CZ6A 1BC7C 4JVIA 2V25A 4MGRA 4KDPA 1OKRA 1P2FA 2EZIA 2EA4A 3SZTA 4ZS9A 2IJLA 1G2HA 4MLVA 3KLOA 4HLXA 5GPAA 4IO7A 1NI9A 5EEAA 2VBWA 3RKYA 5EDNA 4M9ZA 3CC2I 2IGMA 4U4XA 3VXBA 3H3UA 1MY0A 2RV8A 3H36A 4H65A 2V84A 1TTYA 2XPWA 1Z9CA 1ENHA 5FKMA 2I58A 4ESBA 3TP3A 4YKJA 4RS8A 3ROUA 1VQPI 1ZRFA 3K2DA 3L6HA 1UTBA 4ZEFA 3K9TA 3ASNH 4GXOA 2Z33A 4CDGA 2NNYA 3RQ4A 2IA0A 4U23A 1G6NA 2LY1A 3RZDJ 2X51A 2MG4A 3I54A 3ISPA 1MY1A 3H6UA 1ETVA 3IV5A 4CCKA 4A3GJ 4LZ8A 4N6KA 3JV9A 3MZBA 1OQGA 2XHKA 5FHMA 2DK8A 4GX6A 2R7SA 1FSHA 5CBSA 1IGNA 1RRJA 2LNBA 4N13A 5K7FA 3WU1B 1UAAA 4ZZDA 4QRZA 3L00A 5A5XA 1SFXA 2DA7A 4XTCQ 1B3GA 4DYRA 4XKQA 2E5NA 1W1WE 3VYRB 2H6CA 2LTPA 2LP0A 2Y9YA 1POGA 3Q0WA 5JFRA 4WCGA 3G4SI 4G68A 2WBDA 2E35A 3PQJA 4Q30B 2LK2A 2AO9A 3P7IA 2K4BA 1B6HA 2YX7A 5LHHA 1D8JA 2R8TA 1EU8A 4D5CA 2VXDA 2RDPA 2WAFA 4PGGA 1B8IB 1VQ8I 1HA8A 1NUYA 3G3GA 4OXVA 2VT2A 1K4TA 1V5EA 4XICA 1B3LA 2UYFA 2Y7PA 3ZQCA 1HDDC 2XKPA 3RJPA 2B7EA 5CM6A 1BJZA 2CQ7A 3V8LA 1O3SA 1R49A 1HOMA 1A99A 4W1UA 1FJ6A 3I3LA 4GRIA 3LSTA 5FBPA 3OO6A 4EXLA 5E3MA 4OESA 1MMSA 1XCBA 3HKZA 1TL8A 3CI8A 4QSCA 5F7VA 4CHUA 1OLAA 1IDYA 2BV6A 4C2MJ 4F31B 2DT6A 2HVSA 1LUJB 4ZEIA 3PUXE 2HR3A 4XKRA 2OJTA 1WVRA 4XL9A 3HTSB 1R7JA 1HF0A 1B4AA 1N7WA 1SVOA 1Y1MA 3A2KA 4N17A 1XVYA 4PJJA 3TOBA 1YS6A 2DOAA 1K78A 1JW4A 2GHAA 4KFQA 1SFEA 4G8HA 1N76A 3BOQA 5DM7F 4BEHB 4IHXA 1QPIA 4IRHA 1T2KA 1ZBMA 3EF7A 3KJTA 2VLAA 1CQTA 1NV7A 4N9HA 5I5PA 4BDYA 2ONRA 1J9IA 3K6VA 1ETYA 2FIXA 1OCOH 3I0TA 1NFTA 3MQ9A 3BR2A 4RGSA 4XLFA 4HRIA 2L5VA 1UTHB 1EJ9A 3G1LA 2LLKA 3KEYA 4R6HA 4CYDA 2ESNA 2F36A 1JEUA 4UUSA 4FTHA 3SKPA 2NVUB 4ASNA 2EZHA 4B8XA 3QUJA 4QFLA 1MBKA 3TQWA 1U5TB 2A6EF 3GVAA 5ET6A 2I49A 1IN6A 1MXVA 4GF8A 4DCXA 3JYRA 4L9NA 2QCOA 3IB2A 4H67A 4PBHA 3S9NC 4RK2A 1LDKB 1V3FA 2ADUA 3G3IA 4CZZA 5FLVA 2YSRA 1BN5A 2E1MB 1IITA 3IAM2 2OD5A 3OYLA 1OYWA 1FY7A 2Z5UA 2V3QA 3L2CA 5I2NA 5AIPA 4PUSA 1O64A 1PBPA 2E7WA 2B3FA 2DDAA 1KA0A 2RC8A 4A3DJ 1B1XA 2OZZA 3D0SA 3PSIA 3ECRA 2ECBA 2QVRA 4QFNA 3K1NA 2R7UA 4YFKF 4R9FA 4F3BA 5DS9A 3JAMZ 1A55A 2KLFA 3BC8A 3TTMA 2BOLA 1AH5A 3LA3A 3LC8A 2KFDA 3JRIA 3I71A 4O94A 4ZH4F 3N26A 2H94A 2XGEA 3GTOJ 2ZNTA 4N6PA 3GWZA 2XD3A 6PAXA 4JDFA 2O6GE 1QVSA 4LG0B 3KP7A 5L9SA 3S3MA 2O61A 1XGNA 2H8WA 2NS0A 3S15J 1Y4TA 3H0DA 4I02A 3CR9A 2XX7A 2R5ZB 1TWAJ 1XTAA 4AUXA 4E4HA 2QQBA 3F8MA 5DW8A 3WGHA 3FVOA 3C18A 3WODF 1T8IA 1OISA 1LAHE 1CF7B 4MAGA 2Q8KA 2XAFA 3U9GA 1LBWA 1YPNA 3OELA 3OOAA 2DA6A 