1MH4A

Maltose binding-a1 homeodomain protein chimera, crystal form ii
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords maltose binding-a1 homeodomain protein chimera
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
total genus 136
structure length 418
sequence length 418
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh4A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A01
1VFDA 5DEXA 5AA3A 2V3QA 5A5XA 4JX6A 2O8KA 4YKPA 3BQZA 4AYBN 5DEXB 1LFUP 1PBPA 5K2YA 3MVZA 3FXUA 3H4ZA 1HSLA 1RYXA 1MDQA 4OYVA 1M5CA 4YICA 3IOVA 2M8CA 2MW8A 5FJ8J 2LVSA 2EH3A 4ELRA 3M4OJ 3GBBA 5L9OA 2YLNA 1NL5A 4HCYA 2O1MA 3N6UA 5IP6A 1H76A 4GD5A 3LOCA 1G2HA 3MVYA 1MNMC 4PETA 3KN3A 3VE1B 4GWOA 3MWBA 2HXOA 1ANFA 1NNPA 2OJTA 3UORA 1MBFA 3H6WA 1IG7A 1LFGA 3G1OA 4EUOA 1Y3PA 4JWXA 4DE8A 1P1UA 4RXLA 3CI8A 3LC8A 3TTRA 2BJJX 1QPIA 2W48A 4AB5A 4FTHA 1ETKA 2QS1A 3CSGA 4BKXA 1LE8A 4G4PA 3PD9A 3UKGA 2D5VA 3K00A 1IITA 1N3WA 5M5YJ 1HDDC 4RY1A 4FCYA 1LBBA 4OFJA 4QSEA 2QF7A 4XRMA 2IA4A 4HCWA 2COBA 3USDA 1MY0A 4DYQA 2YU9J 1GV8A 5HM4B 4DW6A 1O64A 2XX8A 4NMYA 3I4NJ 4WEPA 5CMMA 3KZGA 3I6VA 3C4MA 4YB5A 3QQAA 5DVIA 2ZYNA 1QUKA 4M6VA 5FTHA 1OLAA 2A5TB 3V83A 2L9RA 5I2NA 5I2KA 1M5EA 4XRSG 2JK3A 2XXPA 3H03A 4RPNA 4U1ZA 4H8JA 2I10A 4F2QA 2FJ1A 5L8DA 1MG1A 4JSDA 4R2BA 1EU8A 4DCYA 4LUBA 4FECA 1GVCA 4HW8A 1PDAA 1NNFA 1LCFA 1RESA 2P1SA 5EYFA 1FTTA 1PB8A 5EF6A 1USYH 5ICQA 3S4UA 2LR8A 1WH5A 1B4HA 1IC8A 1JT6A 3VDFA 2WAQN 4K3FA 4OWDA 1OJLA 4YMBA 1P1NA 1XVYA 3M3LA 1IUDA 1O4XA 1WI3A 3HCQA 4R6KA 1JTXA 3MZ1A 4A3EJ 3GZGA 4G68C 5BNGA 3LSXA 2DWJA 4JX4A 1TC3C 3L6GA 4BY1J 1P1QA 3FGSA 4H65A 2VHAA 3S15J 2Z8FA 3T9HB 2K9SA 3HKZN 3T9XB 2UVGA 3FVOA 2GM4A 3IJXB 1MBEA 1U78A 3S9LC 3MJNA 3WHBA 4LP2B 3CVGA 1MBHA 4PFYA 5CMKA 4R6HA 2XB0X 3PPRA 2R5YA 1O7TA 4IO5A 1VSOA 2R5YB 1B8IA 3O9PA 4I8CA 1BP5A 1N7XA 3B6CA 2FD5A 1B8IB 1NH8A 1APLC 4GRKA 4N13A 4X1EA 3IORA 3K01A 1CE2A 4KR5A 1N84A 1AU7A 5TP9B 4XIDA 4BXXJ 5AA1A 2Y7KA 5GPAA 4U1OA 3PV0E 4G68B 1QVSA 2OLBA 3CR9A 4H6DA 3PMWA 1JJ8C 3MZBA 2HAUA 2Y30A 4OETA 3K2AA 1I6HJ 5IKBA 1R1NA 3U72A 4FJPA 3TTMA 2TCTA 4GFRA 3JRDA 3IO4A 2O69A 4Y7NJ 2JA8J 4U23A 3U8QA 1OMPA 2HYJA 3LSLA 4LVQA 3TAJA 4FORA 1MQIA 1RYOA 3GTLJ 1JT0A 1EZPA 2VUMJ 3A3UA 2H25A 1D9VA 1MSEC 1MM6A 1LFHA 1UTHB 4G8HA 3Q29A 3S2HJ 4F3GA 2QS2A 5CRYA 1VI0A 4GL8A 5H8SA 2XXXA 2Y31A 1RPWA 4MBPA 4OTEA 5J1RA 3IH3A 3Q28A 2F6GA 4NWDA 4IHYA 3ZKLA 1I6BA 3S2DJ 4Z7EA 4IO6A 4V2FA 2LKXA 3OELA 4H5GA 5H8FB 2UVHA 4BDNA 1RKMA 4JX5A 4FE7A 4QFPA 4CYCA 4DCXA 5I84A 3MZ9A 3IH2A 4KCCA 1LLSA 2XXQA 3ILTB 4ZEFA 4MO7A 1IUFA 3QAXA 2DA3A 1XS9A 1NKXA 1TWFJ 2F35A 3BR2A 5JEIA 4EQBA 3W9VA 1TT1A 2CU7A 1M5FA 4RK2A 3DCFA 1UQWA 1POGA 4UUTA 2B3BA 2JMWA 1QUIA 4DIGA 1TWAJ 3GTKJ 2Z22A 3BR3A 4A93J 5AE4A 4A3LJ 1QULA 2UVJA 5EZGA 4GOTA 3SDFA 1VFEA 3TMGA 2RC7A 3FISA 2R92J 5B7DA 3QIMA 5ELVA 2ECBA 2R0QC 5F0HA 2Y7WA 4KCDA 2DS9A 3IOWA 3SEVA 1BKAA 3SEUA 2PT2A 3RTWB 5HODA 1RKWA 5F7VA 3G3IA 3JRGA 4F1YA 2NS8A 2EBIA 4OEUA 3HOZJ 3RQIA 1ZBMA 3CFLA 2CMOA 3BT9A 2E1OA 1HSEA 2ALUA 5J1YA 4KPTA 2MG4A 4HS7A 2H5YA 2XX9A 1Y3NA 2V93A 3VLVA 3ODBA 4B4CA 1JVXA 4DYRA 4YKIA 4PQJA 4R9GA 1SDXA 4NEDA 1F43A 2OBGA 5EEAA 1QKBA 3KFMA 2Z8DA 2Q88A 2EZLA 1FTKA 2QS3A 4C0RA 4F2OA 1QRYA 1NMUA 1IEJA 2I0CA 4IO4A 2VOZA 2P81A 5DTDA 4IGTA 1AIVA 4HNVA 3M3YJ 1K61A 4R6YA 1IXCA 4R72A 2F34A 1JUMA 4AB6A 2GRVA 2LD5A 4F39A 4IY5A 4IB2A 4QFOA 1Q35A 3PUYE 4YMAA 1VE4A 3TCHA 3OXNA 4QTRA 2DWIA 1I50J 4IHXA 1SQYA 2FA7A 4PP0A 3GTJJ 1F36A 1BJZA 2QPQA 1UTBB 2XXRA 2GH9A 4JYKA 2DMPA 4XTCQ 1ZQ3P 5M5WJ 1IGNA 2Y0SN 1RETA 3V5AA 4QSDA 4X48A 4LQ5A 4Q30B 2H4IA 3JRFA 5KDTA 4OVJA 2OK2A 2EZIA 5KDTB 3JRHA 1XT8A 5C3EJ 5JTYA 3PPOA 5L9MA 9ANTA 1DTGA 2JJ7A 3TW6A 5JTYB 3BBRA 4PFUA 2THIA 2GBYA 2OF7A 1SI1A 4X1BA 1IIWA 1JNFA 3V89B 4MF3A 4LZ8A 1UIUA 2GHBA 1FTZA 2XXVA 1WH7A 3H3GA 4NF4A 3I4MJ 2B63J 3KN7A 5FLMJ 3EHSA 3EHUA 3JR9A 1BLFA 1VNDA 3VV5A 1Z77A 4WKMA 2QCOA 1YRNB 1Y1WJ 4IO2A 3RNNA 1T56A 4L17A 2ECCA 1H88C 4N07A 3R6UA 3K7AJ 3E7LA 1XVXA 3LR1A 3RT6B 3S9MC 1IRZA 1H89C 3MAMA 3MQ9A 3VXBA 3QXMA 2HOAA 3TEDA 4JWOA 4ZEBA 2V3TA 2DXYA 5IOYA 5K7FA 1A55A 4EEFG 1A8EA 1MQHA 3TP3A 2DYXA 2DXRA 2VKVA 2R6GE 4R2FA 4YKKA 3I5OA 2PMZN 4G12A 2ZNSA 1FJLA 3TQWA 3C36A 4OESA 4A3CJ 5M5XJ 4BBSJ 3CFXA 3SEXA 3K02A 2V25A 1ZIUA 1OCPA 3E4RA 3EF7A 2JWTA 3Q27A 2F7CA 1YAEA 1J1NA 5DTBA 4OHNA 5CM6A 3H0GJ 3S9NC 4ZECA 3WHCA 4A3JJ 3OO7A 1FEXA 1HOMA 1Z7NE 2ONKE 4X1DA 2DA1A 1TWGJ 2I4BA 1QVTA 4U4XA 5IYBJ 1FTOA 3HGYA 4O3CA 3U92A 3N94A 2ESNA 1AMFA 4UACA 5M2VA 3MP8A 3MP6A 4GXAA 2E19A 1JW1A 4M3EA 3BR0A 2H1KA 2F7BA 3EQ1A 3FJ7A 4MFDA 1M5DA 3D4CA 3FV1A 1MBJA 3GXAA 3DEWA 2XXUA 3OSFA 4C3IJ 2XGEA 1LAHE 2OPTA 1URSA 2H99A 1A99A 2HXWA 2HFBA 3E9XA 1ENHA 3U93A 3H7MA 5B70A 5H8HB 3RLFE 3VVFA 2G0EA 1B1XA 2XRLA 1DOTA 1UHSA 3G1LA 3DP8A 3HGGA 3V8XB 1N76A 3H3VK 2VP1A 3PMXA 3HM5A 1LB8A 1B9JA 1QVUA 3HDDA 4IO7A 3RZDJ 5IP9J 4DYCA 1MPDA 1XC1A 1SI0A 3TELA 3OSRA 1EZOA 4GIZA 3ZQIA 2L7MP 4GFBA 4X6AJ 1JUPA 1SW5A 2A5TA 3PO2J 2HOSA 3MVWA 4OZ9A 3T93B 3RZOJ 2TRTA 2LP0A 1Y3QA 4ZEDA 3F11A 