1MH4A

Maltose binding-a1 homeodomain protein chimera, crystal form ii
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords maltose binding-a1 homeodomain protein chimera
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
total genus 136
structure length 418
sequence length 418
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh4A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A01
5B7DA 1WVJA 2XX8A 5DYHA 3VLUA 2HCAA 3OENA 4IO7A 1WI3A 3HCQA 4X1DA 3TTMA 3JZJA 4Y7NJ 3O2AA 5CMMA 2OF7A 2GLOA 4P0IA 3IH2A 5EG0B 3HB9A 1B9JA 2K9SA 2K9QA 3OSRA 3I6VA 1ANFA 3K02A 3HKZN 5A5XA 1JEUA 3BT9A 4J19A 2F97A 1X2NA 1Q35A 3I3VA 3JRFA 3U93A 1GDTA 3K1PA 4RDUA 3KN7A 1EZ9A 2MSYA 1O4XA 4V2GA 1GT0C 3BQZA 1QUKA 4ZDMA 3H6TA 1MS7A 1IGNA 3FIWA 5DT6A 3HEFA 1B3GA 1PEBA 1TWYA 1VFEA 1NFTA 3TMGA 1MPBA 2K40A 2FQ4A 1FEXA 2CUFA 2NOOA 3FJMA 5FLVA 4LOCA 2DE2A 2P2AA 1MRPA 2EBIA 4AC0A 4PETA 2IA4A 3P7IA 3Q0UA 3UORA 2XXQA 4QSCA 4OMBA 4DYRA 5H8FB 3QPLA 2P81A 3QXMA 2EZKA 3TPAA 5TP9B 2RCAA 3KSJA 2DMPA 4YMBA 2RC9A 3S9NC 4MO7A 2H1KA 3G7WA 5CC2A 3G1MA 3CMYA 4FEDA 1K61A 1XS5A 5BWJA 2R5ZA 1LFUP 4GF8A 4R75A 3PUXE 2FNCA 2X7PA 4G68B 2IEKA 1D5YA 5TPAA 3SERA 1SYIA 2I49A 5GPCA 4NF6B 1BL0A 1ATGA 3UIFA 2JJ7A 1IG7A 1Z7NE 3C33A 2EQRA 5CMBA 3UK4A 5C4XJ 2OZZA 1QUIA 2XXRA 1B3LA 3MVXA 5J1DA 2ID3A 3IB0A 1A6IA 4JWYA 2HXWA 2I6EA 3JREA 1JW5A 1PUFA 4A93J 5KCJB 1URGA 2V3UA 1OFCX 1I6QA 5AA1A 2QJEA 3QPSA 5IYCJ 2NS8A 4QTRA 1SW1A 4TQUQ 4PE5B 5KDTB 3Q26A 4DW6A 3ZQLA 3FIRA 2XRLA 2O84X 4A3KJ 2E1OA 2ME0A 4DYQA 1TWCJ 3SFIA 1JUMA 5EG0A 1HF0A 4CYCB 1WH7A 2ELKA 4Q5TA 1O7TA 1B32A 1B72A 1MXYA 1Z7ME 2BJJX 4KD5A 3U94A 3V89B 4BDQA 2ANJA 4S0HB 1B6HA 1UTBB 4IEJA 3CG3A 3L6HA 3LSRA 3GTKJ 1JW1A 2O9LA 2JA5J 4A3GJ 3FVNA 1I6AA 2H4IA 1EZPA 3TODA 3DP4A 3IB2A 5C3EJ 3IORA 1SQYA 1P1OA 1NK2P 3PO3J 4KYSA 2L7MP 5EZHA 2HFBA 2IBDA 4BBRJ 3RT8A 2ONSA 2HI3A 5IPAA 4QRZA 3KJTA 3PD9A 4FE4A 4HCWA 5EHSA 1FQCA 3C9HA 1GR2A 1IDZA 3MVPA 2M0CA 5TP9A 5LOMA 3G3KA 4M6VA 2Y9YA 4XKQA 4YKPA 1LFGA 4KQPA 3F11A 3PMWA 1LAGE 1MM7A 4G68A 1S9TA 4L5EA 2XD3A 2DA6A 1FTMA 3CFLA 4NMYA 4LATA 2LTPA 3BR3A 4I8CA 4NF6A 2OLBA 3CSGA 2AL4A 4YKKA 5F04A 3C32A 4G2ZA 5B70A 5FKOA 5F1JA 2OWSA 1JVYA 1MXUA 3BFTA 1MBHA 4R2BA 2ZB9A 1MY3A 3QIMA 1ETXA 4BLAA 3E7LA 2R5YA 4BBSJ 2REJA 5H8NA 3HHGA 4G8HA 1B3EA 4MBPA 4DCYA 3MQ9A 5M3FJ 2R71A 4F1VA 5FHMA 4FAJA 1IV6A 5M3MJ 2RF1A 2HAUA 4CYCA 4MFIA 1TWGJ 3W9VA 3MP1A 5K2YA 2QPQA 1I3QJ 2JA7J 1F36A 3LSGA 4MLOA 5DEXA 1GTKA 1BLFA 3S1MJ 3TW7A 1OVBA 3PUWE 1XC5A 3O97A 4OENA 4R6KA 1O64A 3WAFA 1L5TA 2Y7KA 1PB9A 1MPCA 1IUDA 4ZZAA 3CFZA 2HXOA 3JRGA 2PX1A 5AA4A 3MPLA 1AL3A 5ITPA 1FW0A 4FECA 1XS9A 4F3BA 1A5JA 2LY9A 3PGFA 2VHAA 1HLVA 1Y9UA 3N6TA 2X6OA 5DS9A 1MY2A 3TW6A 1OLCA 2XX7A 1AOVA 1IXGA 2R6GE 3TQLA 3S16J 1SI1A 4XKRA 1HDDC 4ZEKA 1DTZA 4KYDA 4LP2B 5H8HA 3E4RA 3VPRA 4LQ2A 3TELA 1LFHA 3K7AJ 1QVUA 4RBOA 4A3FJ 1Y3NA 5I57B 5L9OA 2PT2A 2YU9J 2O7UA 3T9UA 3RUMA 1N84A 1RR7A 1US4A 3FXRA 2Z22A 4U2RA 3TUSA 1ZGWA 4NEDA 4XKPA 1IDYA 2XXWA 2FD5A 3G3JA 3HOUJ 3QUFA 1B0LA 4IY5A 4DDDA 3OIOA 3U8QA 3DM0A 4I1DA 4LA9A 1B7UA 4X6AJ 1DPPA 1R1NA 3IL1B 2IAIA 2R92J 2H99A 1D9VA 1QKBA 1Y4TA 3O6GA 2VOZA 3AXFA 3G1OA 2V93A 1ZLQA 1Z0XA 3TTLA 4H1XA 1ETQA 1ITYA 1JKOC 5F0CA 1FQBA 2QS4A 4M3EA 4GXSB 2VP1A 1K83J 1ETWA 2LD5A 1IXCA 1OQGA 2NXOA 1TT1A 4KPTA 2F34A 1B8IA 3MJNA 1MQHA 2PMZN 4X1BA 4GD5A 2QL3A 3T9HB 3TP3A 1POGA 1ORKA 2XXHA 3M3KA 1Z77A 2XGCA 4R2FA 2NOGA 3WAEA 4NF4B 4K3FA 1GV2A 1A8EA 1MXXA 3VVFA 2Q89A 2DE3A 2UVJA 4PFYA 2RC7A 3IX1A 2DA2A 1IXHA 1KWHA 1JKRC 2AO9A 3A3CA 3RLFE 1MSFC 3USDA 5DVIA 4QHQA 4GLIA 4BDNA 4LZ8A 2XHDA 1YTVA 4DZJA 3IK6B 3Q29A 4PFWA 2P1SA 5AE4A 1MBGA 3ZKLA 3GBGA 1B3HA 3BR0A 3SESA 2I3VA 5A5XB 2I0CA 2Y7IA 4UA8A 1Y1ZA 5EYRA 1U9NA 1HCRA 2O8KA 3SEUA 2W48A 1LFBA 1BJZA 5L9SA 1UMQA 3S9MC 3B6WA 1H76A 2B65A 3FV2A 3FK6A 4OYVA 4XRSG 1ETVA 3OSFA 3JRDA 2F7CA 4OWDA 5JLWA 1HSEA 1NNTA 3I4MJ 4NWCA 5GP9A 1LGBC 4EF2A 4R9FA 2PVUA 3RQIA 1S50A 2GRVA 2NVXJ 2QMXA 3DLNA 3E9XA 2E0SA 3OO6A 5DTBA 3OSQA 5JTYB 2Y7RA 4OHNA 2JA8J 2I4CA 3QQAA 5EYFA 3SETA 5TU0A 3OXNA 5I2KB 3SEVA 3PMXA 4IO6A 5H8QA 3DP6A 3BTLA 3LOCA 4GL8A 1CE2A 5L8DA 1QRYA 2DMUA 1MXZA 4F31B 2R5ZB 2WV1A 1XVXA 1VSOA 2OJTA 3S9EA 3CDLA 1H8AC 4RY1A 4ZEDA 4WEDA 3PV0E 5TPAB 3TFLA 3VDFA 1OMPA 4ELOA 1NH7A 4ELQA 4M3GA 1JVXA 2Q88A 4F19A 5I2NA 2O6AA 3G3GA 4LONB 3S4UA 2H25A 1MH4A 4NF4A 2XXXA 1II5A 2ZNUA 3MP6A 1SW2A 3PPQA 4O3BA 4NE4A 3PM1A 2F78A 3KZGA 4JWOA 1PUFB 3PUZE 3GTMJ 2XXUA 1JQFA 1QPIA 1YRNA 1B40A 2LAOA 5C44J 1BP5A 2I48A 2ZNTA 2PBWA 3CIJA 3THIA 1UIUA 3FV1A 3RPWA 4L17A 3HDDA 1FQFA 3LBSA 4PFTA 1SW4A 4A3LJ 1SYHA 2DE4A 3F0CA 1DSNA 2ZYNA 4GFBA 3SEWA 1B72B 5J3LA 2OWTA 4M1VA 2R93J 4POWA 3MC2A 5AA3A 3S1NJ 1Y1VJ 3M3YJ 1UQWA 3TYHA 5GPAA 1RKTA 2L7FP 3FD3A 3ZQCA 5AA2D 3RT6B 1H88C 4RPOA 2QS2A 3O9PA 4BDLA 3TTNA 3ZQFA 3BFUA 1HSLA 3N26A 3L6GA 4WEPA 1U8BA 2QF7A 4XKNA 2OCUA 5JTYA 4YMAA 3OD7A 4A3MJ 4U23A 1ZTRA 5IYDJ 4AB5A 2VPRA 3U92A 2M9HA 2Y7PA 3VV5A 2DMQA 1PB8A 3H6UA 5I2KA 1SW5A 3FVOA 1I6BA 4F18A 4KCCA 3VE1B 5F27A 3CI8A 3Q3SA 2HZLA 