1MHNA

High resolution crystal structure of the smn tudor domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
LQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Survival motor neuron protein
publication title High Resolution X-ray and NMR Structures of the SMN Tudor Domain: conformational variation in the binding site for symmetrically dimethylated arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1mhnA00
1RI0A 3FEOA 3DLMA 3MEAA 3QKJA 3OYAA 4B9WA 4A4FA 4Q5WA 2M1HA 3S3MA 2RHUA 3S3OA 4E7IA 4HCZA 4QQGA 2PQWA 4RG2A 4LD6A 2JTFA 1WJQA 4BDYA 2DIGA 5FRMA 5CIUA 2BIVA 3OMCA 2L89A 3KUFA 2R58A 2RJCA 4E7LA 3DB4A 2FHDA 3LX7A 4A4EA 3L2QA 3L2RA 1H3ZA 2LVMA 2X4XA 3OS2A 5FROA 3H8ZA 2JZ2A 2B8AA 2K3XA 5J26A 2DIQA 4IUPA 2BKDN 2NLUA 3PMIA 2RJDA 4QVZA 3L42A 4A4HA 3ASKA 4BE2A 1WJRA 3FDRA 5D6WA 5C0MA 3C4SA 3NTKA 2EFIA 3UWNA 4A4GA 5IN1A 5KE2A 3OYGA 3E9GA 4CRIA 3MEUA 1N27A 4II1A 3MP8A 2RJEA 3NTHA 4IUUA 2LDMA 3OY9A 2HQXA 4BDZA 4IURA 2K3YA 3QIIA 4PLLA 1OZ3A 3OYKA 4N4HA 3ME9A 3O8VA 3OMGA 5KCHA 4N4GA 3OYHA 4BE0A 4C5HA 3Q1JA 1G5VA 2M0OA 2R5MA 5D6XA 2LCCA 4IUVA 4PLIA 4C5IA 2YRVA 3M9QA 2X4WA 3GOXA 4IUQA 3OYNA 4E7JA 4FL6A 2RO0A 3CEYA 2QQRA 1OZ2A 2BUDA 3LGLA 3PNWC 4FU6A 3LYIA 2RJFA 2GFAA 3EAEA 2MWOA 3PMTA 2QQSA 4C5EA 4PL6A 2X4YA 3OYMA 4BE1A 2EKOA 3S3NA 1MHNA 4GY5A 2R5AA 2G3RA 3UT1A 2L8DA 3PFSA 2EQJA 5KE3A 2LTOA 2MWPA 2VYTA 2WACA 3MP6A 4N4IA 2P0KA 2XK0A 3DB3A 3MEVA 3OYIA 2GFUA 3OQ5A 3OYBA 5FRNA 3LLRA 1WGSA 3FLGA 4X34A 3E9FA 3QBYA 3OYFA 3F70A 3FC3A 4OVAA 1XNIA 3H6ZA 2DAQA 3LH0A 4L59A 2RHXA 4QW2A 3SD4A 3OYJA 2RHZA 4C5GA 1OYXA 4EDUA 1KHCA 2RI3A 2D9TA 2RHYA 3OB9A 5D6YA 3OS0A 2E5QA 3OYCA 3L2WA 3L2VA 4NS5A 3MP1A 4E7KA 2L3RA 2GF7A 3NTIA 3MEWA 2O4XB 2X35A 4IKFA 2R57A 4ZTFA 2CKKA 2IG0A 3L2UA 3S6WA 4B9XA 3OS1A 1WJSA 2XDPA 2EQUA 2M16A 3LGFA 4UC4A 4Z02A 2EQMA 5KCOA 5C6SA 2HQEA 3P8DA 3P8HA 3ZEHA 2O4XA 5IAYA 4BD3A 3MO8A 2RI5A 5M9OA 3BDLA 4IUTA 3OYDA 3OA6A 1OI1A 2F5KA 2E6NA 3OYEA 5J39A 2EQKA 3OYLA 4BACA 5KH6A 4E7HA 4ZTJA 3META 2LRQA 4QQDA 2RHIA 3QJ6A 1SSFA 2RI2A 4QQ6A
chains in the Genus database with same CATH superfamily
2OAUA 2J05A 2QASA 2VKNA 4J9IA 4HCZA 1TH7A 3VRZA 4LD6A 3BE3A 2DXCA 4JJDA 3EFOA 1ZUKA 1EFNA 2ATCB 1SPKA 3L2QA 1H3HA 3OS2A 2FZGB 3H8ZA 3H0HA 4PJOD 4KT0E 1Q82R 4C0DC 1FX7A 3TU4K 5GANj 2BKDN 3RDVA 1OU8A 4CC7A 1Y07A 3NTKA 1VQNQ 2BE9B 2CP3A 4OB0B 1KQSP 2DLPA 2RQVA 1NYFA 2EIFA 2GNCA 1B34A 4N4HA 3H0IA 1R0CB 4M78E 1YITQ 1FMKA 4K11A 5I22A 4L6V5 2P84A 2ZGWA 4FW1A 3JCMf 3THKA 3CCLQ 3OYMA 4O5VA 1D09B 1VQ9T 1TWBA 3CC2T 2YUNA 1W2BP 4PKCC 1UTIA 2X4JA 1TXQA 4M78F 4M7DC 2KT8A 1M9SA 1UUEA 1JB0E 3QZ9B 2DAQA 1FYNA 2EGAA 3CCUA 2E3HA 4FYXB 4MDWA 1OYXA 4HVUA 1K0XA 5DM7R 2X51A 3HHTB 4KH0B 2A36A 2RF0A 4RTVA 1K9MU 2P0PA 3SDZA 4DEXA 3G71Q 2GF7A 2J7IA 4LN2A 4E7ZA 1G3SA 4C0DB 3CCQA 2FG0A 3RMQA 4E2FB 2DKGA 1GCQA 3CPFA 3ZEHA 2M0YA 4RTYA 1PC0A 4ESRA 4DEYA 2VWFA 3PVLA 1YHQA 3DLLA 2RQRA 4J7FA 2JUFA 3FJ5A 2KROA 3CXCS 1ZA1B 3M58A 3QKJA 3EGDB 3OYAA 2PUKB 4J9BA 3OYYA 2OTLQ 4E7IA 5HKCA 4RCBA 