1MH4A

Maltose binding-a1 homeodomain protein chimera, crystal form ii
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
molecule keywords maltose binding-a1 homeodomain protein chimera
total genus 136
structure length 418
sequence length 418
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh4A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh4A01
1MXZA 1IQ7A 2VUMJ 4GL8A 5F1QA 1VI0A 1MS7A 3QPLA 3VV5A 3VVDA 1D4NA 1B72A 5HBCA 2O7UA 3H7MA 1DSNA 2FJ1A 4FISA 4L5EA 4W1UA 3GTLJ 3H06B 4U2RA 3HHFA 3L6HA 4GXAA 3GXAA 2IEKA 1PB7A 3PMVA 4UUTA 1USYE 3OELA 4F22A 3IOVA 5FKLA 1G2HA 4FE4A 2I4CA 5C3EJ 1O63A 3DCFA 4DYRA 2LAOA 2XX7A 4KYSA 4JB7A 2HCAA 4DLDA 2KT0A 4B1RA 2FD5A 2F34A 4QHQA 4RY1A 2O6AA 1ETYA 5CMBA 1MBFA 3MKLA 4ZEIA 4I1DA 3H3GA 3C33A 4ELPA 3V89B 3GTGJ 1VR5A 3A03A 2M9HA 3O97A 4M3DA 1M5FA 3A3CA 3R26A 1VF9A 4XKPA 2Y2ZA 2HZKA 5DEXA 2X6OA 4FJPA 5BUUA 5IKBA 3Q28A 4GFBA 2IA4A 5H8QA 4TQUQ 4IHYA 4TLMB 4EXKA 1FQAA 3IOWA 3LUYA 2PX1A 2E1OA 5M3MJ 3BFTA 4F18A 1TWCJ 5M5YJ 2HOSA 2F7BA 2ZYOA 2O7OA 4HTGA 4QFNA 3G3GA 1H89C 2E2JJ 4V2GA 4A3CJ 2COBA 1B4HA 2LK2A 4KQPA 5ITPA 4H67A 2EBIA 1P99A 1MQJA 3ECRA 3KSJA 3HB9A 2DA2A 2QJEA 1PEBA 3H3VK 4IGTA 3RLFE 3PMWA 4Q8RA 3Q25A 3TW7A 4F19A 2HXIA 4TLLB 1F43A 2F5XA 2K9NA 3KEIA 2ID6A 3MAMA 4LZ8A 4KFQA 3MPLA 1OVBA 4UACA 1FQEA 1OMPA 2I4BA 3ZQHA 4C2MJ 2I6EA 1IV6A 2JA8J 4ELQA 1P7JA 4X6AJ 1MY2A 1MY3A 4ZEKA 1FQBA 3G7WA 4EEFG 2H99A 3M4OJ 1R9TJ 2MGQA 1W0UA 3D4CA 1MQIA 3OO7A 3H6VA 2ECCA 5FHOA 5FTIA 1Z0XA 5LOMA 2WKYA 3PD8A 2K40A 4NWCA 3H4ZA 2REGA 4MLVA 1H88C 4ZEDA 2H8RA 4IHWA 5J1YA 3HO7A 1JW4A 4R74A 3OO6A 2CQXA 4K3FA 3GZGA 5IYCJ 3CRBA 4POWA 4O3AA 1EF4A 3VLWA 1FQFA 4RK2A 3TELA 4QSCA 4H8JA 5ISUA 4OYVA 1JEUA 2LFBA 1IITA 2ZYNA 3HOUJ 5JK4A 1T56A 4XRSA 4LOCA 4YU0A 4C3JJ 2I48A 2REJA 1GV2A 2Y30A 2ME6A 2P0SA 1GGGA 1LAGE 3P7IA 3MZ9A 1AH5A 1DTGA 1AIVA 3TZAA 2QF7A 5C44J 2QRYA 4RYAA 5DS9A 1HOMA 2XXYA 2X7PA 4E0WA 5EG0A 1AL3A 5M2VA 3QAXA 5EHSA 4OMBA 3IORA 1OJLA 4UUSA 1CE2A 2Y9YA 2XXXA 4X9TA 3B6WA 4OQOA 1FTLA 5FKKA 2L7MP 3G3IA 1HLVA 4QFKA 3LSRA 1LE8A 3SDFA 3HOYJ 3FGSA 3CFZA 2DYXA 3QIMA 1OCPA 3VDFA 2V93A 3PUYE 5F0HA 3EHTA 3E13X 2VD2A 3JZJA 5K7HA 1WH5A 2DXRA 1JGGA 1YCJA 1D9VA 4CYCA 1TWYA 3BR1A 4G8NA 5EEAA 1B0HA 3EN3A 5FKOA 1DTZA 4DCYA 1YPNA 4QSHA 1MXYA 1P1WA 1MH4A 1Z7NE 5M5XJ 1F36A 4FTHA 4BBSJ 4JWOA 1XG1A 4LP2B 1RPWA 4YMBA 2ME0A 1XVYA 3U93A 1AHDP 2UVHA 5H8SA 2PT2A 5BNGA 1LFHA 1P1UA 5EG0B 2O68A 4BLAA 1ZLQA 1US5A 3B6TA 1VSOA 3ODBA 4Q5TA 2XXQA 3MVXA 4DXUA 3GTPJ 1SVXB 4H1XA 1GUUA 1GVDA 4I6ZA 4M1VA 3UGWA 2Q9TA 2WAQN 3ZSFA 3TCGA 1BTJA 3NARA 2XXWA 3HOXJ 4D5CA 1SDXA 2LLKA 1LFIA 3QK6A 3C4MA 2DVCA 1YTVA 2R71A 4AYBN 1MDQA 1N3WA 4QFLA 3W9VA 3GTMJ 1FTKA 1JJ8C 2Y9ZA 3OO8A 3TTMA 4YB6A 4H5FA 1II5A 3SEXA 3GBAA 4YKPA 4IHVA 1PBPA 2FA7A 2XPUA 5ICQA 1MY4A 3BR3A 1ETVA 2DSFA 3DP4A 1UG2A 4WEPA 1ZR4A 1BW5A 1EZOA 2TRTA 5ICTA 1JVXA 1LBBA 2A5TB 4V2FA 2DMTA 3JRBA 3KZGA 1URGA 1P1OA 2Y7RA 2D21A 2LKXA 4ISUA 1Y1MA 4U23A 3BG9A 1QUIA 1SQYA 1Y4TA 3I4NJ 1FTJA 4KHZE 3JRHA 2A5SA 3ZQFA 3EF7A 5JEIA 4FIMA 1X58A 4F1UA 3IJOB 2KLFA 2ZNSA 3CG1A 4GXSB 3O6GA 4ZDMA 1A99A 5A5XA 3MVZA 1IZ1A 1IDYA 2QS2A 4A3MJ 5I56A 2QSXA 3RTWB 1W0TA 1YAEA 1PBQA 1UTBA 1LBCA 1IXIA 4RJZA 4XICA 1IJWC 3ZQGA 4YKIA 2RINA 5CRYA 3OMBA 3O29A 5F08A 3S4UA 1OFCX 4KYEA 4OFLA 2O9LA 3JREA 1MPCA 2H98A 3BR5A 5E3NA 9ANTA 1EZ9A 2GBYA 4R6KA 2JMWA 5HM4B 2XD2A 4X1EA 1QRYA 3MUQA 4MBPA 3Q0VA 4RNSA 3MN2A 1WPKA 1JVYA 2DA5A 3Q27A 1IUDA 1XS5A 3B7DA 3G1MA 3IH2A 1M5CA 1SYHA 5E3OA 1P1QA 4GRKA 1WODA 4Y7NJ 1SANA 4JX4A 1WI3A 4XIDA 4X1DA 3OOAA 2R9JA 3M3LA 5DTDA 5I57A 3S1NJ 1MY1A 3S9MC 2LY9A 2LTPA 3UIFA 4A3FJ 2YPNA 3TODA 4MLOA 3OXNA 2XB5A 3QQAA 1IDZA 1XC1A 1IGNA 4DXBA 1MNMC 4BDRA 1GT0C 1B7UA 2A5TA 4F3BA 2WV1A 3V5AA 3SDGA 5H8NA 1ZJLA 1APLC 5HPQA 5J1RA 5L9SA 1N76A 4JYKA 4R9GA 3FVNA 1I3QJ 3TP0A 2HOTA 5CM6A 3LSXA 1Y1ZA 2DN0A 3I4MJ 4YICA 2Y7IA 1NNTA 2OK2A 1MPDA 3PM1A 3FKIJ 4DZ1A 5I2NA 1Y3QA 1ZMGA 1OCTC 4PETA 2UXAA 3C35A 1MXUA 3E4RA 1LFGA 5A5XB 1O64A 3HKZN 4R72A 1MM7A 1SBPA 2O51A 2Q2AA 3QUFA 1H45A 1XT8A 2Z22A 1LAHE 3IR1A 5CI5A 1UQWA 1ZK8A 3K01A 3G1LA 4DDDA 2HAVA 4C3IJ 5H8NB 4M6VA 3BQZA 3TW6A 5TPAB 1MXVA 2ALUA 3MZ1A 2FYIA 3KOSA 5K2XA 3TMGA 3DP8A 2XX9A 3BG3A 2ECBA 3FK6A 4Y52J 1ORKA 4EF2A 2DA4A 3H6TA 3KSXA 2DJNA 5GPAA 2ANJA 4JP0A 1CB6A 4R9FA 4U22A 1XS9A 4J19A 2PVUA 2ONKE 3QYTA 4MFEA 2JA6J 2D5VA 1M5DA 3SETA 3FJGA 1JW1A 4F31B 1TFAA 3MVWA 4IEJA 2ABHA 2XD3A 4N13A 1X2NA 1DPPA 4RK9A 2LP0A 3I6VA 1QULA 4OFJA 2NXOA 1MXXA 3VXCA 2P81A 2I49A 2CU7A 2ZNUA 2ZNTA 3O8HA 1KWHA 1S50A 2I3WA 4JX5A 3RQTA 1IRZA 4O3BA 1YRNB 3VLVA 1HDDC 5FKNA 2O84X 4AC0A 3SEUA 3DP6A 4A3BJ 2FX0A 2GLOA 5L9OA 1S9TA 2ELKA 1FQDA 3M8UA 2LD5A 1ZR2A 4ESWA 1B8IA 2XRLA 4EUOA 2L7ZA 3S1RJ 4YKJA 2RC7A 2M8GX 2XHDA 5C4JJ 1MSFC 1MBJA 2XSDC 1ETXA 4IO6A 5TP9B 3JRCA 3MP6A 2QMWA 3DLNA 3OIOA 3JYRA 5F7VA 2V3TA 2ID3A 1B2HA 2DS9A 2P1SA 5DTBA 2H1KA 1I6AA 1GV5A 3JRGA 2ONSA 4PFTA 4D7MA 1VNDA 3SEYA 1A8EA 4NF6B 4NE4A 3S14J 1P7IA 3M3KA 4RDUA 1UIUA 1VFEA 1U9NA 3WAFA 2GH9A 5EGOA 3IJXB 3IOUA 1B46A 