2XSDC 4F3SA 4F1YA 4G12A 1NL5A 1JUPA 1JT6A 4V2FA 3TTKA 1A7LA 4ZEIA 1IQ7A 5EDNA 4RXLA 1B4ZA 1MG1A 2XX9A 3HSTA 3I5OA 2D21A 2LR8A 3O8HA 4QFLA 4NDLA 1FQDA 1VE4A 4QSHA 3BG5A 4ABZA 4P11A 2HOSA 3QK6A 1SVXB 3TEPA 3C36A 2R5YB 4FTHA 4GVOA 5C4JJ 5H8NB 3LNQA 1P1QA 1XOCA 5CMCA 4HTGA 2HYJA 4G8MA 4BKXA 3DP8A 5E3NA 3SJMA 3ZSFA 2VD2A 5JEIA 3ONMA 3QSLA 3WHBA 4RNSA 1IRZA 3RY3A 1WH5A 3GTGJ 4H6DA 1VF9A 3K00A 3B6AA 4BY1J 1DTGA 5CI5A 3FKIJ 2L7ZA 5I59B 4DZ1A 3W15C 2REGA 4O3AA 1VFCA 1N3WA 3UA8A 3CRBA 5CM6A 1AKHA 3OOUA 2D5VA 2CQQA 1SD3A 3TZAA 2DVZA 5DEXB 3Q0WA 4QSDA 5CBSA 3A01A 4H65A 2V3TA 5ICQA 1TWHJ 1LB8A 1IITA 3HOYJ 3GXAA 1USYE 1FTKA 1LCFA 4ONYA 3MW0A 4MLVA 5HPQA 5AA4B 1QUJA 3TAJA 4JXIA 1F9BA 3UP9A 4KYEA 2G29A 2ECBA 4H5GA 3MWBA 3ODBA 2QS1A 2F8DA 2Z23A 1S7EA 1M5DA 2GFEA 4EQ9A 4UUSA 3S14J 3G3FA 5I84A 3TTRA 3H3VK 3DEWA 2O7OA 1LAFE 1P7IA 5H8HB 3T66A 1XVYA 3IO4A 2CQXA 4EEFG 5L9MA 4WKMA 4OFLA 4C0RA 1MM6A 5M5YJ 3BBRA 2NWJA 2DMTA 5IYBJ 2X48A 1IIWA 1IC8A 3IH3A 4I62A 1HSJA 3PU5A 1JT0A 1I6HJ 3JRCA 3JR9A 3OO8A 4IY6A 4XXUA 1TXFA 2UVHA 4X1EA 4ESWA 2OPTA 3M4OJ 4F39A 4P0GA 4KFQA 2I3WA 2Q2AA 1LLSA 2DTZA 1DOTA 2THIA 1D4NA 2Y2ZA 4GOTA 1GVDA 1H44A 2DQVA 4F3GA 1DU0A 4EQBA 1ZJLA 4H5FA 4OEUA 2TRTA 2LLKA 1FTZA 2XXPA 3M8UA 5J1RA 1SANA 1MSEC 2HEUA 1UIVA 1D9YA 3R26A 2QSXA 1B8IB 2P0SA 4N13A 4RK2A 5I59A 4GFRA 3RKQA 1XHYA 3JRAA 3MZ9A 3BTCA 1Y3QA 3PO2J 4YB7A 5K7FA 2JA6J 5JLXA 2ZYMA 3EPEA 1JW4A 4BXXJ 3B7DA 5M5WJ 4RK9A 2ZYKA 5IKBA 1GGGA 4XIDA 4OTEA 3FXQA 1SI0A 3C34A 2E19A 2LK2A 3QUJA 3VFJA 2UYEA 2A5SA 4ECFA 1A54A 1I69A 4Q8RA 1MY1A 3O28A 3S15J 1RYOA 1YPNA 3IOTA 3LC8A 5DTDA 2KLFA 3HV1A 4N07A 2HDDA 3W6VA 1ENHA 1SFOJ 2GH9A 3A02A 4NF8A 2G0EA 3O29A 5EHMA 2EZLA 1AMFA 3LSWA 4E0WA 3TCGA 4UACA 3NARA 2Y7WA 1WCMJ 3CSBA 4R74A 2DP8A 2E2HJ 3CFXA 4IHXA 4ZEBA 1MNMC 3TQWA 3K0VA 1AIVA 3S2HJ 5I58A 1N7WA 1MQJA 3T22A 3M3FA 4G77A 2Q8JA 2HXIA 2HQ0A 2PMSA 3C2BA 4EQ7A 2XB5A 1MY0A 2H9BA 3FJ7A 3OMBA 3IV5A 4OEVA 4B4CA 4U1OA 2Q9TA 3DCFA 1Q1KA 3LSFB 4G4PA 4XRSA 2F7BA 1B0HA 2XD2A 4B3AA 4QFKA 5H8QB 4F2OA 4OQOA 3HN0A 4A69C 2ZNSA 4C1TA 1US5A 4NF5A 3KG2A 3VXBA 5EGOA 4FISA 4JX4A 2ONRA 1P1NA 1HOMA 3V8XB 4OERA 4Z0IA 4H8IA 3I4NJ 4JB7A 4POXA 4G68C 4MH5A 3DELB 1JGGA 5HODA 2DA1A 3BTIA 3IH4A 3NAUA 4YICA 5I2NB 3U1OA 2Y0SN 1BIYA 1P1UA 1AU7A 1VNDA 4KI0E 5BNGA 1FTTA 1FIPA 2XXYA 3EF7A 3KFMA 4W1UA 4HCYA 5ELVA 4DCXA 2A5TA 3MP8A 1B4HA 1JEVA 3TP0A 2K9NA 3MPKA 1MQDA 1UG2A 4IGTA 1YRNB 4F2QA 1EH3A 3V5AA 1TC3C 3LR1A 4C1UA 3KN8A 2ALUA 1ZK8A 2IEEA 4IO2A 3JRIA 1O63A 2R9JA 3G3IA 4XK4A 2Q2CA 3N6UA 1FTJA 3BR5A 3U72A 1ETKA 2ZXTA 1QVTA 4THIA 2EH3A 2B3FA 3BKIB 4QFOA 1DMBA 3KSXA 1JJ8C 2AIXA 5EF6A 5H8SA 4ZS9A 1IJWC 4EF1A 2B63J 4D5CA 3K01A 1MXWA 5F0HA 1FTOA 1USYH 5FHOA 3SDFA 4DLDA 2R0QC 3BR1A 5DVFA 3LSXA 4TOZA 4ZZEA 2RAEA 2JK3A 3RNNA 2M8GX 4IHYA 1LBBA 1F43A 2N8GA 1TWFJ 2VGQA 2F36A 3JRBA 1GUUA 3E3KA 3O66A 4F3PA 5HBCA 2YUSA 4A3EJ 2I4BA 5FLMJ 4YZZA 4M4GA 1B05A 4MF3A 4A3IJ 1B52A 5FHNA 3C4MA 1NNFA 4R6YA 1OCTC 1DU6A 2XPUA 1UTHA 4IO3A 4IGRA 4U4XA 1I50J 2XPWA 5FJ8J 1MDQA 4D7MA 4UUTA 3MZ1A 1APLC 2Z8EA 3GTQJ 3OELA 2CMOA 4Q30B 4Y52J 1GV8A 1VI0A 2FX0A 1B7HA 3K1NA 3HOVJ 2ECCA 1ZKGA 3S1RJ 2LP0A 2D3IA 5FKMA 4QIWN 5F0FA 3LUYA 2H5YA 1LFIA 4RYAA 1QW0A 5K7HA 3Q28A 1OLAA 3FUZA 3IB1A 3KJ7A 3VVDA 3VXCA 2DWIA 3H7MA 3BR2A 2QS3A 2D5WA 2OK2A 3MVWA 3A03A 5CBRA 3Q27A 4R73A 3IR1A 1MBFA 2F5XA 2DOJA 1ZMGA 3TCFA 2DA3A 1Y1MA 3RZOJ 2KDZA 1XC1A 1FJLA 1NK3P 3KGCA 4OVJA 2NUVA 2WKYA 5IP6A 5FTHA 2DSFA 3H3GA 3OOAA 3D4CA 2GHAA 3D4GA 3H0GJ 1U78A 2FJ1A 1M5BA 1PB7A 4U22A 4HNVA 4DIGA 2ZMBA 3FVKA 3PPPA 1AKHB 2H98A 2V84A 2X7QA 2ABHA 4DE8A 3UN6A 4OXVA 3A01B 3H4ZA 5ICTA 3HM5A 4IHVA 4DXCA 1MPDA 1ZR4A 4QF9A 3FXUA 4JSOA 1R6ZA 3IOUA 3ZQGA 3CQZJ 2UVGA 1OIBA 2CUEA 2RC8A 3K6UA 4LVQA 1GVCA 3PD8A 1DPEA 5EZGA 1PBPA 1B51A 1JTXA 1RKMA 2O7IA 3PUYE 4U1ZA 2VKVA 2I0BA 1WGXA 3PPNA 2QRYA 5I56A 1POTA 2KT0A 4UUSB 4Q0CA 4C3JJ 2O1MA 1H45A 2M8CA 4A3JJ 2NS7A 5FKNA 1J1NA 2F6GA 4M3BA 4JBZA 2OBGA 1JUSA 4QSEA 5ISUA 4BY7J 4D5FA 1LE8A 1PBQA 3FGSA 2Y31A 4FORA 3H6WA 1ETYA 1PDAA 4ZE9A 4JX5A 3GTLJ 4H0WA 3K6WA 4H67A 4E0XA 3GTPJ 4GWOA 2JN6A 3IO6A 4R6HA 4GQOA 1SBPA 1WODA 1RESA 1N04A 1QVSA 5E3MA 2HQ5A 4MFEA 3MVYA 2CJJA 2B3BA 2RINA 3D1NI 1FQAA 2ME6A 4QFPA 2UYFA 1B7ZA 3G1LA 1E3OC 4YU0A 2XB0X 1MBJA 4OESA 4U21A 4MIMA 2CZLA 3E13X 3Q0VA 1N3XA 5E3OA 4KR5A 1OVTA 1MXVA 3LSJA 4C2MJ 1H3DA 1Y3PA 1MQGA 3MKLA 4W97A 3OSGA 2UXAA 2DWAA 3QAXA 1B1XA 4ZECA 4YB6A 4OFJA 4JDFA 1OQHA 1HDPA 1ZKBA 3MAMA 4EXLA 2YLNA 1NH8A 1N0TA 2YJPA 1G2HA 4YKIA 5IOZA 4XIGQ 2XGEA 2L0KA 1WPKA 1XT8A 3ZKKA 2XGDA 1BW6A 4RA1A 2WAQN 1B5JA 2HAVA 3A3UA 3ILTB 3O8GA 1RETA 2COBA 2V25A 2NVUB 3C35A 4KHZE 5FTIA 1P7JA 4NWDA 1H89C 2GHBA 1VR5A 3MZBA 1LBCA 1R9QA 3H6VA 4JX6A 2ONKE 2VUMJ 3OO9A 5DVJA 2MGQA 3T93B 1BKAA 2RCBA 1MQIA 4QFNA 3HOWJ 2AYSA 4NF8B 1JJ6C 2CRGA 1T56A 2X9DA 4DXUA 1LCTA 1XG1A 4MLQA 1NTCA 3JV9A 3RGYA 2FA7A 3FATA 1BTJA 4B1RA 2HOAA 4DXBA 1FCKA 3MVZA 3RTFB 2TCTA 3HOZJ 3T9XB 3O6HA 1ZTYA 1A40A 2DMNA 2WB1N 4MFDA 2Y84A 5I58B 1FIAA 1A99A 3M3LA 1MBEA 4G8NA 1GV5A 1T0KA 