4RG2A 1MV0B 1WJQA 3BW1A 4V2SA 5CIUA 2KRSA 2YHTA 2O2OA 4A4EA 2DFUA 2DXTA 2JZ2A 4KGZB 1Q82U 2BZ8A 4N0AC 1BB9A 2NLUA 2DA9A 4QVZA 4XU3A 4M7DB 2V26A 5LJ3e 4A4GA 4M78C 1VQ7A 2HAXA 4RTZA 2BE7D 3NTHA 4RTUA 3CCEQ 1TUDA 1B07A 4RKUE 4LDUA 1M4ZA 2XDDA 1UHCA 1VQ9Q 3CC2Q 2RM4A 1D3BB 1QVFS 5KYUA 3NMZC 2L3SA 2DJZA 1RAEB 4M75A 5I2SA 4Z8AA 2FEIA 3QPHA 2KRNA 3JB9J 3UATA 1A0NB 5FWBA 3JCMV 4ZGJB 1B3QA 4HCBA 1IZ6A 4ZN1A 3FC3A 1QCNA 2ZPIB 2IPOB 4OMLA 4KULA 4IIOA 3CPWA 2ED1A 5GAOn 5GANe 2HBWA 5CKHA 2YT6A 4OGEA 1ZBJA 1LJOA 2KK4A 1WLPB 2YXYA 3CCVT 3EGDA 2MAMA 4JJNK 4M78B 3JCMW 3OYDA 2DXBA 2LMJA 2KXCA 3A5ZB 3RR6A 4ZTJA 3EFSA 2QTVA 2FRWA 3FEOA 1JXOA 2D1XA 2YRDA 2PQWA 4M7DA 4HCKA 2HL5C 3GNGA 5LJ5f 5IXFA 4JRKA 5GAN6 1ZX6A 2K9GA 2PNIA 1FMWA 5GAOq 4LUEA 3GNFB 4A4HA 2F1LA 3OW2A 3VUZA 4F14A 2QAZA 5KE2A 1AWXA 2E5KA 1WNLA 2MCNA 1B7TA 1YNZA 3CQTA 2BZXA 2NUZA 3CCSQ 3JB9F 5KCHA 1YWOA 1V29B 5KYYA 4R55A 4IIMA 4M77E 3CCMT 2YSQA 1VQ8A 1OOTA 2DPPB 1N6AA 2EYYA 4P5NA 4Y92A 2DYIA 1VYVA 4XTXA 3QSUA 3MP6A 4QVCA 4XU1A 2J06A 2W10A 2RNAA 3BFMA 4M77F 1NPRA 3HKSA 1SG5A 1XOVA 2DVEA 2YDLA 4J9FA 2PVGB 3AHUA 3QDFA 4N0AA 4C5GA 1VQLQ 3E1SA 4LDWA 2F5TX 4M78A 2P4TA 4ZTFA 4A4KA 2F69A 3L2UA 3HSBA 4Z02A 3G4ST 4AMCA 3VS1A 4C92E 1K8AR 4Z89A 1O75A 2YLCA 3GIBA 3UF4A 4IUTA 2JM8A 2MMPA 1Q82C 3QHSA 2RHIA 2CYZB 4R0KA 5IHKA 3RUXA 1YI2T 2K57A 2M1HA 4JJCA 1G8XA 2RHUA 1GCPA 3HFOA 4C92F 3A98A 2VB6A 2A37A 3KUFA 1YJNQ 3VS7A 2DEQA 1M1GA 1IGUA 4NL2A 1VYUA 3RIRA 5FU7C 5GAMg 1AHJB 5J26A 5LJ3f 5KYXA 2DERA 1GFDA 3ASKA 1W1FA 5D6WA 3OBWA 5I21A 3I56T 4M77C 3EG9B 4PJLA 3OY9A 4HVVA 1SHFA 1VQOT 5GAN3 3O8VA 1UG1A 1DJ7B 1GXIE 3HTRA 4C0ZA 3SEMA 1BU1A 2HBPA 1D0YA 5GAOm 4KUDK 1OPLA 3EAEA 3CCJT 2G3RA 2EQJA 2XD0A 5HK3A 1K4US 3O5ZA 2A7YA 2K5FA 4X34A 3G6ET 1T0JA 3G4SQ 2PUOB 3MJXA 1LVKA 1QVGP 2DZCA 3OB9A 2FZKB 3V8LA 3FRNA 2DD4A 2V8KA 3X28B 3REAB 4M7AD 4C92C 5GMKj 1YJ9A 5CKEA 5FU7B 5GAMd 2EQUA 2M16A 4XTWA 4J5YA 2RH2A 3HFNA 5GJWB 4X9CA 4C8QE 1K8AU 4OMFB 4M78G 2HZYA 2K7AA 2GQIA 4JS5A 2NUTA 2LQKA 5KYNA 4M77B 2M51A 4QQDA 3NGPA 2RI2A 1T0HA 5EG2A 4B9WA 5LJ5h 2JNGA 1ACMB 3UDCA 4J6WA 4ZGDB 1D0XA 4OB2B 1WHGA 4C8QF 1QMCA 2DIGA 2AT1B 3I56Q 2KBTA 2HDAA 3JCMP 1TG0A 1W6XA 2B8AA 3C12A 3FJPA 3EG9A 2K3XA 1ABQA 3R6OA 4BI4A 1XJWB 1VQ5Q 2XMFA 2DL5A 5KYWB 2KR3A 4DQ2A 2VGNA 1YCSB 2I2LA 3TSZA 4F7UE 3VU3C 1JJ2A 1TUGB 4XAXB 3SHWA 5CR2A 1AWJA 4AFZC 2CP5A 2LQWA 3JRZA 4C92B 2QEXA 5GAN2 2COZA 3ZBDA 1M8VA 5FU6C 3CMEA 2ZCFB 1QLYA 4C0FA 4F7UF 3G6EQ 1D1CA 1IRXA 4A54A 2HMAA 4BE1A 2X4YA 1WQWA 2R5AA 3A8OB 2L8DA 4J8OA 1OV3A 1ZSZC 2X3WD 2VYTA 1VQKQ 1YITA 1ZUUA 1TS9A 1BI1A 2F2WA 2O88A 3GPLA 5CKDA 4OVAA 3CCLA 2V1QA 2RHXA 2RI3A 1WX6A 1C1AA 5GAMj 2E6ZA 2DTOA 2VC8A 4C8QC 3NTIA 4DA4A 2KYBA 4QKUA 4KGXB 4M77A 3QG1A 3S6WA 2L0AA 3QO3A 1BK2A 4M4ZA 1XTDA 2NYSA 1I0CA 2O4XA 1QKXA 3CBMA 3G71A 4CI0C 2LRQA 4M75D 3PIPA 1N9RA 3MEAA 2RQTA 1M30A 2NUPB 1S72Q 1QKWA 5LJ3h 5FU6B 2COYA 4J6XA 1VQMT 3CC4A 1OQKA 1PRMC 2L89A 1WHHA 3QDRB 5FW9A 2FPEA 1ZSZB 4HA8A 3EG0A 2OTLA 3VS2A 4C92A 3QWYA 4PJOF 4JDSA 4XQ3A 