5KZTA 2RC9A 2RF1A 1TFDA 1O7TA 1MPBA 4YMAA 1K83J 1P1NA 1HCRA 1B51A 2GHBA 4RXLA 1SFOJ 5F04A 2MW8A 2AIXA 3IH3A 3HGYA 3TFLA 3FJ7A 1B8IB 2Z23A 4FEDA 4PE5B 4NF4A 4FECA 1OQHA 5C4XJ 4XKNA 4PFUA 4IO7A 4B4CA 2OCUA 4OEVA 3TQLA 4IO3A 3H6WA 2Y7WA 3UORA 1Y3PA 3KJTA 2BJJX 1AKHA 3CIJA 1Z77A 4JX6A 3S17J 4A3DJ 1OIBA 1B58A 5I84A 2O1LA 4O3CA 1UTHA 2F78A 3G3HA 1MBEA 5CC2A 4NF8A 4XK4A 2XX8A 3M3FA 2O7IA 3MP8A 3TEDA 1SW1A 4JWXA 5DVJA 1FCKA 3OSRA 1RYOA 5FHMA 3EHSA 1OVTA 3LOCA 1JJ6C 4YKKA 2W48A 2PMZN 3H03A 4JSDA 3U94A 3PPQA 2UVGA 1I50J 3IAZA 2UYEA 2HXOA 3KG2A 4A3KJ 1D3KA 3HOVJ 3RQIA 1DU0A 4JDFA 4M4GA 3K6WA 3QUJA 1JKQC 2HQ0A 3ZQLA 4G68B 2GFEA 5K7ZA 2CJJA 4GIZA 1AU7A 2XPVA 4WKMA 3JR9A 1TWFJ 1IXGA 4U1ZA 4DIGA 3LSFB 3OSQA 5AE4A 1JKPC 3ILUB 1XOCA 4NF5B 1GR2A 3MVYA 3PO3J 3FVKA 4P0GA 4NF6A 1ETKA 3OENA 3RKQA 2Q8JA 4JWYA 3UKGA 4GQOA 5BWJA 1DPEA 3O9PA 3QXMA 3DM0A 4DCXA 1FIAA 1B40A 4JSOA 3M3YJ 2XXUA 4A3EJ 1K61A 1YRNA 1N7XA 2CUFA 5M5WJ 2F7AA 3K02A 1HSEA 1B52A 4QF9A 3ZKKA 2XGEA 1QVUA 1IUFA 1L5TA 1H8AC 1B6HA 3PPPA 1JETA 5IOYA 4DYQA 5DVFA 3C34A 1ZKGA 1IIWA 1JQFA 5FKMA 5J1UA 3ZS6A 2F6GA 3LSJA 3FVGA 3VVFA 2I10A 3OO9A 5IOZA 1A7LA 1ETWA 3PPNA 3LBSA 3LC8A 2UVIA 2Y31A 2NWJA 3WHCA 3D1NI 3R6UA 4LZ7A 2V3UA 4A3GJ 2XXHA 5E3LA 5IYDJ 2DA1A 3ONMA 4U21A 4MFIA 3JRIA 3C9HA 2L7FP 2X9DA 1H44A 2NUVA 4OVJA 1AOVA 4ONYA 2AO9A 4IB2A 2RCAA 3KBRA 1ELJA 5EGOB 4GF8A 2VD3A 3WHBA 4U4SA 1FEXA 3S9NC 4MF3A 3BQYA 3MPKA 3HM5A 3N6TA 4F1YA 1AKHB 4LQ5A 2FNCA 2VOZA 3VLUA 5H8FB 1PB8A 1IG7A 5FLVA 3R7XA 2OWTA 3IB2A 1QVSA 1WVJA 3T22A 3BR6A 4GFRA 3K2AA 2OPTA 2VKEA 3IV5A 3UA8A 1U9OA 3F0CA 3C36A 5K2YA 1MBKA 3RN8A 1BA5A 1US4A 3CFXA 3T93B 3GTOJ 2LR8A 1FQCA 3TCFA 3W15C 4PFYA 3HN0A 2OWSA 4RBOA 3PV0E 3CVGA 3FJMA 4OXVA 3K0VA 4C1UA 2F8DA 5H8HB 1NK2P 1XC5A 3MP1A 1F9BA 4GD5A 3WAEA 1URDA 3MW0A 5B70A 5KCJB 3T66A 4UUSB 3CMYA 4XRSG 3UK4A 5TU0A 2GM4A 2GHAA 4EF1A 3IO4A 3SKPA 3T9UA 3C31A 1TWAJ 1FW0A 2GRVA 2EZKA 3OSGA 4R73A 1WCMJ 4R6YA 3CG3A 3T9VA 1PUFB 3CQZJ 1B05A 3A3UA 3MZBA 4KI0E 3FIWA 2Q88A 3KOTA 3V83A 4NF5A 3W6VA 3NAUA 2ZB9A 3PD9A 4OETA 2DWHA 4G2ZA 3TDJA 3SEVA 1Q1VA 5GP9A 1B72B 4NDLA 2NOOA 4R2FA 5EZHA 1TWHJ 4G8MA 2E2IJ 3OOUA 4YZZA 3AXFA 3PMXA 4FCYA 2WB1N 4QSEA 5I57B 2Z8EA 1UMQA 2MSYA 5I59B 2QCOA 3C32A 3O6IA 1TXFA 4GL0A 1B3GA 3PO2J 5IPAA 4ZS9A 2F97A 2RKMA 4KPTA 3EPEA 4DYCA 1B4ZA 2IEEA 1LGBC 3G1OA 2NVXJ 1VFDA 4KCDA 4EDPA 4BY1J 1S7EA 2OBGA 5I2NB 2MG4A 3LSLA 1N04A 2H25A 3KJ7A 2YU9J 4GOTA 3HOWJ 4ND9A 1LCTA 3THIA 4F3SA 2R5YB 3LNQA 4HS7A 4P0IA 1GVCA 4ELOA 3Q0WA 4BY7J 1UTBB 3S1QJ 2V25A 2JA5J 3KGCA 3B6AA 2RCBA 4KD5A 2XGCA 3HCQA 5L8DA 4C3HJ 1A6IA 1PC3A 1B1HA 3KN8A 3ZQCA 2UVJA 3LSGA 1I69A 3S9EA 3Q0UA 2YUSA 2R7ZJ 4H0WA 5E3MA 5JTYB 2I58A 1MQDA 5AA2B 5B7DA 4FAJA 3VE1B 3G3KA 1T33A 1U78A 3U8QA 3TKDA 2OJTA 3RT6B 5JTYA 1RETA 1N0TA 4NTLA 4DZJA 1A8FA 5EZGA 5EYRA 2VGQA 4IY6A 5I58A 4OESA 2G93A 2R93J 4KR5A 3FISA 2N8GA 1ZBMA 5FHNA 3K2DA 4GVOA 1SD3A 2OF7A 2DWIA 4MIMA 3UP9A 2D3IA 1LFBA 4OZ9A 3HOZJ 2NVQJ 3PUVE 1OQGA 3TTLA 5AA3A 1WH7A 3RT8A 2DA6A 2R5YA 2OLBA 3CI8A 1MRPA 2CZLA 3CDLA 4FORA 1GV8A 1SW4A 5J1DA 1QUJA 3Q29A 4A69C 5AA1A 1MG1A 4AB6A 2QS1A 4FEBA 3JV9A 2E2HJ 1Y3NA 3TTRA 4UA8A 2R5ZA 2DE4A 3RNNA 2VPRA 3TPAA 3KFMA 4LA9A 2QMXA 2ZYKA 5FTHA 5ITOA 4D5FA 1RKTA 2P2AA 1BL0A 2AL4A 2YJPA 1ITYA 3GLBA 2NVTJ 1BJZA 1MSEC 1MQGA 1ZKBA 3I5OA 2CQQA 1MQHA 1SYIA 4ZE9A 4THIA 1Y20A 5JLWA 2YS9A 1IEJA 1BLFA 2M34A 5AA2D 5I2KA 3KN3A 4ZE8A 3PPOA 3S15J 2VI6A 1Q35A 2V84A 2DMNA 3K1MA 4YB7A 1H76A 4M3EA 2JWTA 4LQ2A 1RR7A 1POGA 2NS7A 4H6DA 3K1PA 3MBPA 3SERA 2JA7J 3FATA 3A01B 3MC2A 1QPIA 1JT6A 1B7HA 1UTHB 5F0FA 1R6ZA 4P11A 1JUSA 4XRMA 3RUMA 4IO2A 2AHQA 4HCWA 3C2BA 1IXCA 4OWDA 5DEXB 3QSLA 4BDMA 3SESA 3T9XB 4U1OA 5EF6A 4KYDA 4DW6A 3A02A 2DA7A 3SJMA 2DA3A 5F1JA 4G12A 3IOTA 5I58B 4I62A 1QVTA 1JUPA 3N6UA 3O66A 3PUZE 2JJ7A 4C1TA 4I8CA 2X26A 1NFTA 3GBBA 1JEVA 3S2DJ 1B0LA 1FJLA 1R1NA 1MDP1 4L17A 3MQ9A 4QSDA 5ELVA 1ATGA 1JKRC 2R6GE 5F27A 3JRDA 4QRZA 3HV1A 1B5IA 3O28A 1WGXA 3S2VA 4POXA 4JBZA 5J3LA 1EZPA 3MWBA 4BBRJ 1B7ZA 1S7YA 3RTFB 4N6PA 3HPIA 2IBDA 1D5YA 1D9YA 1MH3A 3PU5A 1IC8A 1ZGWA 3HGGA 1POY1 3T96B 3FXRA 3LSWA 4NMYA 1ZIUA 3RGYA 4M3BA 3LSPA 2AYSA 4IO4A 3O8GA 3S1MJ 2OZZA 5M3FJ 1J1NA 2RC8A 5AA4B 1Q1KA 2HOAA 2Z8DA 4RPOA 5TP9A 4HW8A 1N3XA 3K6XA 4EQBA 3ILTB 1B1XA 2HYJA 3K00A 2PMSA 3EQ1A 3H0GJ 1LAXA 4FE7A 1O4XA 3FV1A 4BDOA 5H8FA 2QS3A 1GTKA 4GLIA 4Q0CA 3FASA 4ELRA 3BR0A 2KDZA 3IO6A 3IX1A 1UHSA 3BBRA 5GPCA 1B5JA 4XKQA 5TPAA 3N94A 4E0XA 2RAEA 1HDPA 1TWGJ 4MFDA 3GTJJ 1B3FA 4G68C 3JRFA 2DMQA 1R9QA 2PYYA 1A55A 4F3GA 4B3AA 1ZQ3P 4QIWN 4IY5A 3A09A 5L9MA 1B3LA 4EXLA 3S16J 3FXQA 3SEWA 3E3KA 4FATA 2HZLA 3GTQJ 3BTCA 2E0SA 1OLAA 5EYFA 1ENHA 1RYXA 1JKOC 1NNPA 4H65A 3HDDA 5IYBJ 1NKXA 1M5EA 5AA2A 1IXHA 3TEPA 2NS8A 1FIPA 4HCYA 2X7QA 3G3FA 2F36A 2O69A 3USDA 2Q2CA 2L9RA 3JRAA 3FIRA 1LE8B 1GDTA 4MH5A 2DE2A 4LZ5A 5JLXA 4BDQA 3RY3A 3CSGA 4QTRA 3TTKA 1PDAA 2F35A 2DMPA 5DVIA 4G77A 3OEKA 2THIA 1NTCA 3TP3A 3FD3A 2L0KA 4R6HA 3RZDJ 3L1PA 1E3OC 1B3HA 3N5LA 5CBSA 3K1NA 1SW5A 4XIGQ 3FZVA 3FUZA 