3L1PA 3S2VA 1QKAA 1ZQ3P 1JKQC 4TLLB 1TFAA 5H8FA 4U4SA 3GBAA 4I9DA 1Y4CA 1M5EA 2GM4A 3B6QA 3UGWA 4GL0A 1B5HA 1LB9A 1W0UA 4AB6A 3N94A 1ZIUA 1A55A 1QULA 5IOYA 3GLBA 4F1UA 1H43A 4FJPA 4FE8A 2O51A 2JWTA 4A3BJ 4NF5B 1N76A 3VVEA 5EGOB 2DN0A 2G93A 4N6PA 1ZU0A 4X9TA 1POY1 1P1WA 1EF4A 1VFDA 2XXVA 4BDMA 3GZGA 2DYXA 3FZVA 2I10A 3KN3A 5HM4B 3RN8A 2V3QA 3CG1A 2UVIA 4R9GA 4BDOA 1NKXA 3OO7A 3SEXA 1JETA 3K6VA 3FJGA 1IUFA 2JMWA 5FKLA 3TKDA 2X26A 3H03A 2L9RA 4C3HJ 5KCJA 2A5TB 4A3DJ 4PP0A 1CB6A 3HO7A 3RZDJ 4RJZA 3K6XA 5KDTA 3V83A 2MW8A 2Y30A 3BTJA 3K4UA 3S9LC 5ITOA 2LKXA 3OEKA 2ESNA 3K2AA 2YPNA 1B46A 3K2DA 4LZ7A 2ZYOA 3RTWB 4JSDA 3TCHA 1B3FA 3ECRA 2MG4A 3JYRA 1UHSA 3W9WA 3EHTA 3Q25A 4YKJA 3K1MA 1MBKA 2E1SA 1LAHE 4GXAA 3MBPA 3QYTA 1UTBA 5M5XJ 2DXYA 4DYCA 1D3KA 3BR6A 1JKPC 1X58A 4X48A 1A8FA 4JWXA 3CCYA 4AYBN 2PYYA 4PFUA 1T33A 4EXKA 3PMVA 3PPRA 4FE7A 3EQ1A 3KBRA 4JYKA 5IP7J 2NVQJ 2LVSA 5CRYA 5CMKA 2NVTJ 4D7NA 1M5FA 1YCJA 2PT1A 4XTCQ 3SKPA 1LSTA 3LSPA 4OZ9A 2QCOA 3WHCA 3EN3A 2F35A 5J1YA 1AHDP 3VLVA 2ID6A 1YAEA 2QMWA 4A3CJ 1LAXA 4TLMB 1JTYA 1FQEA 4LUBA 3IJXB 2O69A 4FIMA 1B2HA 3TEDA 2DXRA 1UTHB 5JK4A 3GTOJ 3BG9A 1N7XA 3IOWA 4O3CA 3SEYA 4OFOA 4HW8A 5AA2B 4NTLA 2VD3A 5F1QA 5BUUA 1CQTA 1AH5A 4EUOA 4BDRA 3KOSA 3JRHA 1OCPA 1FTLA 3A09A 5IP9J 1NMUA 4FEBA 2M2EA 2RKMA 1B58A 4Z7EA 3C31A 4GRKA 2Z8DA 4ZE8A 2VKEA 1TWAJ 3S2DJ 3KOTA 3HOXJ 3HGGA 3ILUB 2HZKA 1IXIA 4KCDA 1B5IA 4F22A 3B6CA 2DVCA 2F6PA 3H06B 1W0TA 3FISA 3SDGA 2HOTA 3O6IA 2GBYA 4R72A 4DZPA 1BA5A 2DA7A 1TFDA 1PC3A 4C3IJ 5K2XA 5K7ZA 2EZIA 4IO4A 3TDJA 2NVYJ 1S7YA 3GTJJ 3VLWA 5F08A 9ANTA 3G3HA 5J1UA 2FYIA 3R7XA 1ZR2A 3RQTA 5FKKA 2DA5A 1R9LA 4AQ4A 3S17J 1IEJA 1ZBMA 4FCYA 1WDNA 3LSLA 4HS7A 5KZTA 2CU7A 4ZEFA 2E2JJ 1R9TJ 1NNPA 3ZQHA 4XRMA 3FVGA 3MN2A 1QJMA 4YAHX 4I76A 3ZS6A 1EZOA 3IJOB 2XPVA 1P99A 2Z8FA 1BW5A 3CVGA 4OETA 3ZOBA 2M34A 5E3LA 2EZHA 3PPOA 2DA4A 3OEMA 2XXTA 2DWJA 4ELRA 4GIZA 2DJNA 4IB2A 5I56B 4M3FA 3S1QJ 1RYXA 3UKGA 1MDP1 4ELPA 3IOVA 5F7VA 1SDXA 4H8JA 3HBLA 4I6ZA 4PQJA 5I57A 2DS9A 3IAZA 3R6UA 1LE8B 3EHUA 1NNKA 3MUQA 1JNFA 1OJLA 1RPWA 3BG3A 4IHWA 3B6TA 1Y20A 3CR9A 1ETOA 2R7ZJ 5AA2A 1B1HA 4JP0A 2O68A 3HPIA 2XXIA 2F7AA 2AHQA 4WXJA 4XICA 4ESXA 4FATA 1URDA 1RKWA 5EEAA 4EDPA 2W7YA 5M2VA 2I58A 1U9OA 3T9VA 3N5LA 4LQ5A 1X2MA 1MH3A 4RPNA 3EHSA 2VI6A 2YS9A 1Q1VA 1IZ1A 2DWHA 3KEIA 2H8RA 1URSA 4ISUA 2AL5A 4IO5A 5IAIA 2O1LA 4M3DA 1Y1WJ 1MY4A 3HHFA 1EU8A 3BQYA 4YB5A 4ND9A 2E2IJ 4F29A 1M5CA 3HGYA 4LZ5A 3PUVE 3T96B 3FASA 2Y9ZA 3ZQIA 2LFBA 3GBBA 4AUXA 1ELJA 3FK7A
chains in the Genus database with same CATH superfamily
1XGOA 1R6RA 2ELJA 3DPLC 4JVDA 1NV4A 3E5UA 5ET5A 1WVJA 5B7DA 2XX8A 2R7OA 3I53A 5DYHA 3VLUA 4CCJA 2R7TA 4BQNA 2FF4A 2HCAA 4F52A 3OENA 4IO7A 3K4KA 1WI3A 4O7IA 4KDPA 2DYSH 3HCQA 4X1DA 1BM9A 3JZJA 2OTJI 3TTMA 2AS5F 4D1QA 4Y7NJ 3O2AA 2HKOA 5CMMA 2OF7A 4CUGA 1YYVA 5K5QA 2GLOA 4P0IA 3CUOA 5KAIC 3IH2A 5EG0B 2WY8Q 2XASA 4GX3A 3HB9A 4PAIA 1B9JA 4B3XA 2K9SA 2K9QA 3OSRA 3I6VA 3DU5A 3ULQB 2X4HA 1ANFA 3K02A 1XSXA 1YOVB 3HKZN 5A5XA 1JEUA 2IJLA 3B73A 3BT9A 4L5JA 4J19A 2F97A 1X2NA 4R8HA 1Q35A 3I3VA 3JRFA 3U93A 1LEAA 2KJBA 1GDTA 3K1PA 3R61A 4OANA 5H2FC 4RDUA 4IOAF 1X19A 1J2XA 5LGTA 3KN7A 3QOEA 1EZ9A 2MSYA 1O4XA 1U2WA 3LSKA 4V2GA 3F8BA 5HS7A 4AM3A 4HE2A 1GT0C 4IF4A 2OJED 3BQZA 4II3A 1G8XA 5JHFA 3RYDA 2ISYA 2XV4S 1QUKA 1FBCA 1W5TA 3DBHB 1E2XA 3HZJA 2MH2A 4KYWA 3F8CA 1FBPA 3H6TA 1SFUA 4NHJA 3CESA 1MS7A 3M1CA 1IGNA 4IHTA 2E60A 3FIWA 1Z05A 1O3SA 2P3VA 2M7AA 3HEFA 4UV8A 5DT6A 2CV1A 1B3GA 2ZXIA 3ASOH 3KEYA 1FBGA 1PEBA 1TWYA 2VT3A 3E6DA 4ZDLA 3MKWB 3P9IA 4HAMA 1VFEA 4F3QA 1JE8A 1NFTA 3TMGA 4IJAA 3GX4X 1FRPA 1MPBA 2K40A 2FQ4A 1FEXA 2CUFA 4XONA 2NOOA 3LQQA 4XLHA 3CO6C 5FLVA 3FJMA 2CQNA 3H3UA 1NUYA 4LOCA 1FZPB 2DE2A 3V8KA 2HFHA 2ZMEC 2GXBA 2P2AA 5FO5A 3JTHA 4ON0A 4JOMA 4NNJA 3OS2A 1MRPA 2EBIA 2RN7A 4AC0A 1U5TA 1X1AA 4PETA 1EH7A 2IA4A 5FD6A 3P7IA 3Q0UA 3UORA 2D45A 2PCRA 2XXQA 4QSCA 4U7DA 2P5VA 4DYRA 4OMBA 4RAGA 2Y5LA 5H8FB 3IL2A 3QPLA 2P81A 5LGNA 4HSRA 1J75A 3QXMA 2EZKA 3K2ZA 2E71A 3CCRI 5TP9B 3TPAA 4KT5C 2VBXA 2RCAA 4MJOA 2LC2A 3R60A 2K7LA 4HV5A 3KSJA 2DMPA 4DOZA 1K9YA 4YMBA 2RC9A 3S9NC 4MO7A 3CCUI 2H1KA 3G7WA 5CC2A 2DDAA 3VYSB 3G1MA 3CMMA 3OV8A 3CMYA 1K61A 5E1XA 3BJOA 5CVIA 4BGDA 1XS5A 4FEDA 4XFEA 1WJEA 3IKTA 2R5ZA 4JK1X 2KDOA 1LFUP 2XWOA 5BWJA 1BIBA 3SXYA 3CJNA 4GF8A 4R75A 1IN6A 2DTRA 3L09A 2FNCA 3PUXE 4IVNA 2CGPA 2X7PA 3FXLA 1FC3A 2IEKA 4G68B 5CJ9A 5DW8A 1D5YA 3ML6A 4O7MA 3IFCA 2FVZA 1QA6A 5TPAA 4OVPA 3SERA 3TMOA 1SYIA 1FWZA 2I49A 5GPCA 3CF5F 4FQGA 1BC7C 1BL0A 1ATGA 4NF6B 3UIFA 1L0OC 2JJ7A 2PEXA 2W84A 5D4SA 1IG7A 4BACA 1Z7NE 3C33A 2LRDA 1Z3XA 4LG3A 3BIGA 2EQRA 5CMBA 1DP7P 3UK4A 4P3LA 1IF1A 4HX4A 5LGUA 3EYIA 5C4XJ 1QUIA 1B3LA 2OZZA 2XXRA 3MVXA 3R0JA 4P96A 2ID3A 3IB0A 5J1DA 1A6IA 4JWYA 3CO7C 1FMVA 2HXWA 5CQEA 2I6EA 4P9FA 2KIMA 4XLEA 3GO5A 3JREA 1JW5A 2WAEA 3B50A 3TDZC 2P3NA 1PUFA 2F5DA 1WJCA 4A93J 2XROA 2JQ7A 4RGUA 3PSFA 3HSRA 2KIFA 5KCJB 3ASNH 2NRAC 2OTLI 2LMDA 2ZSHB 1URGA 2V3UA 2EV6A 1OFCX 4NBQA 4P1WA 3HYIA 1I6QA 