2WYPA 5L3GA 4U7BA 2E7XA 4MMPA 4U2RA 1U9OA 3QAHA 3BDDA 2YUSA 3LSMA 3GXAA 4TQUQ 3MVYA 3V83A 1B9NA 2MGQA 1ZH5A 4X1BA 3ECHA 2ZJPF 2EIJH 3T93B 2E19A 4KCDA 1RKWA 3KP3A 3FK6A 3E5QA 1EYJA 3F0CA 3S1RJ 2H27A 2GXGA 4BE2A 4KICA 1MJAA 3E6DA 1ON1A 5K7ZA 3W9VA 2F48A 2ZMEA 4PJ0C 1LE8B 3M4OJ 2DYSH 4D1QA 1A04A 2L5QA 4IHTA 1EKEA 2PX1A 2NWJA 5ET7A 1Z21A 4BDRA 4LJZF 1X4OA 2ZCWA 3A03A 1XSDA 3IJOB 3V4GA 2RGVA 2OUMA 2FNAA 3BTIA 4LGWA 2F4IA 2LR8A 5CQGA 4OFOA 2Q2EB 1D9QA 4L0ZB 4CICA 1MBHA 3TW7A 1OCRH 2W24A 2WX9A 3TDUC 3KSXA 3ULQB 4NEDA 2LRDA 4EATA 1DTGA 1OVTA 2CEXA 3BFUA 3SEVA 3FV2A 4K2EA 3RDIA 1FPBA 2CSOA 3N6TA 1FTZA 5HS7A 3TUSA 3KEQA 2OPTA 5K5QA 2OCCH 2M4GA 2QF7A 3V8KA 1KQ0A 4NF5A 2XX8A 4TLLB 4FX0A 3R61A 2ZSIB 1R9TJ 5H8QB 2FX0A 3ZPLA 5FROA 4QLCU 3V42A 3J81K 1LAXA 3CG3A 3IWFA 1G0HA 1YW7A 3AG2H 3H6WA 2ZNZA 3T22A 2D5VA 3UA8A 1FBEA 2ZB9A 5IYCJ 2LOOA 2AHQA 3OYIA 1RYOA 3CFLA 1P4AA 2HQRA 4LD5A 1FBQA 4EMSA 5HNFA 3WTTC 1YTYA 1LPQA 1LCFA 3MZ8A 1IO2A 5D5XB 1I6AA 2I3WA 3IOTA 1Z77A 5ELVA 3FUZA 4F52A 1MQDA 3PIOF 1BJAA 5AA3A 3GX4X 3LUZA 2RNJA 1FPLA 1NNKA 3MPKA 3TMOA 3IL1B 3LBSA 3OD7A 2HQNA 1X1BA 4OAYA 1YW8A 4XKBA 2RVCA 2M87A 4EVIA 1DK4A 2A5TB 4GL0A 4QF9A 2NS8A 1HW2A 5HM4B 4BKXA 4Z0IA 2XD2A 2FOKA 1HKTA 1FBFA 5CVIA 2WB1N 2D2WA 1RETA 3LSWA 2NOJB 4Z7EA 2PMZN 1P92A 3G71I 3D4CA 1ZLKA 3OIOA 2XPVA 3SHFA 3PTYA 3ZMZA 2CO5A 3OWTA 5LGTA 4IX7A 3OO8A 1IV8A 3HRUA 5I84A 3VVDA 1NG6A 3WE2A 3KOTA 2L54A 4IJAA 4PJNA 3B7DA 4HYEA 3JAMK 2X6OA 3IHUA 4ENKA 3DXJF 3B6QA 4C2TA 5ITPA 1D0XA 1JTXA 2X6YA 4G6DA 4HBLA 4M9XA 5CVRA 3WHCA 3OENA 5J4VA 5I58B 1X3WB 3HRMA 2GH9A 1TQIA 2DYRH 2Y7WA 3JREA 3KC0A 4ZE9A 3EUHA 4XRSA 4MCOA 3K02A 4PZJA 5KCJA 3HCQA 4BS9A 1P1NA 3IC7A 5D6FA 1RUOA 1K61A 3K6XA 4JSOA 4Q0CA 1UZCA 1LBBA 1XGOA 2BEOA 4GO1A 4CA0A 5HNHA 3K70D 2JA2A 4I01A 3NRVA 3FASA 2CUJA 4HAMA 4M6YA 5DUKA 2O6AA 5DD4A 2VHAA 4IL6C 1BTJA 3R60A 4RA2A 1G3WA 2QSFX 3Q0VA 2ZMBA 3QK6A 4OVPA 1EZ9A 4P56A 2XXQA 4YFXF 2DWHA 2NNNA 2XXKA 4AYBN 4CUGA 1VQMI 1FZPB 5H20A 1AOYA 1V54H 1O3QA 4PFUA 5DCMB 3TFLA 3GFJA 1VNDA 4KHZE 5F0CA 1TQPA 4NQWB 3OSGA 1X19A 4RMNA 3ZQFA 2Z16A 4D0PA 1IMEA 4YICA 1MDP1 3TKDA 4B47A 5FKKA 3H3GA 2OQGA 3QYFA 3S2HJ 5AA2D 1AHDP 3KYCB 3PV0E 4MJOA 1FMVA 3RTRA 2FEZA 4KJZA 2I5UA 2WBMA 3MJNA 4IO2A 2K9SA 2FA7A 3GTGJ 4EQ7A 1Q1VA 2G93A 3SYTA 2WC2A 3DLNA 4IO3A 5IT3A 3IOWA 3K7AJ 2Y0SA 3ZQGA 4KI0E 2ME0A 1DP7P 2ZJ2A 1YO5C 2F97A 3CRBA 4DGWB 5F1JA 3MUQA 1XDUA 2Y7KA 4E7HA 4YAHX 4NF4A 1W5SA 4UABA 1BLFA 