1U8RA 5C0MA 5GMKe 2C0OA 1MNDA 1BI3A 3OYGA 1BIBA 2K3YA 2HD0A 4N4GA 1VUBA 3VS0A 4C5HA 1QP2A 1GBQA 4TVRA 4C8QB 1VQ6Q 4PK4A 2HSEB 2DTHA 2AIRB 2L2PA 1OZ2A 3CCEA 3FB9A 3U23A 2MOXA 5HY6A 2MWOA 2RA2A 1GL5A 5IH2A 2QYZA 3UT1A 1X2QA 5KE3A 1QCOA 4M7DD 2P0KA 4PJNA 3GBQA 4DOWA 1PD0A 2CREA 3OQ5A 1MMDA 2K2MA 1HD3A 1K8AC 2EYZA 2QI2A 3CD6T 4J9EA 1WXBA 4XTUA 3SD4A 3JB9G 5CVIA 1IHWA 2OX7A 4EDUA 1VQPT 1N8RR 1R0BG 2D9TA 2RHYA 2KY9A 4JZ4A 3CMAT 2CGHA 1UGVA 3I5SA 2QGFB 4WF2A 4KRTA 4F7UB 3CPWS 2XI9A 4X1VA 4FCYA 1M27C 2GCXA 3OS5A 2RMOA 2QQ9A 1VQMQ 1BBZA 2YUOA 3BDLA 3URGA 2LCLA 4M77G 2RK1A 3A8MB 5J39A 4E7SA 4JZ3A 3M53A 5KH6A 2JW4A 2D8HA 4PFOA 2LZ6B 1WHMA 3V7RA 4EIKA 1G3TA 2O9SA 2WSEE 1M1FA 4A4FA 4Q5WA 1ZSZA 3MHXA 1OEBA 1RACB 2AKLA 1WHJA 2R58A 3MPUB 4EMKC 1U06A 5GMKm 2YUPA 2YLBA 1AT1B 3ULRB 4KUIA 4RTTA 4R56A 5GAMe 4C8QA 1KG1A 1K0SA 1WHKA 1NBEB 1JU5C 1HXDA 1M3CA 1R77A 2XIDA 3OW2S 1UGRB 3J80E 1UECA 2KVQG 1G5VA 4C92G 3SFMA 2PTKA 1E7OA 2M0OA 4PLIA 5IHIA 2LJ1A 4E6RA 2JT4A 2ECZA 3CCUT 2ROTA 4O6JA 2Y4XA 3PNWC 3CD6Q 2EPDA 1PCXA 3X25B 3CCSA 2EGEA 1VQPQ 1SEMA 5CAIA 3CMAQ 2KYMA 2QG9B 3JCMJ 4PJOB 1VIEA 3EGUA 2CP2A 3CCQT 3OYBA 2EJFA 1KK7A 3QBYA 4F7UA 2ABLA 3OYJA 3M56A 4OF1A 1OULA 3ZL7C 2AZVA 1YJWT 1N8RU 3RKXA 1OU9A 3L2VA 1WQ7A 4EMKB 2CKKA 3OS1A 1NLPC 2EQMA 5KCOA 2E1HA 2FB7A 1VQLA 1WI7A 4LDXA 1VA7A 5IAYA 2FVUA 2LJ3A 1Q86R 1MMAA 4HT8A 1T3LA 2HKQB 3OYEA 4CC3A 2RQWA 2VXFA 1WDXA 1NJIR 1OX9A 4HVWA 1PRLC 2AKKA 1V1CA 2RB6A 3CPWP 2EVRA 2VUBA 2FL7A 3RBBB 3HRTA 4WCIA 3OMCA 2ZPBB 4J9CA 1HYOA 3V7SA 3H9NA 2COWA 3EG2A 2D0NA 1X75C 2GBQA 5D7UA 2RK2A 1IO6A 3PMIA 1D1BA 1YJNA 1JQQA 1M2VB 3E19A 3JSCA 3P8BB 2CS7A 1M5Q1 1U5SA 4RTXA 1WHLA 4AFSC 2DL3A 1QWFA 2L5QA 4C8QG 2E10A 4CC2A 2ROLA 2HQHA 4PJMA 2JTEA 3CCQQ 1WPYA 1X69A 1VYTA 2AK5A 2DBKA 4FU6A 3CXCP 2EJGA 2VVKA 1D3BA 2EKOA 1YJWQ 1MHNA 1K1ZA 4GY5A 1UJYA 2LT4A 3MKDA 3QZ5B 4PFZA 3D7SB 2MWPA 3OW2P 1NG2A 1KQ2A 2ZZDA 4LNPA 2XK0A 4HCCA 1PKSA 3JCMh 4XTYA 3MEVA 4BUGA 4EMKA 3CBOA 3E9FA 1KIKA 4AG1C 3F70A 4QW2A 3C0CA 3PTAA 2XKOC 2NWMA 4DBHA 1WXUA 2E5QA 3L2WA 3I9QA 3OBYA 2J6OA 3QWXX 1UDLA 2DTIA 2EYWA 4F7UG 4F04B 3G4SA 1WJSA 2XDPA 3TCJA 2ZPEB 4AFUC 5GAN4 3P8DA 1ZA2B 2J6KA 2CH4A 4C0GA 1QVFP 5IT9E 5LJ5g 1WFWA 3L1AA 1Q7YR 1Q86U 2DEUA 3CCVQ 1Q95G 1KQ1A 4AFQC 1EX4A 1NJIU 2F2XA 3DLMA 3EHRA 1YP5A 2KE9A 3S3MA 3HP9A 3JCMc 4KGVB 3GF5A 4QVDA 1FXXA 4BDYA 2LNHB 2KGTA 4A53A 5GMKi 2X3XD 2QTXA 1RABB 2QDLA 1EZZB 3DKMA 5CQXA 4MMKA 5FROA 1U1SA 2JN0A 1TUCA 4HT9A 2D0QB 2KDSA 4DBQA 3NPFA 4HKEA 3EFRA 1BI2A 5GAN7 2LT1A 2YUQA 2EFIA 2JJ9A 4OMQA 1VIFA 1KC8R 1KHIA 4CRIA 2CP6A 3MEUA 1RAIB 2L3PA 1SSHA 4DBFA 4EMGA 4BDZA 1OZ3A 3M5AA 4J9HA 1YIJT 1VQ5A 3JB9H 4ORZA 2YRVA 4J6YA 1GFCA 1JJ2S 3GOXA 1N8RC 4FL6A 3RERA 4GLMA 1SHGA 1TSFA 3JCMb 2RJFA 1RL2A 2XG8D 5IHNA 3FIFA 2DE0X 5LJ5d 1TTHB 1Y96B 3CCMQ 4ZNXA 3KFVA 1Y0MA 4PJOG 2GTJA 1W4SA 2JMAA 2FPDA 4NOYA 3OYIA 2L3QA 2M9UA 3G6EA 3LLRA 1G83A 4YTLA 4RTWA 3R6NA 4M7AE 1BIAA 2WSFE 5HK0A 5EC7A 4FW2A 1VQKA 3OYCA 4C92D 2J6FA 1QWEA 3CCRT 5AT1B 1NEGA 1PSEA 2IVWA 