2DOJA 1BTJA 3PUXE 2NUVA 1PB7A 3HB9A 1EF4A 1H45A 2VI6A 3H6UA 3TDJA 3G3GA 3THIA 3S1MJ 1D4NA 2V3UA 2Y9ZA 4QF9A 2DQVA 4KFQA 1HSJA 2REJA 3T9UA 5I58B 3G3HA 4FEDA 5JK4A 3BTIA 1SFOJ 1ZLQA 3OIOA 2RCAA 5EGOA 4BLAA 5ITOA 5EGOB 4UA8A 1Y20A 2O6AA 2F36A 4KHZE 2I6EA 1QKAA 1WVJA 5TPAB 5M3FJ 5E3MA 3VFJA 2X26A 2XPWA 1MH4A 4BDLA 3PD8A 1B05A 1GTKA 3PO3J 2OCUA 3TTLA 5H8NA 5I56B 3B6TA 5H8QA 3KSXA 5H8NB 1N04A 1AL3A 1JEVA 5H8QB 1ZMGA 2I3VA 3TP0A 2L7FP 3HOUJ 1B32A 3DP4A 5K2XA 4MLOA 1PB9A 2WV1A 1XS5A 3FVGA 2NS7A 1IDZA 4JSOA 4OFOA 1CQTA 5K7ZA 3CQZJ 2RF1A 2DE2A 1M5BA 3SJMA 3OD7A 4DLDA 4GF8A 4M4GA 3LSPA 1Y1ZA 3BG9A 1MXXA 2OZZA 3O97A 1S50A 1SW4A 4A3KJ 3JRIA 1JKQC 1DMBA 4OFLA 1RKTA 1TWCJ 2HQ0A 4OENA 1LAXA 1T33A 2XX7A 4S0HB 1ETWA 4R75A 2NVXJ 5TP9A 4MLVA 5C44J 4G68A 1K83J 1IDYA 1D9YA 4OXVA 1MQGA 4TOZA 1GVDA 4POXA 2DP8A 1B7UA 4A3DJ 1ETXA 2Y7IA 3FZVA 3JYRA 1ETVA 3CG1A 3FATA 2K9NA 3D1NI 5FKOA 1TWHJ 3IOTA 1EZ9A 4GLIA 1Z7ME 2DVCA 4F3PA 4D7MA 5IAIA 4F3SA 1HF0A 4A3FJ 1IXHA 4XKNA 3S1QJ 1YCJA 4M3GA 1B3FA 1U9NA 5DT6A 5FTIA 5I59A 2NVTJ 2NXOA 1B7HA 1FQCA 4C2MJ 4H5FA 3ZQLA 5I59B 3B6AA 1E3OC 1UTHA 5FLVA 1B5HA 3K6WA 1JVYA 3TKDA 4J19A 4G8MA 3MN2A 3N5LA 3QPLA 4QSCA 3QPSA 3TTNA 3PPNA 2JA5J 4C3JJ 1TFDA 3BFTA 4O3AA 3RQTA 1S9TA 1P99A 4C1UA 4R74A 3L6HA 3RN8A 1ZR4A 2HQ5A 3KEIA 1ETOA 3EN3A 4L5EA 4BY7J 5H8FA 2O68A 1U9OA 3LUYA 2L0KA 2F97A 1FQFA 3K2DA 3MW0A 5AA4B 3PM1A 3LSRA 5KCJA 1LAGE 3M8UA 1SVXB 4KQPA 4RNSA 2P2AA 5KCJB 1B2HA 4QHQA 2FX0A 3HN0A 1H44A 1DPEA 3HBLA 1A54A 3DM0A 4LATA 5EHSA 2QJEA 4YB6A 2EZKA 3OEKA 3IOUA 5FHNA 2E2IJ 2ZXTA 2Y2ZA 4Q5TA 1NTCA 3PPQA 3JRCA 3T22A 3A01B 3UK4A 1Z0XA 3B6WA 1IXGA 4RA1A 4E0XA 4ELQA 5ISUA 1AKHA 5C4XJ 2I0BA 4W1UA 4MLQA 4Z0IA 1AKHB 3HOWJ 2AIXA 3QYTA 3MUQA 3Q25A 2AL5A 2QMWA 2GLOA 4F3BA 3TODA 3IK6B 2PX1A 5FKLA 2E2JJ 1UG2A 3HV1A 5FHMA 1OCTC 5ITPA 2DTZA 3KN8A 5HPQA 4PFTA 4FE4A 4ABZA 3W15C 3RUMA 1ITYA 3IR1A 4EXKA 2R5ZA 5BUUA 1DU6A 3IL1B 4I6ZA 2R5ZB 1I6AA 3D4GA 1X2NA 3FIRA 1II5A 3OSQA 3TQLA 2IBDA 1MXWA 1SYIA 1XOCA 4IHWA 2F6PA 2IEKA 4AUXA 2NVUB 2QS4A 2DA6A 2RINA 4D5FA 1AHDP 2RCBA 1QJMA 1Y1VJ 2Y7PA 3F0CA 4IO3A 2DA5A 1MY3A 4NF8B 3K6UA 3NAUA 2XSDC 1Q1VA 2X9DA 3IB0A 4TQUQ 1WPKA 2PVUA 1MSFC 4ZE8A 2B3FA 4YZZA 1GDTA 2Q9TA 3PGFA 5FKNA 2LLKA 2JA7J 2ZMBA 5I57B 4XIGQ 5DVJA 1OVTA 4E0WA 3VPRA 4OERA 3KBRA 1BW5A 1ETQA 1FTJA 1TWYA 3K1NA 5TU0A 1WCMJ 2M34A 4EQ7A 4V2GA 3K6VA 2PT1A 1OVBA 2VGQA 4RDUA 2MGQA 4U22A 2RKMA 3G3KA 1OQGA 2X6OA 4GL0A 3EHTA 2RAEA 1N3XA 1OIBA 1I6QA 3MBPA 4FE8A 1L5TA 3C9HA 4HTGA 2Q8JA 2F78A 3BTJA 4ND9A 1NK2P 2X48A 3O28A 4XKPA 1JKPC 1UTBA 1SYHA 4H0WA 1A6IA 3N6TA 2ZYKA 3U94A 2AHQA 1NK3P 1MPCA 1XG1A 3ZQCA 1IZ1A 1D5YA 2NVYJ 1JGGA 4XKRA 3SKPA 1SW2A 1FTLA 1MBKA 2PYYA 4ZS9A 2CQXA 4F19A 2H9BA 3Q0WA 3SERA 3O8HA 1F9BA 3H06B 4U2RA 1WODA 3ZOBA 3HHGA 1B46A 1Y9UA 5EG0B 3IJOB 3GTQJ 5IOZA 4NF5A 3BKIB 3B6QA 5JLXA 4NF5B 4ELOA 3IH4A 3K4UA 3OEMA 4MIMA 2UXAA 3M3KA 2DMQA 3LBSA 2KT0A 5LOMA 3S1RJ 4GXSB 3FJMA 1MM7A 4EDPA 3BQYA 3UP9A 5F08A 1XHYA 2A5SA 1AH5A 1R9LA 3QUJA 1MY2A 2FQ4A 5L9SA 2XGCA 1YRNA 1MQJA 4RK9A 3HO7A 2QL3A 4ZZEA 1W0TA 1RR7A 4RBOA 1FQDA 1MXUA 4YB7A 3JREA 2ME0A 2IEEA 4G77A 3S1NJ 4A3GJ 2WB1N 1POY1 4P0GA 1GV5A 2DMTA 2YPNA 3HOYJ 3O66A 1MY4A 1R9TJ 4YU0A 3BFUA 1NNKA 3G3FA 2HCAA 3T96B 1BW6A 2JA6J 4KYDA 2Q2CA 5FHOA 3S2VA 2O7OA 3ECRA 5F1QA 2AO9A 1UMQA 3E13X 1ZKBA 3B7DA 3O2AA 1VR5A 2M2EA 1MY1A 2REGA 3MPKA 1VFCA 3BR1A 3QUFA 4H1XA 4LQ2A 1H43A 2D5WA 4A3IJ 1TXFA 3OOAA 1IJWC 2F7AA 1B3LA 4JBZA 4Q0CA 2HXIA 1JEUA 3MVPA 2MSYA 4UUSB 3S14J 1LSTA 3VXCA 5ICTA 2I3WA 2DA2A 2VPRA 4ESWA 2XXWA 1GUUA 5J1UA 5A5XB 2XXYA 4LZ7A 4XK4A 4B1RA 3OO6A 1US4A 3C32A 3O8GA 4ZDMA 4N6PA 3GLBA 3OMBA 3TFLA 2W7YA 4YKJA 1B6HA 1B5JA 2X7PA 2AL4A 3HOXJ 3W9WA 4FISA 4OQOA 4R9FA 3S9EA 5GPCA 2NVQJ 3GBAA 3LSJA 3TCFA 3PUZE 3CRBA 1B58A 2DWAA 4NWCA 4IY6A 5H8HA 1CB6A 5FKKA 2LTPA 4GQOA 1OLCA 4G8NA 4THIA 3BTCA 2FYIA 4JDFA 2ZB9A 2Q89A 2HI3A 2UYEA 2XXIA 4LOCA 2ELKA 1LCTA 3N26A 5M3MJ 3HEFA 3Q0VA 5AA2A 2DSFA 2CRGA 3K0VA 5AA2B 2PBWA 2ZYMA 3P7IA 2VKEA 1ZR2A 4M3BA 1FQBA 1I3QJ 3BG3A 4LZ5A 1LE8B 3Q0UA 5IYCJ 1LFIA 1OQHA 3WAFA 1B5IA 4QRZA 2E1SA 2XD3A 1IXIA 5CMBA 5E3OA 2EQRA 3CG3A 3KOTA 1T0KA 5FKMA 4ZEIA 4BDMA 4H67A 2KDZA 1P1OA 4Q8RA 1DSNA 3RKQA 2ZYOA 2R7ZJ 1JW5A 4P11A 3ZSFA 4DXCA 1MPBA 3FVNA 3UGWA 3SDGA 5I58A 3KJTA 1Y4TA 4DXUA 1ELJA 3DP6A 5I2NB 5I2KB 5E3LA 5CMCA 4TLLB 2HZLA 3TTKA 1H3DA 2P0SA 3IB2A 4JWYA 2LAOA 3MP1A 4LA9A 4OMBA 1P1WA 5TPAA 1MRPA 1FW0A 4IGRA 1HCRA 3CIJA 3HPIA 2XHDA 4IEJA 1LAFE 4I76A 3LNQA 4MH5A 4BDQA 4ZZAA 4F1UA 4KI0E 1MH3A 5I56A 1GV2A 1HDPA 5CC2A 3DLNA 1S7YA 4RJZA 5IPAA 2DE4A 2Z23A 4F31B 4M3FA 1BIYA 3T66A 1B40A 1SBPA 1URDA 2X7QA 5IP7J 5F27A 3FASA 4O3BA 3FVKA 2DJNA 2R93J 1FQAA 1LGBC 2VD2A 2XXHA 2ANJA 1B3EA 2H8RA 4DZPA 3PMVA 5C4JJ 2O7UA 3Q3SA 2PMSA 2DN0A 1KWHA 1POTA 2KLFA 2K40A 3ZQGA 3HSTA 3FXRA 1JUSA 3UN6A 2N8GA 1YTVA 2I48A 3OO9A 1ZKGA 2RC9A 4H8IA 3VVDA 2ZNTA 2O9LA 2NOOA 3E3KA 2Y84A 3K1MA 2M9HA 2F8DA 4B3AA 1YPNA 1I69A 4NE4A 3PPPA 1MDP1 1TFAA 2H98A 4U4SA 2NOGA 4FAJA 5EDNA 1JETA 1O63A 3TCGA 5DS9A 4KD5A 3ZS6A 