3CCVI 3JRGA 2HYGD 2KIQA 4PAKA 1X58A 1PP7U 1J7KA 1LJ9A 2A5WA 4LG0A 2M2EA 3U2RA 2HGCA 4G7HF 1IRZA 1IMFA 1WJDA 2PFYA 3BFTA 3HN0A 4IQ4A 1MY3A 3KG2A 2HZTA 2X85A 3U72A 4JX6A 1VQ6I 1XOCA 5AA4A 1YRNA 2CQQA 1JUSA 3JRCA 1ANFA 1IRXA 4D7NA 2KIUA 5ILSA 1B3FA 1FIPA 1IXHA 2QENA 4POXA 2QUFA 3BJAA 1OCTC 1DQUA 3S1NJ 4N0BA 3RPLB 5HLTA 2DVCA 2BBYA 1FBPA 3HJEA 5ERIA 1IN5A 1FRPA 1P1QA 3PPQA 4MLQA 4RLQA 2HWVA 2DPDA 5CMCA 1Q1KA 2XAHA 3VXCA 4BY7J 3CUQB 4JBZA 3MP8A 3MVPA 3NAUA 1LB9A 4DIGA 4FE4A 2CMPA 3E97A 4M73A 5FGMA 4A3EJ 3WGIA 3CJRB 1PP8F 3C7JA 5JVTA 2Q2AA 2QFLA 2ZXTA 1S7YA 5K7HA 4HF2A 2HCAA 4PC9A 5GAHJ 1MH4A 1BM9A 2L9SA 3DPLC 1P7IA 2B63J 2A5SA 3D5RC 1SW4A 1ZN2A 2DT5A 5CMKA 2ZMEB 3E0JB 3Q9VA 3IKVA 1LE8A 2F6GA 3I59B 3T0JA 1LBVA 3DEWA 2RC7A 4EJOA 3LSGA 5LHIA 2X6WA 3WHBA 3OS2A 3K6UA 4QFPA 1RKTA 4ZYGA 3TQLA 2ISYA 2NYXA 1K4SA 5I59B 3VVEA 3SZPA 2O8KA 2EH3A 1KU2A 3KN3A 1MNEA 2BW3A 3KETA 2XF5A 1JKRC 4YKPA 1I6XA 4IO6A 1XC5A 5K5OA 3G2BA 1WJ5A 2XAQA 5L3BA 1USYH 2QSGX 1NV4A 1A36A 3EETA 3C36A 3PGFA 3MEXA 3PU5A 4XLCA 4PE5B 5FHOA 1U2WA 2VD3A 1N3XA 2DA1A 2K9NA 4LFUA 2L9RA 4CYCB 3KPHA 4ZEKA 4C3IJ 2QJEA 1KA8A 2OV7A 4JSDA 4PCDA 5IM2A 3KSJA 1PYVA 2XIGA 3P9KA 2ZZWA 2DXYA 1GVCA 4NHBA 5CJ9A 5D8KB 1N84A 2ELJA 2UVIA 2UVHA 4EXKA 2RC9A 3BCBA 4DYQA 3BQYA 4UV9A 2QBYA 4GGGA 4GYGA 1Q35A 3RGYA 3E1SA 3ROJA 2ZMEC 2PFZA 4HQMA 2DFIA 1UB9A 3FXLA 4AIKA 5HS8A 2CFXA 1Z7ME 1O57A 1R5ID 4F3SA 1WDNA 1MXUA 1S7AA 2Y5LA 4YU0A 1WPKA 4KUMA 4FCYA 3S1MJ 2O68A 1UIVA 1B58A 4H1XA 4WF2A 4PFRA 4M6XA 1FBHA 2PCRA 2KIMA 1MQIA 2EZKA 2THIA 4OINF 2DOJA 5IYBJ 2NXOA 1Z6TA 2HYFA 4AS4A 3N94A 1IXCA 1NUXA 1ETOA 4BJ5C 1FOWA 2H8RA 1R9QA 4HNVA 1NHAA 2MBFA 5E20A 5ILUA 4MTDA 1PC3A 1ZLJA 1Y39A 2HQAA 3TP0A 5E8IA 4PE3A 1U8BA 4RNSA 4ABZA 5I56B 2PT1A 5E3NA 4BDQA 3GBGA 4WEPA 4I6ZA 1HSLA 1ODDA 3WG9A 3U1KA 2VP1A 1YI2I 5TPAB 2ZKZA 3G3ZA 4P96A 5L3EA 2DAOA 3EQLF 2FQ4A 1I50J 1CNQA 2F5XA 3C4MA 3HO7A 3CP2A 3FXKA 4X6AJ 1E3OC 5ILVA 1D1CA 1S9TA 1VQOI 3I56I 4RM3A 1FOKA 2WTEA 4IY5A 1NNPA 3L9FA 2M5WA 5JI6A 1LVKA 1OJLA 2MH2A 5B1BH 2AIXA 2YLNA 1EH6A 2K4JA 3EHSA 1UJ8A 2V9VA 2WWYA 2JQ7A 1TP4A 2RQQA 1APLC 2VJ5A 1MMNA 1HLVA 2IEEA 2KJCA 4EGYA 1IMBA 4R9GA 4G7ZF 4ENMA 3E9XA 1WRJA 3H4ZA 2ZBKA 3C9HA 5KVRA 2XSDC 4KQPA 5IP6A 1JKPC 4DXUA 5CBRA 2E1CA 1ULYA 2NAZA 3LAPA 4C3JJ 1VF9A 2GXAA 3MZ9A 1ATGA 2P0SA 3MW0A 4IXAA 3PUWE 3FKJA 2TRTA 2FD5A 4NX1A 2QSHX 3L1PA 2CH0A 2JSCA 3FK7A 3W2WA 2MA3A 1ZQ3P 4O3CA 4R8HA 4DDDA 1KU9A 2OJED 4UB8C 3RKXA 