5CQYA 4L5GA 4IKFA 3T9NA 4M7AF 3SWNC 2OTJT 5CO7A 2SEMA 2HQEA 2QQAA 3LWHA 2MIOA 5L8RE 3MO8A 2EYXA 5GANf 1M90R 1Q7YU 1OI1A 4DBRA 5LJ3g 2H3JA 1M3BA 3I55T 2DETA 4D8KA 3HRUA 5GAOp 2DM1A 3M0RA 3J81E 2KMTA 2DL7A 3M0SA 3C95A 1UEBA 4QQGA 2CZ6B 2BIVA 1QVGA 1Q81R 1YI2Q 3A8HB 2JOYA 3DB4A 3LX7A 2Y4YA 3VYGA 1S72A 5FWCA 1UGPB 2JS0A 2GQVA 1YIJQ 1RLPC 2W0ZA 2QXFA 1Y7XA 1UB4A 3E9GA 1KC8U 1IB8A 4D6WA 8ATCB 4JUVA 3M0UA 4IURA 3BY7A 4OMMA 3HPWA 1JBMA 2X9HA 4NL3A 3EH2A 2DL4A 2K3BA 3I5RA 2CUBA 4E7JA 1VQOQ 4JLGA 2EWNA 1QW1A 3SWNB 5LJ5j 2CDTA 4PJJA 2CZ7B 2EGCA 2ZPFB 2QQSA 1O9SA 1H641 4KBMB 2H3EB 4M7AC 1VQ6A 2E3IA 5LJ3d 3CCRQ 1X2KA 4J9DA 3CCJQ 2DK3A 5GAOr 2ESWA 1YN8A 5FRNA 2OTJQ 1Q86C 1UFFA 2GGRA 1KHCA 1VQNA 3UPUA 5D6YA 1NJIC 3N5BB 1UE9A 3MP1A 1C0MA 1OPKA 1PG5B 5ECAA 1YCYA 1M2OA 4LE9A 3I55Q 2K5LA 4Y28E 4MZPA 4XU0A 1RAGB 4M75E 3A1PA 3TQ7P 2EYQA 2JVVA 5M9OA 1AEYA 1M90U 1K73R 2E6NA 2A28A 3EFOB 3QJ6A 4QQ6A 3J7AF 4X9DA 3TVTA 1VQMA 2DBMA 4M75F 2KEAA 2ZPHB 1JXMA 1W2BS 2FZCB 3RESA 3QYHB 1Q81U 2V8JA 3M54A 3RKYA 3CC7T 4XK8E 4M7AB 2QEXT 3VS4A 1LNXA 2DXUA 1BCMA 3CMET 3PVQA 1B34B 3EGXB 3SWNA 3VYHB 4PJOE 3QIIA 4ZGEB 2Z0WA 5KYWA 2C06A 2DZ9A 3OSSC 1LOJA 4PNOA 1AD5A 1UJ0A 5DLQE 3LGLA 1K9MR 1QVPA 3PMTA 1AZEA 1VQ4T 1P92A 1UGSB 4DOVA 1UGQB 4M7DF 1Q7YC 1VQPA 3JCMQ 3G71T 3X20B 1G3WA 2QA4T 3CMAA 3QXEB 1U1TA 1YBYA 3PT9A 4M75C 5GANh 3G1JA 1VQ9A 1E6GA 3CC2A 3TEEA 3INZA 1QQJA 4KH1B 4J9GA 1AWWA 5IXBA 3CC4T 1HJDA 3H0FA 5C6SA 1X01A 5J3BA 5DLOA 2PZ1A 3WVDB 1K73U 2KT1A 3KBGA 3OYLA 4BACA 2CH4W 2OTLT 2XHCA 3META 5LJ5e 3CC7Q 2QEXQ 1U3OA 4RMOA 2Y90A 1BI0A 4M7AA 1KQSA 3CMEQ 5AYFA 1KC8C 4ANJA 3LWIA 1CSKA 3HRSA 2JTMA 1X43A 1NEBA 5CKBA 1FWZA 2EQIA 4FT2A 1Y71A 2PU9B 3EGXA 2NUPA 2LVMA 2X4XA 2JM9A 3GP8A 1IGQA 1CKBA 3REBB 1NLOC 2VGMA 2DYBA 4PJOC 1W2BA 2RJDA 3CCET 1M8MA 2ED0A 2K79A 3EG1A 3PGGA 4LXCA 5LL6S 3JB9I 1MMGA 3FDRA 2QGGA 3A8GB 3H41A 3MP8A 5KYUB 3RKWA 2DO3A 1VQ4Q 4MMLA 3ME9A 4FYVB 3OMGA 1RAHB 4M75B 3Q1JA 1H8KA 3RNJA 2MI6A 5FLXE 1N5ZA 3VS5A 3WVEB 1PSFA 1NPPA 2MK5A 2O01E 1SKUB 2QQRA 1AZGB 3JCMg 2XICA 2QA4Q 1YWPA 3S3NA 4M78D 2KQWA 2QQBA 1PHTA 1LPLA 3PFSA 3CBPA 2WACA 3E2UA 2CUDA 2GFUA 4LUDA 4FYYB 3VS3A 3CC4Q 4RCCA 1SRMA 1M90C 1JO8A 1YJWA 2LX7A 1G2BA 4BB7A 3TSWA 2VXEA 1HSQA 2R57A 4FYWB 2K5IA 3M0TA 4UC4A 4JRIA 1Q81C 5GJVB 3VKIA 5L23A 2ENMA 4Y91A 2CZ0B 4J7IA 1J3TA 1PWTA 2EQKA 2FPFA 1YHQT 4OP0A 4E47A 4WTOB 5CKFA 3C94A 1PD1A 1KJWA 3A8LB 1M1KR 2DD5A 3EHQA 3S3OA 2CP0A 4MDXA 3CCVA 2CT4A 2RD1A 3JCMd 3PIOA 4E7LA 2LX9A 1ZSGA 2OI3A 4M7AG 2O31A 4D8DA 4B6MA 2DIQA 1BCOA 4F17A 3L42A 1T3SA 4BI8B 3M0QA 2F2VA 3CCST 1NM7A 1K76A 1BYMA 2LP5A 2AHJB 1X27A 2IIMA 5KYYB 3JV3A 1VQ7T 2LDMA 2E12A 4ZN3A 3VV0A 4PLLA 3OYKA 1I81A 1HK9A 1LCKA 4LDYA 4FSSA 1N9SA 2LCCA 2ZPGB 1KFZA 4IUQA 1RI9A 9ATCB 1NE8A 3CEYA 3V7CA 5GAOl 3M4YA 1D0ZA 1IHVA 2EKHA 3VJPA 2EAYA 3CCUQ 2KAFA 3V8KA 4J83A 3M55A 1ZUYA 1G3YA 1H92A 1RADB 1VQLT 3EG3A 4FSXA 3UA6A 2C0IA 3FLGA 3L2ZA 3V8JA 1XNIA 2BZYA 1ZBXA 1K73C 3CCMA 4PJOA 3OS0A 1S1NA 4E7KA 2RN8A 4EPCA 3MEWA 1YHQQ 4B9XA 