3GBGA 3ZOBA 4A3LJ 1ZTRA 1QKAA 3ZQIA 2DVZA 3VFJA 3TTNA 4OHNA 5CMMA 3OSFA 1BIYA 4F29A 2EZIA 4ZEFA 1TT1A 1MXWA 2VKVA 3HSTA 5KCJA 1PUFA 4ESXA 2IAIA 1BP5A 2Q89A 2HI3A 2W7YA 2M8CA 3V8XB 3Q3SA 4ABZA 2M2EA 1HF0A 3T9HB 2NVYJ 4I76A 5IP7J 2VP1A 2O1MA 3PUXE 4KCCA 3HHGA 4RA1A 2G0EA 3S2HJ 1QKBA 1SI1A 2QPQA 4NWDA 2HXWA 2HDDA 4XKRA 3U72A 4YAHX 4IGRA 4F2OA 5CMCA 3IH4A 3RPWA 4LUBA 2R0QC 3TUSA 1FTMA 5I59A 4A3IJ 2DMUA 3H6UA 2R92J 2V3QA 4OEUA 1BW6A 2FQ4A 1FTTA 2G29A 2Y7KA 4S0HB 1NNFA 1I6HJ 3PGFA 4QFPA 4WEDA 1U8BA 5IP9J 3E7LA 1VFCA 4Z7EA 1X2MA 4OFOA 2LVSA 1AMFA 1RKWA 2CRGA 1HSLA 2DWAA 3G3JA 3BTJA 3FK7A 1B32A 5IP6A 4BKXA 2XB0X 5DT6A 5F0CA 4M3GA 3BFUA 4AQ4A 3MVPA 4I9DA 4NF8B 1A5JA 4LVQA 2HAUA 2K9QA 2ONRA 3K7AJ 1LSTA 1DMBA 3BKIB 2H5YA 4QFOA 3K4UA 1BKAA 3UN6A 1Y4CA 3EHUA 2PBWA 1Z7ME 1LB9A 3BTIA 3TQWA 4HNVA 1NK3P 1I6BA 4RPNA 4WXJA 2DWJA 4H8IA 1JW5A 1FTOA 1QJMA 3VXBA 1SW2A 1EH3A 2ZMBA 2QL3A 2ZXTA 1POTA 4AUXA 2K9SA 1B5HA 1HSJA 1M5BA 3IB1A 4OERA 2EZLA 2Y7PA 1Y1VJ 1USYH 3CSBA 3IK6B 5DYHA 1JTXA 4ZZAA 3HEFA 4XTCQ 2HEUA 3RZOJ 1NH8A 1CQTA 4ZZEA 2F6PA 4W97A 1LAFE 4JXIA 1NNKA 2YLNA 5FLMJ 4G68A 4XXUA 3OEMA 2DTZA 4OTEA 1R9LA 2EQRA 4X1BA 1LB8A 1PB9A 5I56B 1LLSA 1A40A 2DE3A 1MM6A 4U4XA 2EZHA 1OLCA 2CMOA 2B3BA 1MBHA 1H43A 2XXTA 4R2BA 2DOJA 3B6QA 2JK3A 3IB0A 3A01A 2I0BA 2O8KA 4F3PA 2Y84A 2E1SA 5KDTB 1B3EA 5HODA 3D4GA 4A93J 5FJ8J 1XVXA 2M0CA 4PP0A 1MBGA 1JT0A 4G8HA 2E19A 3OD7A 4Q30B 3HBLA 2TCTA 3CFLA 3S9LC 1EU8A 3F11A 3BR2A 2XXPA 3O6HA 2DXYA 2R5ZB 3K6VA 1TC3C 3DEWA 2B3FA 3U1OA 2ESNA 1VE4A 2F7CA 2ZYMA 3FXUA 3L6GA 2XXVA 3B6CA 4DZPA 4IHXA 1Y9UA 2Z8FA 4X48A 3I3VA 4Z0IA 5I2KB 1T0KA 2VHAA 1ANFA 2D5WA 1NL5A 4IO5A 1XHYA 3IL1B 3QPSA 3E9XA 3VVEA 1LCFA 2NOGA 4MO7A 1RKMA 5CMKA 4LATA 4DXCA 3W9WA 2I0CA 1WDNA 2DP8A 4N07A 2I3VA 2XPWA 1Y1WJ 4ECFA 3BG5A 3U92A 5IAIA 4NEDA 2XXIA 5H8HA 1NMUA 4F2QA 3GTKJ 3SFIA 1A54A 4ZEBA 1FTZA 2X48A 5K7FA 1DOTA 5KDTA 3Q26A 4NF4B 4G4PA 4AB5A 1LFUP 1RESA 1QUKA 5CBRA 3BT9A 2B63J 2XXRA 2EH3A 3ZKLA 4R75A 1ZU0A 3FVOA 4ZECA 4M3FA 3MJNA 3CR9A 3KN7A 2NVUB 2UYFA 1JTYA 1H3DA 2JN6A 1MY0A 2HQ5A 1I6QA 2H9BA 3PUWE 2HFBA 2PT1A 4DE8A 1DU6A 4PFWA 4EQ7A 1ETOA 2QS4A 4MLQA 4GWOA 3FV2A 1QW0A 3TYHA 4FE8A 4CYCB 2AL5A 5EDNA 1URSA 2XGDA 1NH7A 3CCYA 4D7NA 3N26A 4A3JJ 4TOZA 4BDNA 3PPRA 4YB5A 5EHMA 3LR1A 3VPRA 4F1VA 1ZTYA 2CUEA 1UIVA 3TCHA 1SI0A 1N7WA 1JUMA 4C0RA 2DQVA 1JNFA 1ETQA 2Y0SN 4BDLA 2H4IA 5AA4A 4F39A 3DELB 4H5GA 1N84A 2B65A 4EQ9A 5H8QB 4BXXJ 3BTLA 3K6UA 3O2AA 1B9JA 3TAJA 4PQJA 4OENA 4LONB
chains in the Genus database with same CATH superfamily
5LGUA 1T2KA 1MXZA 1FY7A 1PYVA 1IQ7A 1NUZA 2VUMJ 5EQ8A 4GL8A 3QOEA 3P9IA 5F1QA 4P3LA 1VI0A 2QVUA 1MS7A 3QPLA 3VV5A 3VVDA 1X4OA 1D4NA 1G4DA 1B72A 5HBCA 4BUPA 2O7UA 3H7MA 4UB8C 3KEOA 1DSNA 2R8TA 4P47A 1BR1A 2FJ1A 4FISA 3H0DA 4L5EA 4W1UA 3GTLJ 3B8BA 3H06B 4U2RA 4PGNA 2ZXJA 3HHFA 2VKDA 3L6HA 3GXAA 4GXAA 3VEPA 2IEKA 1PB7A 5F6FA 3PMVA 3FBNB 4UUTA 5J8CA 3K4NA 1USYE 1VTNC 3OELA 2HQAA 3TQNA 4KXPA 4F22A 1XDSA 3IOVA 5FKLA 1G2HA 3E97A 4FE4A 4XKWA 5J6XA 2I4CA 4BEHB 3ABKH 5C3EJ 2EFOA 1XCVA 1YIJI 1O63A 3DCFA 4DYRA 2LAOA 2XX7A 4KYSA 4G7OF 4MNCA 1BJAA 5J8FA 2MBFA 2CWEA 2HCAA 4JB7A 4EGYA 4DLDA 2KT0A 4KICA 2FF4A 2EILH 1EYIA 4G68C 2VJ4A 3GF2A 4B1RA 2P8TA 2FD5A 4PJ0C 2F34A 4QHQA 1EH7A 4M9XA 1ETYA 4EGZA 1XGSA 2O6AA 4RY1A 5CMBA 1MBFA 2QENA 4B3XA 2XWKA 4RLQA 3MKLA 3FF5A 4ZEIA 4I1DA 3H3GA 3C33A 3FMRA 4ELPA 2OBPA 3V89B 2F5EA 3GTGJ 2OD5A 3RSNA 1VR5A 3A03A 2M9HA 4BQNA 3O97A 1TQIA 1G3TA 3LSMA 4M3DA 1FPGA 1M5FA 3ZMZA 3A3CA 2UV1A 2CZHA 1MMAA 3R26A 1VF9A 4PCQA 4IQJA 3NQOA 4XKPA 2EWNA 2Y2ZA 1B6AA 4HX7A 2HZKA 5DEXA 2ZNYA 2X6OA 3ASNH 4FJPA 2XV4S 4QLCU 5BUUA 4PUSA 4GBWA 2A5YB 5IKBA 3Q28A 2VB6A 4GFBA 2IA4A 5H8QA 4TQUQ 4IHYA 4AVPA 1LDDA 4TLMB 4EXKA 1FQAA 2WC2A 1FBPA 4KYWA 2XAGA 2DPUA 3IOWA 2WAFA 3LUYA 2PX1A 2E1OA 4IJAA 5M3MJ 3BFTA 4F18A 1I6XA 1TWCJ 4RLFA 5J47A 1NUWA 3OR1C 5M5YJ 2HOSA 3HIFA 4EM0B 2F7BA 2ZYOA 2O7OA 2BVMA 4HTGA 4XKCA 4QFNA 3G3GA 1RDZA 1IRXA 2ADUA 1H89C 2E2JJ 4V2GA 4A3CJ 2IS4A 3LQQA 3OYLA 2GQQA 1EH6A 3M8JA 1HQCA 2BHZA 5D6EA 2EIJH 2COBA 2GZWA 2KRFA 2ZXHA 1B4HA 3MQ0A 2LK2A 4KQPA 4ZDLA 5ITPA 3T0JA 4H67A 2EBIA 2IGMA 2VIXA 4RB1A 1P99A 1MQJA 5DYMA 2FIXA 5LDZA 4PDDA 3QYFA 1BI3A 3R60A 3ECRA 3KSJA 4Z2YA 3H5NA 3HB9A 2DA2A 1GXPA 1SD5A 4BACA 2E5ZA 1E0EA 2HXRA 2QJEA 2BVLA 2YX4A 3H3VK 1PEBA 4IGTA 3D5RC 2CYYA 3PMWA 3RLFE 3Q25A 3TW7A 4Q8RA 3F22A 5A5LA 1U6GA 4AIHA 4F19A 2HXIA 5EQ7A 4TLLB 1ZRCA 1F43A 5LFAA 2F5XA 2DPDA 2VBZA 2K9NA 2FMLA 3PIOF 2QZ8A 1ULYA 1DUXC 2ID6A 1QHHD 2IS6A 3KEIA 2HQNA 2ZJRF 3MAMA 4KFQA 5FD6A 4LZ8A 3MPLA 1OVBA 4UACA 1FQEA 3H9GA 4E7JA 3K70D 1OMPA 3F8CA 1BIAA 3ZQHA 4C2MJ 1SAXA 2I4BA 2AQFA 2I6EA 4HQMA 3HOTA 1IV6A 2JA8J 4ELQA 4ZYEA 1P7JA 3FXJA 4X6AJ 1MY2A 1MY3A 4A6EA 4ZEKA 1FQBA 1UHMA 2F4MB 3G7WA 4EEFG 2H99A 3M4OJ 1K78A 1X1AA 1HA8A 1ACIA 1R9TJ 2MGQA 2HU9A 1W0UA 3D4CA 2RQPA 2WY8Q 3CJNA 3IAS2 1MQIA 1B1BA 3L2RA 2OWZA 3OO7A 4XFEA 4IXAA 3H6VA 2ECCA 2M1BA 3K4CA 2ZZXA 2LKPA 3BIGA 5FHOA 5FTIA 1S7AA 5FRMA 1OLTA 1Z0XA 5LOMA 2WKYA 3PD8A 2K40A 4FHTA 