3FHZA 1PUFA 3S1QJ 3H92A 2R7VA 2F5EA 1O7TA 2P6TA 1XGMA 3L09A 1U9NA 4IZZA 2X6XA 1LVAA 1WH7A 1IN4A 1B72B 3U93A 1ONVA 3LA7A 4H8IA 3VODA 2DODA 1W7PD 3CLOA 1ACIA 2Q8JA 5EHMA 3K4MA 2QM3A 1REPC 4II3A 1MM6A 4I3YA 4H0EA 2Z8DA 4NUBA 3BT9A 2XX9A 3MD2A 3KEOA 1XT8A 5F0FA 2COMA 5FJ8J 2MFZA 3LAJA 3BCAA 5KCMA 2F34A 2O1LA 1UHWA 2P5VA 1KYWA 4FE7A 1O3RA 4KR5A 4RLFA 1RESA 1E3PA 5HDNA 3GTQJ 4RDUA 3BP8A 4RAYA 1IRGA 2GHBA 3VOEA 2XHDA 1JEVA 2HPGA 3K4JA 2DVZA 2QEXI 2ELHA 2E1NA 3O8HA 2M45A 4GBVA 2X48A 2Z9OA 2FBHA 2YU3A 3NEUA 4L9VA 4UXNA 4DNCA 4KNYA 1MDMB 2DK5A 3F72A 2L4AA 3VSLA 2FBKA 4B3XA 1D4NA 4I0AA 1NL5A 3PPNA 1OR7C 1KU3A 4NF6A 4NWDA 3ODBA 1XB4A 2OAZA 2W84A 4CCJA 3CC7I 4XBFA 2FMYA 4PAIA 4S04A 3OMBA 4HXVA 1ELJA 5C4XJ 2KJBA 1B7UA 4O7IA 1FYLA 2F7AA 5D5WB 3PO2J 1X1DA 4HNTA 2H5YA 5DCFA 3RPQA 1Y56A 2CU7A 2X9DA 4F1VA 1B32A 4A5MA 2XAUA 2EFWA 2R4GA 2QPQA 4A69C 2L7MP 3JRFA 5H8QA 3ZP5A 4C1UA 2Q88A 4PDHA 5TGTA 4E0WA 1FBSA 1TNSA 2ZJQF 4G68C 1D1AA 2PMUA 1O7FA 1MXWA 1JW1A 2W48A 3RSNA 2BVLA 2F5FA 3R0AA 2HQ0A 3HPIA 4I40A 1I3AA 5AIQA 3M8EA 3M7GA 4OEVA 5A2QK 1HDPA 2MSYA 4IF4A 1H8AC 1MXZA 1SW2A 3CF2A 5B66C 4C3HJ 2QSXA 2Z8FA 1WJCA 2FE3A 3C1DA 5F1QA 4WXHA 5LGUA 2R0QC 2GQQA 3FBIB 1WHUA 4IOCF 4BNCA 2XXXA 4U21A 5K2XA 4DE8A 1U8RA 3Q9SA 4JWXA 2VQHA 4IY6A 4O5VA 2JA6J 3CCLI 2IW5A 4XKWA 1Y1WJ 1QRYA 3OYHA 2GIVA 4A3BJ 4YIFA 3GXOA 1RPWA 1VQ9I 2ZZXA 3F22A 4I0BA 3ZMDA 4ZEBA 4N4OB 4HNUA 4ZYEA 1K9ZA 2FVZA 2COBA 2XRNA 4FQGA 4XOTA 2JRTA 2UVGA 3IO6A 1MBFA 3OO7A 3VEPA 4HLYA 2PX9A 5E18F 1NH7A 3Q25A 3ZSFA 4D5FA 4OQOA 5L9OA 1AKHB 3G1OA 1FTJA 1OVBA 4L9JA 2RF1A 1Y9UA 1AIVA 2VQGA 1W5CC 3QODA 4HPQA 1AA7A 2Y75A 3ZGKA 3CD6I 3J7AO 4PF6A 4E7JA 3A1YA 3HFUA 3V7SA 4XLEA 3ONMA 1B46A 3QXMA 3H35A 3C3WA 3LSKA 4LIUA 3J81Z 1YX3A 4D7MA 3CC4I 3D1NI 3PMVA 4GX3A 4G7OF 3CMEI 4A3FJ 3LSXA 3E6MA 5HLGA 3DTEA 3DP4A 2DE3A 3AXFA 1BOAA 1F1ZA 1TW3A 1XMAA 5TISC 1K78B 3RQTA 2W7YA 2P81A 3OO9A 2OCEA 1N7XA 4AIJA 1WI9A 4HW0A 1B5JA 5IAIA 3OSRA 1LEAA 3N97A 2VB6A 1SDXA 1YZ0A 2M3AA 1MXYA 4M4GA 5FFXA 2EIMH 4HX8A 4GXAA 1D5VA 5E1WA 3CCQI 4EJUA 4A3CJ 1B40A 4A3IJ 5HDKA 1VQNI 4HTGA 2Z2SB 3DWLE 3F8BA 3QOPA 1FBUA 5TRDA 1MY4A 3QPLA 3OL4A 2GA2A 1OR7A 1M1EB 1MMAA 4G2ZA 1Z7NE 4JWYA 4YEJA 1JQFA 3PD9A 3ABTA 3HOYJ 3K01A 3QSLA 4KYEA 2DOEA 4EQQA 4NC6A 1Z67A 5M3MJ 1J1NA 1S6LA 4PGNA 2GZWA 3AG3H 1FPKA 2GOXB 1B05A 3MMYB 4LQ5A 1XHYA 5EQ9A 4FJPA 3FJ7A 5F24A 2IGKA 3FM5A 2HKXA 1T6SA 4P5OA 3TEDA 2HAUA 2EWNA 2REGA 1IXRC 4O7MA 1GLNA 