2LQ8A 1KD1R 3NFCA 3X24B 3P8HA 1RAAB 3CXCA 1F1BB 4BD3A 2LCSA 3IQLA 4JJBA 1MNEA 4CC4B 1ABOA 3ER0A 2JXBA 1RUWA 1YJNT 1M1KU 5CCAA 1ZHIA 3JAME 5KYXB 1MV3A 2B86A 2FHDA 1WXTA 1VQ7Q 2V8IA 1WA7A 4RG8A 1BKBA 3NHNA 1QVGS 4OMNA 1NZ9A 1K9MC 1I07A 2YWWA 4ELYC 1MGQA 1YI2A 3WXMB 3JB9D 1XQHA 1I1JA 1N27A 3M0PA 1QVFA 4II1A 4IUUA 2MF2A 2DRKA 2JMCA 4M75G 2DF6A 1YIJA 2LQNA 1M2VA 4XU2A 1RAFB 4A63B 5GAMf 2CP7A 1RLQC 1E6HA 2PVDB 2HEQA 2E65A 3LYIA 2DX1A 4QT7A 1VQ8T 4HXJA 3I56A 2P4RA 2D6FA 4M77D 2BTTA 3QJYA 1QCFA 2DMOA 4N4IA 2LC4A 1VQOA 2LNVA 1SRLA 5I11A 1WGSA 4AT1B 1K9AA 4JS4A 4BE2A 3LH0A 4L59A 4JRPA 2DRMA 3ZFJA 1UHFA 3CCRA 2E4HA 1NYGA 3CCJA 4ATOA 3LW5E 2OTJA 2NUTB 1KD1U 2E64A 4ME7A 2HSPA 3HL8A 3EH1A 1FMVA 3I55A 3OA6A 4GBQA 4E7HA 4OMOA 4M7DG 3QUIA 1SSFA 3RMSA 2V1RA 1RI0A 2KI7A 2QDYB 2C0TA 3M57A 2E41A 4OMPA 1OX8A 3M59A 3QYGB 2VV5A 4PFPA 1WYXA 1SF9A 2HKNA 5FRMA 3VUBA 1X6BA 3G7ZA 4AG2C 4F16A 2RJCA 7AT1B 3L2RA 1MMNA 1H3ZA 1VQ5T 4ELZC 5DY9A 2RPNA 1WIEA 2CSIA 2YRCA 2WSCE 2KNBB 2VASA 1KSWA 1AWOA 2DVJA 2FO0A 3PE0A 1D1AA 2HNIA 5GMKh 1TOVA 1VQ8Q 8AT1B 4BE0A 1MUZA 2M02A 2R5MA 2XU8A 4IUVA 4VUBA 4FM4B 2KRMA 1CKAA 1VOMA 4Z88A 2H8HA 2BUDA 1VQKT 2GFAA 2XDBA 4C5EA 1I5OB 4MZMA 3I35A 1AVZC 4JPBW 3JCMe 2LTOA 1Z9QA 2GTOA 3AT1B 3DB3A 3SB2A 2DJQA 3JCMX 1X6OA 2SRCA 2RQUA 1Y96A 5GANg 3H6ZA 2HL3A 2I0NA 4BY6C 4OB3B 3GLXA 5HCKA 2E70A 1M1KC 2O4XB 2G6FX 2K6DA 2K4YA 1YJ9T 4LDVA 1W70A 5I2MA 3LGFA 5GAN8 1TU0B 2KXDA 1JJ2P 4FT4A 2EJ9A 1S72T 1PNJA 1Z9ZA 2PVOB 4JLIA 2ZAEA 3M4GA 3OYHA 2QK0A 4OGCA 2HCKA 4OB1B 4RUGA 1IXDA 4C8QD 2K2VA 1I8FA 1AOJA 2JTFA 5GAN5 2D8JA 1KQSS 3UA7A 3CC7A 5A0DA 1JEGA 6AT1B 1PKTA 5GMKl 2FYKA 2JS2A 4IUPA 1PM3A 1ZQ1A 3KXTA 1WJRA 3C4SA 3UWNA 5GAMh 5GANd 2OAWA 5IN1A 3VS6A 4XTVA 1QP3A 4BY6B 2DILA 2RJEA 1VQ6T 1X6GA 2MPXC 2HQXA 2EBPA 1ARKA 1YFNA 3X26B 3TREA 3VRYA 2CZ1B 1GCQC 2DL8A 2LJ0A 4MZTA 5D6XA 4C5IA 2DNUA 3M9QA 2X4WA 3OYNA 2AZSA 5A0GA 2RO0A 1EIFA 1VQNT 1C6VX 2O9VA 5CK9A 1VQ4A 3LH5A 4PL6A 2OJ2A 3MCAB 2A3LA 5A0LA 1WZOA 4JRQA 5A2QE 2CT3A 1KD1C 1M3AA 1YITT 1YJ9Q 4XTZA 2P0QA 1IREB 3OYFA 4GLKA 1JRIA 2FRYA 2QA4A 3CCLT 2RHZA 2MYSA 1V76A 4FIBA 3BDUA 1I4K1 4NS5A 4M7DE 1Y57A 2L3RA 5LJ3j 4BI3A 2X35A 2IG0A 1R8OB 4EMHA 1ZLMA 2EW3A 1GBRA 3CD6A 2A08A 2A0FB 3OSVA 2RI5A 2KSSA 2F5KA 1I5LA 4LD9K 2CSQA 1GRIA
chains in the Genus database with same CATH topology
1NJIU 3A8LB 3DLMA 2OAUA 5EG2A 4B9WA 5LJ5h 2DD5A 2JNGA 3S3MA 3HP9A 4J6WA 3JCMc 3UDCA 4ZGDB 3S3OA 3GF5A 4OB2B 4HCZA 4QVDA 1TH7A 1FXXA 4C8QF 4LD6A 2DXCA 4BDYA 2DIGA 4MDXA 5GMKi 4A53A 3CCVA 2QTXA 2RD1A 3JCMd 3PIOA 2LX9A 3DKMA 5CQXA 3L2QA 4E7LA 4MMKA 4M7AG 3OS2A 5FROA 1U1SA 3H8ZA 3JCMP 2JN0A 2B8AA 3C12A 3FJPA 4HT9A 2K3XA 4PJOD 2D0QB 4KT0E 2KDSA 2DIQA 4C0DC 1FX7A 4HKEA 3TU4K 3R6OA 5GANj 4BI4A 2BKDN 3EFRA 1BI2A 3L42A 4BI8B 5GAN7 1Y07A 2LT1A 3CCST 3NTKA 2EFIA 4DQ2A 1VIFA 2VGNA 4F7UE 1KHIA 2I2LA 4CRIA 1BYMA 3MEUA 3VU3C 2AHJB 1JJ2A 1VQ7T 2LDMA 4XAXB 2E12A 4OB0B 5CR2A 4EMGA 4BDZA 4ZN3A 3VV0A 2EIFA 4PLLA 1OZ3A 3OYKA 1B34A 1I81A 4N4HA 1HK9A 3JRZA 3M5AA 4LDYA 