5AA1A 2QJEA 3QPSA 1IV8A 3FMQA 2NS8A 5IYCJ 4QTRA 1SW1A 4PE5B 4TQUQ 5KDTB 3Q26A 4DW6A 3ZQLA 1Q9DA 4FETA 3FIRA 2X0LA 2XRLA 4GX4A 2O84X 4A3KJ 1F4KA 2E1OA 2H6CA 2ME0A 3H0DA 1ZGAA 2O51A 3I71A 4DYQA 1TWCJ 3SFIA 1S5LC 1JUMA 2W85A 1P92A 5EG0A 1Y39A 3BCBA 3SZGA 5GTHC 1HF0A 4CYCB 1V4RA 1WH7A 2ELKA 2QVVA 4Q5TA 1O7TA 3MQ0A 5GAGJ 1B32A 1B72A 1MXYA 1RNLA 1Z7ME 4HDUA 1A36A 2BJJX 4KD5A 1J59A 3U94A 1YJWI 3V89B 4BDQA 4BHCA 4O8MA 3SYTA 5DUKA 4A6EA 2DOAA 2ANJA 3M8EA 4S0HB 5E8GA 1B6HA 1NI9A 1RZ4A 3CC4I 1UTBB 2B7EA 2HWVA 4IEJA 1T2KA 1MJAA 1P6RA 1YX3A 4GGGA 3CG3A 3T8TA 3L6HA 3LSRA 3GTKJ 3RPQA 3RYRA 1JW1A 1XGNA 2O9LA 3PIOF 2JA5J 4A3GJ 4BJ5C 5IM2A 3FVNA 1I6AA 3GMEA 3MZ8A 3NWTA 2H4IA 1EZPA 4XN0A 1TT0A 2DU9A 2GQQA 3KP6A 3DP4A 2W57A 3IB2A 5C3EJ 2W7NA 1YJ9I 1FYKA 1DPUA 3IORA 1QHGA 1SQYA 1P1OA 1NK2P 3PO3J 4KYSA 1NG6A 2VPOA 2WEFA 2MH9A 2KLOA 2L7MP 3IWFA 1RUNA 2OV7A 5EZHA 2HFBA 1X3WB 2IBDA 5AIPA 4BBRJ 4BXFA 1YI2I 4N8YA 2V79A 4AVZA 2ONSA 4OA4A 3RT8A 2HI3A 4FX0A 4WXCA 2KRCA 2XHKA 3QYEA 3IHUA 4ZZLA 3MCZA 5IPAA 1FSAA 4QRZA 3KJTA 2ZC2A 2FRHA 4LJZF 3PD9A 3MKZA 3RSNA 1NV3A 4FE4A 4HCWA 5EHSA 3Q5FA 1FQCA 2EFQA 4PDKA 2Y0MA 3LFKA 4HOBA 1AOYA 3C9HA 1A31A 2MLKA 2O61A 1GR2A 1R22A 2M0CA 3MVPA 3IRRA 2IS6A 1IDZA 3OYJA 5TP9A 2K4JA 5LOMA 3G3KA 3M9AA 1OQYA 1MMSA 4IRHA 2VASA 2D1HA 1W7PA 4IXAA 2Y9YA 4M6VA 4GWUA 4XKQA 2H27A 1ERDA 1Z7LA 5DEQA 1SD5A 4MHFA 4YKPA 1LFGA 4KQPA 4MEXF 2CW8A 1PYVA 1B4AA 1ZRFA 2PQ8A 3F11A 2FOWA 3ESWB 3GZ5A 3PMWA 2EPFA 2GA1A 1LAGE 4D9JA 1NUZA 1MM7A 4G68A 2DI3A 1S9TA 1I1GA 4L5EA 2XD3A 2DA6A 4BE2A 1FTMA 3CFLA 4NMYA 4LATA 2LTPA 3BR3A 1FJ6A 4I8CA 2OLBA 3CSGA 4NF6A 2AL4A 1ZG3A 5HOOA 4YKKA 3CD6I 2K02A 4E7HA 5F04A 3C32A 4G2ZA 4CGZA 5CPRB 5FKOA 5F1JA 2OWSA 1JVYA 1NUWA 1MXUA 3HFUA 5B70A 3AG1H 4GO1A 1MBHA 2DODA 2ZO4A 1I39A 1R71A 3BFTA 4R2BA 3E78A 2L9SA 4XLAA 2ZB9A 2KJCA 3CC7I 4RB3C 1S7OA 4O94A 1MY3A 3QIMA 1ETXA 4BLAA 3E7LA 2R5YA 4BBSJ 2ACJA 2REJA 2D1VA 4MNCA 5H8NA 2XRNA 2XWIA 3HHGA 1D1AA 5D4RA 4G8HA 3DFGA 1B3EA 4MBPA 2V1XA 5B66C 5JFRA 5JR3A 3SFZA 4DCYA 4F91B 5I3SA 3MQ9A 3LSMA 3OYIA 1FBQA 2FIEA 2HVRA 1BBYA 5M3FJ 1VQ4I 1W5SA 5EQ8A 2CMPA 2VN2A 1TW3A 2R7UA 4A5NA 2R71A 4F1VA 2DDBA 1Z7UA 3H1CA 5FHMA 1WI9A 1DGWY 2CFXA 4FAJA 2QUFA 5ILVA 1IV6A 2MA3A 5M3MJ 2L02A 5LBQA 2RF1A 4G6QA 4CYCA 2HAUA 5LFAA 4MFIA 1TWGJ 2BE5F 4OVTA 3W9VA 4C30A 4KA4A 2K27A 4E7ZA 1WSUA 1LB2A 1VQLI 2VJ5A 3FXBA 3MP1A 3MSTA 5K2YA 4HV6A 1X4PA 2QPQA 1I3QJ 2VJIA 4XRFA 4Y4RA 4Q4ZF 2JA7J 2DOEA 3FMSA 4NB5A 4F7ZA 5ESYA 1F36A 2IP2A 4QPQA 3LSGA 4MLOA 3S3OA 5DEXA 2AQEA 1GTKA 2FA5A 1XN7A 1BLFA 3NOHA 1UJ8A 3S1MJ 3TW7A 1OVBA 3PUWE 1ZREA 1XC5A 2WB1A 3O97A 4OENA 4R6KA 4YIIA 3HTSB 4B43A 2UZKA 1O64A 2OC6A 3RPLA 5F6FA 2XAGA 3WAFA 2OZUA 1L5TA 3QU3A 3T0JA 4PCQA 2Y7KA 1PB9A 2R7XA 1MPCA 1IUDA 4ZZAA 3ZN0A 1BI2A 3CFZA 2HXOA 3JRGA 2QBYA 1KA1A 2F4MB 3U1DA 2PX1A 1T0FA 5AA4A 3F8FA 3DTKA 3MPLA 2Z33A 3WGGA 1AL3A 5ITPA 5GAEJ 3FHZA 4KIFA 1P2FA 1FW0A 4N91A 1VQNI 4FECA 1XS9A 4F3BA 1A5JA 2LY9A 4UV9A 3PGFA 4P1EA 4Z2YA 2QVUA 1ZLJA 2VHAA 1HLVA 1Y9UA 5HLHA 3N6TA 5LD2C 2Y5KA 1S6LA 5ILSA 1BI0A 5LEKA 2X6OA 5CKTA 2CYYA 3C18A 5DS9A 1W1WE 1K6OA 2K9MA 3CLOA 2DFHA 3TW6A 1MY2A 1IXGA 1OLCA 2XX7A 2R6GE 4ENJA 1AOVA 2IS2A 3TQLA 1HA8A 3S16J 2HZDA 1SI1A 5JVTA 4XKRA 4P5OA 1HDDC 4ZEKA 1DTZA 4KYDA 1LPQA 4LP2B 5H8HA 1MNEA 3E4RA 3DBRB 2DK5A 3IKVA 3VPRA 3PJRA 4LQ2A 3TODA 3TELA 2L2OA 3WG9A 3L2WA 3HXLA 1LFHA 3K7AJ 1QVUA 4XLCA 3JTGA 4RBOA 4A3FJ 3T9UA 1Y3NA 5I57B 1B1BA 5L9OA 1G0HA 2PT2A 2DPDA 2MBFA 2YU9J 3HIFA 2HTSA 2Q1ZB 3ISPA 1S8NA 1J5YA 1JHHA 5CVRA 1A04A 3RJPA 4J00A 1N84A 2O7UA 1RR7A 3FXRA 1US4A 2Z22A 3PTYA 4U2RA 2R7RA 3TUSA 1ZGWA 4EVIA 4NEDA 1IDYA 4UVCA 4HRIA 4XKPA 2XXWA 4RGRA 2FD5A 1Z67A 3DV8A 3G3JA 3OYGA 3JSOA 3HOUJ 3QUFA 1B0LA 4IY5A 3MD2A 4DDDA 3OIOA 1W5CC 2QKMB 3RCOA 3TO7A 2QA4I 3U8QA 3DM0A 4I1DA 4LA9A 1EYKA 3TOAA 4LIVA 4X6AJ 1B7UA 1DPPA 1KA8A 1R1NA 3IL1B 4XEQA 5I7IA 4PJLA 2IAIA 2R92J 3S3NA 4FT8A 1O3TA 2H99A 4XL9A 1JP4A 1D9VA 2XAJA 3IWZA 1QKBA 1Y4TA 3V7RA 1F9NA 2LYCA 5L3DA 2M0MA 2VOZA 3G1OA 3PQJA 4HF1A 1X3UA 1ZLQA 1Z0XA 2XVCA 2V93A 3TTLA 4H1XA 4BEHB 5DD8A 1KU9A 2WYPA 1ETQA 1K6YA 1ITYA 1JKOC 2CZHA 5F0CA 4KIGA 2HHMA 1XSVA 1FQBA 2QS4A 4NF0A 4M3EA 4GXSB 2V9KA 2VP1A 3KX2A 1K83J 3R0AA 4GYIA 2X6XA 1KA0A 1KZHA 3ZMUA 1ETWA 2OD5A 2LD5A 1IXCA 1OQGA 2VONA 2NXOA 2FBHA 1J09A 1OCZH 2MC3A 1TT1A 1ACIA 4KPTA 3PNTA 3Q9SA 2F34A 1B8IA 3MJNA 3CUQB 4EM2A 1MQHA 2XAFA 2PMZN 1LVAA 4LD5A 3MKYB 4X1BA 2R4GA 4GD5A 2JSPA 2QL3A 4L9NA 3T9HB 3HJEA 3TP3A 3TO6A 1POGA 2HR3A 2E36A 4HLYA 1ORKA 2LDUA 2XXHA 3M3KA 1Z77A 2XGCA 4R2FA 2NOGA 4KICA 4EMSA 3MWMA 4NF4B 3WAEA 1EYJA 1GV2A 1A8EA 1MXXA 1HSTA 4K3FA 3KEOA 3VVFA 2Q89A 1QO0D 1IMAA 2DE3A 4HG2A 2UVJA 2RC7A 4PFYA 3QP6A 4AYBA 1D0XA 4UVAA 3J7ZI 4MQ9F 3IX1A 4L18B 2E7XA 2DA2A 2EINH 2LY2A 3FX3A 2BYVE 2XIGA 1IXHA 1KWHA 1TW2A 1JKRC 2O03A 2AO9A 3A3CA 3ZQ7A 3H9GA 2ZCWA 1G3YA 3RLFE 4D0PA 1IUYA 5HVQC 1MSFC 4E7KA 1OLTA 3USDA 3EQLF 4A12A 1UZCA 5DVIA 4QHQA 4GLIA 4BDNA 2QFLA 2RNJA 4LZ8A 2XHDA 1XGMA 1YTVA 4DZJA 3IK6B 3Q29A 3H92A 4PFWA 1LBVA 2P1SA 1MBGA 