3FKIJ 4A3KJ 1JHFA 5ET5A 4O8MA 4BLAA 5I2NB 3RIRA 1TWFJ 2RKHA 2KDZA 4Q5TA 4I09A 3USDA 1FLIA 1K9YA 1F9NA 2OBPA 5F64A 2JPCA 3HOSA 1WI3A 2DYXA 3CSGA 1YIOA 5CI5A 4BXXJ 2PJRB 3G3JA 3E5UA 3KP2A 5HODA 1D9VA 4AD9A 1BC8C 1KQ8A 3IP4B 1FX7A 3OYNA 4KA4A 2PYYA 3HHHA 5I7IA 5CPRB 2DFFA 1XD7A 2QLZA 4PK4A 1M5FA 3OIPA 5DM6F 2MLKA 1YYZA 4MBPA 3HOZJ 3PO3J 3F23A 4C2UA 1FTKA 2LSOA 2Z22A 3MSTA 1ZTYA 3A3CA 1FQCA 3EUKL 3PD8A 4C30A 3FDYA 1Y1VJ 1XS5A 4BE0A 4A0XA 5EYGA 1SD5A 4CH7A 3LSFB 2WV0A 3WE3A 1SYHA 3MVZA 4M3DA 2AL4A 2WBBA 3O29A 4CCNA 2W85A 3J7YJ 2UXAA 3JCUC 2CUZA 4XLAA 1ZAOA 2A6TA 4ZDLA 5JLWA 4RY1A 1AKHA 4MLOA 1P4XA 2MD5A 4A3MJ 2DTRA 2L7ZA 2VL8A 4X04A 1B51A 5J6XA 3CG1A 4LA9A 4R6YA 3P7NA 3QQAA 2HPMA 2P1SA 4EQBA 3DLAA 3VYSB 1B3HA 1ZARA 1MXXA 4F93B 1OCZH 4IQJA 3I3VA 1NH3A 1VI0A 2UYEA 4MEVA 2VKDA 3LV0A 3GBAA 3L6GA 2O3FA 1I6QA 4ESWA 3DBHB 5H8HA 1OFCX 2E36A 2GIZA 4XFEA 1J59A 5IOYA 1B7HA 2NOOA 3H7MA 5CMBA 3SESA 1EV7A 1Y8QB 1IXSB 2WYKA 5DTDA 4J19A 1MZBA 1SYIA 4XF5A 1LFGA 5D6EA 3WTUC 1ZRCA 1JETA 3R0JA 2AL5A 3H6TA 3ECOA 4NF6B 2D5WA 4EJTA 4OANA 5LRSA 2VJJA 5FFZA 2R7QA 5HVQC 2QA4I 2CG4A 4EM1A 3ASOH 3TGNA 5EGOB 3M1EA 3G3FA 2H9BA 1IAWA 2F6PA 4I8CA 4OWRB 4L0YB 5JK4A 1TLHB 4X48A 4CYCA 2OX3A 3S4UA 3UGWA 3AG4H 2EA2A 4A6EA 3LMMA 1XX5A 2F5CA 1VFDA 5CRYA 3OYJA 3SQNA 1SPIA 4B44A 2DXRA 1N77A 4XN3A 1WQ2A 2VE9A 1Z6RA 4FT8A 2E2JJ 1O3TA 4N81A 4ZZAA 4HS7A 1O4XA 2A61A 2DMUA 4E6KG 2V3UA 4NE4A 2EJRA 4XONA 2XXHA 2L9NA 2KLOA 4GL8A 3U92A 1R71A 4ESXA 1DDNA 1F9BA 1G0IA 2IAIA 3MZHA 1FQBA 2YR2A 3CIJA 2D1VA 4W97A 2OF7A 5DV5A 1B0HA 1MGTA 1EF4A 2OTJI 3O6IA 3E5XA 5FKOA 4KYWA 2XGXA 4GWXA 4XKVA 1S29A 1USYE 4NAPA 4V2FA 2CJJA 3DBLB 2VXZA 1I39A 1YRNB 3TDJA 1BW6A 5A2QZ 3HV1A 4X8RA 2DMPA 1U6GA 2M0CA 2QYOA 2TCTA 2PQ8A 2DXIA 4U4SA 4XNFA 4DI4B 2E2IJ 2PN6A 1FSAA 2D1HA 3IL2A 2M8GX 2CMOA 5A5LA 1SAXA 3BR0A 1G4DA 2XWOA 4FASD 2VOZA 3FXJA 2BXZA 1LB2A 1ZTRA 2UXXA 2OA4A 5FRMA 3C35A 1LDJA 5K1YA 1FTAA 1MNMC 4F55A 1ZKBA 2OC6A 1SW1A 3TOAA 3VYTB 2ZC2A 3O6BB 2Z3YA 3SFZA 5LBQA 2D21A 2D3IA 2JJ7A 3S3NA 3FF5A 4YB7A 1NUZA 3BJOA 4Q48A 2XPUA 2KPMA 3NWSA 3CP8A 4LK1F 1RI7A 1JE8A 1R58A 3CCEI 1T38A 4RB0A 1G59A 4B4CA 4CCLA 2ZNYA 1PDNC 2ICWG 2VQLA 1LNWA 5M5WJ 1BIAA 2EFQA 2OTLI 2F78A 4N8GA 5I3SA 5KCJB 1EZPA 5KDTB 5EG0A 3QUFA 1B4HA 4JP0A 1IMDA 2DA5A 1NV2A 4QWQA 3S3OA 2WEFA 2NVTJ 1LBCA 3KJ7A 4R73A 3U94A 3PPPA 3ABKH 2DQLA 1MKMA 2W7NA 1QJMA 3ZKLA 3NARA 1TWHJ 1H9TA 3S14J 3F21A 4YG2F 3DFGA 3I55I 3Q29A 1HC8A 3KC1A 