3K1PA 4DDDA 2ONRA 3CFZA 3CMYA 3OO8A 4XRSA 4XXUA 2XPVA 4DZ1A 3G3JA 1SW1A 2DA7A 1UIVA 4WXJA 4BBRJ 3OENA 2V84A 1B1HA 1JQFA 1EH3A 3OOUA 3A3CA 3RY3A 1ORKA 2ZNUA 1X58A 2E2HJ 1GT0C 5E3NA 3PUVE 5DVFA 3VLUA 4JB7A 3TUSA 1LFBA 3FXQA 4POWA 3RPWA 4WEDA 1A5JA 1A7LA 1JJ6C 1B0HA 1Y1MA 1B0LA 4XICA 3QSLA 4MFEA 3TYHA 4ONYA 2M8GX 3QK6A 1MS7A 3Q26A 1WGXA 2O7IA 2ABHA 5EZHA 3KSJA 1MQDA 3U1OA 2XGDA 3KGCA 3PU5A 1JTYA 1VF9A 2HDDA 1PC3A 3LSWA 3NARA 5J1DA 4AQ4A 3HOVJ 4NF6A 1B51A 2FNCA 3IX1A 3C2BA 2QRYA 4FEBA 2I49A 2O51A 3OSGA 4NF6B 3RTFB 5AA4A 1JW4A 1P7IA 1ZTYA 1ZGWA 3T9VA 5KZTA 3H6TA 3WAEA 4ECFA 3CCYA 3SEYA 1MXYA 1MBGA 1B72A 5IYDJ 4I9DA 4JXIA 4I1DA 5F0FA 1B72B 4U21A 4D5CA 3GTOJ 3ZQFA 2ID3A 4JP0A 3JRAA 3BTLA 4EQ9A 2Q2AA 1LBCA 3TZAA 3GTMJ 2CZLA 2F5XA 3A01A 1PBQA 2CUFA 4CYCB 3W6VA 1FTMA 2XPUA 2HAVA 1NNTA 1ZU0A 1USYE 4DXBA 3TEPA 5J3LA 1B3HA 1FIAA 4C3HJ 4PFWA 2B65A 2HEUA 5F1JA 3SETA 3ONMA 5CBSA 3RGYA 4ZEKA 1DPPA 1LB9A 3I3VA 2D3IA 2HZKA 3FJGA 3CSBA 3JV9A 3MVXA 1NH7A 5JLWA 2YUSA 4F22A 1H8AC 2JN6A 1N0TA 4NTLA 2OWSA 3SEWA 2M0CA 1JKOC 3ZKKA 2E0SA 4DZJA 1MXZA 3O6GA 2ID6A 4M1VA 1MXVA 2AYSA 3FV2A 2DVZA 1DU0A 2XXTA 2UYFA 1D3KA 3IB1A 3G7WA 2G93A 3MPLA 3A03A 4A69C 4QFNA 1FCKA 5CI5A 2QSXA 2CJJA 5F0CA 2O1LA 4NF8A 1AOVA 3EPEA 1Q1KA 4F18A 3R26A 2Z8EA 4QFLA 2IAIA 4I62A 1PUFA 3PUWE 1ATGA 4M3DA 1PUFB 1U8BA 5I57A 3TW7A 1IV6A 5HBCA 2UVIA 2I4CA 2WKYA 3A02A 4W97A 3RT8A 4F1VA 1ZK8A 1P7JA 3C31A 3O29A 4EF1A 2CQQA 1A40A 1SD3A 3FUZA 4GVOA 3AXFA 1ZTRA 4A3BJ 4Y52J 3LSFB 1HLVA 4X9TA 3TPAA 4A3MJ 1OFCX 2YS9A 2R71A 3IV5A 1IQ7A 2ME6A 5AA2D 5F04A 3FIWA 1QUJA 4FIMA 3SFIA 3GBGA 3K6XA 3FKIJ 3JRBA 3C34A 4EF2A 2XB5A 2VD3A 1SANA 3S16J 2CUEA 1Y4CA 2G29A 1JKRC 1B3GA 3LSGA 2Y7RA 5GP9A 5DYHA 2O84X 4YAHX 1S7EA 3BR6A 1B7ZA 3GTGJ 2DE3A 3HHFA 3KOSA 4ISUA 1R6ZA 2XD2A 5BWJA 1ZJLA 1ETYA 5EG0A 2LK2A 4NDLA 3FD3A 2DA4A 1N7WA 2GHAA 4F29A 1GGGA 2HOTA 1FQEA 4KYEA 2EZHA 3DELB 3O6HA 3KG2A 4G2ZA 4ELPA 4KYSA 1A8FA 3O6IA 2D21A 4QIWN 1BL0A 5K7HA 2OWTA 1WDNA 2R9JA 4P0IA 1NFTA 4C1TA 4BDRA 3MC2A 2YJPA 3VVEA 5CBRA 1X2MA 1XC5A 1BA5A 2LFBA 3ILUB 1B4ZA 3S17J 4RYAA 4QFKA 3SESA 1URGA 5EYRA 1GR2A 3R7XA 2K9QA 3BG5A 3BR5A 4NF4B 4ESXA 4QSHA 3GTPJ 1QW0A 2RC8A 1W0UA 2GFEA 1B52A 4R73A 3VLWA 3IAZA 3M3FA 3C33A 1PEBA 3IO6A 4ZE9A 3KJ7A 1US5A 4FATA 3FK6A 3H6VA 1R9QA 2QMXA 4D7NA 2ONSA 3FK7A 1DTZA 2DMUA 4IHVA 3A09A 2DWHA 3C35A 4BDOA 2DMNA 2I58A 3MKLA 3CDLA 4RPOA 2L7ZA 3G1MA 2NWJA 2LY9A 3L1PA 4XKQA 4MFIA 3UA8A 1FIPA 4AC0A 3JZJA 5EHMA 4LONB 4OEVA 2Y9YA 3ZQHA 4PE5B 4TLMB 4EXLA 3UIFA 4UUSA
chains in the Genus database with same CATH superfamily
1MMDA 2UUZA 2Z3YA 1NG7A 1VFDA 5DEXA 5AA3A 4ZZDA 2V3QA 4JX6A 2O8KA 4YKPA 1P4AA 5A5XA 3BQZA 4G6TB 4P56A 4AYBN 2PCRA 4S05A 5DEXB 3DTEA 2XASA 3HHHA 4XLEA 2UXXA 1IN7A 1ONVA 3DEEA 1LFUP 2FOWA 1PBPA 5K2YA 3MVZA 2XROA 1F4KA 3FXUA 3H4ZA 4R79A 4N8GA 3KYDB 1HSLA 3KLOA 5K5OA 1FPFA 2V6CA 4DGWB 1RYXA 4ZDLA 4PF8A 3C1DA 1QNTA 5TJJA 1MDQA 2HPIA 4OYVA 4IVNA 3LAJA 3TKYA 4Y17A 1M5CA 5TRDA 4YICA 2BHZA 3PQKA 5EYGA 2E1MC 4NHJA 3PUBA 3IOVA 1SPIA 2EILH 2KRHA 2M8CA 2Z5UA 2MW8A 5FJ8J 2LVSA 2EH3A 3L2VA 2HGCA 4N17A 4ELRA 1GXQA 3M4OJ 1E2XA 3GBBA 5L9OA 2YLNA 1VQ8I 1NL5A 4FQGA 5IZZA 4HCYA 3FXBA 2O1MA 2FBKA 2VJ4A 2K5CA 3N6UA 1ZARA 1LB2A 5IP6A 1RR8C 1H76A 5JVTA 4KYWA 4GD5A 2M8EA 3OYJA 3LOCA 1G2HA 3MVYA 4PBQA 1MNMC 4PETA 1ZRFA 1S3JA 4ANJA 1G8XA 3KN3A 4GWOA 3VE1B 3MWBA 2HXOA 1ANFA 2VQGA 1NNPA 2OJTA 4OVQA 1QZYA 2OX3A 4UXNA 2LNBA 1K78A 2XF5A 3VFZA 3UORA 2OAZA 1DGWY 1MBFA 3H6WA 3IFCA 2WBMA 1IG7A 1JI8A 1LFGA 3G1OA 4G61A 4EUOA 1Y3PA 3ABUA 2VL8A 2VC1A 4HAMA 4JWXA 4DE8A 1WRJA 2F5EA 1P1UA 2KZGA 2B0LA 2JTVA 4RXLA 3BZ6A 1LBYA 3CI8A 3LC8A 4U87A 3TTRA 4MNCA 2XF6A 2BJJX 3CCRI 1QPIA 3SZGA 2W48A 4AB5A 2Y5KA 4B43A 4FTHA 1ETKA 1V55H 2QS1A 1BI0A 3R0AA 4L18B 3CSGA 3ONQA 1YJWI 4A2UA 4BKXA 1LE8A 4MMPA 2D1HA 4EQQA 4G4PA 2KIQA 5D8KB 5IZ1A 3PD9A 3GFLA 2ZZWA 3I64A 3UKGA 2D5VA 2XWIA 1FRPA 3K00A 1R4NB 5GTIC 3ZMZA 1IITA 2XC7A 1OCZH 5D6EA 1IMFA 1N3WA 5M5YJ 1HDDC 4RY1A 4G7ZF 2F4MB 4QPOA 3TO6A 3ZMDA 3GX4X 1BIBA 1KZ8A 4JVIA 4FCYA 1LBBA 3A2KA 4OFJA 1NV6A 4QSEA 2QF7A 4XRMA 2E1MB 3IKTA 2IA4A 3V8KA 1O3RA 2W4SA 4LB6B 2COBA 1NV1A 1MY0A 4DYQA 2YU9J 3E3VA 1MMSA 3ESWB 4HCWA 1GV8A 1MNDA 1BOBA 3ABKH 3Q9VA 4G6QA 4RB0A 4DW6A 1R71A 3TQNA 3I4NJ 3I59B 5FD5A 1O64A 2XX8A 4WEPA 5CMMA 1XN7A 3KZGA 1PYVA 4E70A 3I6VA 3C4MA 4YB5A 3QQAA 1U5TA 4B09A 5DVIA 2K7LA 2HXRA 2ZYNA 2Y0SA 1TW2A 3AG1H 2K27A 4KIGA 4M6VA 4XRFA 4A12A 1QUKA 2XSJC 5FTHA 1OLAA 2A5TB 2WEFA 3V83A 3E1SA 1SVMA 2L9RA 5I2NA 5I2KA 4BACA 1M5EA 4XRSG 2JK3A 2XXPA 5I5PA 2LSOA 3ZMTA 4CZZA 3CDHA 1DCUA 3H03A 4RPNA 4U1ZA 4ZYGA 4J00A 4H8JA 2I10A 4XN0A 2FJ1A 4F2QA 5L8DA 1MG1A 4JSDA 1BBYA 1SFUA 1EU8A 4R2BA 4DCYA 4LUBA 4FECA 1GVCA 1QGPA 3UR3C 4HW8A 5FLXK 4CGZA 5JI6A 4GWUA 1PDAA 1NNFA 1KYZA 1PJRA 3MZYA 4PZJA 3EETA 1LCFA 1RESA 3FXOA 2P1SA 5EYFA 2Q1ZB 2HZDA 5DUKA 5H6QA 5KAIC 1MDMA 1FTTA 5EF6A 1PB8A 1USYH 5ICQA 4PDKA 3RKXA 3S4UA 2L5QA 3PIPF 3BG6A 2UZKA 2E1NA 2LR8A 1WH5A 3LSMA 1B4HA 1I1GA 2H1LA 2M5WA 1IC8A 1JT6A 3VDFA 3JW4A 2WAQN 3K69A 