4UUVA 3ZKLA 5AE4A 3GBGA 1AWCA 1RR8C 1B3HA 3BR0A 3GFLA 3SESA 3WTZA 2I3VA 2I0CA 4IOCF 2Y7IA 5ET6A 5A5XB 1IMFA 1Y1ZA 5K5RA 5EYRA 1U9NA 2OBPA 4UA8A 1HCRA 2O8KA 5HNHA 2KQRA 2JA2A 3VSLA 4BJTA 3AAFA 2EFWA 1R00A 1R36A 4PK4A 5TRDA 2W48A 3SEUA 1LFBA 1BJZA 1YG2A 4RGSA 5L9SA 1XMAA 2HS5A 1QZYA 1UMQA 3K69A 3OL3A 3B6WA 3S9MC 1H76A 4I99C 2KKOA 3IAS2 1NV7A 2B65A 3FV2A 3FK6A 3ZPLA 4OYVA 4XRSG 2H6BA 1FSHA 1ETVA 3QYBA 3A2KA 3OSFA 3JRDA 2F7CA 2H1LA 2QYOA 4OWDA 4B48A 4GWXA 3FWEA 3H5NA 4EJOA 3ZXSA 3AG3H 1KGSA 5JLWA 1HSEA 1NNTA 3I4MJ 4NWCA 5GP9A 3OS0A 3GXOA 1LGBC 4EF2A 3M8JA 4HF2A 4EM0B 2OZ6A 3P9KA 4R9FA 3BOQA 3RQIA 2IGOA 1S50A 2PVUA 1XCVA 3E5XA 3RQ4A 3K70D 3IC7A 2GRVA 2NVXJ 3LL7A 1XGSA 2QMXA 1IN5A 3DLNA 3E9XA 3BJ6A 2FMLA 2E0SA 3OO6A 5DTBA 3OSQA 5JTYB 2Y7RA 4OHNA 3WGHA 2K5CA 1FTAA 4UY8I 2CW0F 1U5TB 5D8LB 2JA8J 3KETA 2V6CA 3FMRA 3ZRGA 3QQAA 2O6GE 2I4CA 5EYFA 4OAZA 3SETA 1ZAOA 5TU0A 5D8KB 3P9CA 3I54A 3OXNA 3LAPA 3GFJA 1BR2A 5I2KB 4RGXA 4E7LA 3GYHX 3SEVA 3PMXA 4IO6A 5H8QA 5B5EC 3DP6A 3BTLA 4RA2A 2CFOA 2VKHA 3LOCA 2VIXA 3GW2A 4OVSA 2BBYA 4GL8A 1CE2A 5L8DA 1QRYA 2DMUA 4DBQA 1MXZA 2ZFUA 1TL8A 2COMA 4S04A 5BOXA 2DPUA 3L9FA 2R5ZB 3AL0C 3HRTA 3PIPF 4F31B 4DQ2A 4BAYA 4U7BA 2WV1A 2PX9A 4HEA2 3SDBA 1XVXA 2JRMA 1VSOA 4JBAA 2OJTA 3S9EA 2DT6A 4PJMA 4PCDA 3CDLA 1H8AC 4RY1A 1BI1A 4ZEDA 1FPKA 1XCBA 4XQFA 3BZCA 4N4OB 2P6SA 5LEJA 4YRVA 4WEDA 4NGUA 1H9GA 5FROA 3CCVI 2O0YA 2VPNA 3PV0E 5TPAB 1JGSA 2QENA 3TFLA 5K1YA 3VDFA 1OMPA 2KHMA 1NH7A 4ELOA 1Q1HA 3V8JA 4GWWA 4ELQA 4M3GA 3K70C 1JVXA 2Q88A 3D0SA 4F19A 1OMIA 2O6AA 3G3GA 5I2NA 2W25A 3EUHC 3O3KA 1DP3A 4MQVA 5A2QK 4LONB 4N6DA 3S4UA 2H25A 3F8NA 5B1BH 1MH4A 4NF4A 1N78A 2XXXA 4L9JA 4NQWA 1II5A 2ZNUA 3RTRA 3MP6A 1YXIA 1FPLA 1SW2A 4HX8A 2ETHA 3PPQA 4NE4A 2UXNA 4U0VA 4O3BA 3PM1A 2F78A 3KZGA 1RRJA 1PUFB 4JWOA 3PUZE 2A6TA 3GTMJ 4OIOF 3BY6A 1UFMA 2A3SA 1JQFA 2XXUA 3U65A 1QPIA 3WTUC 2RV8A 1YRNA 4L0YB 2VBWA 4G7ZF 1B40A 2LAOA 5C44J 1BP5A 3KP3A 2QWWA 2I48A 2ZNTA 4KUMA 4YIRX 3KLOA 2PBWA 3WTYC 3CIJA 4NC6A 3THIA 1SMYF 1UIUA 2BOLA 3E6BA 3ZMDA 3FV1A 2WBDA 3RPWA 3N97A 4L17A 3HDDA 2Y75A 1FQFA 4PDDA 3LBSA 4ETSA 4ZYEA 1SW4A 4PFTA 3K4LA 2PI0A 3F23A 2HPIA 4A3LJ 4OWRB 1SYHA 2GAUA 5FB2A 2DE4A 2GQ1A 3F0CA 1DSNA 3OY9A 2ZYNA 3AXFA 4GFBA 4PF6A 4R1HA 3SEWA 1B72B 3WTXC 5J3LA 2F3DA 4M74A 2HDWA 2OWTA 1A6QA 3CCSI 1KU7A 4M1VA 1BR4A 2R93J 4POWA 1KZ8A 3MC2A 5AA3A 3S1NJ 1Y1VJ 5L3EA 3M3YJ 3DBLB 1UQWA 3TYHA 5GPAA 5IY5H 2F4IA 1RKTA 2L7FP 3ZQQA 4H0EA 3FD3A 4ZYHA 3ZQCA 2XWVA 1FPQA 4HBLA 4Y17A 2PFYA 5AA2D 4KXPA 3RT6B 2X1CA 1E0EA 1WWXA 5DYMA 3VYTB 1H88C 1FSEA 1Y8RB 3F21A 1DDNA 3K9TA 2XSJC 4RPOA 2QS2A 4PC9A 1XPXA 3O9PA 4BDLA 4IZZA 3TTNA 2EILH 3ZQFA 3BFUA 3KYDB 2QQBA 4AIJA 1Z1DA 5KVRA 1HSLA 2ESHA 3N26A 3L6GA 4WEPA 1P4AA 2DT7B 4UVBA 4BL0B 1U8BA 4IRIA 5ET8A 1FBSA 2QF7A 2OCUA 4XKNA 5JTYA 4YMAA 1V5FA 1UHMA 1Z21A 2Q0OA 4A3MJ 1EH6A 3OD7A 1FPIA 4U23A 1ZTRA 5IYDJ 2LREA 2X6WA 2XAUA 2VPRA 2HEOA 3U92A 1YW7A 4AB5A 2M9HA 2WTEA 2HVSA 4RAZA 1LBZA 2Y7PA 3VV5A 2BV6A 2DMQA 3L2CA 4ENKA 1PB8A 3H6UA 5I2KA 4A0YA 3H35A 1SW5A 3FVOA 1I6BA 3LAJA 2HXRA 5CVUA 4F18A 1TQIA 1FT9A 1USTA 2BJIA 4KCCA 3VE1B 1REPC 5F27A 3CI8A 3I3LA 1W7PB 1ZARA 3EYYA 2M4KA 3CCJI 3Q3SA 1SFXA 2HZLA 2F6CA 2XSDC 4F3SA 4NG7A 3S93A 4F1YA 1DUXC 1MMNA 3DLAA 4CH7A 4B09A 4G12A 1NL5A 1JUPA 4FBPA 2RC4A 2XF5A 1JT6A 4V2FA 1PP8F 3TTKA 1A7LA 2L4MA 1VQKI 1S9HA 3AKZA 2ZZWA 1IQ7A 4ZEIA 1WVRA 3CCLI 3LQRA 2EJRA 5EDNA 4RXLA 2GA2A 1B4ZA 3KC1A 2RREA 3U1KA 3M07A 1MG1A 4X0GA 5ET7A 2E1MC 2E5ZA 1WJAA 3OYHA 2XX9A 3HSTA 2V7FA 2X6YA 5FLXK 4KT6A 3I5OA 4F39A 1Y0NA 1K78A 5HS8A 3OYMA 1DBZA 2D21A 4WK8F 2LR8A 3O8HA 4HW0A 4QFLA 2VOOA 4NDLA 1BJAA 1DCUA 2A61A 1KQ0A 2E5NA 3RDIA 4GRIA 5EEGA 2BVMA 4LB6B 1FQDA 3EKIA 1VE4A 1G3TA 3ABTA 4QSHA 3BG5A 2ISZA 4ABZA 4P11A 4E4HA 1YTYA 2HOSA 2IRFG 3QK6A 1G6NA 2P8TA 5J6XA 1SVXB 1VTNC 1LBXA 3TEPA 4AD9A 3C36A 3V7SA 2R5YB 4FTHA 4GVOA 5C4JJ 4MAGA 5H8NB 3LNQA 1P1QA 1XOCA 5CMCA 4PFRA 4HTGA 1EJ9A 2HYJA 3QU6A 4XOPA 4OIQF 2DDKA 2J5PA 1XB4A 4LITA 2GIVA 3KE2A 4OU0A 3W6JB 4BKXA 5E3NA 3SJMA 1T08B 2IA1A 2VD2A 3DP8A 3ZSFA 5JEIA 2XXKA 3HKZA 3ONMA 2H94A 3WHBA 3ZR8X 3QSLA 4RNSA 2M4GA 1IRZA 3KPHA 2ZBKA 4CA0A 1WH5A 3RY3A 3PNVA 3GTGJ 3CUQC 4YEJA 4H6DA 1SVOA 1VF9A 2LF8A 3M7GA 3K00A 1I3AA 3B6AA 4BY1J 2M1BA 3HRUA 2MKZA 3W2WA 1DTGA 5CI5A 3FKIJ 2L7ZA 5I59B 3FXJA 5I5PA 1YHQI 4GX6A 1B6AA 1T6SA 3NWSA 4YFKF 1WRJA 2NNYA 3TOBA 4DZ1A 3J7AY 1A35A 3W15C 4I7HA 2REGA 4O3AA 3OYEA 1VFCA 1N3WA 4IQ4A 4G61A 1YLFA 5KNLA 3UA8A 3CRBA 3H3ZA 2JZYA 1XMKA 2Z1DA 1AKHA 5CM6A 4U88A 2GOXB 3OOUA 2CQQA 3ZN1A 3ZMTA 2D5VA 1UG0A 1SD3A 5FD5A 4ESWA 3TZAA 1IRFA 3FXKA 2DVZA 5DEXB 2DT5A 3Q0WA 1FBHA 4QSDA 1YW8A 5CBSA 3A01A 4H65A 4KMFA 2V3TA 1RI7A 1YZ0A 2M7BA 5ICQA 4CCNA 3F6OA 1KQ9A 1TWHJ 1DPRA 1LB8A 2GWRA 4HNUA 1IITA 1FPBA 3HOYJ 3GXAA 4A0XA 1RUOA 2KR0A 3RPLB 2FMYA 1USYE 1FTKA 3EETA 1LCFA 4ONYA 2FUG2 3HUGA 5HNFA 4PGPA 4PAFA 3GF2A 1LQ1A 3HPGA 3BC8A 3WU0A 2QBYB 3MW0A 2KISA 4MLVA 2NS0A 3F72A 3NRVA 2Z9OA 2IGKA 4ZDMA 5AA4B 5HPQA 1QUJA 3TAJA 4JXIA 4MNIA 3V4GA 4N4NB 5BQTA 1F9BA 