3OYAA 4G8MA 4GLIA 1NKXA 5FD5A 3LWFA 1W5TA 2A3SA 2W4SA 1Y0NA 4YMBA 1HW1A 1MJ9A 3P5JA 5JHUA 3ZQIA 4ENNA 4XMYA 3QP6A 1SVLA 2M8EA 4G94A 5BPIA 3Q3SA 2VN2A 5EGOA 3EHUA 4N4UA 1OPCA 4HQEA 3MWBA 1ZGAA 3O9PA 4GWOA 4MFEA 1FYMA 3K4LA 3HUGA 3MKWB 3K2ZA 2FU4A 1AL3A 3E79A 1I6HJ 3GTLJ 4N15A 2V1DA 4CGZA 2P5LC 1SD7A 2QBYB 1X4PA 2L0KA 3MZ1A 2Y2ZA 2F7BA 2QQAA 2V26A 3L7WA 1FJLA 1QA6A 4KN4X 3CO7C 2HHMA 3AAFA 1BI3A 5JHFA 3KZIC 3OYEA 4H0WA 1YXIA 2PT2A 3VSKA 3GFLA 4RBOA 4RJZA 2PMSA 2P8TA 2DI3A 1JKQC 2M9HA 5CVJA 4S0HB 2I3VA 1J75A 1TNTA 5J4YA 2OBGA 2VD2A 2P5KA 3DQVC 2DTZA 2JK3A 2IS1A 1XCVA 2I10A 1FPDA 1SVXB 1Y20A 1GV5A 5L3CA 3O2PE 2LAOA 2KHMA 2P0WA 2ZFWA 4AWXB 2LYCA 2IA2A 4U0WA 3AL0B 1I69A 1JJ8C 3GLXA 4PFTA 4PSWA 3RYPA 4ELPA 3OYGA 2ID6A 4FAJA 5DVJA 4G9YA 5D4RA 1WWXA 1U0JA 3K0LA 1QQIA 2QS1A 4YKIA 2H6BA 2P7CB 1P4WA 1NH8A 4KFCA 3PSFA 2AXLA 3A01B 3HEFA 1JI8A 4I99C 1SW5A 4UY8I 2Z99A 1OLTA 5E3LA 1SQYA 1Z7LA 3TTRA 5IP7J 4ELRA 3T5XA 3BR1A 2WADA 3QPSA 1OMIA 3GZ5A 5EEGA 1C0WA 2IXSA 1OQYA 4H5GA 1SD4A 3PUBA 5GTHC 1H76A 1R6RA 1JJ6C 2R7WA 1D0ZA 3LSPA 1P99A 4MIMA 3ZS6A 4F22A 2W25A 3BR5A 1ITYA 1LQ1A 2A5YB 5H8HB 2GOMA 5IZ1A 2IBDA 2XF7A 5H2FC 4NQ8A 3RPUD 2ONSA 3AG1H 3EYYA 1Q1HA 2EZLA 4P1WA 2HFBA 1QULA 4P3LA 3D1RA 1Y3NA 1PDAA 1PB9A 4HOBA 5KK1A 2F5DA 1MQJA 4JWOA 3IH2A 1CB6A 3M3YJ 3VFZA 1NMUA 4NTLA 3IKTA 2XSJC 4PFOA 3CUQC 5E3OA 1OLCA 3GFMA 3O2AA 1WGXA 1SAUA 2F3DA 2KT0A 4F3QA 2BW3B 4M1VA 2EV0A 2KISA 3PUFA 4KT6A 4IEJA 3GZ6A 2ELKA 1DPUA 1ZIUA 3FXBA 5BQTA 3JSOA 4H5FA 3BQZA 1OYIA 2V1NA 2WB1A 2VOPA 4N9IA 4BQAA 2XXRA 2ZYOA 4A0YA 4GWWA 3THIA 3SDGA 3GMEA 3RN8A 1TFAA 2RCBA 4HZFA 2ZYNA 1JXSA 2VOOA 2FYIA 5ISUA 2JWTA 4M74A 4E0XA 3KZGA 5HLIA 2LREA 2MD0A 2ZYMA 3EHTA 3MC2A 4AQ4A 5H6QA 1E2XA 2ME6A 2DP8A 1T0FC 4CO8A 2EIKH 1P1OA 2ZNSA 1QZYA 2WA0A 4OMBA 4JB7A 2DA4A 3FM3A 1MRPA 4MO7A 3D5SC 4Y4RA 2JTVA 4UVAA 1RKMA 1QNTA 3RQIA 4UVBA 1SI0A 3EQ1A 4ZDMA 3VLUA 4B48A 3B8BA 3OR2C 3SEZA 1RDXA 3W6KB 2CZIA 2GWRA 4P47A 3KYLA 4U87A 2UV1A 1SD6A 5ESYA 5C44J 2M34A 1LSTA 5FO5A 1W4MA 1FQAA 3CO6C 2BHYA 2K9QA 1K6YA 4NBQA 1G3SA 2CWEA 3HBLA 5BUUA 1FPGA 2HEUA 2JN6A 2CQNA 1VQLI 3QU3A 3M9AA 1DPRA 3EKIA 4AU7A 4L18B 4DBQA 1MDQA 2K02A 4YB5A 2JT1A 3OV8A 1FPIA 1Z3YA 3F6VA 1XMKA 3CFZA 2V79A 2STWA 2VT3A 3JRHA 1A8EA 4OVTA 2K5CA 4KIBA 1STZA 3W9WA 3FBNB 2VPRA 1B5IA 4O3AA 3TDZC 4PDKA 4DZJA 3OYCA 4FEBA 2WV1A 4A3JJ 2R9JA 2FOWA 3BR6A 2RKMA 3HSFA 3CDIA 3G3KA 4LZ5A 4JQFA 2OWSA 4RPOA 3KCCA 3SJMA 4QSEA 4Z6YA 5LDZA 