4NWCA 3H4ZA 2REGA 4S05A 1J9IA 4YG2F 4MLVA 1H88C 4ZEDA 3OYMA 2H8RA 4IHWA 5J1YA 3HO7A 2HPGA 4PF8A 2DXYA 1JW4A 5B66C 2YR2A 4R74A 3OO6A 4LN5A 1B9MA 1IMAA 2CQXA 4K3FA 2M5WA 3GZGA 3CCRI 4RMNA 4KJZA 5IYCJ 1U0JA 5E1XA 5ILVA 3CRBA 4POWA 1SVMA 4ZJZA 4O3AA 2G7UA 1EF4A 3VLWA 1FQFA 4RK2A 3TELA 4QSCA 4H8JA 5ISUA 4OYVA 1T0FA 3F3XA 1JEUA 5IGAA 2LFBA 1QQIA 4R8HA 1IITA 3H9QA 2ZYNA 3HOUJ 5JK4A 3SEZA 4NNJA 1T56A 1AWCA 4XRSA 4LOCA 2LSOA 4YU0A 2VJIA 3HSRA 2IT0A 3KIOA 3CF5F 4C3JJ 2I48A 2REJA 1GV2A 2CH0A 2WTEA 3DF8A 2Y30A 2ME6A 3CCMI 3GYHX 2P0SA 2H6BA 1GGGA 3H35A 4PDHA 1SFUA 1LAGE 3P7IA 2V6EA 3MZ9A 1AH5A 1DTGA 1DGRM 1AIVA 3TZAA 2QF7A 5C44J 4DQ2A 2QRYA 1B59A 1S29A 4RYAA 5DS9A 1HOMA 3E6MA 2XXYA 2X7PA 2X1CA 4F91B 4E0WA 5EG0A 1IRFA 1AL3A 2DJIA 5CPRB 1BIBA 1ZLKA 3E79A 5M2VA 3ZR8X 2UXXA 3QAXA 2BY1A 3ISPA 4O94A 3CJRB 3KLNA 4OMBA 5EHSA 3IORA 1OJLA 3DPTA 1TT0A 2FXAA 2Y9YA 4UUSA 1CE2A 2XXXA 5DCMB 4X9TA 2J5PA 2KRHA 4RAYA 5CVIA 1WKMA 4RAFA 3R4KA 3B6WA 3TBIA 4OQOA 4XM3A 5FKKA 1FTLA 2L7MP 3LAPA 5L3GA 1FPEA 2BW3B 3WU0A 1HLVA 3G3IA 3WGGA 3G2BA 3H5AA 4HE2A 3LSRA 3FWEA 4QFKA 1LE8A 2H6CA 4ETSA 4UABA 3SDFA 3HOYJ 3FGSA 4XN0A 3GW2A 1P9QC 3PUBA 2DTRA 3CFZA 4E7SA 2DYXA 3QIMA 1R1UA 1N25A 1OCPA 1OR7A 4WK8F 2VJJA 2V93A 3B50A 4PBHA 3VDFA 1QBJA 2Y5KA 3PUYE 5CQEA 5F0HA 3EHTA 3E13X 4KIGA 2XASA 4E7KA 2VD2A 2F48A 3JZJA 4RM2A 5K7HA 2RKHA 1WH5A 2DXRA 4KITB 2GA2A 1R4MB 2DK8A 1JGGA 1YCJA 1XGNA 1D9VA 1IMBA 4CYCA 1TWYA 4PSXA 1H0MA 3BR1A 1GHCA 1YG2A 4QPQA 2R7SA 4G8NA 5EEAA 2DDKA 2OV7A 1B0HA 3EN3A 2ZJ2A 3I58A 5FKOA 2WB1A 5D5VB 2JA2A 3DWLE 4N4OB 1DTZA 3A4CA 4DCYA 4RGSA 1YPNA 4I3EA 4QSHA 3KYLA 4HQEA 1MXYA 1P1WA 2E34A 3OV8A 1MH4A 3OYAA 5EYHA 1Z7NE 5M5XJ 5E18F 5E8IA 2QQBA 2EIKH 3FXKA 3M8EA 1F36A 5D8LB 3MSTA 4FTHA 4BBSJ 5BPDA 4JWOA 1XG1A 4ON0A 3U65A 2IA0A 4IO9F 1F5TA 2O5RA 2X1EA 3GFIA 4LP2B 1RPWA 2DDAA 4YMBA 2ME0A 4BL0B 3CMEI 1XVYA 4GCVA 3U93A 4OMZA 4UVCA 1MIJA 1AHDP 2UVHA 5E17F 1DDNA 2PT2A 5BNGA 5H8SA 1IV8A 5BQTA 5I7IA 1LFHA 1CF7A 2ZC2A 4KUMA 1S3JA 1P1UA 5EG0B 2O68A 4HAMA 4BLAA 5J40A 1ZLQA 3QU6A 4EJTA 2K4JA 1US5A 3G73A 3B6TA 1VSOA 3ODBA 1R4NB 1L3LA 4Q5TA 4N6KA 2XXQA 2JUCA 2VJ5A 4AVZA 3MVXA 1MJAA 4N15A 4DXUA 4CCKA 3GTPJ 1W7PA 1GUUA 1SVXB 4H1XA 1GVDA 4I6ZA 1YW9A 4M1VA 3H3UA 2BYVE 3BG7A 4EATA 3UGWA 2XDVA 2GXBA 4I99C 2WAQN 2Q9TA 3ZSFA 2OQGA 3TCGA 1DQUA 2CV2A 3DTEA 1BTJA 2K85A 3NARA 2XXWA 3KC1A 3LSHA 2HWVA 4D5CA 3HOXJ 2LLKA 3WG7H 1SDXA 1WJAA 4S04A 1LFIA 3QK6A 5IM2A 1LPQA 3C4MA 2DVCA 4AYBN 4MEXF 1MDQA 1YTVA 1N3WA 2R71A 4QFLA 3W9VA 1LNWA 2VPNA 3GTMJ 1FTKA 3OYNA 1JJ8C 2OJED 3CLQA 2Y9ZA 2W84A 3OO8A 3KP2A 3M1EA 3R6SA 3TTMA 4YB6A 4H5FA 1II5A 1XGOA 3SEXA 1FBEA 3GBAA 4GO1A 2HPMA 5DEQA 3ROUA 1A35A 3H3ZA 3E6CC 4YKPA 4IHVA 5I5PA 4UNOA 1PBPA 2XPUA 2LF8A 2FA7A 4PF6A 5ICQA 1MY4A 3BR3A 1ETVA 2DSFA 3I4PA 1DBZA 3DP4A 1UG2A 4WEPA 1ZR4A 1BW5A 1EZOA 4WWCA 2TRTA 5F1RA 3QODA 4A0YA 2XAJA 3R0JA 2E1MC 2C6YA 3EQLF 5DUIA 1FYMA 1CF7B 1JVXA 5ICTA 1K78B 4B09A 1LBBA 3K0LA 2A5TB 3C2HA 4V2FA 5LBQA 2VN2A 2DMTA 3JRBA 3V42A 3KZGA 2V1XA 3BLYA 1URGA 2ZFUA 4FX4A 1P1OA 2Y7RA 2D21A 2LKXA 2STTA 4ISUA 4NAPA 4Y4RA 2QQAA 4XKVA 4IVNA 1Y1MA 4U23A 4PE5B 2E36A 2OC6A 5CJ9A 4NGUA 1X3ZB 3O6BB 3QP6A 1BOBA 2BEOA 2M7BA 3BG9A 3RPUA 5K1YA 2PMHA 1ZGJA 1FJ9A 1KA0A 1QUIA 1SQYA 3K4KA 2ZSHB 4BHBA 3I4NJ 1REPC 1Y4TA 1KQ8A 1FTJA 4KHZE 3JRHA 2Q8JA 2A5SA 3ZQFA 3EF7A 2DYSH 1WVRA 4EM1A 3X2QH 3KETA 5JEIA 2EV0A 4FIMA 1X58A 4F1UA 3IJOB 2KLFA 2BHYA 3SZPA 2IRFG 4KIFA 3L2WA 5DW8A 3CMAI 2ZNSA 3CG1A 1UJ8A 4GXSB 2I8DA 3O6GA 4ZDMA 2V9PA 4KA4A 1MMNA 3OS0A 1A99A 3LSKA 1YS6A 3LWFA 3PNYA 5A5XA 3R0AA 3KC0A 1LBZA 3FMSA 3MVZA 4G61A 1IZ1A 3LUZA 2XKOA 3QYBA 3RPQA 1IDYA 2QS2A 4A3MJ 5I56A 4HZFA 1E3PA 2F5CA 2QSXA 1W0TA 3RTWB 2EFPA 2XSJC 1YAEA 1PBQA 4G7ZF 4XLAA 1UTBA 1LBCA 2CW8A 1IXIA 4XICA 4RJZA 1IJWC 5FROA 2VQLA 4B8XA 3ZQGA 4YKIA 1BR4A 2RINA 5CRYA 3OMBA 3GWZA 3GLXA 5H2FC 3O29A 3K4MA 5F08A 3F8FA 3S4UA 1OFCX 5GAEJ 4KYEA 1BM9A 4BE0A 5BMZA 2O9LA 4OFLA 5H6RA 4XSZF 3JREA 3L00A 1Z3YA 3HC7A 4KIBA 4GX6A 1MPCA 3HHHA 5HNFA 4HOBA 3ZN1A 4JK1X 1YITI 2H94A 3BR5A 2H98A 3P9CA 5E3NA 2VPLA 9ANTA 3SYTA 4MNIA 2GIVA 4YEJA 1SC7A 1EZ9A 4XQFA 2GBYA 4XL9A 4R6KA 2JMWA 5HM4B 4MAGA 3U9GA 3TO6A 2WWYA 1X19A 4X1EA 2XD2A 4CDGA 4GWYA 4HRIA 2XROA 1RUOA 4XLEA 1QRYA 4C2UA 1BI1A 5AONA 1KA1A 3MUQA 2BY3A 4MBPA 3Q0VA 1U3EM 4CZZA 2E7XA 2A6TA 3L09A 4RNSA 3MN2A 1WPKA 3JSOA 3K2ZA 2DA5A 1X3UA 2QKMB 1JVYA 3Q27A 1IUDA 1XS5A 3B7DA 5ET7A 2MLKA 4OA4A 3G1MA 3IH2A 1PVEA 1GLNA 4II3A 1M5CA 4RS8A 1LDKB 1FC3A 1SYHA 5E3OA 1P1QA 5D6FA 2Q2EA 1NHAA 5GTHC 4GRKA 5TJJA 1WI9A 3RKXA 4Y7NJ 1WODA 3C2GA 4AS5A 2H27A 1SANA 4BH9A 4PAIA 5JHUA 3GZ6A 4JX4A 2W4SA 1WI3A 2K5CA 4XIDA 1D9QA 4X1DA 1OCCH 3TMOA 1U5TC 3T8RA 5LEJA 3V4GA 3OOAA 4PAKA 3KP7A 2R9JA 4KNYA 1H9TA 2OTJI 5DTDA 3M3LA 3S1NJ 5EYGA 5I57A 1MY1A 3IAM2 3S9MC 4RM3A 1I3AA 2LY9A 2LTPA 3UIFA 4A3FJ 4CUGA 2WBBA 2YPNA 3TODA 4U87A 4MLOA 3OXNA 4JVIA 1W7PD 1VQNI 2XB5A 3QQAA 1X1DA 1IDZA 1XC1A 1IGNA 1J2XA 4Y3OA 4DXBA 3NRVA 1MNMC 3AL0C 1YHQI 1VZ0A 4BDZA 4M73A 4BDRA 2L9NA 1GT0C 3TDUC 1B7UA 