2VOOA 2OV7A 1RI7A 2R7UA 4K3FA 4OWDA 1OJLA 2F48A 1LBXA 3ZKLA 3N4MA 4YMBA 4BE2A 3REOA 2EFOA 1P1NA 2DBBA 1XVYA 3M3LA 1IUDA 4KISA 1O4XA 1WI3A 1YS7A 2F2EA 2PFBA 3CUQB 3EF7A 4FX4A 4KDPA 4PE3A 3HCQA 3LL7A 3KETA 1S6LA 3DTKA 3VDXA 2GXGA 4R6KA 1JTXA 3MZ1A 4A3EJ 3GZGA 4G68C 1FPQA 3ELKA 5BNGA 1YOVB 3LSXA 3D5LA 3W6KB 2DWJA 3QPTA 2QFLA 1Z6RA 2MH9A 4JX4A 1TC3C 2GQQA 3K4KA 3ZGKA 2KRFA 3L6GA 1W4MA 1T95A 1TQIA 3QWLA 4HQEA 3ERED 5DM7F 4BY1J 1FPIA 1P1QA 3EUAA 2MLGA 3FGSA 4H65A 2VHAA 3S15J 1Y0NA 4NB5A 4ESFA 2BV6A 2F6CA 3A1YA 5KAFC 3WG9A 2Z8FA 4N4UA 3CCSI 3USDA 4HA8A 1TQMA 3T9HB 2K9SA 2X6XA 2QBYB 5AIQA 3BY6A 4E6KG 3HKZN 1A36A 4I40A 3T9XB 1USSA 3RPLA 4Z2YA 5J4YA 3CCUI 2UVGA 2VPNA 1TZLA 3WGGA 2IRFG 2O6GE 3FVOA 3QOEA 3LFUA 1YJ9I 2GM4A 3IJXB 2BE5F 3ROUA 1MBEA 2RN7A 3FMSA 1ZGAA 1U78A 3S9LC 2YSRA 5FROA 1IMAA 3MJNA 1EJ9A 3SEQA 3WHBA 4LP2B 2EFNA 5H6RA 1MBHA 4XM3A 3CVGA 1X1AA 4PFYA 5CMKA 3DWLE 3G4SI 4QBAA 2PMZA 2BVLA 2DFEA 2KMUA 2KZVA 2XB0X 3R6SA 3PPRA 2R5YA 4R6HA 1LKXA 1O7TA 4IO5A 1VSOA 4DI3D 2MH2A 2R5YB 1B8IA 5HVQC 3O9PA 3CLQA 1BP5A 4I8CA 2R7VA 1N7XA 1Z7UA 3B6CA 1HKSA 5EEGA 3WTYC 3AKZA 2FD5A 1B8IB 4L5IA 2DAOA 3QU3A 1NH8A 1RC9A 1ON1A 2ZJQF 1APLC 4GRKA 4ZDPA 3I0TA 4N13A 2OCCH 4X1EA 3IORA 2TDXA 3K01A 5K5QA 1CE2A 4KR5A 4BE0A 1FBGA 4RM3A 2VN2A 1N84A 2DU9A 3BROA 3OYMA 1MJBA 2A5YB 2E5ZA 3A0HC 4P55A 4CSWA 1AU7A 3I4PA 4XIDA 5TP9B 4MHGA 1V5FA 4PK4A 4U0YA 1R1UA 1ON2A 5GPAA 4BXXJ 2Y7KA 4U1OA 2VPLA 3PV0E 4G68B 1QVSA 2NYXA 2OLBA 3CR9A 4H6DA 3CD6I 2XXKA 1MIJA 1UFMA 3JAMZ 1JJ8C 3PMWA 5IZ3B 2VASA 4IXAA 5H20A 4ZYAA 4LB5A 2HAUA 3MZBA 2Y30A 1FBHA 5FB2A 4OETA 3K2AA 3HC7A 4BH9A 1I6HJ 2STWA 5IKBA 5ET8A 3KIOA 2A6HF 1R1NA 3OIQA 4YIIA 4FJPA 1K4TA 3U72A 3TTMA 2TCTA 4GFRA 5T3JA 1XGNA 4XLNF 2RV8A 1FYKA 4I99C 2PMHA 3JRDA 2KHMA 3BPXA 3GFMA 1XSXA 3K4MA 3F23A 3IO4A 2O69A 4G77A 5FBPA 4Y7NJ 2GWRA 4HQMA 4E7HA 2JA8J 1OMPA 4U23A 2K02A 2FUG2 3HJEA 2HYJA 4KUMA 3LSLA 3OYFA 4LVQA 3TAJA 1FBSA 4EATA 1LQ1A 4FORA 4N9IA 1MQIA 1Q1HA 4CICA 2QLZA 5GAHJ 5LD2C 1RYOA 2RQQA 3GTLJ 1JT0A 4L9NA 1KQ8A 1EZPA 2HWVA 3KE2A 4BE1A 2VUMJ 3A3UA 2H25A 2ICWG 1D9VA 4MJOA 4P3LA 1MSEC 1MM6A 4FT8A 1LFHA 1UTHB 4G8HA 2X4HA 3Q29A 2FHYA 1G59A 3VYUB 2D2WA 3DXJF 5ICEA 3S2HJ 4F3GA 1TT5B 1H9TA 3LSHA 4HE1A 4RB3C 3E6CC 4O6JA 1YZ0A 2QS2A 4N15A 5CRYA 1VI0A 4GL8A 3GYHX 2RQPA 3HPGA 5H8SA 3HSRA 3LA7A 4HG2A 1HKTA 2M87A 2XXXA 2CW0F 2Y31A 1RPWA 3K10A 3BJOA 2B7EA 3I53A 5J1RA 3P9CA 4MBPA 4OTEA 3IH3A 5LGUA 3Q28A 1FPLA 2F6GA 3TBIA 3J7YJ 4IHYA 2IS1A 4HE2A 4HZFA 1I6BA 3DBLB 3L2WA 4NWDA 3S2DJ 4G7OF 2DO7A 1Z1DA 4Z7EA 4RGUA 3DKWA 3CF2A 4IO6A 1Z67A 4V2FA 2K4JA 5ICGA 2LKXA 1BC8C 3OELA 4H5GA 4UHTA 3WTTC 2UVHA 5H8FB 3I5UA 4BDNA 3H9QA 1ZRCA 1X3UA 2XVCA 2FBHA 2OBPA 4FE7A 1VZ0A 4JX5A 1MMAA 4CYCA 1X1BA 4QFPA 2VODA 2V79A 4DCXA 3MZ9A 5I84A 3IH2A 4HSRA 3UNGC 4KCCA 1LLSA 1IN6A 2XXQA 2D1VA 4MTEA 3ILTB 4ZEFA 4MO7A 1IUFA 3QAXA 2DA3A 1XS9A 4L0YB 1NKXA 4OVPA 3GUDA 1TWFJ 1YE9A 3ZCOA 4BGDA 3BR2A 1F5TA 2F35A 3HOSA 5JEIA 4EQBA 3W9VA 3LSIA 3CJQB 3MKWB 1TT1A 2CU7A 3H5RA 1O57A 3WTUC 1K6OA 1W36C 1M5FA 2WC2A 3T0JA 4WWCA 1WJFA 4RK2A 3DCFA 4XEQA 5H2FC 2JQ7A 4XKWA 1UQWA 1POGA 1BR4A 5LDZA 4UUTA 2B3BA 2JMWA 1QUIA 4E7KA 4DIGA 4M9ZA 4IJAA 1R5ID 1TWAJ 3GTKJ 1JP4A 2Z22A 1FC3A 1OQYA 1G0HA 3BR3A 4A93J 1YG2A 5AE4A 1WJAA 4F3QA 5DM6F 4A3LJ 1QULA 1UHWA 3KP3A 5EZGA 2UVJA 2A5WA 3T8TA 4GOTA 3EYYA 3SDFA 4IOCF 3FHNA 4P5OA 1MMNA 1VFEA 3TMGA 2RC7A 3FISA 1GVJA 2MD5A 4JQFA 4RGSA 4D0PA 2R92J 1NUZA 5B7DA 3QMFA 1OCCH 4BJ5C 3C3WA 1RRJA 1R23A 3PL8A 4RGRA 3QIMA 2CWEA 3CUOA 4GWSA 4JVDA 5ELVA 2BGCA 2ECBA 2KIUA 5DCMA 4YG2F 4U7DA 1VQNI 4Q5SF 2B4LA 2DT7B 3K4JA 1T0FA 4ITVA 2R0QC 5F0HA 4CXFA 2W85A 2Y7WA 5J40A 3U1KA 2P3VA 1WHUA 4KCDA 2DS9A 1S5LC 3IOWA 3SEVA 2PI0A 3KZZA 1BKAA 3SEUA 2PT2A 2KPMA 3FBPA 3CTAA 3ML6A 4I0BA 2VE9A 3RTWB 1VQKI 1MKMA 5HODA 1Z7LA 1W1WE 2LG4A 3T0YA 3WU0A 1FZPB 1RKWA 1SVOA 4H46A 5F7VA 3G3IA 1FOYA 3JRGA 4F1YA 2M45A 2NS8A 2EBIA 3K4BA 1R6RA 3HOZJ 4OEUA 3RQIA 3MWMA 1ZBMA 3CFLA 2CMOA 3BT9A 1W5SA 2H94A 3TZAA 3FDYA 2E1OA 1HSEA 2ALUA 1LNWA 3EDPA 1FNNA 5J1YA 4KPTA 2MG4A 3I56I 4HS7A 3KX2A 4BXUA 2H5YA 1V5EA 1P4XA 4IQJA 2XX9A 1Y3NA 1XCVA 2V93A 2FMLA 3VLVA 1FJ9A 3ODBA 1HA8A 2ELJA 2KQRA 2R7OA 1B9MA 2MC3A 1Z21A 4B4CA 2K86A 1JVXA 1V5GA 4DYRA 3IAS2 4YKIA 4PQJA 4R9GA 4O8MA 1SDXA 4NEDA 1F43A 1G4DA 2OBGA 5EEAA 1EKEA 1QKBA 4XLAA 1DP7P 1VQPI 1FBFA 5E1ZB 1YXIA 2Q88A 2Z8DA 2EZLA 3HZJA 1FTKA 3I54A 2QS3A 4C0RA 4F2OA 2LY1A 1QRYA 2R7FA 4OIRF 5ET5A 1NMUA 5FD6A 4MIJA 1IEJA 1MD0A 2Z2SB 4PCQA 2I0CA 4IO4A 2V26A 4GX3A 2VOZA 2P81A 3VODA 5DTDA 4D1QA 1O3QA 3PNYA 4AM3A 4IGTA 1AIVA 1VQMI 4HNVA 3M3YJ 2KL4A 1K61A 4R6YA 1IXCA 2ZNZA 4R72A 3K70C 2VONA 2F34A 3S3MA 2VXDA 1JUMA 2JT1A 1UB9A 3NQOA 2JUCA 5HS8A 4AB6A 4PGNA 2FIEA 2GRVA 2H09A 2LD5A 1IN8A 2F5CA 4F39A 4IY5A 1NUXA 5I3SA 3GFJA 2IXSA 3FM5A 1I27A 4RB2C 4IB2A 5BQTA 4NHBA 4QFOA 1Q35A 3PUYE 4YMAA 1VE4A 1KONA 3J80Z 2ZZVA 4DIQA 3TCHA 3QPHA 2QSFX 2KQZA 4JK1X 2P6SA 2WADA 3OXNA 5K1YA 3HSEA 3QOPA 5HNHA 4QTRA 2DWIA 1I50J 2MABA 4IHXA 1WKMA 1R1TA 3DF8A 1SQYA 2FA7A 4PP0A 1JHHA 