4C92B 5GAN2 2QEXA 1N9SA 2LCCA 2ZPGB 1YIJT 1VQ5A 2YRVA 4J6YA 3ZBDA 1JJ2S 4M78E 3JB9H 1M8VA 3GOXA 4IUQA 5FU6C 3CMEA 1N8RC 1NE8A 4FL6A 3RERA 3CEYA 2ZCFB 4C0FA 4F7UF 4L6V5 3V7CA 5GAOl 3M4YA 2ZGWA 3JCMf 3JCMb 2RJFA 4A54A 1RL2A 2XG8D 4BE1A 3OYMA 2X4YA 3FIFA 2EAYA 4O5VA 3VJPA 1WQWA 5LJ5d 1VQ9T 3CC2T 1Y96B 2KAFA 2R5AA 2L8DA 3A8OB 4J8OA 3V8KA 4J83A 4PKCC 4PJOG 2VYTA 1W4SA 2X4JA 1YITA 3M55A 4M78F 1BI1A 4NOYA 1G3YA 3OYIA 1VQLT 4M7DC 2M9UA 3G6EA 4FSXA 3GPLA 1M9SA 3LLRA 3FLGA 3L2ZA 4YTLA 3V8JA 5CKDA 1BIAA 4M7AE 4OVAA 1JB0E 1XNIA 2DAQA 2WSFE 3QZ9B 2RHXA 3CCLA 1ZBXA 5HK0A 3CCUA 1K73C 4MDWA 1OYXA 3CCMA 4PJOA 2RI3A 3OS0A 5DM7R 5GAMj 2E6ZA 3HHTB 3OYCA 4C92D 1VQKA 2DTOA 2VC8A 3CCRT 1K9MU 4E7KA 2P0PA 3SDZA 1PSEA 2IVWA 2GF7A 4C8QC 3NTIA 4EPCA 4DA4A 5CQYA 3MEWA 4L5GA 4IKFA 4M77A 3S6WA 3QG1A 4B9XA 2LQ8A 1G3SA 3T9NA 4M7AF 3SWNC 4C0DB 2OTJT 5CO7A 3NFCA 3CCQA 3QO3A 3RMQA 2HQEA 3X24B 2DKGA 2QQAA 3P8HA 3LWHA 3CPFA 3ZEHA 5L8RE 1XTDA 3X26B 3CXCA 2O4XA 4BD3A 3CBMA 3MO8A 5GANf 3G71A 1Q7YU 1YHQA 1OI1A 5LJ3g 3DLLA 2H3JA 3I55T 4CI0C 4J7FA 2LRQA 2JUFA 4M75D 3ER0A 3CXCS 3PIPA 1N9RA 3M58A 3MEAA 3QKJA 3OYAA 2PUKB 3HRUA 1YJNT 5GAOp 3OYYA 3J81E 2KMTA 4E7IA 1M1KU 5LJ3h 5FU6B 3C95A 1UEBA 4J6XA 4QQGA 5CCAA 5HKCA 1VQMT 1ZHIA 4RCBA 4RG2A 3CC4A 1WJQA 3JAME 3BW1A 2CZ6B 4V2SA 5CIUA 2BIVA 2L89A 1QVGA 2YHTA 3QDRB 3A8HB 2JOYA 3DB4A 2FHDA 3LX7A 4A4EA 2DXTA 2V8IA 2JZ2A 2Y4YA 3VYGA 1S72A 4HA8A 4RG8A 1UGPB 1BKBA 1Q82U 1QVGS 2OTLA 4N0AC 1NZ9A 2GQVA 2NLUA 1K9MC 4QVZA 2QXFA 4XU3A 4C92A 4M7DB 4PJOF 4ELYC 1MGQA 4JDSA 1Y7XA 1UB4A 4XQ3A 5C0MA 1YI2A 3WXMB 4A4GA 5GMKe 5LJ3e 1U8RA 1BI3A 4M78C 1XQHA 3E9GA 3OYGA 3JB9D 1VQ7A 1N27A 1KC8U 4D6WA 4II1A 2HAXA 1QVFA 3NTHA 4IUUA 4RKUE 4LDUA 1M4ZA 1BIBA 4JUVA 2XDDA 2MF2A 4IURA 2K3YA 3BY7A 2RM4A 2HD0A 4M75G 1YIJA 1D3BB 4N4GA 1VUBA 1JBMA 3HPWA 4C5HA 1QP2A 4NL3A 4TVRA 4C8QB 1QVFS 4XU2A 5GAMf 2DTHA 4E7JA 4JLGA 2EWNA 2DJZA 1QW1A 3SWNB 5LJ5j 2PVDB 2CZ7B 1OZ2A 3CCEA 2E65A 3FB9A 2ZPFB 3LYIA 4M75A 5I2SA 5HY6A 2MWOA 2RA2A 2QQSA 1O9SA 1H641 4KBMB 1VQ8T 4M7AC 3I56A 3QPHA 3UT1A 2D6FA 3JB9J 4M77D 1VQ6A 5KE3A 5LJ3d 3QJYA 4N4IA 4M7DD 2P0KA 2LC4A 1VQOA 2LNVA 2DK3A 4DOWA 5GAOr 3OQ5A 3JCMV 4ZGJB 5FRNA 4HCBA 1WGSA 1IZ6A 1K8AC 2QI2A 4JS4A 4ZN1A 3CD6T 3FC3A 4BE2A 3LH0A 2ZPIB 4L59A 4XTUA 3SD4A 3JB9G 1Q86C 5CVIA 4JRPA 4KULA 4EDUA 1KHCA 1VQPT 3ZFJA 3CPWA 2D9TA 2RHYA 3UPUA 1VQNA 5D6YA 2KY9A 5GAOn 5GANe 3CCRA 3CMAT 2CGHA 3N5BB 5CKHA 1NJIC 3MP1A 3CCJA 1YCYA 4WF2A 4OGEA 2K5LA 4ATOA 1LJOA 3LW5E 4Y28E 4F7UB 3CPWS 2XI9A 2OTJA 4MZPA 2KK4A 1KD1U 2GCXA 4XU0A 2E64A 3OS5A 4ME7A 3CCVT 4M75E 2QQ9A 3HL8A 2EYQA 2MAMA 4JJNK 2JVVA 4M78B 3BDLA 3URGA 2LCLA 5M9OA 3OYDA 3JCMW 3I55A 3OA6A 1M90U 4M77G 2DXBA 2E6NA 2RK1A 3A8MB 5J39A 4E7HA 3M53A 3A5ZB 5KH6A 4M7DG 3QUIA 4ZTJA 3EFSA 3QJ6A 1SSFA 3RMSA 4QQ6A 3V7RA 1RI0A 2QDYB 3FEOA 1G3TA 2WSEE 3J7AF 1M1FA 3M57A 2E41A 4A4FA 4Q5WA 4X9DA 3M59A 3QYGB 1VQMA 2VV5A 3MHXA 4M75F 1W2BS 2ZPHB 2PQWA 5FRMA 3VUBA 4M7DA 3G7ZA 3RESA 2R58A 2RJCA 3QYHB 1Q81U 2V8JA 3M54A 3RKYA 3L2RA 