3L2UA 2ID3A 2PMZA 3EPZA 1S72I 3UNGC 3KIOA 2JA8J 1G3TA 4F18A 3ELKA 3CTAA 2HTSA 5CYVA 1NNTA 2V9PA 1X3UA 1FBCA 2J5OA 3HPHA 3OYMA 1TT0A 2IA1A 3A0BC 2ETHA 2VKHA 3ZN0A 2JMWA 4IPAA 4AB6A 3I59A 2IPQX 4LIVA 4LLNA 2UXNA 4N6DA 1FP2A 4BQQA 1G8XA 2QQ8A 3C33A 3K0VA 3TTKA 4Y33A 3I4MJ 2QL3A 4RA1A 3V7CA 3VDXA 1B2HA 5LRRA 2EK5A 5J1RA 4RPNA 1B9JA 2QVOA 2GA1A 2F35A 4OTEA 3S9LC 3DU5A 3IK6B 4QXDA 2LG4A 3OXNA 2H99A 2WKYA 3D5LA 3B73A 4FISA 3T9VA 2IGNA 4ON0A 2R6GE 1BR2A 1ETQA 3E7LA 1FNNA 3VPRA 2AYSA 4P0IA 1IC8A 5CKTA 3WU0A 2XXWA 1R1NA 1K7AA 2YPRA 3A4CA 5HBCA 2CW7A 1CF7A 1GV2A 1T33A 5IOZA 1JT0A 3BKIB 1QO0D 3HKZN 4H46A 2YJPA 3OYDA 1FP1D 3IRQA 3N05A 3Q0UA 4IGTA 5ET8A 1MPCA 1GHCA 2CEYA 4EGZA 2CS3A 3L2WA 1FQFA 2DSFA 1VR5A 3PIPF 1QZZA 5LLQA 1YCJA 4WEDA 4F2QA 5KZTA 4R6KA 5I58A 2F5VA 1ZG1A 1FYKA 2H98A 3KLNA 4YMAA 3HSEA 3I4PA 4LB6B 3OS1A 1X1AA 3KFMA 2JUCA 1POTA 1BIBA 4EJWA 3JRBA 3KN7A 4GIZA 3DEUA 5FTIA 3FISA 4DJAA 4HSRA 2GM4A 2Y0MA 2F4OB 3WTYC 4O6JA 1LBXA 2RCAA 4NWCA 1BR4A 1YAEA 1UG0A 3GUDA 2CW0F 2OLBA 3IORA 3PL8A 1POY1 2H1KA 2KKOA 4HDUA 4I9DA 1D3KA 2I0CA 1WFXA 4RAZA 2CV0A 2VODA 2O03A 1US4A 2B4LA 1VZ0A 2Q2EA 4LOCA 4A6DA 4M3GA 2ABHA 1IIWA 2I48A 1D8KA 3CHGA 4HW8A 1IQ7A 1JP4A 4ECFA 1ZHFA 1DUXC 4M3EA 3LQRA 4PGPA 1PEBA 1Z05A 4RM2A 2H1LA 3OMYA 4KMFA 2E71A 1OYYA 5DCMA 1KU7A 4DI3D 3LFKA 4BJTA 3O66A 3I5UA 5GPCA 2Q2CA 3IX1A 3DF8A 1WVJA 3RT8A 5J8CA 5EHSA 1IUFA 3DPTA 3N5LA 4H8JA 4NB5A 4M71A 2K85A 2KQRA 4Y17A 3TO7A 5LEJA 3K1MA 3HL2A 4DCYA 4TOZA 1AWBA 3RNNA 2ZO4A 5H6RA 1FT9A 3PFYA 1H0MA 2O1MA 4OIOF 3BJ6A 3CCYA 2K40A 1DGWY 1S50A 5DTBA 3ZN1A 1LB8A 2XWIA 1USTA 4GFBA 4WXJA 4MEXF 3HOWJ 2L2OA 3BTJA 2KR0A 2R7DA 5H8NB 4Y52J 5B70A 5IT9Z 3QMFA 4GOTA 5EF6A 3BPXA 1WJBA 3QAXA 3V89B 1ZELA 2REJA 3WU2C 3A0HC 3UORA 3MZYA 3W3CA 3DBRB 4WXCA 1VQ4I 1FTTA 2O51A 3OIQA 4BE1A 2IEKA 2V6EA 3F8CA 2VKEA 3VWBA 4ONYA 3V7RA 4ENJA 1MMGA 1UG2A 3H6VA 4GX4A 4I1DA 1PVEA 1ZLQA 3C2HA 5J3LA 1ON2A 1YLFA 1DOTA 3W2VA 4AB5A 1I27A 4PF8A 5F0HA 4XSXF 1TWGJ 1R5GA 3H03A 3IJXB 3KP4A 1OIBA 5DUIA 2L7FP 4II2A 4I2OA 3E13X 4OVQA 4FETA 3SDBA 1SD3A 2G0EA 2IS2A 3TL4X 4E7LA 2XWKA 1FPQA 5CQEA 3TQNA 5CLSA 5J1YA 3K2AA 3AL0C 2F4MB 4U0YA 2CV2A 4ZZLA 4BBSJ 1EYKA 1RDZA 3GO5A 3ZQLA 4BDNA 3LSRA 2DMQA 4KMUX 2F2EA 1N25A 4XK4A 5KAFC 5LFAA 2I4CA 3KZYA 3CUQA 4S05A 3FGSA 4NGUA 3ILUB 2LKXA 2QMWA 1H45A 5D5UB 1UHMA 3LNQA 2GQ1A 2ISZA 1E0EA 4ETSA 4R72A 3TYHA 3MWMA 2ZSHB 3RKQA 3E6BA 1F4KA 5ED4A 2M8CA 3I58A 1URSA 1QHGA 1I6BA 4XSZF 