4KYEA 2G29A 1UELB 3TL4X 3UP9A 2CSOA 2ECBA 2B4LA 2FIXA 2IPQX 1N75A 4CCOA 3OS1A 4IX7A 4H5GA 3MWBA 3ZMSA 3ODBA 2W00A 2QS1A 2F8DA 2DYRH 3KEQA 2KQZA 2NOJB 2Z16A 1R5HA 2Z23A 3V8LA 1S7EA 1M5DA 2GFEA 4EQ9A 4EATA 4UUSA 3S14J 3G3FA 1TBXA 2ZKZA 3W2VA 3K6GA 5I84A 4HE0A 3TTRA 2EA2A 3H3VK 3L00A 5KAFC 3LSIA 3DEWA 4MGRA 2O8XA 5EJCA 2O7OA 1LAFE 4N15A 1P7IA 2BEOA 3J81K 5GAHJ 5H8HB 3T66A 3ZMZA 1XVYA 4PSXA 1R5ID 1K7AA 4EJTA 3IO4A 5DM6F 2CQXA 3BG6A 4EEFG 5L9MA 3E6MA 3GZNB 4RB2C 4WKMA 4EQQA 4OFLA 4C0RA 1MM6A 3E0JB 1KYZA 2K3FA 5M5YJ 3BBRA 1FPGA 2DMTA 5IYBJ 2NWJA 2X48A 1WZ2A 1IIWA 2P5KA 3JW4A 3I5UA 1IC8A 4KITB 4CO8A 3K10A 3CMEI 3IH3A 4I62A 1HSJA 3PU5A 1XX5A 2DK8A 2BY1A 1X1CA 1JT0A 1I1SA 4PE3A 1D8KA 4MTEA 1I6HJ 3JRCA 3JR9A 3EUAA 2CS3A 1SEUA 2RQQA 4QPOA 4XBFA 3OO8A 4IY6A 4RB1A 3RIRA 1VQ5I 3IFAA 4XXUA 5B1AH 4HQMA 4ZZDA 1TXFA 1R4MB 2FU4A 4X1EA 2OPTA 3ERED 2YU3A 3M4OJ 4YFNF 1D5VA 2UVHA 4XNFA 4KFQA 4P0GA 1V55H 3ZMVA 5IZZA 2I3WA 4ZYGA 2Q2AA 2FE3A 4Z6YA 1LLSA 2L3DA 2DTZA 3CTAA 2HQRA 4QLCU 1DOTA 2THIA 4GXOA 1D4NA 1QZZA 2Y2ZA 3VODA 1GVDA 4GOTA 1XI6A 5FBPA 1H44A 2DQVA 4F3GA 3L2VA 1E3PA 3I9V2 1YFHA 1DU0A 4EQBA 1ZJLA 4H5FA 4OEUA 2TRTA 2BW3A 3GLLA 2LLKA 1OCRH 2WYKA 4M73A 2J5OA 2KP6A 2WAQA 3CCMI 1H0MA 1FTZA 4UXNA 1KU3A 2XXPA 3M8UA 5EQ9A 5J1RA 3R6SA 3KCCA 1SANA 1OYYA 2CG4A 2VE8A 5KCMA 2LOOA 4BE0A 1MSEC 2HEUA 2M3AA 4ENNA 1D9YA 1UIVA 3Q9VA 1IRXA 3G2BA 3R26A 1CNQA 2QSXA 1B8IB 1P4WA 2P0SA 2HYFA 4NQ8A 4N13A 5FFXA 5J8CA 2ZNZA 4PFIA 4RK2A 1WJDA 4XR6A 1WHUA 5I59A 1FBEA 4GFRA 3RKQA 3WE2A 1XHYA 2YR2A 1ZG1A 2UXXA 2ADUA 1OKRA 3C1DA 4OIPF 3JRAA 3D1RA 4S05A 3MZ9A 3BTCA 3DKWA 3PO2J 1Y3QA 3O6BB 4YB7A 5K7FA 4H46A 5LDZA 2JA6J 3WTVC 2DQLA 1I27A 2VC1A 3FM5A 5JLXA 3E97A 3KP5A 4P55A 1GLNA 4P47A 5DUIA 4Y15A 3MAJA 2ZYMA 3WTTC 4BXXJ 1JW4A 3EPEA 2L01A 3B7DA 4ASNA 2VODA 1ZRCA 1DGRM 1R4NB 5M5WJ 4RK9A 5ICFA 2ZYKA 2DXIA 3RYPA 1TZLA 3CZ6A 4G7OF 5IKBA 3JCUC 5AONA 3RI4A 1GGGA 2X1DA 4LGWA 4C9YA 1GHCA 1VQPI 5J8FA 4XIDA 3RKWA 4OTEA 3FXQA 3GYYA 3U2RA 4LB5A 3F9KA 1SI0A 3C34A 2E19A 2LK2A 1XDUA 2FEZA 5J4YA 2VE9A 3QUJA 3EPZA 2UYEA 4WWCA 3VFJA 4EV0A 4BDYA 2A5SA 1CGPA 3RKYA 1RDZA 4ECFA 1A54A 2MYSA 3H5RA 1I69A 4BUPA 4EGZA 3MMYB 4Q8RA 2UV1A 1MY1A 3O28A 2VXZA 3S15J 5LRSA 4GBWA 2M30A 2QVOA 1RYOA 1YPNA 3IOTA 4AIDA 1O7LA 3QRFF 1ON1A 2WV0A 3LC8A 2P6TA 4UB8C 2EB7A 5DTDA 3LWFA 3FBNB 2KLFA 3HV1A 1SAXA 4N07A 2HDDA 3W6VA 6PAXA 2FOKA 1ENHA 1SFOJ 2GH9A 4M9XA 3A02A 4NF8A 4EM1A 2G0EA 4OVRA 3O29A 4MNUA 1HKTA 5EHMA 3DPTA 3BZ6A 1ZELA 1W7PD 2EZLA 4DBRA 1AMFA 3LSWA 4AIKA 4E0WA 1ONVA 3OR2C 2XAQA 3TCGA 5H6QA 4UACA 1VDWA 3NARA 4MEYF 1WCMJ 1BOAA 2Y7WA 3CSBA 3I59A 4R74A 4JVCA 1WJBA 3K4NA 1FPDA 4F92B 1DQUA 2PBIA 5EYGA 2BY3A 2DP8A 2E2HJ 3CFXA 4G6DA 3CC2I 4IHXA 4ZEBA 1MNMC 3TQWA 4OVQA 3K0VA 1YIJI 1U0JA 1AIVA 3S2HJ 2CEYA 2QQAA 3KZIC 2MABA 4Y33A 3CLQA 4ZTFA 1X1PA 5I58A 1N7WA 4DNCA 3VEPA 4AWXB 1MQJA 5IZ1A 3T22A 3M3FA 3V42A 2HZTA 4G77A 2Q8JA 1INPA 2L4AA 2HXIA 2HQ0A 2PMSA 3C2BA 4EQ7A 2XB5A 3ROUA 1MY0A 4EGYA 2FBKA 1CF7A 4I2OA 2HOEA 3S2WA 1V5EA 2H9BA 3VFZA 3SHFA 4UABA 3FJ7A 2LBFA 3TO9A 3IV5A 3OMBA 4OEVA 3HC7A 1Z6RA 4B4CA 4U1OA 1TP4A 4ZYDA 5D5WB 2Q9TA 3DCFA 3DPUA 3G4SI 1Q1KA 4GWYA 2R7WA 3OL4A 3LSFB 4XRSA 4G4PA 3KP7A 2F7BA 1B0HA 2TDXA 2XD2A 2BY0A 4B3AA 2ZNYA 4E7JA 1IMCA 4CXFA 5B3SH 4QFKA 2JPBA 5H8QB 4OQOA 4F2OA 4ZJZA 3HN0A 4A69C 2OWZA 1F1ZA 2ZNSA 4C1TA 2P7CB 5LLQA 4GBVA 2ICWG 2L5VA 4N6KA 1US5A 2QQ9A 4NF5A 2Y69H 3KG2A 4Y3OA 1ON2A 5EGOA 3VXBA 4LLNA 4FISA 3LA7A 3BCAA 1D0YA 4JX4A 1P1NA 3WTSC 2ONRA 2VC0A 1HOMA 3V8XB 2JUCA 4OERA 4BNCA 1F5TA 4H8IA 1D1CA 3FBPA 4Z0IA 2DBBA 2OX3A 3ECOA 2DFFA 1IXSB 4KMUX 3I4NJ 3O6GA 4JB7A 2KFDA 4DI3D 4BDZA 4POXA 4G68C 4H45A 4MH5A 3DELB 1FJ9A 2KIQA 2M45A 4HYEA 1BIAA 2QLZA 3EUHA 4ZTJA 1K4SA 1JGGA 3B8BA 4UB6C 3J7YJ 5HODA 2DA1A 4LG0A 2XGXA 3BTIA 4HPQA 3C3WA 2EK5A 3IH4A 3K4BA 3NAUA 4YICA 5I2NB 5DCMB 1MW7A 3U1OA 2Y0SN 5E1ZB 1BIYA 1P1UA 1AU7A 4R79A 1SFEA 1VNDA 4KI0E 5BNGA 1SFKA 4O5VA 1FTTA 2PJRA 1FIPA 4NQWB 2L9VA 3MZHA 2XXYA 1RDXA 3RKXA 3EF7A 3KFMA 3PSIA 4W1UA 4HCYA 1MZBA 2Z99A 2A5TA 5ELVA 4DCXA 1SD4A 3MP8A 2MD5A 4P9UA 2NNNA 2MFZA 1ZRDA 1B4HA 1JEVA 4MTDA 3TP0A 4HXVA 2K9NA 2HGCA 3MPKA 2LNBA 1MQDA 4MIJA 1R58A 2W82A 1P4XA 1UG2A 4N0BA 4PJNA 4RLFA 3QAHA 4BU2A 1YRNB 1EH3A 4IGTA 5IZ3B 4F2QA 3V5AA 1SVLA 1TC3C 1VQOI 1W4MA 3LR1A 4JVIA 4C1UA 3KN8A 2ALUA 1STZA 5DCFA 1ZK8A 1PDNC 1VQ8I 1G3WA 2IEEA 3ZCOA 4IO2A 1EKEA 4XKCA 3JRIA 1K4TA 1O63A 4PGNA 3A4CA 4IHSA 3DTEA 2R9JA 3G3IA 2EIKH 5L3BA 4XK4A 3RPUA 2VKDA 1VQ6I 3DU6A 2Q2CA 3N6UA 1FTJA 2ZJQF 3BR5A 5IT9K 3U72A 1ETKA 1LDKB 2DOFA 2ZXTA 1QVTA 4FASD 3VWBA 3GUDA 4RM2A 4THIA 2GZWA 1OCCH 2EH3A 2JVHA 2B3FA 3BKIB 4GCVA 4QFOA 1DMBA 3KSXA 3H9JA 1JJ8C 1MMGA 2AIXA 1V54H 5EF6A 2WC2A 5H8SA 1KU2A 4I98B 3CP2A 4ZS9A 2M8EA 1IJWC 4EF1A 4AIHA 4D5CA 2B63J 2QSHX 3GCMA 5ICEA 2G7UA 2V9VA 4C2TA 4IQJA 1JI8A 4WXHA 1MDMA 4LK0F 3K01A 1MXWA 5F0HA 1FTOA 4I09A 1LVKA 4PFOA 5E20A 1USYH 4II2A 5FHOA 3SDFA 4DLDA 4G9YA 2A5YB 3QODA 3KP4A 2OQRA 2R0QC 2XF6A 3BR1A 2ZMEA 1T95A 2XA5A 3LSXA 4TOZA 2FQ3A 2RAEA 2JK3A 3BPXA 