3GVAA 3GTJJ 2V1NA 1F36A 1BJZA 1PP7U 5IT9K 1ZLJA 3IP4B 5D8LB 3CCVI 1Y6IA 1X3WB 1CF7A 1VQ6I 1UTBB 2QPQA 2GH9A 2XXRA 4JYKA 1T8IA 4P47A 4I98B 1WWXA 2DMPA 1HW2A 1B1BA 4XTCQ 1ZQ3P 5M5WJ 4PJ0C 3W2VA 3KP5A 1IGNA 2Y0SN 1RETA 3FBIB 1BOAA 3V5AA 2L9VA 1U2WA 4QSDA 4X48A 3V4GA 2ZJPF 4LQ5A 1OPCA 3ISPA 3TO9A 3BPVA 4C2TA 4Q30B 2A3SA 3TDUC 2DLLA 3SZTA 3JRFA 2H4IA 1MZBA 2IA0A 4AIJA 4OVJA 3RKYA 5KDTA 2OK2A 1D1AA 2EZIA 2DQRA 2YPRA 5KDTB 3JRHA 2OTJI 3VOEA 2AXLA 2MD0A 2PX9A 1XT8A 5C3EJ 5JTYA 5LRRA 3PPOA 1RDYA 3HG9A 5L9MA 4DI4B 3R60A 1X1CA 2EA2A 2IGOA 2JJ7A 9ANTA 3TW6A 4EM0B 1FYMA 1DTGA 3OIPA 3BBRA 2M3AA 4PFUA 5JTYB 2CQ7A 5LEKA 4EJWA 2Z33A 3W2WA 2XKPA 1B59A 2THIA 5DV5A 2GBYA 2OF7A 2BW3A 3WODF 2G9WA 2XDVA 1SI1A 4X1BA 1IIWA 2WBDA 3QU6A 2OC6A 1JNFA 4NG7A 3V89B 4MF3A 2XAUA 3I9V2 4LZ8A 1UIUA 4BDZA 3FXMA 1WJEA 1FTZA 2GHBA 2XXVA 1R7JA 1WH7A 3H3GA 2CV0A 4NF4A 3VWBA 1NV4A 2HYFA 5J4VA 3JSPA 3I4MJ 1FOXA 2B63J 3I58A 2LDUA 3P9KA 3H36A 3KN7A 3G2BA 5A2QK 5FLMJ 3EHSA 1YS6A 2W57A 3DPLC 3BZKA 4E7LA 3EHUA 2V1XA 3JR9A 2CV1A 1BLFA 1VNDA 4CCLA 3CCQI 1NV5A 1TLHB 2FVZA 4NMYA 1Z77A 3E97A 3VV5A 2KIMA 4WKMA 2QCOA 3DP7A 2Z9OA 1YRNB 4WX9A 1Y1WJ 4IO2A 3RNNA 1T56A 3T1BA 2V6EA 2ECCA 4L17A 2B4MA 1DBZA 4MNIA 1H88C 4N07A 3CC7I 3DBRB 3R6UA 1LFPA 3E7LA 2Q2EA 3K7AJ 3ZMVA 1XVXA 1IRZA 3LR1A 3RT6B 1H89C 2NS0A 2FU4A 3MAMA 3GZ6A 3W3CA 1YIJI 2Q2EB 2LH9A 4HDUA 3MQ9A 3VXBA 2M7BA 3QXMA 5F1RA 5IT3A 2HOAA 5BS6A 2IP2A 5HDNA 3TEDA 4JWOA 4ZEBA 4U0WA 2V3TA 2DXYA 5IOYA 3FMQA 5K7FA 4MAGA 1ZHFA 1A55A 2PFYA 4EEFG 1A8EA 1MQHA 3CHGA 3F21A 3OY9A 4CA0A 3TP3A 5ERIA 3M9AA 1NV7A 2A69F 2WV0A 2DYXA 2DXRA 1D5VA 2VKVA 3KP4A 2E71A 2HTJA 3BDDA 5HS9A 2R6GE 4R2FA 1LJ9A 1JGSA 4YKKA 3I5OA 1XD7A 3H3ZA 3J81K 4FX0A 2PMZN 4G12A 1FLIA 2ZNSA 1FJLA 3TQWA 3C36A 4OESA 4P9FA 1LPQA 1IUYA 4A3CJ 1SMYF 4LIVA 5M5XJ 4BBSJ 3CFXA 2ZJRF 4AIDA 4MX6A 2ISYA 3SEXA 4KN7X 2WTEA 3K02A 1XX5A 1YW9A 2HQAA 2JVHA 1D8KA 4A0XA 1OCPA 4X0GA 1GXPA 1ZIUA 2V25A 2JWTA 2WBBA 1NUYA 1YW8A 3E4RA 3COAC 2F7CA 3Q27A 4GYGA 4QWQA 1FSAA 4GYIA 3ZMUA 1YAEA 2Y5LA 4XF5A 3HIFA 1J1NA 1FX7A 3V7CA 3OV8A 5DTBA 3MEXA 2G7UA 5J8CA 4IRIA 3EQLF 3H0GJ 3KP6A 3PSIA 4OHNA 5CM6A 3S9NC 2L2OA 4ZECA 2AXTC 3WHCA 3U65A 4A3JJ 3IFAA 3OO7A 5GAGJ 1FEXA 1HOMA 1Z7NE 1M1EB 2ONKE 3WE3A 4MNPA 1A35A 4X1DA 2DA1A 1TWGJ 2I4BA 1F1ZA 1J75A 1GHCA 2XF7A 2W24A 3KBZA 1QVTA 4U4XA 4HW0A 5IYBJ 2XWKA 3ULQB 5F6FA 4DBQA 4RB1A 1FTOA 1KA1A 4NN3A 3HGYA 5HLHA 4O3CA 2V9PA 2ZO4A 3U92A 4AIKA 3N94A 2ESNA 1AMFA 4UACA 5M2VA 1FMVA 3MP8A 3MP6A 3PNVA 3ZPLA 2E19A 4GXAA 5L3FA 1JW1A 4M3EA 3K4CA 3BR0A 4G9YA 2H1KA 2F7BA 2BY3A 4MEVA 3EQ1A 2DOAA 3FJ7A 3BIHA 3S9MC 1IN4A 2OQGA 4MFDA 1NH3A 1G3SA 2ETHA 2P8TA 3LWFA 5D5XB 1M5DA 3JCUC 2VT5A 1S9HA 1R4MB 4ESBA 4HV6A 3D4CA 3FV1A 2Q8MA 2NOJB 4EJTA 2DK5A 5E8GA 1MBJA 3GXAA 1VQ5I 3DEWA 2XXUA 2ZXHA 3TMOA 3OSFA 2F3DA 4C3IJ 2XGEA 1LAHE 1YITI 3P5JA 4AD9A 1C0WA 2OPTA 2HVSA 3HRTA 1URSA 3QODA 2H99A 2CO5A 2JUGA 2HZTA 5KK1A 1A99A 2HXWA 2HFBA 1LBZA 3E9XA 1ENHA 1XMAA 5CVVA 3NWTA 4HSTA 2VIXA 3H7MA 3U93A 5H8HB 3RLFE 1E3PA 2F5FA 1TWYA 2JSPA 3VVFA 5B70A 1EA3A 2QM3A 1D0XA 3RKWA 3HOTA 2G0EA 1YX5A 1B1XA 2XRLA 1IMBA 3CJNA 2K4BA 2PG4A 4YFNF 4E7ZA 2DQLA 1DOTA 5J6XA 1EH6A 1UHSA 3G1LA 3DP8A 3HGGA 2QEXI 2VBYA 1N76A 3H3VK 2VP1A 3PMXA 3V8XB 3H92A 3HM5A 2XAFA 3N97A 1LB8A 2CZKA 4F93B 1OYIA 5EEHA 1R22A 1QVUA 3NEUA 3SZPA 3HDDA 1JXSA 1B9JA 4XOPA 3CUQC 4IO7A 3KZYA 4L9TA 2CV2A 3RZDJ 1TTYA 3L2UA 3RCOA 2XWVA 5IP9J 2E7WA 5BPIA 4AS5A 2DYRH 4DYCA 1MPDA 1SI0A 1XC1A 3TELA 3EYIA 3H3UA 3I59A 3OSRA 3G71I 4BHPA 1EZOA 1Z9CA 4GIZA 2K9MA 5D5VB 3BCAA 2RNJA 3ZQIA 2IGMA 2L7MP 1X3ZB 2WAFA 3KZIC 4IO9F 4GFBA 2HYGD 3T5XA 1U0JA 1JUPA 4X6AJ 1LDKB 1SW5A 1FPBA 2A5TA 5JR3A 3QAHA 3PO2J 4Y4RA 1ZG5A 2HOSA 3MVWA 4OZ9A 3E0JB 3MKZA 1UG0A 1T6SA 3T93B 2XKOA 1D0ZA 1FJ6A 4CZCA 2TRTA 3RZOJ 2LP0A 1FPKA 4RLFA 1Y3QA 1UELB 3BIGA 2RKHA 4CH7A 4ZEDA 2QVRA 3WTWC 3S3OA 2DOJA 3F11A 2P7VB 1BK4A 1BTJA 3PUXE 2NUVA 2CS3A 4PFBA 1U6GA 3F8NA 5D5UB 2EFWA 1PB7A 3WU2C 3HB9A 2FSWA 1EF4A 1H45A 1ZG3A 1D0YA 1HW5A 1Y0UA 4LFUA 5I7IA 2VI6A 3H6UA 4NC6A 3G3GA 2LYCA 3S1MJ 1D4NA 2V3UA 3TDJA 3THIA 3B50A 5IGAA 5HLTA 1K6YA 2Y9ZA 3FXLA 2QSGX 5FLXZ 3O3KA 4QF9A 2DQVA 4KFQA 4M6YA 1HSJA 4BEHA 2REJA 3T9UA 3KEYA 5I58B 3F8FA 4A0ZA 1V3FA 1S72I 3U1DA 3G3HA 4EGYA 3V42A 4OU0A 4MCOA 4BEHB 3M1EA 3BJAA 4N4NB 4FEDA 5JK4A 3BTIA 1SFOJ 1ZLQA 3BZCA 3OIOA 1J2XA 2LY2A 2RCAA 5EGOA 4BLAA 1N77A 4IQ4A 5ITOA 5EQ9A 3K4LA 3E6DA 5EGOB 1ZREA 4UA8A 1Y20A 2O6AA 5HDGA 3RPUD 2F36A 4ZYDA 1GLNA 3CUQA 1RIOH 2I6EA 4KHZE 2ZFUA 2HVRA 5J16A 1QKAA 1WVJA 5TPAB 5M3FJ 5E3MA 4XN3A 3VFJA 3F3XA 2X26A 2X51A 1MH4A 1N25A 2XPWA 3ZN0A 4BDLA 2DPUA 2FRHA 3PD8A 1B05A 1GTKA 3PO3J 2OCUA 3TTLA 1PUEE 5H8NA 4PFIA 5I56B 2W84A 3B6TA 1K9YA 3K2ZA 4F55A 5H8QA 2EINH 4FBPA 3KSXA 5H8NB 1MMGA 1N04A 1W36D 3KEOA 1AL3A 4YFKF 1JEVA 5F24A 5H8QB 1ZMGA 2I3VA 5D4RA 1FBUA 2GIVA 3TP0A 2L7FP 1X19A 2WB1A 3HOUJ 2K3PA 2WYPA 2KRCA 3LA2A 1B32A 4XLFA 3RQ4A 2R7TA 2QBYA 1DPUA 3DP4A 5K2XA 2QA4I 5D5WB 1W5TA 4MLOA 2F5DA 3VB2A 1PB9A 2WV1A 4O5VA 1U8RA 1XS5A 2RNGA 3FVGA 2NS7A 