1H3ZA 3CC7T 4XK8E 3GNGA 4EMKC 4M7AB 2QEXT 1VQ5T 5GMKm 5LJ5f 1LNXA 2DXUA 4JRKA 4ELZC 5GAN6 5DY9A 3CMET 2YLBA 4KUIA 4R56A 5GAMe 5GAOq 2WSCE 3GNFB 4A4HA 3OW2A 1B34B 3VUZA 4C8QA 1KG1A 5KE2A 2HNIA 1WNLA 3SWNA 3VYHB 5GMKh 1HXDA 2XIDA 4PJOE 3OW2S 1UGRB 3J80E 3QIIA 4ZGEB 3JB9F 2KVQG 1G5VA 5KCHA 4C92G 4BE0A 3SFMA 2M0OA 2R5MA 2XU8A 4IUVA 4PLIA 4VUBA 4FM4B 2C06A 2DZ9A 1V29B 3OSSC 1LOJA 4R55A 3CCUT 4PNOA 4M77E 3CCMT 5DLQE 3LGLA 2BUDA 2Y4XA 1QVPA 3PNWC 4O6JA 1VQKT 2GFAA 1VQ8A 3X25B 4C5EA 3PMTA 2XDBA 3CCSA 1VQ4T 4MZMA 2DPPB 1N6AA 5CAIA 4P5NA 1P92A 4XTXA 3JCMe 3QSUA 1UGSB 2LTOA 3MP6A 4QVCA 4XU1A 3JCMJ 4PJOB 3DB3A 1VIEA 4DOVA 3SB2A 3CCQT 3JCMX 3OYBA 1X6OA 2EJFA 3BFMA 1UGQB 4M77F 1NPRA 3HKSA 3QBYA 4F7UA 4M7DF 1Y96A 5GANg 1XOVA 3H6ZA 3OYJA 2DVEA 1Q7YC 3M56A 1VQPA 4OF1A 3JCMQ 3G71T 2PVGB 3X20B 1G3WA 4BY6C 2QA4T 4N0AA 4OB3B 4C5GA 3CMAA 3QXEB 1YJWT 3AHUA 3E1SA 1N8RU 3RKXA 1U1TA 1YBYA 3GLXA 3L2VA 4LDWA 3PT9A 4M75C 5GANh 1WQ7A 2E70A 2F5TX 4M78A 4EMKB 2P4TA 1VQ9A 1M1KC 2O4XB 3CC2A 1YJ9T 2K4YA 3INZA 3TEEA 4ZTFA 4LDVA 2CKKA 2F69A 4A4KA 3L2UA 3OS1A 5I2MA 3HSBA 3CC4T 3LGFA 4Z02A 3G4ST 2EQMA 5KCOA 2E1HA 5C6SA 2FB7A 1VQLA 5GAN8 1X01A 5J3BA 4LDXA 4C92E 5IAYA 1O75A 2YLCA 5DLOA 2FVUA 3GIBA 4FT4A 2EJ9A 4IUTA 4HT8A 3WVDB 2MMPA 1S72T 1Q82C 3OYEA 1K73U 3KBGA 2VXFA 3OYLA 4BACA 2OTLT 2PVOB 4JLIA 2XHCA 3META 3QHSA 3M4GA 2RHIA 5LJ5e 3OYHA 4OGCA 4RMOA 2Y90A 2CYZB 4OB1B 1BI0A 4C8QD 4M7AA 1KQSA 2K2VA 2RB6A 5AYFA 1I8FA 3RUXA 1YI2T 2K57A 2M1HA 2RHUA 1KC8C 2VUBA 3HFOA 2FL7A 4C92F 3LWIA 3HRSA 2JTFA 2JTMA 5GAN5 3HRTA 3OMCA 2ZPBB 5CKBA 3KUFA 1FWZA 3V7SA 1KQSS 2DEQA 3CC7A 4FT2A 5A0DA 1M1GA 1Y71A 2PU9B 2LVMA 2X4XA 4NL2A 5GMKl 3RIRA 5FU7C 5GAMg 3GP8A 1AHJB 2FYKA 5J26A 1X75C 5LJ3f 4IUPA 2RK2A 2VGMA 4PJOC 1ZQ1A 1W2BA 3PMIA 2RJDA 3KXTA 3CCET 3PGGA 3ASKA 5LL6S 3JB9I 1YJNA 1WJRA 3FDRA 5D6WA 3C4SA 3UWNA 5GAMh 5GANd 3OBWA 5IN1A 5I21A 4XTVA 3A8GB 1QP3A 3I56T 3E19A 3JSCA 4BY6B 3MP8A 2RJEA 1VQ6T 4M77C 3RKWA 3P8BB 2DO3A 2CS7A 2HQXA 3OY9A 1M5Q1 1VQOT 5GAN3 4MMLA 3ME9A 3O8VA 3OMGA 2CZ1B 1DJ7B 4M75B 2L5QA 3TREA 3Q1JA 4MZTA 2E10A 5D6XA 4C8QG 1GXIE 2MI6A 4C0ZA 4C5IA 3M9QA 2X4WA 5FLXE 3WVEB 3OYNA 2HBPA 1WPYA 1PSFA 5A0GA 1NPPA 2O01E 2RO0A 1EIFA 2QQRA 1VQNT 4FU6A 5GAOm 4KUDK 2EJGA 5CK9A 1D3BA 3JCMg 3EAEA 3CCJT 1VQ4A 2XICA 4PL6A 2EKOA 3S3NA 4M78D 2KQWA 1MHNA 3MCAB 4GY5A 2QQBA 2A3LA 2G3RA 5A0LA 2LT4A 3PFSA 4JRQA 5A2QE 3QZ5B 3CBPA 2EQJA 2MWPA 2WACA 1KD1C 5HK3A 2XD0A 1KQ2A 2ZZDA 2XK0A 4HCCA 3JCMh 4XTYA 1YITT 3MEVA 2GFUA 4XTZA 2A7YA 4BUGA 2P0QA 1IREB 2K5FA 3CBOA 4X34A 4EMKA 3E9FA 3G6ET 3OYFA 4GLKA 3F70A 1JRIA 4RCCA 1M90C 2QA4A 4QW2A 1YJWA 2PUOB 2RHZA 3CCLT 2DZCA 2XKOC 3OB9A 3PTAA 3V8LA 3FRNA 2E5QA 2DD4A 2V8KA 4FIBA 3X28B 3BDUA 1I4K1 4NS5A 3L2WA 4M7DE 4BB7A 4M7AD 2L3RA 5LJ3j 4C92C 5GMKj 3OBYA 1YJ9A 2DTIA 4BI3A 2VXEA 4F7UG 2X35A 5CKEA 5FU7B 5GAMd 2R57A 2IG0A 2K5IA 3G4SA 1R8OB 1WJSA 4EMHA 2XDPA 2EQUA 2M16A 4UC4A 3TCJA 2ZPEB 5GAN4 4JRIA 3P8DA 4XTWA 1Q81C 4J5YA 2RH2A 4C0GA 3HFNA 3VKIA 4X9CA 3CD6A 5IT9E 4C8QE 1K8AU 4OMFB 