3IAS2 4OOIA 3OS0A 1RYXA 4IHVA 3CCRI 3CCSI 5KDTA 4R79A 5H8FB 2ZZVA 1J2XA 2VI6A 1PUEE 4ZECA 3RCOA 5EZGA 4AVZA 4PSXA 2FQ3A 2EPFA 4ELQA 3HGGA 1VQKI 1B52A 3HB9A 5HDGA 3KBRA 1YIJI 2DBBA 3M8FA 1EA3A 2DMNA 4M72A 3J80K 1N0TA 4PGHA 3WTSC 1T98A 2L3DA 4B1RA 1T39A 4U1OA 5M5YJ 3FV1A 1GTKA 4F7ZA 2HDCA 2QMXA 2P3VA 1XPXA 1YTVA 4LITA 2B4MA 4JK1X 4OU0A 1FCKA 4IKFA 4M9SA 2BJIA 3HSRA 2F7CA 4RB3C 5LD2C 1QKBA 2GBYA 2DWIA 3H3VK 1H3DA 4F19A 1UQWA 2R7OA 3CLQA 4DIQA 3DLLF 2LKSA 2NRAC 3OOUA 5DYMA 3DPUA 4X0GA 2CW8A 1EH3A 4YFNF 3BWGA 1MSFC 3NOHA 3O6HA 2G7UA 3PJRA 1SFKA 1RZ4A 2VJ4A 1KYZA 4XLNF 3M3FA 4BGDA 3PFIA 4AYBA 2O5RA 4A3LJ 5BMZA 4X1DA 3ZMSA 1PB8A 1JHHA 3CCMI 1CGPA 2P7VB 4Q5SF 3V8XB 3F8NA 3H0GJ 4WWCA 1F43A 3OR1C 2DA2A 5FLXZ 3ZR8X 1ZRDA 5FTHA 3IUOA 1LFHA 1R4NB 4E7IA 1ZK8A 1LEBA 1R1VA 3FX3A 4IGRA 2DQRA 2ZXJA 2XVCA 4XKNA 2BGCA 1Z1DA 2JVGA 2BXYA 3RT6B 2DW4A 1DSNA 3K4UA 2EBIA 2KP6A 3T8RA 2XV4S 4BL0B 2JZYA 4MNUA 4GWSA 2JSPA 4V19K 2PVUA 5AA4B 1TBXA 2E1OA 3K4CA 4OA4A 3M3KA 3FMSA 2EFPA 3S2WA 4P9UA 4M3FA 3G3HA 3VFJA 4ZDPA 1S5LC 2B9SA 3A29A 4UHTA 4KPTA 3TTLA 1B9MA 2G7HA 5AONA 2RQPA 3K4KA 4FHTA 2XDVA 3A01A 1VTNC 1B4ZA 1H88C 1AU7A 1XC1A 4AM3A 4KCCA 2QVUA 4RGRA 3FZVA 1D3YA 5LOMA 3CDHA 1FOYA 4RYAA 4F2OA 1IRFA 1BKAA 2Y30A 1R1TA 3F6OA 2CUEA 2LMDA 4A5NA 3DKYA 4DOZA 4OEUA 1MQHA 4MFDA 1HCRA 1Y6IA 2HNHA 5GADJ 3JZJA 2QKLB 3BTCA 3KX2A 2HZKA 1MW7A 3PUVE 4QBAA 1U5TC 2UUZA 2PI0A 2CZLA 2DQVA 5TU0A 1SC7A 3K4NA 4NC7A 5JEIA 5I2KA 1A8FA 4O3MA 1FPEA 5FLXK 2DE2A 1FTOA 4Y13A 3ABLH 2Q89A 4QSDA 4U22A 1URGA 1RR8C 3DCFA 1KWHA 2YS9A 4R1HA 5HS9A 3RKWA 1TC3C 4OETA 2E34A 5IZ3B 3TO6A 4OYVA 3KYDB 2EINH 3GW2A 3U65A 2L9VA 1U3EM 3ERMA 3BR3A 3FXRA 4RAGA 4QIWN 3RZOJ 2DDBA 2KQZA 2ZXHA 2ZNUA 1BI2A 3T8TA 3C2BA 1FBDA 1S3JA 4HA8A 1FTLA 1LBZA 2CZKA 3WTVC 2IS4A 2H4IA 3IO4A 1V55H 3HUGB 2GAUA 3HRSA 1Y0UA 4GCVA 3OOPA 5FRNA 1CE2A 3B6TA 5EYHA 3BROA 5DEXB 3SEWA 4ND9A 2HDWA 2K9MA 2X1DA 2Y48A 1T0FA 1T56A 3G7WA 2HYJA 5IGAA 1ZGWA 1YHQI 2VPLA 3B02A 1DMBA 3FXMA 2Z1DA 3QYEA 1HSEA 3T96B 2I6EA 3VE1B 3VB2A 3F11A 3RUMA 4ANJA 3KGCA 3CMYA 2MH9A 3ZOBA 1RNLA 2UWMA 4WX9A 4YIIA 4P1EA 3UIFA 2MC4A 4KYDA 2Y9ZA 1MM7A 3V5AA 1MPDA 4NDLA 3W2AA 1XI6A 4GQOA 5TP9A 3TODA 4ZTJA 2OQRA 3GBBA 4YRVA 5DD8A 2OWTA 1T08B 3BG9A 3DP7A 5J1UA 4H45A 2JA7J 2DWJA 3EDPA 2H09A 4A2UA 2CQXA 1JUMA 3HRTA 2DFEA 4A93J 4HCYA 1KZHA 5IT9K 4OMZA 1ZJLA 4GXSB 3FJMA 1IJWC 3H3ZA 1NUWA 1IN7A 3E3KA 3RTFB 3GZNB 5D5VB 4C9YA 1L3LA 1M5EA 5EQ7A 3FVKA 2Y84A