3BP8A 3EUHC 2A5TA 4F3BA 3DBRB 2WV1A 2DODA 1VQ6I 3OL3A 3V5AA 1FPKA 3SDGA 3K10A 4MNUA 5H8NA 4ENJA 4DOZA 1FZPB 2QA4I 1ZJLA 2K7LA 1APLC 5HPQA 1HC8A 5J1RA 5L9SA 4PGHA 1N76A 3OYHA 4JYKA 2HZDA 3F9KA 3RJPA 5DM7F 2HVRA 2LG4A 4R9GA 3FVNA 4XLNF 4ZDPA 1I3QJ 1WJCA 4HV6A 5LGTA 4MMPA 1FBHA 1ZELA 3TP0A 3CP8A 2HOTA 5CM6A 1KYZA 4UB6C 3ASOH 1Y1ZA 3ZMDA 3LSXA 2DN0A 4HNUA 1BI0A 3IP4B 2VODA 3I4MJ 2UUZA 4ESJA 1NNTA 2OK2A 1MPDA 3PM1A 3FKIJ 2Y7IA 4YICA 4DZ1A 1Y3QA 1FP1D 1I27A 1ZMGA 1OCTC 4PETA 5I2NA 2UXAA 3C35A 2K27A 4Y15A 3HXLA 3NWSA 1MXUA 2HFHA 1QU3A 3E4RA 4GYGA 1LFGA 2W24A 3CMMA 5A5XB 4OIRF 5ED4A 2CV1A 5KVRA 4R1HA 1O64A 3BPVA 3HKZN 4R72A 1MM7A 4BE2A 1SBPA 2O51A 2Q2AA 1R71A 3I56I 3QUFA 1H45A 1XT8A 2Z22A 1LAHE 3IR1A 2BV6A 1FSHA 5CI5A 2CQNA 1XGMA 1K4SA 4GDFA 4UY8I 2WYKA 1UQWA 1ZK8A 3K01A 3F6OA 4WXDA 3G1LA 4DDDA 2Y48A 1RI7A 2KPMA 2AXLA 1U2WA 4NC6A 3E6BA 3Q9SA 3AG3H 4C3IJ 2HAVA 5H8NB 4M6VA 4LLLA 3A2KA 2P7VB 3BQZA 3TW6A 5TPAB 1TNSA 5ET8A 1MXVA 2ALUA 2PQ8A 2X6YA 3MZ1A 3KZYA 2FYIA 1DPRA 4C9YA 1SPIA 3KOSA 5K2XA 2ZCWA 1UZCA 1WJDA 3OIQA 3TMGA 1ZG1A 4BQOA 2H8WA 3DP8A 2XX9A 2QQ8A 2ECBA 3BG3A 3FK6A 3L7WA 4Y52J 1YIOA 1ORKA 2QVOA 2GOXB 2CV0A 4EF2A 2DA4A 2VQGA 3H6TA 3KSXA 2DJNA 3A0HC 3G71I 5GPAA 2ANJA 3EUHA 4JP0A 1CB6A 2EFNA 2Y75A 4F93B 4EJWA 4R9FA 1NV1A 2WADA 4U22A 1VQ7I 1XS9A 3SZTA 4J19A 2PVUA 4M6YA 2ONKE 4DGWB 4ZZLA 3QYTA 1XI6A 2BY0A 4HE1A 4MFEA 1IXSB 2VQHA 3REOA 1EJ9A 1X1PA 2JA6J 2D5VA 1NUXA 1M5DA 2WX9A 3SETA 1LBYA 3FJGA 4XSXF 1ZARA 2HQRA 2VE9A 1JW1A 4F31B 4HDVA 1TFAA 1MMGA 3MVWA 4IEJA 2ABHA 2XD3A 4AIJA 4F92B 2A6HF 1X2NA 1JHFA 3EYIA 4N13A 3FKJA 4A5MA 1DPPA 4RK9A 2LP0A 4WF2A 1LVKA 2VT2A 4UV9A 3JAMZ 1NV0A 3I6VA 1QULA 3W2AA 4OFJA 2NXOA 2HYGD 2KRCA 3CTAA 4ZZDA 1Y8QB 3I59B 1MXXA 3VXCA 1FWZA 2P81A 4F7ZA 5K5OA 4OIOF 3M9AA 2I49A 3RYPA 2XHKA 5B1BH 1MJ9A 2E35A 2CU7A 4UVBA 2ZNUA 3OIPA 5D5UB 2ZNTA 3O8HA 1KWHA 1OCZH 1EV7A 3QRFF 1S50A 4WXCA 2I3WA 4JX5A 3RQTA 1IRZA 2X1DA 4PJLA 4CICA 4O3BA 1YRNB 3VLVA 1YQAA 1SVLA 1IMFA 1HDDC 2FNPA 5FKNA 3RYRA 4AC0A 4BYYA 2O84X 3SEUA 1VDWA 3DP6A 1WSUA 1YO5C 2BY2A 4A3BJ 1N78A 2FX0A 2GLOA 1RRJA 3GX4X 3E0JB 5HDKA 3KN7A 5L9OA 3KCCA 1S9TA 2ELKA 1FQDA 5FLXZ 2LD5A 1HXDA 3M8UA 4U0WA 2Z2SB 3I3LA 2V26A 1ZR2A 2XRLA 1XN7A 3V8KA 1X1BA 4DBRA 1B8IA 4IHTA 4N8YA 4EUOA 2L7ZA 3CCUI 3S1RJ 2ZJQF 4NBQA 1VQPI 4JVCA 1W36C 3KEYA 4YKJA 2IVMA 2PBIA 4BJ6C 4ENNA 3V7RA 2RC7A 4HF2A 2QQ9A 3CP2A 1T8IA 4RB3C 5F64A 2M8GX 2RREA 5ICGA 4RGXA 2X6WA 2XHDA 2LKSA 2HZTA 5C4JJ 1ZYRF 3J7ZI 2ZMEC 1MBJA 1O3SA 2XSDC 1ETXA 1MSFC 4IO6A 2IA1A 5TP9B 3JRCA 3DLLF 1Y6IA 1ODDA 3MP6A 4M6XA 2BW3A 2D1VA 2QMWA 3DLNA 1MGTA 2E71A 3OIOA 3JYRA 2L5VA 5F7VA 2V3TA 2ID3A 1B2HA 2AQEA 2K3PA 1FOXA 1LBVA 2DS9A 2P1SA 1V5FA 3DQVC 2HR3A 1K4TA 1FOKA 2H1KA 1FPDA 5DTBA 3CO7C 4HBLA 4EJOA 1I6AA 1GV5A 3J80Z 2KIMA 3JRGA 5FBPA 1E17A 1MNEA 4G6TB 3T5XA 2BOLA 2VQCA 2ONSA 4PFTA 4D7MA 2VPOA 4M71A 1VNDA 4RGRA 1GVJA 2JUGA 2L9VA 2MC4A 3SEYA 1FMWA 3EYYA 3I5UA 2VE8A 1A8EA 4NF6B 4NE4A 3S14J 2ISYA 3EKIA 1G0IA 4HXVA 1P7IA 5HNHA 3M3KA 4XOPA 4RDUA 4ASNA 2IGKA 3MZ8A 1UIUA 2P6SA 4RGUA 1VFEA 1U9NA 1SFEA 3QWLA 4U7BA 4N0BA 2GH9A 5EGOA 3WAFA 2MC3A 4LB6B 3IJXB 1KZHA 3BZCA 2CFOA 4M72A 3IOUA 5ICEA 3I54A 5KAIC 1PUEE 1B46A 4XLCA 2VBYA 5KZTA 2RC9A 2RF1A 3GXOA 3EPZA 5D5WB 1G3YA 1TFDA 1SVOA 3OS1A 1MPBA 1O7TA 5EJCA 3PTYA 4YMAA 1K83J 4KT6A 1P1NA 4A0ZA 3TKYA 1HCRA 5HOOA 2K86A 1B51A 2GHBA 2XWVA 4RXLA 5LHGA 3IWZA 2R4GA 1SFOJ 3K70C 4GWSA 5F04A 2MW8A 4P5OA 1LB2A 2AIXA 3IH3A 3HGYA 1NG6A 1HKQA 3FJ7A 3TFLA 4LIVA 3LL7A 1B8IB 1FBDA 2Z23A 4ESFA 4FEDA 1PJRA 3ZCOA 4KFCA 4PAFA 3WGHA 4NF4A 2KIFA 1ZLJA 3ABLH 3D1RA 2YPRA 4BAYA 1OQHA 1S7OA 1KU7A 4FECA 4CH7A 5C4XJ 2L54A 1VQLI 3HFUA 4XKNA 2OZUA 4PFUA 4IO7A 4B4CA 2OCUA 2NNNA 4OEVA 3TQLA 2JTVA 3GFJA 3FM5A 1KU9A 4IO3A 4II2A 4XRFA 1J59A 3HTUA 2Y7WA 3H6WA 4CCLA 1Y3PA 3UORA 3KJTA 2BJJX 1AKHA 2ZO4A 1ZG3A 2EV6A 2KIUA 3IKTA 3CIJA 1YZ0A 1UCRA 1Z77A 3MWMA 1V5GA 4JX6A 5TISC 1ZHFA 4F52A 3S17J 1NV5A 4A3DJ 1FPLA 1OIBA 1NV6A 1B58A 1T39A 3J7AY 3BJAA 3LSTA 3LMMA 1OCOH 2CMPA 1R49A 2O1LA 5I84A 4EMSA 4O3CA 2QWWA 2XAHA 1UTHA 3KPHA 3OYIA 1NI9A 2F78A 2GXGA 2M4KA 3S2WA 1MBEA 3FXBA 1B9NA 1SMTA 4PJNA 1VQOI 1LDJA 5CC2A 4NF8A 4XK4A 1OYIA 2XX8A 3M3FA 2O7IA 1TQPA 3GYYA 4QBAA 3UNGC 1CGPA 3TEDA 1O3RA 3MP8A 3ERMA 4XEQA 1SW1A 1FYLA 5J16A 4YIIA 2RV8A 3CC7I 1FCKA 4JWXA 3OSRA 5DVJA 3VYSB 2VBXA 3PNTA 1RYOA 3C7JA 5FHMA 1TLHB 3EHSA 1OVTA 3LOCA 2R7FA 4G94A 3K4JA 1FSEA 1RNLA 1JJ6C 2DXIA 4YKKA 1WQ2A 2W48A 2PMZN 3OOPA 3H03A 4JSDA 3U94A 5BPIA 3DBHB 3DTIA 3PPQA 1MNDA 2Z9OA 2UVGA 1I50J 1AWBA 3IAZA 3FXMA 4GRIA 3U21A 2UYEA 2HXOA 3RIRA 1ON1A 2ESHA 3KG2A 5B3SH 4A3KJ 1D8KA 1D3KA 3HOVJ 4PFIA 3GVAA 3RQIA 2Q8MA 5DM6F 1DU0A 4JDFA 4RAZA 5A2QK 3MKYB 3K6WA 3QUJA 1JKQC 2A07F 4M4GA 1XCBA 4AIKA 2HQ0A 3ZQLA 4G68B 5JHFA 4L5JA 2GFEA 5K7ZA 2CJJA 1F4KA 2CQKA 4GIZA 2LYCA 1AU7A 1LJ9A 3BCBA 1LVAA 2XPVA 3CCJI 2OA4A 2PCRA 4PCDA 1N77A 4WKMA 3JR9A 3LAJA 1IN8A 1TWFJ 1IXGA 2TDXA 4U1ZA 3HRTA 4DIGA 3LSFB 1FT9A 3OSQA 2M0MA 4OIQF 4O3MA 1XSDA 5AE4A 1JKPC 1Z05A 2OZZA 5E1ZB 1IN4A 