1IDZA 4JSOA 2CEYA 4OFOA 1CQTA 2F4OB 1Z6TA 3F6VA 5K7ZA 4B3XA 2ZSIB 4GX6A 3CQZJ 2RF1A 1P4WA 1QZZA 4KFCA 2DE2A 1M5BA 3K0LA 1YI2I 1WSUA 1LUJB 2IS6A 3SJMA 5L3EA 2O61A 3HSFA 3OD7A 5LEJA 4GF8A 4M4GA 3LSPA 4DLDA 1Y1ZA 3BG9A 3GLLA 1MXXA 2QQBA 1A6QA 3CCLI 1PC3A 2OZZA 4MQVA 1T38A 1CGPA 3O97A 3X2QH 2OU2A 2FOKA 3SEZA 3L9FA 1S50A 1SW4A 4A3KJ 1IXSB 4LG3A 3JRIA 2MFZA 3N05A 1JKQC 1FY7A 1DMBA 4OFLA 1RKTA 1O3SA 2DW4A 1FPEA 1G0IA 1TWCJ 2HQ0A 4OENA 1LAXA 1T33A 4ZJZA 2QQ9A 2IW5A 2V4CA 2XX7A 4S0HB 1ETWA 3U21A 4R75A 3MZ8A 4XMYA 3HRSA 2NVXJ 5TP9A 2NXNB 4MLVA 5C44J 3IL2A 3L2CA 2GIZA 4G68A 4WXDA 3ZQ7A 2HEOA 1K83J 1IDYA 1D9YA 4OXVA 1MQGA 4TOZA 1DDNA 3I71A 5IZ3A 1GVDA 4IKFA 3MMYB 2DP8A 4POXA 1B7UA 4A3DJ 1ETXA 3FZVA 3GCMA 1R5GA 2Y7IA 3JYRA 1ETVA 3CG1A 2L7KA 2K9NA 5L3CA 2RDPA 2HQRA 5GAEJ 5FKOA 3D1NI 1KGSA 3FATA 1TWHJ 3BJ6A 4NC8A 3IOTA 2A6TA 3GYYA 1EZ9A 2FNPA 4GLIA 4XBFA 1Z7ME 2DVCA 4D7MA 4F3PA 4OIQF 2K9LA 1IXRC 3OYAA 1LDDA 5IAIA 4ZH4F 4IOAF 1HF0A 4A3FJ 4F3SA 1IXHA 4XKNA 3S1QJ 1YCJA 4M3GA 1B3FA 1U9NA 4DBRA 2CYYA 1UJ8A 5DT6A 5FTIA 5F64A 5I59A 5EQ8A 4NUBA 2NVTJ 1B7HA 1FQCA 2NXOA 4C2MJ 3R0JA 4H5FA 1ERDA 5A5LA 5GADJ 3ZQLA 5I59B 3B6AA 2E1CA 3KP7A 1P2FA 2PJRB 2BY0A 2EIMH 2RC4A 1E3OC 1UTHA 4NBQA 2M7AA 4I3YA 4BQAA 5FLVA 3VYTB 4P8BA 3K70D 2WX9A 3GW2A 1B5HA 2ZJ2A 4XNFA 4ENKA 1D8JA 3K6WA 1JVYA 5B66C 3TKDA 2FF4A 2Q74A 3U9GA 4J19A 4G8MA 4R1HA 1B9NA 1WJBA 2OD5A 4F7ZA 3PJRA 3MN2A 2FBPA 3N5LA 3QPLA 4QSCA 3QPSA 4LMYA 3WTSC 3TTNA 2PFZA 2VJIA 3PPNA 2JA5J 4C3JJ 3IRRA 3FKJA 1TFDA 4F91B 4HXVA 3BFTA 4O3AA 4M74A 3RQTA 1P99A 1S9TA 4C1UA 4P1WA 4R74A 1S7OA 2Q0OA 4XKVA 1I6XA 3L6HA 2MLKA 1ZR4A 1DPRA 2HQ5A 3RN8A 1I3AA 1U3EM 3KEIA 1ETOA 3HUGB 4RAZA 5E1WA 1TQPA 4HBLA 3EN3A 3KC1A 5CVJA 2VB6A 3G73A 4L5EA 4BY7J 3HXLA 1FBPA 5H8FA 1NHAA 2QGUA 1IF1A 2DTRA 1U9OA 1WJDA 2O68A 3LUYA 2L0KA 2HR3A 2F97A 1FQFA 3K2DA 3MW0A 4PSWA 3K6GA 4HDVA 5FRNA 5AA4B 2VQCA 4GCVA 1IMCA 3PM1A 3LSRA 1UZCA 5KCJA 1LAGE 3M8UA 3E5QA 1EH7A 4PGHA 4I2OA 2LOOA 1SVXB 4PFOA 1WZ2A 2KKOA 4KQPA 4RNSA 5ILVA 2P2AA 5KCJB 3J7AO 1B2HA 5DCFA 2GQ1A 2P0WA 2FX0A 3HN0A 4QHQA 5ET6A 1H44A 5LFAA 1DPEA 1FBQA 3HBLA 4HPQA 1A54A 3CO6C 2R7RA 3DM0A 4LATA 3IAM2 2QJEA 4S04A 3H9JA 5E18F 4YB6A 5EHSA 5HM4B 2QUFA 1QHHD 1TBXA 2EZKA 2O03A 2Y48A 5E20A 1IMEA 2G7HA 3OEKA 2EV5A 3IOUA 1OKRA 2VKDA 5FHNA 1FSEA 2E2IJ 2ZXTA 2Y2ZA 1KU2A 4Q5TA 1NTCA 2IVMA 3PPQA 3NOHA 3M8FA 3FM3A 3JRCA 3T22A 3A01B 3UK4A 2J5PA 1Z0XA 4RA2A 3B6WA 5KHDA 1IXGA 1FBCA 4RA1A 1VQ7I 4E0XA 1XCBA 2WAEA 4ELQA 2L4AA 3G3ZA 4B47A 3BC8A 5ISUA 4UB8C 1AKHA 3DQVC 5C4XJ 2I0BA 4W1UA 4MLQA 3JSOA 3G6EI 4Z0IA 2UXNA 1BJAA 3DEUA 4PUSA 4UVCA 1AKHB 4EJVA 3ZQQA 3B73A 3HOWJ 2AIXA 3QYTA 3MUQA 4PSXA 3Q25A 2AL5A 2QMWA 2GLOA 4F3BA 3TODA 3IK6B 2PX1A 3OR1C 5FKLA 2E2JJ 1UG2A 3HL2A 3HV1A 1XDSA 1KQ0A 2ZKZA 2VE8A 5FHMA 2JZYA 2AQEA 2K85A 1OCTC 5ITPA 2DTZA 4CCOA 1RZ4A 3KN8A 5HPQA 4PFTA 4FE4A 2MYSA 4ABZA 4PAIA 3RPUA 4BJ6C 3RUMA 3W15C 1ITYA 5HDKA 4E7IA 3QYEA 2EIJH 3OYHA 1D1BA 1MJ9A 3IR1A 4EXKA 2R5ZA 5BUUA 2IA2A 2JPCA 1DU6A 3IL1B 4NX1A 1WVRA 4XL9A 3IKVA 4I6ZA 4MQ9F 1OLTA 2LMDA 2O3FA 3FHZA 2R5ZB 1I6AA 1X2NA 3D4GA 2YX7A 1II5A 3VEPA 3FIRA 3OSQA 1P6RA 4AIHA 2VBZA 1RUOA 2IBDA 3CMMA 3AAFA 3KLNA 3TQLA 1MXWA 4GX4A 1SYIA 1XOCA 4IHWA 3FBNB 2F6PA 1ULYA 1IV8A 2IEKA 4AUXA 2NVUB 2QS4A 1DQUA 2DA6A 1A31A 2RINA 4D5FA 1AHDP 2GAUA 3SFZA 2RCBA 2VBWA 1QJMA 1EYKA 1Y1VJ 4XOTA 2Y7PA 3F0CA 4O7MA 2M4GA 4IO3A 2ADUA 2DA5A 1MY3A 1BIAA 3RYPA 3HRMA 1ZYRF 1XMKA 3NAUA 3K6UA 4NF8B 2JRMA 4E4HA 2XSDC 4O94A 1Q1VA 2EA4A 1G3TA 2X9DA 3I55I 3IB0A 2HPGA 2CH0A 2L3DA 4TQUQ 1WPKA 2HKOA 2PVUA 3H1CA 4MGRA 4KA4A 2DDAA 1MSFC 2HTSA 4E7SA 4ZE8A 4HX8A 4CCMA 2B3FA 6PAXA 1GDTA 4YZZA 2Q9TA 1XSVA 3M1CA 4Y33A 3VSKA 5DYMA 3PGFA 5FKNA 2LLKA 2JA7J 2ZMBA 5I57B 4XIGQ 5DVJA 1OVTA 4E0WA 2P4WA 3VPRA 2F3BA 2H8WA 1RDXA 4OERA 3KBRA 1BW5A 1ODDA 2CEXA 1BI2A 4F52A 1EH8A 1ETQA 4M9SA 3S2WA 3OYGA 2P7CB 3FMRA 3K1NA 1QZEA 1FTJA 4P96A 3CCEI 1WCMJ 2M34A 4P9UA 4EGZA 1INPA 5TU0A 4EQ7A 4V2GA 3K6VA 2PT1A 1OVBA 2A6EF 1VQOI 2VGQA 4N4OB 4RDUA 2MGQA 4U22A 1KU9A 2RKMA 2FE3A 2EK5A 1OQGA 3G3KA 2EV6A 4LLLA 2X6OA 3OYNA 1WJ5A 3OYDA 3EHTA 3J7AY 4GL0A 1EV7A 2RAEA 1N3XA 1OIBA 3O2PE 3K4NA 2LKPA 1I6QA 4XSZF 3MBPA 4FE8A 4Z6YA 2WWYA 1L5TA 3C9HA 4HTGA 3MFKA 2P3NA 4A6EA 2Q8JA 2CUZA 2F78A 3BTJA 4ND9A 3CC4I 1NK2P 1D3YA 2X48A 2O0YA 3O28A 1V4RA 4XKPA 3DLLF 3ZXSA 4BNCA 1JKPC 1UTBA 1SYHA 4H0WA 1A6IA 2BBYA 3CMEI 5AIPA 3N6TA 1W7PB 3VYRB 4NF0A 2ZYKA 3LFKA 3U94A 2RGVA 2AHQA 1TP4A 3OL4A 3OYCA 1NK3P 5IT9Z 2DDBA 5IM2A 1SD6A 4GO1A 1MPCA 1XG1A 3KFMA 3A29A 2ACJA 2J5OA 2Z99A 3EUHC 4WF2A 2EFPA 3ZQCA 2BOLA 2HDCA 1IZ1A 3GWZA 3LQQA 1D5YA 4JBAA 1E17A 4PAKA 2NVYJ 1JGGA 4XKRA 3SKPA 1SW2A 3TO7A 3LQRA 3MCZA 5HLIA 3LAPA 1FTLA 1LEBA 4GGGA 1MBKA 2CFXA 5J47A 2PYYA 4E7JA 1AA7A 4BAYA 2CQXA 4ZS9A 4F19A 2H9BA 4HLYA 3H5AA 5ED4A 3Q0WA 1FPGA 3SERA 4HF2A 3O8HA 1F9BA 4LD5A 4LK0F 3H06B 3WU1B 4B8XA 4U2RA 3V8JA 3HHGA 3ZOBA 1WODA 2KISA 1B46A 1Y9UA 3D5SC 3F8CA 5EG0B 4BUPA 3IJOB 3GTQJ 5IOZA 4NF5A 3GXOA 1QA6A 3BKIB 4X04A 3B6QA 1I5ZA 4RAYA 5JLXA 3CP2A 4NF5B 