5DVFA 4ZZEA 3RNNA 2M8GX 4KNYA 2A68F 4BH9A 4IHYA 4ESBA 2P5LC 3VSKA 3OIQA 1T0FC 4NUBA 1LUJB 1LBBA 1F43A 4NN3A 2N8GA 3TDUC 1TWFJ 2VGQA 2F36A 3M8FA 3SQNA 2VBZA 3JRBA 2VJJA 5FRNA 1GUUA 3E3KA 5E1WA 3O66A 2EA4A 5K5OA 4F3PA 5HBCA 3U9GA 2YUSA 4A3EJ 1LEBA 3ZP5A 5FLMJ 2I4BA 4YZZA 1U6GA 2ZJ2A 4M4GA 1B05A 1LNWA 2EV5A 2R7FA 4MF3A 2E1NA 4HNTA 5BMZA 5D5UB 1U3EM 2GIZA 5D6EA 4A3IJ 1LDDA 4LMYA 1Z6TA 1B52A 5FHNA 3C4MA 1NNFA 4R6YA 3ROJA 4BS9A 3L2UA 1OCTC 1DU6A 2XPUA 1UCRA 2YX7A 5ED4A 4X04A 1UTHA 4RAYA 2PMZA 4IO3A 2AXLA 1BC8C 4IGRA 1W36D 4U4XA 1I50J 3CP8A 2XPWA 1O7FA 2EIMH 3F3XA 3PUFA 4C2UA 3OYBA 5FJ8J 1MDQA 4D7MA 2E7WA 4UUTA 3DLLF 3MZ1A 1APLC 5E8IA 3CDHA 3GTQJ 2Z8EA 3OELA 2ZXJA 2CMOA 4Q30B 3HG9A 2GXAA 1J7KA 2MLGA 4Y52J 5CQGA 1SPIA 1GV8A 3SEQA 1EH8A 2XDVA 1VI0A 1HW1A 2FX0A 4L0ZB 4HF0A 1E17A 1OR7C 5CYVA 5FFZA 1I6XA 3K1NA 3S8PA 1T38A 3HOVJ 1B7HA 2ECCA 1ZKGA 3LA3A 2XF7A 3X2QH 3S1RJ 2LP0A 2D3IA 5FKMA 4QIWN 5F0FA 1K78B 2A6EF 3MZYA 4DI4B 3LUYA 3FDYA 2H5YA 5DCMA 5JHUA 5FTIA 5EQAA 1LFIA 4RYAA 4XMYA 1QW0A 3QYTA 5F64A 5K7HA 1YS7A 1OLAA 5J4VA 3Q28A 3FUZA 1HKQA 3IB1A 3KJ7A 2HNHA 1HC8A 3VVDA 3VXCA 1MKMA 2DWIA 1YITI 3I0TA 3H7MA 3BR2A 2QS3A 3MEXA 3BP8A 4RM3A 2D5WA 5H6RA 2OK2A 3MVWA 1ZHFA 4BXUA 3A03A 1NV0A 5CBRA 3Q27A 3SEZA 5BS6A 1IW7F 3OR1C 4OMYA 4R73A 1USSA 2CZIA 3IR1A 4PZJA 1MBFA 5IZ3A 3AFHA 2IS4A 2F5XA 3F22A 2DOJA 1ZMGA 3TCFA 2DA3A 1Y1MA 3RZOJ 2KDZA 1XC1A 1FJLA 1ZLKA 1NK3P 3KGCA 4OVJA 2NUVA 2WKYA 5IP6A 2VB6A 3HL2A 5FTHA 1H9TA 2DSFA 3H3GA 3OOAA 2A6HF 3D4CA 2DW4A 3CJTB 3LSHA 2GHAA 4P9KA 2LSOA 4N81A 4NC7A 3H0GJ 3D4GA 1U78A 1BI3A 2FJ1A 4FHTA 3OYNA 4PFPA 1M5BA 1PB7A 1LEVA 3CHGA 4AU7A 4U22A 2KRFA 1IO2A 2F48A 2XAHA 4HNVA 4B47A 3VOEA 4DIGA 1WQ2A 2M5WA 2ZMBA 4YIFA 3FVKA 3PPPA 1YS6A 4L9VA 1AKHB 2H98A 2V84A 2X7QA 2ABHA 2IA0A 4IO9F 4BE1A 3LUZA 4DE8A 2NAZA 3U21A 1VZ0A 3UN6A 4OXVA 3A01B 3H4ZA 2G9WA 2JT1A 5ICTA 4A6DA 2EFNA 3J7AO 1O3QA 3HM5A 5T3JA 4QBAA 4IHVA 4DXCA 1MPDA 3B02A 2EFOA 4PUSA 4Q48A 1ZR4A 4WCGA 2RKHA 3FXUA 4QF9A 4GDFA 4JSOA 2PMUA 2I5UA 1Y8QB 4XLPF 3HUGB 1R6ZA 5F24A 3IOUA 5HDNA 3ZQGA 4TV7A 1UAAA 1IN4A 3CQZJ 2UVGA 1OIBA 2CUEA 2RC8A 4CDGA 1SVMA 4RAFA 3K6UA 4LVQA 1GVCA 3PD8A 1DPEA 5EZGA 3W6KB 1B51A 1PBPA 4QXDA 1C0WA 1D1BA 4CCMA 1TNTA 1FOXA 2VL8A 1JTXA 3ABUA 3HRMA 3DEEA 3QPTA 1QNTA 1RKMA 2O7IA 3PUYE 4U1ZA 2VKVA 2I0BA 1WGXA 3E1SA 3PPNA 1QGPA 2QRYA 5I56A 2AXTC 1POTA 1MMDA 1YIOA 2KT0A 2HYGD 4LK1F 5KHDA 3QYFA 4UUSB 4C3JJ 1FYMA 4NAPA 4Q0CA 3ERMA 2O1MA 2HU9A 3LFUA 1H45A 2M8CA 4A3JJ 3W2AA 1IN8A 1QU3A 2NS7A 5FKNA 1J1NA 3C2HA 4M3BA 2F3BA 2F6GA 3O2PE 5L3FA 2W1OA 3OMYA 1JUSA 2OBGA 2WBBA 4JBZA 4QSEA 5ISUA 4BY7J 4D5FA 1LE8A 1PBQA 4XF5A 5F1RA 3I55I 2Y31A 3FGSA 5ICCA 2A69F 1Y56A 3H6WA 1ETYA 4FORA 4AVPA 3C2GA 1PDAA 3A29A 1T98A 4ZE9A 2JRTA 4QWQA 4JX5A 2JUGA 2R3SA 1NV1A 3GTLJ 4H0WA 2CQ7A 3DKXA 1QBJA 1OYIA 3K6WA 3DKYA 5A2QZ 3N4MA 3PNYA 1ZG5A 4H67A 4E0XA 1FY7A 1NHAA 4UNOA 3AG2H 4PFBA 3KIOA 1HW2A 3GTPJ 2Q8MA 1O57A 2DCEA 4ZDOA 4B44A 2OUMA 1PJRA 3G3ZA 4GWOA 2JN6A 3EDPA 3IO6A 3LV0A 5IGAA 3WG7H 2LF7A 4X8RA 2DO7A 4R6HA 4J01A 4N8GA 4GQOA 4JQFA 2VPLA 1SBPA 1WODA 1RESA 2V1DA 2K86A 3C7JA 1N04A 2O3FA 3LMMA 5E3MA 1QVSA 2FBIA 3A0HC 2HQ5A 4MFEA 3MVYA 2QGUA 4UHTA 5CLSA 2CJJA 2IS1A 2OAZA 3P7NA 2B3BA 2RINA 3D1NI 3OIPA 1FQAA 2ME6A 5EEHA 4QFPA 4BHPA 3BJAA 2OA4A 2UYFA 4PBQA 1HBXG 1B7ZA 3G1LA 3PFYA 1E3OC 3CF2A 1VQMI 2UWMA 4YU0A 2XB0X 1LKXA 4GWZA 1HW5A 1MBJA 4OESA 4ITVA 4LN5A 4MIMA 4U21A 2CZLA 3E13X 3Q0VA 1O3RA 4B8XA 1R23A 2BW3B 2QKLB 3K4MA 1N3XA 2LY1A 5E3OA 3T8RA 5J47A 4KR5A 4N9IA 4CYDA 4F93B 2UUZA 2BXYA 2A05A 3HTUA 3LSJA 4M9SA 4XKBA 1MXVA 1OVTA 1AA7A 1MJBA 3D5LA 4C2MJ 1JHFA 3MYUA 1UB9A 3LSTA 1H3DA 4M6XA 1Y3PA 1MQGA 5EQ7A 2DFIA 2IT0A 1LBYA 1FPEA 2FBPA 3K4JA 1R1VA 1ZGJA 3MKLA 4W97A 3OSGA 2QEXI 2STWA 4CZZA 1V5GA 2CEXA 2DWAA 2UXAA 3QAXA 1B1XA 2G7HA 3P5JA 2CZKA 4ZECA 2QVRA 3T1BA 3E6CC 1XSDA 5LHHA 4YB6A 4OFJA 4JDFA 1OQHA 4PTKA 1HDPA 1FP1D 2AQFA 2R7DA 1ZKBA 3MAMA 2KZVA 2L54A 4EXLA 3DXJF 4GYGA 4M6YA 4PSWA 1NH8A 1HXDA 1FX7A 2EIJH 3OOPA 1N0TA 2YJPA 2YLNA 1G2HA 4YKIA 5IOZA 5ICGA 3WU1B 3COAC 3SZTA 4KN7X 4XIGQ 1MGTA 2XGEA 3OYDA 2L0KA 4G94A 1MNDA 1WPKA 1YW9A 2RDPA 3NQOA 1FNNA 2NYXA 4OOIA 1XT8A 3ZKKA 2B9SA 4BQQA 2XGDA 3PFIA 4KFCA 5FGMA 1BW6A 3OYCA 4RA1A 2WAQN 4ZYAA 5TGTA 1B5JA 2JPCA 2HAVA 3A3UA 3ILTB 3ABKH 2VOPA 1XD7A 3HSEA 3O8GA 3KFWX 1RETA 2COBA 4IPAA 2V25A 3K4CA 2NVUB 1G3SA 2NXNB 4CSWA 2V26A 3VDXA 3L2QA 3C35A 1P7JA 4XLFA 4KHZE 4XOTA 1H89C 4NWDA 1EYIA 4U87A 2GHBA 1VR5A 2VQCA 5JI6A 5HDGA 2R7SA 3MZBA 5LTCA 1LBCA 1R9QA 5H20A 5DM7F 3H6VA 4E7SA 1BN5A 4CHUA 4JX6A 2ZJRF 2PLYA 2VUMJ 2ONKE 1J9IA 3OO9A 5DVJA 2MGQA 1IRGA 3T93B 4KIBA 2KIUA 1BKAA 2RCBA 1MQIA 1UHWA 4QFNA 3HOWJ 2AYSA 2XKPA 1JJ6C 1HKSA 4NF8B 2CH0A 2CRGA 1T56A 2VXDA 3GFIA 3FXOA 2X9DA 1ZYRF 1TQPA 3UNGC 1XG1A 1LCTA 4MLQA 4DXUA 1NTCA 3FBIB 5JVGF 5CVJA 3JV9A 3RGYA 2FA7A 3ABMH 3FATA 1BTJA 4B1RA 2BHYA 2HOAA 3WTWC 4DXBA 3I59B 2CUJA 3KBZA 1FCKA 4G8XA 3DEUA 3MVZA 2EFPA 3RTFB 3D5RC 2TCTA 4CZCA 3FM3A 3HOZJ 3BIHA 2WADA 3O6HA 3T9XB 1ZTYA 3BG7A 1SAUA 5FLXZ 3BROA 