4H46A 2RC8A 2FBHA 3OR2C 2E7WA 2ELHA 2K4BA 2YSRA 2Z1DA 1XOCA 2KLOA 1W5SA 4N4UA 4NF5B 3BZ6A 2FOKA 2MA3A 4GX3A 1GR2A 3MVYA 3B02A 3PO3J 3FVKA 2JRTA 1AOYA 4P0GA 1O7FA 4U0YA 5L3EA 4NF6A 1ETKA 3OENA 4C1TA 3IUOA 1UELB 5LEKA 3RKQA 4X8RA 1KYWA 2CZKA 3IWFA 2P4WA 5LHHA 4FBPA 3UKGA 1QZYA 2MD0A 2JSPA 4JWYA 4GQOA 5BWJA 1DPEA 2EJRA 3ZMVA 3O9PA 1SD4A 3QXMA 3RKWA 3DM0A 3T8TA 4DCXA 3EUKL 5E79C 4CHUA 1FIAA 2M87A 3KEQA 3AG1H 1B40A 1R6RA 3M3YJ 2XXUA 4JSOA 2P3NA 2R7UA 4A3EJ 2COMA 4IRHA 2XF6A 1K61A 1YRNA 2VKHA 3N05A 4IQ4A 4HF1A 2QLZA 1N7XA 2CUFA 2DFIA 2JPBA 4IPAA 5BOXA 5M5WJ 3QPHA 5CQGA 1YJWI 2F7AA 1LBXA 2W25A 2ZZVA 1V4RA 3VYUB 2L02A 3ONQA 3K02A 1HSEA 2W85A 2QM3A 1B52A 4QF9A 4YFXF 5HDGA 2XGEA 3ZKKA 5EEGA 1QVUA 1IUFA 2HVQA 1H8AC 1L5TA 3D5SC 1B6HA 2R7QA 3KP5A 4L0ZB 1JETA 3PPPA 5IOYA 4DYQA 5DVFA 2HGCA 3RDIA 1J0RA 3C34A 1G59A 1ZKGA 4HA8A 1BC7C 1IIWA 1JQFA 5FB2A 5FKMA 4PFOA 5J1UA 1DP3A 4IHSA 2F6GA 3LSJA 3ZS6A 3FVGA 3VVFA 2I10A 3S8PA 1MKMA 3OO9A 2EFWA 5IOZA 3KP3A 4E7HA 1A7LA 1ETWA 2FIEA 2F2EA 5CVRA 5HDNA 2MKZA 3PPNA 4I02A 5DUKA 3LBSA 2VASA 2L7KA 1BK4A 3LC8A 2JSCA 3ML6A 2V9KA 2UVIA 2Y31A 2DLLA 4HX4A 3CLOA 3W3CA 2QUFA 3CCLI 3L2CA 2NWJA 3GEZA 1HKSA 5H20A 3WHCA 2FHYA 3D1NI 1LQ1A 1D1BA 2OAZA 3R6UA 2A61A 4A2UA 3OMYA 1NG7A 4GWWA 3S9LC 3CCSI 1VQ5I 1T38A 4LZ7A 2V3UA 2QBYB 4EM2A 2HVSA 4A3GJ 4MQ9F 3JAMK 2XXHA 3ZRGA 5E3LA 5IYDJ 2DA1A 1G8XA 1WHUA 3WTTC 3RI4A 3ONMA 4U21A 4MFIA 3OYDA 2HYFA 3QYEA 3JRIA 2XGXA 3V8LA 3C9HA 2L7FP 2X9DA 5E20A 1H44A 2NUVA 2X0LA 4NF0A 4OVJA 4ONYA 1AOVA 2AO9A 3HPHA 2B4LA 2QYOA 4IB2A 2F5VA 2RCAA 3KBRA 5DD4A 1W36D 1V3FA 4LG0A 1ELJA 4P56A 5EGOB 1R1TA 1K6YA 4GF8A 2VD3A 3PSFA 3WHBA 3ZMTA 1EKEA 2ZKZA 3G4SI 4U4SA 3F8NA 2O61A 1FEXA 4HLXA 4CYDA 2G9WA 3E6DA 5TRDA 3S9NC 4MF3A 5LHIA 4NG7A 5D5XB 2DFFA 4CGZA 3BG6A 3BQYA 2FMYA 4PDKA 3MPKA 4GX4A 3MKWB 1V5EA 2K9MA 3HM5A 1QA6A 2WYPA 4HW0A 1PDNC 3N6TA 4LGWA 1Y0UA 4F1YA 5HS7A 3CCVI 2MABA 3TOAA 2PJPA 1EYJA 4EJUA 1RUNA 1AKHB 3EETA 3J7YJ 4IOCF 4LQ5A 5ILUA 2MYSA 2I5UA 4MGRA 1H9GA 3C1DA 2FNCA 2VOZA 3VLUA 2MH2A 2JZYA 5H8FB 1PB8A 1IG7A 3HTSB 1D1AA 2D1HA 5FLVA 3R7XA 2LY2A 4H0EA 1R36A 5LTCA 2OWTA 3IB2A 5J4YA 4UUVA 1QVSA 1WVJA 4FASD 3T22A 3EUAA 3BR6A 1T08B 2PMZA 4NN3A 4GFRA 2KISA 4BHPA 3CDIA 1WWXA 3K2AA 2OPTA 3PQJA 2VKEA 4Q47A 3WU1B 4L0YB 2RNJA 1ZH5A 3IV5A 3UA8A 1U9OA 3CESA 3F0CA 3C36A 1MBKA 4M9ZA 4BJTA 2CZIA 5K2YA 2HKXA 3RN8A 4O8MA 3CUQB 1BA5A 1US4A 3CFXA 1KONA 4BNCA 3T93B 2P5VA 2OU2A 1HSTA 3GTOJ 2LR8A 1FQCA 3TCFA 3W15C 5AIQA 2XC7A 2JJKA 4PFYA 4HSTA 4ZTJA 3HN0A 2CGPA 1RDXA 2ZBKA 2OWSA 4L9VA 2B4MA 4LK0F 3BZKA 3CUOA 4RBOA 3PV0E 1B4AA 1HBXG 3CVGA 3FJMA 4OXVA 1K9ZA 2V1UA 4ZYDA 2F8DA 3K0VA 1MD0A 1NK2P 1XC5A 3O3KA 3MP1A 5H8HB 4C1UA 1F9BA 1P6RA 1D0YA 3KE2A 4GD5A 5F24A 3W6JB 1OCRH 5KNLA 2EV5A 2PJRB 3WAEA 1URDA 3MW0A 4HE0A 5B70A 5KCJB 4AD9A 1QHGA 4ZYGA 2MH9A 3T66A 3RYDA 4UUSB 3CMYA 4XRSG 3UK4A 5TU0A 2GM4A 2GHAA 4MQVA 3IO4A 3SKPA 3T9UA 4EF1A 2GOMA 2KMUA 3C31A 4AYBA 3IRRA 3C3WA 3K4LA 3MZHA 2X4HA 4AM3A 1TWAJ 1HW2A 4PE3A 1J7KA 4BXUA 1FW0A 2GRVA 2EZKA 5LRSA 3OSGA 5IZ3B 2JPCA 1J75A 4MHFA 4R73A 5IY5H 5JFRA 1WCMJ 4R6YA 3PL8A 3CG3A 3T9VA 3BROA 5HS8A 3CQZJ 1PUFB 3A1YA 2M8EA 3CCQI 1B05A 3A3UA 3MZBA 1T0FC 1KQ0A 4KI0E 3FIWA 1P4WA 3OL4A 1JE8A 2Q88A 3CD6I 3KOTA 4NF5A 3W6VA 3V83A 2DI3A 3NAUA 4EVIA 2ZB9A 4N81A 3PD9A 4OETA 2ZNZA 1IMCA 4BQQA 2DWHA 4IZZA 4G2ZA 2WV0A 3ROJA 3TDJA 3SEVA 3JTHA 1Q1VA 3QP5A 5GP9A 5I3SA 1UB9A 4HX8A 4E7LA 5GAGJ 3K6GA 4DBQA 3KYDB 4KDPA 3MCZA 1B72B 4NDLA 1S5LC 3AL0B 2NOOA 4R2FA 1XMAA 5EZHA 4X04A 1YS7A 3WTYC 4N17A 1TWHJ 4G8MA 2E2IJ 3OOUA 1NV7A 1R5ID 4YZZA 3F8BA 3GLLA 4Z6YA 5GAHJ 1K6OA 2VT5A 4HDUA 4Q5SF 3AXFA 3PMXA 1YYVA 4FCYA 1WRJA 2WB1N 1WJEA 4QSEA 5I57B 1QGPA 1IXRC 4G8XA 3V7CA 4BE1A 4I2OA 1VQ9I 5KAFC 2Z8EA 1S8NA 4UXNA 1UMQA 2MSYA 5TGTA 5I59B 1OQYA 1R22A 2QCOA 6PAXA 3C32A 4GWXA 3O6IA 1YLFA 1O3TA 1TXFA 4GL0A 1B3GA 3QOPA 3CCEI 3PO2J 4E7IA 4NQ8A 5IPAA 3QU3A 3WODF 1KZ8A 4ZS9A 2F97A 2PJRA 4OIPF 2AS5F 1TL8A 2VXDA 2LMDA 2RKMA 1Q1HA 4KPTA 3EPEA 4BJ5C 4DYCA 1B4ZA 1IN6A 1TP4A 1Y56A 3KYCB 4ZC3A 3WTWC 2R7DA 1LGBC 3G1OA 2NVXJ 2V1DA 4DIQA 2IEEA 4LITA 2DT6A 1VFDA 4L5IA 3TOBA 4KCDA 3ABTA 4F55A 4EDPA 1NV2A 2ZZWA 2NRAC 3J7AO 1T0KA 5IZ3A 4BY1J 1S7EA 2O0YA 1MZBA 1Q9DA 2OBGA 5I2NB 2MG4A 1N04A 3LSLA 1T98A 2YU9J 2VLAA 2H25A 3KJ7A 4GOTA 3HOWJ 4ND9A 1USSA 1LCTA 3THIA 4F3SA 2R5YB 4OAYA 3LNQA 1D3YA 2RGVA 3HRUA 4JQFA 4HS7A 1VQKI 2CFXA 2LBFA 2LREA 2PI0A 4P0IA 4ANJA 1GVCA 1TZLA 4ELOA 3LQRA 2HNHA 1MMSA 3M1CA 3Q0WA 4OVQA 1Z67A 4BY7J 1UTBB 3FXOA 3S1QJ 2V25A 1V54H 4EV0A 2JA5J 2ZMEB 3KGCA 2PEXA 3B6AA 2RCBA 4KD5A 2XGCA 3HCQA 1FBFA 5L8DA 4C3HJ 1A6IA 2R7VA 1B1HA 1PC3A 3OYCA 3KN8A 3ZQCA 2A6EF 2GWRA 2KZGA 1XB4A 4PC9A 3OWTA 5ICFA 3CHGA 2EPFA 2UVJA 3LSGA 2Q0OA 4CSWA 3P7NA 1N75A 3HRMA 1I1SA 1I69A 3I0TA 3S9EA 2FSWA 2YUSA 3Q0UA 2R7ZJ 1Z1DA 1S72I 4H0WA 3S3OA 4MJOA 5E3MA 3VODA 3PJRA 5JTYB 1XMKA 3WE2A 2I58A 1MQDA 3Q9VA 1TQMA 5AA2B 4I0AA 4O6JA 5B7DA 1TTYA 4XOTA 4FAJA 3VE1B 2XWOA 4OMYA 5KCMA 3TO9A 2DDBA 4L9JA 3G3KA 1T33A 1U78A 4WCGA 4BXFA 3U8QA 3TKDA 