2MBFA 1WI9A 1YW7A 2VT2A 2LBFA 4ELOA 4PDHA 3E6BA 3IH4A 3K4UA 3HYIA 1SFKA 1IW7F 4MIMA 3RPQA 2GXBA 1J9IA 2LBFB 2DMQA 4GDFA 2UXAA 3LBSA 3M3KA 2DT5A 2KT0A 2R7SA 5LOMA 3OOPA 3S1RJ 5GTHC 4PDDA 2K3FA 4GXSB 3FJMA 1MM7A 3I3LA 4EDPA 3BQYA 3UP9A 5F08A 1XHYA 2A5SA 1AH5A 1Y8RB 1OCRH 2PQ8A 1R9LA 4UV8A 3QUJA 3PSFA 1MY2A 1SD5A 2FQ4A 2CZIA 1YLFA 4PAFA 4C9YA 4FHTA 5L9SA 1NV0A 2XGCA 1YRNA 1MQJA 5A2QZ 4RK9A 3HO7A 3L09A 1YTYA 4HV5A 2QL3A 4YIRX 1DUXC 1FYLA 4ZZEA 3TDZC 2L01A 1W0TA 1RR7A 4Q4ZF 3MZHA 4RBOA 4XSXF 2QVUA 1NG6A 4R8HA 1FQDA 4BYYA 1OYYA 4EV0A 3CCJI 1MXUA 4YB7A 3JREA 1PDNC 2ME0A 2ELHA 4UUVA 4UVAA 4PJLA 2LREA 2IEEA 5DEQA 2A68F 3A0BC 3GMEA 4BXFA 3S1NJ 1LDJA 2WB1N 2F5VA 4A3GJ 1POY1 4PFRA 4P0GA 2OTLI 1GV5A 3TGNA 3V7RA 2ZXIA 3KP2A 2DMTA 3GZNB 2YPNA 5K5RA 3OEMA 4BHBA 3HOYJ 1MY4A 3O66A 4HE0A 4MNUA 3ROJA 5ESYA 1R9TJ 2EWNA 3KYCB 3BOQA 4YU0A 2XIGA 1UCRA 4NC7A 3T8RA 3BFUA 2M4KA 1NNKA 3JTGA 3G3FA 3L2QA 1KA0A 2HCAA 5CVRA 3T96B 4H4KC 2X1CA 2XGXA 3FXJA 1BW6A 2OCEA 1QBJA 2IPQX 1L3LA 2JA6J 1O7LA 2Q2CA 4KYDA 5FHOA 2V4JC 2XAHA 3S2VA 2DODA 2O7OA 5HLGA 1SFEA 3ECRA 1UHMA 2WYKA 5F1QA 2OUMA 2QQ8A 2AO9A 3SDBA 1UMQA 2HU9A 2V1UA 3J81Z 1OISA 2VQLA 3E13X 2HS5A 1ZKBA 4XKCA 3B7DA 4EJOA 3DKYA 3O2AA 2WY7Q 2M0MA 1VR5A 2M2EA 1MY1A 2REGA 4PJNA 3MPKA 4PJMA 1HC8A 3DV8A 5ILUA 3SHFA 1VFCA 3BR1A 3QUFA 2GZWA 4H1XA 2P5KA 5CQEA 3CC2I 1H43A 4LQ2A 3OYLA 2D5WA 4G7HF 4A3IJ 2R7XA 3GFIA 1TXFA 1X4PA 2DFIA 1IJWC 1OR7C 1XTAA 3OOAA 4WXHA 2F7AA 1B3LA 4JBZA 4Q0CA 2HXIA 2A61A 1JEUA 1W5CC 3MVPA 2BJIA 2MSYA 3BWGA 3MKYB 4UUSB 1FOKA 3S14J 1LSTA 3VXCA 5ICTA 2I3WA 2DA2A 2VPRA 2XRNA 5ICCA 4ESWA 2R7QA 2XXWA 1GUUA 5J1UA 4KNYA 2FNAA 2QZ8A 3DTIA 5A5XB 3D1RA 3ZR8X 2XXYA 5CYVA 4LZ7A 1XB4A 4L5JA 4XK4A 2XAJA 4B1RA 1HBXG 4FASD 3OO6A 1A04A 3IUOA 4G94A 2ISZA 1US4A 3C32A 2LC2A 3O8GA 4ZDMA 2DK8A 2DI3A 2X85A 3M8EA 4ZZLA 4RAGA 3IWFA 3QRFF 4N6PA 2VKHA 4B48A 1O7FA 3WTXC 1FBEA 3GLBA 1BC7C 1TNTA 3OMBA 1YX3A 4N81A 3TFLA 5LHHA 2W7YA 1DP3A 4BQQA 4YKJA 3E78A 4YFXF 1B6HA 2XAGA 1B5JA 2X7PA 3H35A 5DD4A 5LHGA 2STTA 3L00A 3MD2A 2AL4A 2KLOA 2R7DA 3HOXJ 4MEYF 4FISA 3W9WA 2W7NA 1IN5A 2ZBKA 4CYDA 4OQOA 2QKLB 4R9FA 5GPCA 3S9EA 2EV0A 2NVQJ 3GBAA 3LSJA 3TCFA 3PUZE 1ZH5A 3CRBA 1Z3XA 1MGTA 3CLOA 2ZSHB 3MAJA 4EVIA 1B58A 2DWAA 4NWCA 4IPAA 4HYEA 4BU2A 1U5TC 3KC0A 4GBVA 3OYBA 2XA5A 1H0MA 4IY6A 5H8HA 1CB6A 5FKKA 2IGNA 4HRIA 2LTPA 4GQOA 3RI4A 1OLCA 2HQNA 3IHUA 4G8NA 1XGSA 2E5NA 2VBXA 4THIA 3BTCA 4HEA2 4M71A 2VQHA 2FYIA 3KYLA 2ZB9A 1XPXA 4IHTA 4JDFA 4OMYA 4UVBA 1SVLA 3D0SA 2PJPA 2Q89A 2DOEA 1OR7A 1KU7A 1K78B 2HI3A 2UYEA 2XXIA 1HSTA 1Y8QB 1H9GA 4HOBA 4L9VA 4LOCA 1Y56A 2JSCA 2Y75A 4II2A 3LUZA 2ELKA 1LCTA 2VXZA 1SD4A 1HW1A 3N26A 4N6DA 2DDKA 5M3MJ 3HEFA 3Q0VA 5AA2A 2DSFA 4RAFA 2V9KA 2CRGA 3K0VA 5AA2B 4EM1A 2PBWA 1HKQA 2ZYMA 3P7IA 3HTUA 2GOXB 1RKMA 2VKEA 3JTHA 1Q9DA 1ZR2A 2OJED 3L7WA 3EUKL 4KT6A 4M3BA 5LGNA 1FQBA 1I3QJ 3BG3A 2E60A 4A0YA 4LZ5A 2W25A 4ENJA 1LE8B 3Q0UA 5IYCJ 2JA2A 4XONA 4UNOA 5AA1A 1LFIA 1KU3A 1S29A 3QP5A 1OQHA 3WAFA 5CVIA 1B5IA 4QRZA 4M9XA 4N8YA 1ZAOA 2E1SA 4PFPA 4WXCA 1YYVA 1IXIA 3OS2A 2XD3A 5CMBA 2ZCWA 5E3OA 2EQRA 3CG3A 2ZZXA 1T39A 3KOTA 1LBVA 5FKMA 2VOPA 1T0KA 4ZEIA 3PIOF 2UV1A 4BDMA 4H67A 3GZ5A 4U7BA 2KDZA 4OINF 1P1OA 1NI9A 3FF5A 2JJKA 4GWWA 4Q8RA 4IX7A 1QO0D 1DSNA 2KP6A 3RKQA 2R7ZJ 1JW5A 1VQ9I 1N75A 2ZYOA 4P11A 4AS4A 1BI3A 4EJUA 4NGUA 2MC4A 3ZSFA 4HLXA 4D9JA 1IRGA 1MPBA 2X6YA 3FVNA 4DXCA 3UGWA 3NWSA 4OIOF 3ZMSA 2HFHA 3GF2A 3M8JA 5CKTA 4NQWA 1U5TB 2M1BA 3SDGA 5I58A 2I8DA 3KJTA 4ZYEA 2FQ3A 4OAYA 4NQWB 1Y4TA 5FFZA 1SMTA 3OS0A 4DXUA 2BY1A 1ELJA 3DP6A 4B44A 4JVCA 2NNNA 5KVRA 5I2NB 1MNEA 5I2KB 3DKXA 5E3LA 5CMCA 4TLLB 2HZLA 3DPUA 5L3DA 4MHFA 3TTKA 2HKXA 3M07A 2PN6A 4OOIA 4UABA 1H3DA 2P0SA 3IB2A 4JWYA 2LAOA 4LG0A 3MP1A 3DBHB 4LA9A 4OMBA 1LVKA 2FEZA 3ABLH 1P1WA 1R58A 4AU7A 5ICFA 4TV7A 4LG0B 5TPAA 1Z05A 4RS8A 1P92A 1O3TA 1FW0A 3OYKA 1HCRA 1MRPA 3CIJA 4IGRA 4V19K 3HPIA 1MJAA 2XHDA 4IEJA 1KZHA 1LAFE 4I76A 4HX4A 3LNQA 4MH5A 4BDQA 2KFDA 4ZZAA 2BHYA 4KI0E 4F1UA 1MH3A 3OYEA 1IO2A 5E8IA 5L3GA 5LTCA 2KDOA 1MDMB 4ON0A 5I56A 1GV2A 5D4SA 4KITB 3PTYA 1FBDA 3V7SA 1HDPA 5CC2A 4HNUA 4GWXA 3DLNA 1S7YA 4GWZA 4OIPF 4RJZA 1ZGJA 2BEOA 4M6XA 5IPAA 1TL8A 2DE4A 4M3FA 2Z23A 4F31B 4C2UA 5FGMA 2IS2A 4PCDA 2VT3A 1SD7A 4LLNA 1BIYA 3T66A 1B40A 1SBPA 1URDA 2X7QA 3WTZA 2QYOA 4XLPF 1T2KA 3S32A 1E3HA 2ZXJA 2L9SA 3CCMI 5IP7J 5F27A 2HVQA 1AWCA 4UY8I 3FASA 1SAUA 3DFGA 5L3BA 3FVKA 2DJNA 4O3BA 2R93J 1FQAA 1LGBC 3RYRA 5CLSA 2VD2A 2W1OA 4KIBA 1FTAA 2XXHA 4ESJA 2ANJA 1FP1D 1B3EA 4PBHA 1YIOA 1R49A 2H8RA 3MQ0A 2P5VA 4CCNA 2HDWA 4DZPA 4OA4A 1LBWA 3QYFA 3PMVA 1BR1A 5B1AH 1AOYA 3WTVC 5C4JJ 2O7UA 4GWYA 2Q8KA 3RJPA 1FOWA 3Q3SA 3LA3A 5DUIA 2QENA 4LITA 2DN0A 1KWHA 2ZFWA 2PMSA 2L9NA 1YJNI 3PNTA 1POTA 2K40A 2PBIA 2HOEA 3ZQGA 1SC7A 2KLFA 3HSTA 3LSTA 2EB7A 3FXRA 2DYSH 1JUSA 5FRMA 3UN6A 2N8GA 4N91A 2VJ5A 1YTVA 2I48A 3OO9A 4P1LA 1J5YA 1ZKGA 2L54A 4XLCA 4MTDA 4X8RA 2RC9A 4H8IA 3VVDA 2MA3A 2ZNTA 2GXAA 3RPLB 4IR8A 3E5UA 4DOZA 2B9SA 3TOBA 3BCBA 3H0DA 2O9LA 5LHIA 1AWBA 2NOOA 2RVCA 