1A40A 1IXRC 2DMNA 2WB1N 4MFDA 1YX5A 4E6KG 4PDHA 1Y6IA 2Y84A 5I58B 5CVVA 1FIAA 1A99A 2LH9A 3BPVA 1MBEA 3M3LA 1MMAA 4G8NA 1GV5A 1T0KA 5HS9A 3L1PA 1X1BA 3S2VA 4NX1A 1AWBA 2PG4A 1QKAA 1Y0UA 2W24A 1ZQ3P 2BXZA 2HVQA 2WA0A 1JKQC 1CF7B 4TLLB 2ELHA 2D2WA 3FHNA 2V1NA 2YSRA 2LBFB 1TFAA 5H8FA 1B9NA 1FOWA 4U4SA 2HPMA 3GBAA 1U5TC 4BQOA 2BZTA 1Y4CA 4I9DA 1M5EA 4XSZF 4NC8A 2GM4A 3B6QA 1QPMA 1T39A 4BQAA 3UGWA 1TT5B 5D6FA 4GL0A 2EWNA 1B5HA 4IL6C 3BZKA 3EUKL 3CDIA 5LRRA 1LB9A 1GVJA 1W0UA 3AL0B 3N94A 1ZIUA 4AB6A 4N17A 1A55A 2GXGA 1QULA 5IOYA 3GLBA 4F1UA 2EV0A 1H43A 4PJ0C 4FJPA 1LFPA 4FE8A 4CCLA 3FXMA 4L5IA 2JWTA 4A3BJ 4HA8A 3QPHA 1G0IA 1N76A 5EGOB 4Q5SF 2ZZVA 4NF5B 4ZH4F 3VVEA 2DN0A 2ZXWH 2G93A 4N6PA 4P8BA 1ZU0A 2DLLA 4X9TA 1G4DA 3IAM2 2WWYA 1POY1 1P1WA 1FOYA 1EF4A 4A2UA 4E7IA 2K85A 1VFDA 3GEZA 2XXVA 4BDMA 3GZGA 3FZVA 2DYXA 1YQAA 2I10A 4U0WA 5D5XB 3T5XA 3KN3A 3RN8A 5HM4B 2V3QA 3J80K 2FSWA 3PUBA 3CG1A 3KC0A 2V9PA 3HSFA 3PL8A 2UVIA 4R9GA 1R7JA 1X1DA 4BDOA 4LG0B 4XSXF 1NKXA 3FKJA 3CCQI 3OO7A 3SEXA 4RMNA 4ENMA 1JETA 2OCCH 2B4MA 4NHBA 4P56A 4A0ZA 2XWKA 1M1EB 1IMBA 3K6VA 1MJ9A 3FJGA 3WGIA 4ANJA 4G8MA 3HRSA 1IUFA 2JMWA 4I0BA 5FKLA 3TKDA 2X26A 2PJRB 1KQ8A 1D0ZA 3H03A 3L7WA 3E3VA 2CUZA 2L9RA 4C3HJ 2Z2SB 2M87A 4DGWB 5GADJ 5IT3A 4KISA 5KCJA 2A5TB 4A3DJ 2LKPA 2P7VB 1CB6A 1FP2A 4ESJA 3HO7A 4PBHA 4PP0A 2JSCA 1S29A 4KN4X 3OWTA 3RZDJ 1T8IA 4RJZA 2BGCA 1R1TA 3K6XA 1NV5A 4EJWA 5KDTA 2CO5A 4HX7A 4RS8A 1IAWA 3V83A 2MW8A 3PQKA 2Y30A 2I8DA 2Q2EB 3BTJA 3CMAI 4RB0A 3K4UA 4XKVA 1PP7U 3S9LC 5ITOA 4YG2F 4LLGF 4HZFA 2IXSA 2LKXA 3OEKA 2ESNA 5AIQA 3GZ6A 3K2AA 3BWGA 1B46A 2YPNA 3K2DA 4LZ7A 4ESFA 2ZYOA 2IA2A 3RTWB 1XTAA 3I58A 1TNSA 2HTJA 5LHIA 4JSDA 3TCHA 1BK4A 1B3FA 3J81Z 4PAKA 3ECRA 4PGGA 2MG4A 3ABLH 1YYZA 4MEVA 1G59A 2QQ8A 4K2EA 1S3JA 4M71A 3JYRA 2FHYA 1UHSA 4G7HF 3W9WA 3EHTA 3Q25A 4YKJA 3K1MA 4CCKA 1EV7A 4OAYA 1ZH5A 1MBKA 1VQ7I 1LAHE 2E1SA 4GXAA 1RDYA 2CW7A 3MBPA 2FNPA 2QSFX 2PJPA 5J40A 1UTBA 4YELA 5M5XJ 4DYCA 1D3KA 2DXYA 3BR6A 3CCEI 1JKPC 1X58A 4X48A 4A5MA 3F6VA 1A8FA 1E3HA 3L2RA 4WX9A 2JJKA 5DDGA 2W4SA 1X3ZB 1MDMB 4JWXA 3CCYA 4AYBN 2PYYA 3H9QA 3G73A 3QOPA 1OPCA 2Q74A 4PFUA 1T33A 3K0LA 5LHGA 3PMVA 4EXKA 2PFZA 3PPRA 3DP7A 4FE7A 1FBFA 3EQ1A 2F5FA 3KBRA 4JYKA 5IP7J 2NVQJ 2V4JC 2LVSA 4LFUA 5CRYA 2L9NA 2R7QA 5CMKA 2NVTJ 4D7NA 1M5FA 1YCJA 2PT1A 2ZMEB 2ZSIB 3ECHA 4XTCQ 3SKPA 2V6EA 2K9LA 1LSTA 3G6EI 3HHHA 3LSPA 4MX6A 4I01A 3TBIA 4M9ZA 4OZ9A 1IMEA 2QCOA 3WHCA 2OU2A 3EN3A 3BLYA 1FBDA 2F35A 1NUXA 1FLIA 2JTVA 4XM3A 5J1YA 3I56I 1AHDP 3LA2A 3VLVA 1ZN2A 2ID6A 2JVGA 1YAEA 1EA3A 2QMWA 4A3CJ 2V1UA 4ZC3A 1WJFA 1FPFA 1ULYA 1Z91A 1LAXA 2KMUA 3V7CA 1JTYA 1FQEA 4TLMB 3VB2A 2WAFA 1V3FA 3WE3A 2XC7A 1DK4A 1SMTA 3HPHA 3OYFA 4LUBA 2VQGA 3J80Z 2O69A 3IJXB 4PF8A 3DTIA 4FIMA 3OYAA 1B2HA 4HDVA 3WU2C 3TEDA 4V19K 2VQLA 4HE1A 2BHZA 1K79A 4IKFA 2HQAA 2DXRA 4EJVA 2KRHA 1UTHB 5JK4A 3GTOJ 3BG9A 1IN7A 2P4WA 1N7XA 3IOWA 2STTA 4O3CA 4OFOA 3SEYA 4HW8A 5AA2B 2IGMA 2LG4A 1FOKA 3GFMA 5HDKA 3JAMK 4NTLA 2CWEA 1Z9CA 1OR7A 3TQNA 1QZEA 2F5EA 1NV6A 2E1MB 3W3CA 1L3LA 2VD3A 2ZZXA 5F1QA 4XKWA 5BUUA 1CQTA 1S72I 1XDSA 1AH5A 4BDRA 3KOSA 3JRHA 2Q8KA 4EUOA 3KYCB 1OCPA 2P0WA 2IGNA 3BDDA 3VYRB 2E1CA 1FTLA 5IP9J 3A09A 4AS4A 1VQ9I 5A5LA 1OYWA 1QHHD 3I64A 2QZ8A 1NMUA 4FEBA 2M2EA 4LIUA 2XKOA 3OYKA 4HSTA 1B58A 1D9QA 2RKMA 2FXAA 3C31A 4GRKA 3RUMA 4M72A 2Z8DA 3D5SC 4BHBA 4ZE8A 1LDJA 2VKEA 2CV0A 1TWAJ 2QSGX 4O6JA 3S2DJ 2QM3A 3KOTA 4RLQA 2Z3YA 2KPMA 3HOXJ 3DQVC 3HGGA 3IP4B 3UR3C 3ILUB 2K3PA 3GVAA 2RGVA 1IXIA 2HZKA 2K4BA 2B0LA 4KCDA 1B5IA 2VT2A 3A1YA 2E35A 4F22A 4ZDPA 1S7AA 5BPIA 2E34A 3B6CA 2DVCA 2F6PA 3H06B 1W0TA 5ILUA 1YJNI 2C6YA 3FISA 2L5QA 3SDGA 2HOTA 2VT5A 2GBYA 3TGNA 3O6IA 1FYLA 1D8JA 4R72A 4CICA 3H5AA 4DZPA 4U0YA 1BA5A 1QQIA 3CJQB 5E79C 1MD0A 1OCOH 2Y48A 2ZFWA 5L3CA 1FPJA 2Z5UA 2X51A 2H09A 2DA7A 2WX9A 2BVLA 2Q2EA 1P9QC 4LLLA 1K9ZA 1TFDA 1TLHB 1PC3A 4C3IJ 5FRMA 1YE9A 5K2XA 4E70A 1N77A 5K7ZA 2HKXA 1NH3A 3VYUB 2EZIA 5E18F 4IO4A 1I5ZA 3TDJA 2NVYJ 1S7YA 4HQEA 3HOSA 2XUBA 5F08A 3REOA 3TKYA 3GTJJ 3VLWA 2CV2A 4PJJA 9ANTA 1FBUA 5J1UA 2FYIA 3ONQA 1ZR2A 1Z3YA 3CJRB 3G3HA 5BPDA 3R7XA 4WF2A 1LJ9A 3S32A 4MMPA 1QGXA 3RQTA 5FKKA 2DA5A 2WBMA 1R9LA 4AQ4A 3QWLA 4OIRF 5J16A 3S17J 1BR1A 1WJ5A 1JXSA 1FMWA 1IEJA 4XORA 1ZBMA 1WKMA 4FCYA 2PMHA 4BYYA 1WDNA 3LSLA 4HS7A 1RC9A 5KZTA 2RNGA 4GWSA 3ZGKA 2CU7A 4ZEFA 2E2JJ 1R9TJ 2F5CA 1J0RA 2VQHA 4Q47A 5HLGA 1NNPA 3ZQHA 4XRMA 4HLXA 2F5VA 3N05A 2HPGA 3FVGA 5D5VB 3MN2A 2MD0A 1QJMA 4YAHX 1TTYA 4I76A 2ZXHA 3ZS6A 2A5WA 1EZOA 2FNAA 4Z7EA 3IJOB 5ERIA 2XPVA 1P99A 2H8WA 3KP2A 2VBYA 2MC4A 4MHGA 2R7VA 2Z8FA 4BJ6C 1BW5A 3CVGA 4OETA 1D3YA 4DJAA 2PN6A 2KL4A 3ZOBA 1SD6A 2M34A 2RVCA 3GLXA 5E3LA 1LBWA 2EZHA 3MFKA 3PPOA 4OMZA 2DA4A 1RIOH 3OEMA 2XXTA 4AS5A 3QMFA 2X85A 2DWJA 4ELRA 2YX4A 2DQRA 4GIZA 1U8RA 1GXQA 1SD7A 5TJJA 3IRQA 5DD4A 3JAMZ 2DJNA 4IB2A 5I56B 4M3FA 3S1QJ 1RYXA 4P1LA 4EJUA 3A0BC 3UKGA 1PVEA 1MDP1 1GXPA 1WFXA 1R1UA 3IOVA 4KJZA 4ELPA 3OYLA 5F7VA 4YFXF 1B9MA 1SDXA 4H8JA 3HBLA 4I6ZA 5HLTA 4PQJA 2DAOA 5I57A