4BS9A 1FJ6A 2OJTA 1TT5B 3RT6B 2FRHA 1RETA 5JVGF 5JTYA 2Z16A 1N0TA 4NTLA 4PBQA 3ZQ7A 3PIPF 1ONVA 2FUG2 1R23A 4DZJA 1A8FA 5EZGA 2DFEA 1NUYA 5FLXK 5EYRA 2VGQA 5T3JA 3GO5A 2F3DA 4IY6A 5I58A 1KGSA 3F21A 5EQAA 2G7HA 2R3SA 4L18B 2ETHA 3BJ6A 2AXTC 3OYKA 2R93J 2G93A 2HHMA 3FISA 4KR5A 4OESA 1A6QA 1ZRFA 2FE3A 1SD7A 4K2EA 2N8GA 3JTGA 2JRMA 1ZBMA 5FHNA 3K2DA 4XMYA 4QXDA 4DI4B 4B44A 4GVOA 4NX1A 1G6NA 1SD3A 2OF7A 2DWIA 4MIMA 3UP9A 1ZRDA 1IRGA 2D3IA 1LFBA 4OZ9A 5L3DA 3HOZJ 2X6XA 5B5EC 2NVQJ 3IFCA 3PUVE 3HRSA 4EQQA 1OQGA 2V9VA 3GUDA 3TTLA 4V19K 1QZEA 1WH7A 3HOSA 5AA3A 1GXQA 1YX5A 4MIJA 4LJZF 3KP4A 3RT8A 2DA6A 1LFPA 2R5YA 2OLBA 2DQRA 3CI8A 4D1QA 1MRPA 5J4VA 2CZLA 3CDLA 4FORA 1GV8A 1LEVA 1SW4A 5J1DA 1QUJA 3Q29A 2Q2EB 1QZZA 3LFUA 4GBVA 4A69C 2IJLA 4WX9A 5AA1A 1E3HA 3W6KB 2LRDA 1A31A 4ENMA 1MG1A 5DV5A 3PNVA 1YI2I 2QS1A 4AB6A 4FEBA 5CVVA 2VL8A 3IKVA 3JV9A 3JW4A 2P5LC 1R00A 1D0XA 3CDHA 2E2HJ 1Y3NA 1FP2A 3TTRA 1HKTA 4UA8A 2R5ZA 2JVHA 2DE4A 3RNNA 4OU0A 2KDOA 4ZH4F 4UV8A 3W2WA 4AS4A 2VPRA 3NWTA 2KQZA 4U88A 2J5OA 3H36A 3ILUB 3TPAA 3KFMA 2IGOA 2V7FA 5CKTA 1VQMI 4LA9A 1P4XA 1LKXA 2QMXA 2ZYKA 3KBZA 5FTHA 5ITOA 4D5FA 2Q74A 3I9V2 1RKTA 2P2AA 1TNTA 3N97A 1D5VA 2IS1A 4JVDA 1BL0A 2AL4A 3N4MA 2YJPA 3HUGB 1ITYA 5HLTA 3KX2A 2NVTJ 3GLBA 3W2VA 1BJZA 3ABMH 5GTIC 1MSEC 4IR8A 5IZ1A 1MQGA 1ZKBA 1U5TA 2E5NA 3WGIA 3I5OA 2CQQA 1MQHA 1SYIA 1L0OC 5GADJ 2W7NA 4ZE9A 4THIA 1Y20A 5JLWA 4XR6A 3J80K 2YS9A 3MEXA 1IEJA 1BLFA 3RPLA 2M34A 5AA2D 2VT3A 3KN3A 2WAQA 4I40A 3PPOA 4ZE8A 4AWXB 3IRQA 4FX0A 3S15J 2PG4A 2WBMA 3TGNA 3OYBA 1Z3XA 5DCMA 3I59A 4FT8A 2VI6A 2MLGA 1WJ5A 1Q35A 3QPTA 2DMNA 2O3FA 2V84A 1IN5A 3K1MA 4YB7A 4Y17A 1H76A 2L9SA 4M3EA 2JWTA 1ZREA 1ERDA 4LQ2A 1RR7A 1POGA 2NS7A 2OCCH 4H6DA 4HV5A 5D4RA 4BHCA 5HLIA 1OISA 3I55I 2XA5A 2K9LA 1P2FA 3K1PA 4Z0IA 2RVCA 1E2XA 4XLHA 5LGNA 4HSRA 3MBPA 3I53A 3OYFA 3SERA 4D0PA 1JP4A 2JA7J 1RDYA 3CUQC 4Y33A 1XSXA 3A01B 3TDZC 3FATA 2ZSIB 3MC2A 3D5LA 4LIUA 2Z3YA 1QPIA 1JT6A 3A29A 1B7HA 1UTHB 5F0FA 5K5QA 4DI3D 4N91A 2P0WA 2M4GA 2W57A 5B1AH 4I3YA 4F3GA 1R6ZA 4P11A 1JUSA 4XRMA 3E5XA 4JBAA 4IO2A 4OVSA 3RUMA 3U1KA 2PX9A 4OVRA 2AHQA 4JOMA 3HKZA 4HCWA 3C2BA 2IPQX 3IL2A 1IXCA 4R79A 4OWDA 1IUYA 4PGPA 5DEXB 1MMDA 3ESWB 3DEEA 5IT9K 2WBDA 3QSLA 4BDMA 3SESA 2FA5A 3T9XB 5E1WA 1FOYA 4U1OA 4ENKA 3LSIA 5EF6A 4KYDA 3RPLB 4DW6A 3A02A 2DA7A 1FX7A 3FHZA 3J81K 3SJMA 2F6CA 2DA3A 5F1JA 2B7EA 3VDXA 1QPMA 2QGUA 4G12A 3IOTA 2DK5A 3PQKA 5I58B 2PN6A 2KFDA 3DLAA 1QVTA 1JUPA 3N6UA 4I62A 4MX6A 3HUGA 3ULQB 3E5QA 1ZG5A 2JJ7A 3O66A 2LNBA 1KU2A 3DU6A 4P55A 3PUZE 3GCMA 2B0LA 4I8CA 1P4AA 2F5FA 3F23A 1NFTA 2X26A 2LC2A 2HKOA 2UZKA 3GBBA 1P92A 4H45A 1JEVA 2XF7A 3S2DJ 4FETA 1B0LA 2GQ1A 5ET6A 1EA3A 4EJVA 3A0BC 2M7AA 2DU9A 5HLHA 2VC1A 2A3SA 1FJLA 1R1NA 1MDP1 4L17A 4PSWA 3MQ9A 4QSDA 3MKZA 5ELVA 1ATGA 1KQ9A 1JKRC 2R6GE 5F27A 3JRDA 1BR2A 1RR8C 4QRZA 3HV1A 4XBFA 4Q48A 2NXNB 2RNGA 2IA2A 4YIFA 2DOFA 4YFKF 5L3FA 1B5IA 4P1LA 1ZN2A 2EA4A 5H6QA 3O28A 4IF4A 1WGXA 3MZYA 3S2VA 4POXA 3VSKA 4JBZA 5JI6A 1MDMB 5J3LA 2QBYA 1EZPA 2GA1A 2KZVA 2LBFB 2NOJB 2M30A 2CQ7A 3B73A 4BBRJ 1B7ZA 3U1DA 4KT5C 1S7YA 3MWBA 3RTFB 4PK4A 2D2WA 4N6PA 1TW3A 2GAUA 1U8RA 1YW7A 3HPIA 2IBDA 1D5YA 1D9YA 2HDWA 4NC7A 4E7ZA 1MH3A 3PU5A 1IC8A 1ZGWA 3HGGA 1POY1 4MHGA 2P5KA 3T96B 2HDCA 1RC9A 3FXRA 3LSWA 4NMYA 1D1CA 3V7SA 2O03A 1DGWY 1ZIUA 3RGYA 4M3BA 3V8JA 3LSPA 4O5VA 3L2VA 1AA7A 2CEXA 5EQ9A 1X3WB 3K4BA 4XORA 2AYSA 1XMXA 4XNFA 4PGGA 4IO4A 4O7IA 3O8GA 2XIGA 3S1MJ 2M45A 1OMIA 5M3FJ 1X1CA 2KP6A 3JCUC 4DNCA 3Q5FA 1DPUA 1J1NA 1Q1KA 5LLQA 3FBPA 2HOAA 2Z8DA 4RPOA 4CCJA 2VBWA 5TP9A 3FM3A 4HW8A 2ZFWA 1N3XA 3K6XA 4EQBA 3S93A 3ILTB 1BOAA 2HYJA 2DBBA 3ZN0A 2QSHX 1B1XA 3K00A 2PMSA 1M1EB 3H0GJ 3EQ1A 5KK1A 4FE7A 3RQ4A 1O4XA 2BGCA 1LAXA 3FV1A 4BDOA 5H8FA 2OX3A 1UHWA 2WEFA 2QS3A 2Y0SA 1GTKA 4GLIA 4Q0CA 1O3QA 1FPBA 4UVAA 3FASA 4ELRA 2MD5A 3BR0A 4NB5A 4CCNA 2KDZA 2ZJPF 2DO7A 1FYKA 3IO6A 3IX1A 1R5GA 1R1VA 4Q4ZF 2XAQA 5CLSA 3T0YA 1UHSA 4MNPA 2BXYA 3CF2A 2DQLA 3HZJA 3BBRA 3WU2C 2X85A 2YU3A 1W5TA 2WAEA 5GPCA 1B5JA 4XKQA 5TPAA 3N94A 4E0XA 4NC8A 1TBXA 2YX7A 3LA3A 2KJBA 3PSIA 2RAEA 1HDPA 1TWGJ 4MFDA 4RAGA 3S3MA 1UFMA 2X51A 1Y8RB 2ICWG 3GTJJ 2L2OA 1B3FA 3SHFA 3DPLC 2DMQA 3JRFA 4AU7A 1R7JA 1A55A 1R9QA 2PYYA 1LEBA 5FRNA 3LA7A 4HEA2 4B3AA 4GGGA 1ZQ3P 4QIWN 1Z7UA 2VC0A 4GXOA 4L9NA 3G3HA 2L4AA 2Z5UA 3A09A 4IY5A 2ZMEA 5L9MA 4IOAF 1B3LA 3S16J 1Z21A 3FXQA 3SEWA 4EXLA 4A6DA 4L9TA 4G7HF 4D9JA 2Q1ZB 4CZCA 4E6KG 2HZLA 5FD5A 3E3KA 4FATA 3FHNA 4A0XA 3GTQJ 2R7WA 4IL6C 3BTCA 4ESBA 2E0SA 3DBLB 1I39A 5AIPA 1OLAA 2NAZA 1A04A 1ENHA 1SD6A 3EDPA 5EYFA 4CCOA 1RYXA 4TV7A 1JKOC 1NNPA 4H65A 1C0WA 1JI8A 3VYTB 1YTYA 2KR0A 2JT1A 3HDDA 5IYBJ 1NKXA 1M5EA 5AA2A 1IXHA 3TEPA 2NS8A 1FIPA 4HCYA 4KMFA 2DOEA 2X7QA 3G3FA 2F36A 5IT9Z 4U0VA 4PTKA 2O69A 3FX3A 1OYWA 4GWUA 3L9FA 3VFZA 2QSFX 4IX7A 3USDA 1NH3A 2Q2CA 1UAAA 2L9RA 2CO5A 3OYEA 2R7RA 3ERED 2V79A 1I1GA 4NQWA 3JRAA 1X4PA 1R5HA 3H9JA 2WA0A 4ZYAA 3ZP5A 3SDBA 2LH9A 3DPUA 1LE8B 3FIRA 3FDYA 4F3QA 1GDTA 4MH5A 2DE2A 1XDUA 3NEUA 4LZ5A 5JLXA 