4M72A 1QHGA 5JFRA 3K1MA 2Y84A 3E3KA 2M9HA 5HNFA 2F8DA 3E79A 1OYWA 2DFFA 2I5UA 4B3AA 3C18A 4JOMA 1E0EA 4KJZA 1YPNA 4PF6A 3QP6A 1I69A 4NE4A 3PPPA 5KNLA 3LSKA 1MDP1 1TFAA 4KMUX 5JHUA 2H98A 3KGCA 4U4SA 2NOGA 3R4KA 4FAJA 1W7PD 2XV4S 5EDNA 1JETA 3ZRGA 1O63A 3B8BA 3OYIA 3TCGA 5DS9A 3FX3A 4RLQA 4KD5A 3ZS6A 3K1PA 4IHSA 4DDDA 3HRUA 3GEZA 2R3SA 2ONRA 3CFZA 4ENNA 4DNCA 4AYBA 2GA2A 3M7GA 2HHMA 3CMYA 4AWXB 3OO8A 2E7XA 4XRSA 4XXUA 1FSHA 1J7KA 2XPVA 3CJTB 4DZ1A 3G3JA 1SW1A 2BY2A 2DA7A 1D9QA 3WE2A 1WFXA 4Y15A 1UIVA 4BBRJ 3OENA 2HNHA 4WXJA 2V84A 1B1HA 1K7AA 1JQFA 5LLQA 1EH3A 3OOUA 3A4CA 4AVZA 3A3CA 3RY3A 1ORKA 5TGTA 1X58A 2FMYA 2WA0A 2NNYA 3JAMK 2ZNUA 1R36A 2E2HJ 4N9HA 4OVTA 4NNJA 5E3NA 1GT0C 2IS4A 3PUVE 2PJRA 4GBWA 2W00A 4OWRB 5DVFA 3VLUA 1MW7A 4KICA 4JB7A 3F6OA 1LFBA 5CQGA 4RM2A 4QLCU 4NQ8A 1I39A 3FXQA 3TUSA 3AL0C 4H45A 3OMYA 4POWA 3RPWA 4WEDA 1PP8F 3AG2H 2BVMA 3FXKA 4EM2A 1A5JA 1A7LA 3HTSB 1JJ6C 1VDWA 1B0HA 1KYWA 2FBIA 3CP8A 4BS9A 3S3NA 1B0LA 1Y1MA 2EFQA 4XICA 3QSLA 2FIXA 5B5EC 4MFEA 3K9TA 3TYHA 4ONYA 3Q5FA 1KQ9A 1T98A 2M8GX 3SQNA 5HOOA 3QK6A 3U1OA 3ECHA 2H6CA 2P6TA 5LBQA 2OZUA 2NAZA 3S93A 1MS7A 2GA1A 3Q26A 1WGXA 1IRFA 3AG3H 4A5MA 2GOMA 2ABHA 2O7IA 1KA8A 1X1DA 5EZHA 1TNSA 1V54H 4LK1F 4YRVA 3KSJA 3RYDA 4Q47A 4ETSA 3CF5F 2XGDA 1UAAA 4BL0B 1LEVA 2BXZA 1JTYA 1VF9A 3HUGA 2HDDA 1BR2A 2VLAA 1ZELA 2EJRA 1R1VA 3NARA 5BPDA 1YO5C 2DCEA 3LSWA 5J1DA 2WY8Q 2O8XA 4AQ4A 3HOVJ 2L02A 1Y39A 1B51A 4NF6A 2FNCA 4BQOA 1R00A 2Y0MA 3IX1A 3C2BA 2QRYA 1F9NA 5TISC 4FEBA 2EPFA 4ENMA 3OSGA 2I49A 2O51A 2DOFA 4NF6B 3RTFB 5AA4A 2LKSA 5EYHA 3ASOH 1JW4A 4XR6A 3ABTA 1P7IA 2O5RA 1ZTYA 1ZGWA 2A05A 3AG4H 3T9VA 2VPOA 5KZTA 4O3MA 2KIFA 3H6TA 3WAEA 4ECFA 4RMNA 5BOXA 3EKIA 3CCYA 4XKBA 1HQCA 4N6KA 3Q9SA 5B1BH 3SEYA 2C6YA 3P9IA 1MBGA 1B72A 5IYDJ 1MXYA 1QPMA 4I9DA 4HF0A 4I1DA 4JXIA 4LIUA 2R7WA 5F0FA 1T0FC 2MKZA 1CNQA 3CMAI 1B72B 1EYIA 2H27A 4U21A 4D5CA 3BLYA 5BMZA 5EQAA 3GTOJ 2M30A 3ZQFA 2IT0A 3E6MA 3HPHA 4HX7A 1G3WA 4OAZA 2ID3A 4JP0A 4BJTA 3JRAA 4C30A 2LF7A 3BTLA 4EQ9A 4G6DA 2Q2AA 1LBCA 4IL6C 1ZG1A 1TW3A 3W2AA 3GTMJ 2CZLA 2QWWA 4ZYHA 3A01A 1PBQA 2F5XA 1QQIA 2CUFA 4CCKA 4DJAA 4CYCB 4Y3OA 3W6VA 3AL0B 1FTMA 1ZLKA 1QGXA 3V8LA 3IC7A 1FMWA 2XPUA 2HAVA 1NNTA 2DT6A 1ZU0A 1RNLA 3IRQA 1USYE 4DXBA 3TEPA 4AVPA 5J3LA 3AFHA 3L2RA 1B6AA 2JRTA 3MSTA 4I3EA 1B3HA 1FIAA 1SEUA 4C3HJ 4LN5A 4YEJA 3R61A 3SYTA 4PFWA 5DDGA 1J59A 2B65A 1X1PA 2HEUA 4UV9A 4IRGA 3NRVA 2QSHX 2DFHA 5F1JA 3SETA 3ONMA 5CBSA 3RGYA 4J01A 1ZN2A 4ZEKA 1DPPA 2YR2A 1LB9A 1R5HA 2D3IA 3I3VA 3RTRA 2HZKA 3FJGA 3PQJA 2LF8A 3CSBA 1NH7A 5JLWA 2YUSA 3JV9A 3MVXA 2EIKH 1H8AC 4F22A 2JN6A 2JPBA 1N0TA 5DD8A 4NTLA 3H5NA 2OWSA 3ZN1A 3SEWA 2KJCA 2OWZA 2D45A 2M0CA 5EQ7A 1JKOC 3ZKKA 2E0SA 4NAPA 1QU3A 4DZJA 1MXZA 3O6GA 1TT0A 5JHFA 1FP2A 2ID6A 1RDZA 2R4GA 4M1VA 2X1EA 4PGGA 1BM9A 5D6FA 1MXVA 2AYSA 2ZMEC 4F92B 2WAQA 3FV2A 2DVZA 1DU0A 2XXTA 2UYFA 5DCMB 1D3KA 3IB1A 2PLYA 2XWOA 3G7WA 4HNTA 4MEXF 4UB6C 2G93A 4XORA 4QXDA 4A5NA 3MPLA 3U2RA 3A03A 1J0RA 4A69C 1FCKA 3PU5A 4OANA 4QFNA 3D5RC 5EJCA 1STZA 2FXAA 2V1DA 5E17F 2QSXA 2CJJA 2KJBA 4KXPA 5CI5A 4RGXA 5F0CA 2V7FA 5IY5H 2O1LA 3HFUA 4NF8A 1AOVA 2COMA 2R8TA 5FO5A 3CO7C 3VYSB 3EPEA 3RDIA 1Q1KA 3PFYA 4KN4X 3F72A 3TL4X 4KT5C 2IJLA 4F18A 2W82A 1JHFA 3J7ZI 1YYZA 3F22A 2Z8EA 3R26A 2IAIA 1K79A 1HXDA 4WCGA 1PUFA 4I62A 4QFLA 1XGMA 4ZTFA 3PUWE 1ATGA 4OVSA 4M3DA 1BN5A 3O6BB 2QKMB 1PUFB 4BHCA 1U8BA 3TW7A 3KEQA 2DPDA 5I57A 1S7AA 1IV6A 5HBCA 2UVIA 4N0BA 2I4CA 1YHQI 3A02A 1DK4A 2E36A 2WKYA 4I7HA 4W97A 4HF1A 3OR2C 5JVGF 3RT8A 4F1VA 1ZK8A 4DQ2A 1Z91A 5E1XA 3HKZA 5B3SH 1P7JA 4LLGF 2YU3A 3WG7H 3C31A 3KCCA 3ZP5A 2AS5F 4XFEA 3EPZA 2VC0A 1OMIA 3KPHA 3QYBA 2KR0A 3O29A 4EF1A 1IRXA 2CQQA 2BYVE 4XQFA 1A40A 1SD3A 3FUZA 3C2GA 1D1CA 3ASNH 4IZZA 4GVOA 3AXFA 5CPRB 3H9GA 3MYUA 4GXOA 5ET7A 1ZTRA 4A3BJ 4XLHA 3U8QA 1L0OC 3LMMA 4Y52J 3LSFB 2OA4A 1Z3YA 3BP8A 1HLVA 1XI6A 4A3MJ 1OFCX 2YS9A 4X9TA 3TPAA 2CFOA 2E35A 2R71A 3IV5A 1IQ7A 2CSOA 2QVOA 2ME6A 4YELA 5AA2D 2Y69H 5F04A 3FIWA 1IMDA 2CW8A 2LRDA 5KCMA 2L4MA 2CZHA 2ZMEA 1QUJA 3DU6A 4FIMA 1W7PA 2FA5A 3SFIA 3GBGA 1S8NA 4I02A 3WGHA 2ZMEB 5LRSA 3K6XA 3FKIJ 3JRBA 3C34A 4EF2A 3RIRA 1T08B 4FETA 2YX4A 2X1DA 2XB5A 2VD3A 3OWTA 4P9KA 1SANA 1FT9A 5LGTA 2CUEA 5AONA 3S16J 1Y4CA 3LV0A 2OZ6A 1X4OA 3J80K 2G29A 1JKRC 3CDIA 3ABMH 1B3GA 1B4AA 2XUBA 3F8BA 3LSGA 1G3YA 2Y7RA 5GP9A 5DYHA 2DJIA 2O84X 4YAHX 2X0LA 3KFWX 2HPMA 1VQ4I 5DW8A 3E5XA 1S7EA 3BR6A 3F9KA 4L9JA 1WJCA 4K2EA 5FFXA 1B7ZA 3GTGJ 2DE3A 3HHFA 2PMUA 3PFIA 5CVUA 1REPC 1N78A 5J8FA 1PVEA 2CQKA 3KOSA 4ISUA 4U0VA 1R6ZA 2XD2A 5BWJA 1ZJLA 1FWZA 1ETYA 4OMZA 4O7IA 2BZTA 4A6DA 2CQNA 5EG0A 2LK2A 4Y13A 1CF7B 4NDLA 2ZNYA 5ILSA 4ZC3A 3FD3A 2DA4A 2Z16A 2CMPA 1N7WA 2GHAA 4G8XA 4F29A 2CUJA 1GGGA 2HOTA 1FQEA 4KYEA 4L0ZB 2EZHA 4H0EA 4ZDOA 3DELB 3KG2A 3O6HA 3CJRB 4G2ZA 4P1EA 4ELPA 2OQRA 1A8FA 4KYSA 2P5LC 1XSDA 1MQDA 2RREA 2V9VA 1LEAA 1FPDA 3O6IA 1YFHA 2D21A 4QIWN 1BL0A 2XHKA 2CW7A 5K7HA 4ASNA 2OWTA 5HS7A 1WDNA 2R9JA 2IA1A 1P9QC 4I01A 1XMXA 2H6BA 3B02A 4P0IA 5CJ9A 4LJZF