3F8MA 4BDQA 2QEXI 4ITVA 3LFKA 1WFXA 4KISA 3H92A 1FPJA 3E78A 3RY3A 2PMUA 1Z9CA 3CSGA 3OS2A 5ET5A 4QTRA 1IN7A 1FRPA 1PP7U 2A05A 4P9UA 2IGNA 4HNTA 3KZIC 2ELJA 1BI2A 3TTKA 1PDAA 3AFHA 2F35A 3D0SA 1STZA 2DMPA 1FPQA 4P1EA 2WY7Q 3M07A 5DVIA 4G77A 3NOHA 3OEKA 4BEHA 2P3VA 2THIA 1NTCA 3TP3A 3FD3A 1FPIA 1A36A 2Y5LA 2DCEA 4XKBA 2L0KA 4R6HA 3RZDJ 1YJ9I 5ERIA 3L1PA 4HG2A 3H1CA 1E3OC 1B3HA 4KMUX 3TO7A 3N5LA 4N9IA 5CBSA 4N8GA 3K1NA 4M74A 4I0BA 2E1CA 3FMQA 1SW5A 3FZVA 4XIGQ 3FUZA 2XAUA 5E8GA 3GBGA 3ZOBA 2CG4A 2RQQA 4A3LJ 2RN7A 4YFNF 1ZTRA 2OTLI 1YE9A 3ZQIA 1QKAA 2LDUA 3L2UA 1IF1A 2DVZA 3VFJA 3TTNA 1QO0D 4OHNA 5CMMA 3OSFA 1BIYA 4F29A 2EZIA 1G3WA 3ECOA 2CEYA 2XXKA 4ZEFA 5IZZA 1D0ZA 2NS0A 1TT1A 3QMFA 1MXWA 2VKVA 1EYKA 3HSTA 2PFZA 5KCJA 1PUFA 1OPCA 4ESXA 2IAIA 4O7MA 2IXSA 2FQ3A 2QKLB 3VYRB 1BP5A 3E1SA 2BJIA 5FO5A 4OVTA 5FFXA 5AA4B 2Q89A 2HI3A 2Z99A 2W7YA 2M3AA 3ECHA 4C2TA 2M8CA 3BIHA 3V8XB 3Q3SA 4A12A 4ABZA 2KQRA 4BDYA 2V6CA 4MCOA 3QAHA 1FNNA 2CUZA 2M2EA 1HF0A 4UHTA 4B48A 3T9HB 1FBSA 2NVYJ 2IW5A 1OKRA 4I76A 3IHUA 4X0GA 3OYGA 5D4SA 3O2PE 3MAJA 2E60A 3CUQA 4LLGF 3WTXC 5IP7J 2E1NA 2VP1A 2O1MA 3SXYA 4IRIA 5JVTA 3PUXE 4KCCA 2KJCA 3COAC 1FBQA 2F5DA 3HHGA 3SZGA 4G6DA 4RA1A 2MFZA 1UG0A 2G0EA 4A5NA 1LEAA 1K79A 3PUFA 3S2HJ 1QKBA 4MTEA 1SI1A 1JHHA 2QPQA 4NWDA 4X48A 1FOWA 1I5ZA 3BJOA 3CZ6A 3F72A 4RA2A 2HDDA 2VOOA 2HXWA 4XKRA 3WTVC 3VSLA 4N6DA 1TW2A 3U72A 4QWQA 5FFZA 4IGRA 2UWMA 2DOAA 4YAHX 3I64A 4J00A 1ON2A 5CMCA 4F2OA 1LUJB 3IH4A 4LUBA 2R0QC 3RPWA 3TUSA 2QVRA 1FTMA 1MW7A 1LBWA 4LG3A 5I59A 2KKOA 1Z6RA 3DTKA 2DMUA 4A3IJ 5ESYA 3RCOA 3H6UA 2A5WA 2R92J 2V3QA 1F9NA 1G3SA 1HW5A 4OEUA 1BW6A 2Y0MA 2FNAA 2Y69H 4PFBA 4CA0A 4LG0B 4XF5A 2FQ4A 3CJQB 1FTTA 2O6GE 2G29A 2Y7KA 4S0HB 2OZ6A 1NNFA 1W4MA 4RB0A 1I6HJ 3PGFA 4QFPA 4WEDA 1KU3A 1U8BA 5IP9J 1K7AA 2KHMA 2DT7B 3E7LA 3GFLA 4LMYA 2NNYA 1VFCA 4MEVA 4Z7EA 1X2MA 4OFOA 2A69F 2LVSA 1AMFA 1FBCA 1RKWA 2CRGA 1HSLA 2DWAA 3DV8A 3G3JA 1Z91A 3BTJA 1WZ2A 3FK7A 4C30A 1D8JA 1G0HA 1B32A 4OWRB 1W5CC 4ZDOA 2IP2A 5IP6A 4B47A 4HPQA 2XB0X 3S32A 4BKXA 3S3NA 4NQWB 5DT6A 5F0CA 3HYIA 5I2KA 4M3GA 3BFUA 2BE5F 4GWZA 4AQ4A 4I09A 2HS5A 3U2RA 4IKFA 3MVPA 4E70A 4OINF 4I9DA 2E1MB 4NF8B 1Z6TA 2CUJA 3WTSC 1USTA 1A5JA 4LVQA 2HAUA 1SFXA 2DFHA 3BOQA 3GFMA 2OCEA 2R7TA 2K9QA 2ONRA 2B9SA 3K7AJ 3FBIB 3L2QA 5ICCA 4U7DA 1LSTA 1DMBA 3BKIB 2H5YA 4QFOA 4N4NB 3ZGKA 3R61A 2EFQA 3K4UA 3ZMUA 1Y39A 1BKAA 2PLYA 3UN6A 3AG4H 3K9TA 1FMVA 3VWBA 1IO2A 4XLFA 1CNQA 1Y4CA 4KN7X 3EHUA 4H4KC 2PBWA 4XN3A 4PJMA 1Z7ME 4QPOA 3JSPA 1LB9A 4NUBA 3BTIA 5ILSA 3TQWA 4HNVA 1NK3P 4LD5A 1I6BA 2JQ7A 1INPA 3GMEA 1YXIA 4RPNA 1OYYA 4WXJA 2DWJA 5DDGA 1J5YA 2QVVA 2L4MA 1S6LA 4H8IA 1VQ8I 1JW5A 3BPXA 1FTOA 1QJMA 2EB7A 1MDMA 2KIQA 3VXBA 1FBUA 1SW2A 1EH3A 2ZMBA 1DK4A 2QL3A 2ZXTA 4ESWA 1V55H 1POTA 2XRNA 3KFWX 2A68F 4AUXA 2K9SA 2VONA 1B5HA 1HSJA 1M5BA 2DT5A 3IB1A 4OERA 4Y13A 2EZLA 2GXAA 2EK5A 2Y7PA 1F1ZA 1NV4A 1Y1VJ 2IS2A 3MYUA 2OQRA 2Q8KA 1USYH 3CSBA 3IK6B 5DYHA 1JTXA 2P7CB 3HEFA 4ZZAA 3DFGA 4XTCQ 2HEUA 3RZOJ 1NH8A 1CQTA 3P9KA 4E4HA 4W97A 1LAFE 4NHJA 2F6PA 4ZZEA 4JXIA 4OAZA 3VOEA 2R7OA 1NNKA 4AIDA 2YLNA 2L5QA 5D8KB 5FLMJ 4G68A 2QSGX 4XXUA 3OEMA 2GIZA 2DTZA 3OY9A 4OTEA 3ZPLA 1R9LA 3DKYA 4HF0A 4XLPF 2EQRA 4X1BA 1LB8A 1PB9A 1IMEA 5I56B 1LLSA 1A40A 2DE3A 1W7PB 5K5RA 3WTUC 3BC8A 1MM6A 4OVPA 5L3BA 5CVUA 1SFKA 4FQGA 4U4XA 2EZHA 2K3FA 1OLCA 2CMOA 2F4IA 2F4OB 1MBHA 3HL2A 1IAWA 2B3BA 4I98B 1DP7P 3OYJA 4IRGA 5DCFA 1H43A 2XXTA 2HTJA 4I01A 4R2BA 1YX3A 2DOJA 3B6QA 1XX5A 2JK3A 2FU4A 2ZXWH 3IB0A 2EIMH 3A01A 2HPIA 1RZ4A 3C18A 4CXFA 2XWIA 2I0BA 2O8KA 3CC2I 4F3PA 2Y84A 2E1SA 3IFAA 3HSFA 2OUMA 1YOVB 2QFLA 2STWA 5KDTB 1B3EA 5HODA 1T95A 1WJBA 3DXJF 1NV3A 3D4GA 3H5RA 2CW7A 1MJBA 4A93J 1SAUA 5EEHA 5FJ8J 1XVXA 4G6QA 2M0CA 4PP0A 1R58A 1MBGA 5HLGA 1JT0A 4G8HA 2E19A 4PFRA 3OD7A 1YYZA 4Q30B 3HBLA 5JR3A 2XAFA 2TCTA 2ZXIA 3UR3C 3GZNB 3CFLA 3DP7A 2KL4A 3KZZA 4ZYHA 3BR2A 1EU8A 2XUBA 2XXPA 3SFZA 5HVQC 1S9HA 4YIRX 3F11A 1RIOH 3G6EI 5FGMA 3O6HA 3M7GA 2R5ZB 2H09A 1QNTA 1U5TB 2D45A 3DEWA 1TC3C 2RC4A 2B3FA 3K6VA 3U1OA 3ELKA 2ESNA 2W82A 1VE4A 2F7CA 3LA2A 4PFPA 3WTZA 3ZMSA 1FBGA 2ZYMA 3FXUA 3L6GA 2ACJA 1JGSA 3B6CA 4DZPA 4IHXA 4RB2C 3F6VA 2W1OA 1Y9UA 2XXVA 2Z8FA 1FSAA 2VHAA 3I3VA 2VOPA 1ANFA 5I2KB 3AKZA 2D5WA 4PJJA 1JXSA 1HW1A 1NL5A 4IO5A 4HYEA 1XHYA 3CJTB 3IL1B 3QPSA 4LLNA 1OR7C 4LFUA 2LF7A 3E9XA 3BCAA 3SQNA 3T1BA 3DKXA 1O57A 1LCFA 2F3BA 3VVEA 3MD2A 2NOGA 4MO7A 3M8FA 2FVZA 2CS3A 3WG9A 1RKMA 5CMKA 3KP6A 1YW8A 3VB2A 5A2QZ 4LATA 4MEYF 4DXCA 3PFIA 3W9WA 2XF5A 2I0CA 1WDNA 3RKYA 1ZAOA 2DP8A 4N07A 2I3VA 3KLOA 3HPGA 1SMYF 2XPWA 1Y0NA 1YFHA 4OOIA 1Y1WJ 3IC7A 3BG5A 4ECFA 4OANA 3U92A 5IAIA 1FLIA 2ISZA 2P6TA 4NEDA 1WJFA 4M9SA 2XXIA 5H8HA 2EINH 4I7HA 1PP8F 1NMUA 4YRVA 1FPFA 1BC8C 4F2QA 3GTKJ 3WE3A 3DEUA 4G9YA 1Z7LA 3BDDA 3RPUD 3SFIA 4NHBA 2HEOA 1A54A 4ZEBA 5CVJA 4P8BA 1XD7A 5BS6A 3P5JA 1FTZA 2DAOA 2K02A 2X48A 5K7FA 1DOTA 2PFYA 5KDTA 2CW0F 3Q26A 2L3DA 2LY1A 4G4PA 4NF4B 4AB5A 5L3CA 2VXZA 2FOWA 1LFUP 1RESA 1QUKA 3HJEA 5CBRA 3BT9A 4PZJA