4M78G 5LJ5g 3OSVA 2RI5A 3L1AA 4Y91A 4JS5A 1Q86U 2KSSA 2CZ0B 2LQKA 4J7IA 2F5KA 1I5LA 4LD9K 4M77B 2EQKA 1YHQT 4OP0A 4E47A 4QQDA 1KQ1A 2RI2A 5CKFA 3C94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RI0 A;  3FEO A;  3DLM A;  3MEA A;  3QKJ A;  3OYA A;  4B9W A;  4A4F A;  4Q5W A;  2M1H A;  3S3M A;  2RHU A;  3S3O A;  4E7I A;  4HCZ A;  4QQG A;  2PQW A;  4RG2 A;  4LD6 A;  2JTF A;  1WJQ A;  4BDY A;  2DIG A;  5FRM A;  5CIU A;  2BIV A;  3OMC A;  2L89 A;  3KUF A;  2R58 A;  2RJC A;  4E7L A;  3DB4 A;  2FHD A;  3LX7 A;  4A4E A;  3L2Q A;  3L2R A;  1H3Z A;  2LVM A;  2X4X A;  3OS2 A;  5FRO A;  3H8Z A;  2JZ2 A;  2B8A A;  2K3X A;  5J26 A;  2DIQ A;  4IUP A;  2BKD N;  2NLU A;  3PMI A;  2RJD A;  4QVZ A;  3L42 A;  4A4H A;  3ASK A;  4BE2 A;  1WJR A;  3FDR A;  5D6W A;  5C0M A;  3C4S A;  3NTK A;  2EFI A;  3UWN A;  4A4G A;  5IN1 A;  5KE2 A;  3OYG A;  3E9G A;  4CRI A;  3MEU A;  1N27 A;  4II1 A;  3MP8 A;  2RJE A;  3NTH A;  4IUU A;  2LDM A;  3OY9 A;  2HQX A;  4BDZ A;  4IUR A;  2K3Y A;  3QII A;  4PLL A;  1OZ3 A;  3OYK A;  4N4H A;  3ME9 A;  3O8V A;  3OMG A;  5KCH A;  4N4G A;  3OYH A;  4BE0 A;  4C5H A;  3Q1J A;  1G5V A;  2M0O A;  2R5M A;  5D6X A;  2LCC A;  4IUV A;  4PLI A;  4C5I A;  2YRV A;  3M9Q A;  2X4W A;  3GOX A;  4IUQ A;  3OYN A;  4E7J A;  4FL6 A;  2RO0 A;  3CEY A;  2QQR A;  1OZ2 A;  2BUD A;  3LGL A;  3PNW C;  4FU6 A;  3LYI A;  2RJF A;  2GFA A;  3EAE A;  2MWO A;  3PMT A;  2QQS A;  4C5E A;  4PL6 A;  2X4Y A;  3OYM A;  4BE1 A;  2EKO A;  3S3N A;  1MHN A;  4GY5 A;  2R5A A;  2G3R A;  3UT1 A;  2L8D A;  3PFS A;  2EQJ A;  5KE3 A;  2LTO A;  2MWP A;  2VYT A;  2WAC A;  3MP6 A;  4N4I A;  2P0K A;  2XK0 A;  3DB3 A;  3MEV A;  3OYI A;  2GFU A;  3OQ5 A;  3OYB A;  5FRN A;  3LLR A;  1WGS A;  3FLG A;  4X34 A;  3E9F A;  3QBY A;  3OYF A;  3F70 A;  3FC3 A;  4OVA A;  1XNI A;  3H6Z A;  2DAQ A;  3LH0 A;  4L59 A;  2RHX A;  4QW2 A;  3SD4 A;  3OYJ A;  2RHZ A;  4C5G A;  1OYX A;  4EDU A;  1KHC A;  2RI3 A;  2D9T A;  2RHY A;  3OB9 A;  5D6Y A;  3OS0 A;  2E5Q A;  3OYC A;  3L2W A;  3L2V A;  4NS5 A;  3MP1 A;  4E7K A;  2L3R A;  2GF7 A;  3NTI A;  3MEW A;  2O4X B;  2X35 A;  4IKF A;  2R57 A;  4ZTF A;  2CKK A;  2IG0 A;  3L2U A;  3S6W A;  4B9X A;  3OS1 A;  1WJS A;  2XDP A;  2EQU A;  2M16 A;  3LGF A;  4UC4 A;  4Z02 A;  2EQM A;  5KCO A;  5C6S A;  2HQE A;  3P8D A;  3P8H A;  3ZEH A;  2O4X A;  5IAY A;  4BD3 A;  3MO8 A;  2RI5 A;  5M9O A;  3BDL A;  4IUT A;  3OYD A;  3OA6 A;  1OI1 A;  2F5K A;  2E6N A;  3OYE A;  5J39 A;  2EQK A;  3OYL A;  4BAC A;  5KH6 A;  4E7H A;  4ZTJ A;  3MET A;  2LRQ A;  4QQD A;  2RHI A;  3QJ6 A;  1SSF A;  2RI2 A;  4QQ6 A; 
#chains in the Genus database with same CATH topology
 2OAU A;  2J05 A;  2QAS A;  2VKN A;  4J9I A;  4HCZ A;  1TH7 A;  3VRZ A;  4LD6 A;  3BE3 A;  2DXC A;  4JJD A;  3EFO A;  1ZUK A;  1EFN A;  2ATC B;  1SPK A;  3L2Q A;  1H3H A;  3OS2 A;  2FZG B;  3H8Z A;  3H0H A;  4PJO D;  4KT0 E;  1Q82 R;  4C0D C;  1FX7 A;  3TU4 K;  5GAN j;  2BKD N;  3RDV A;  1OU8 A;  4CC7 A;  1Y07 A;  3NTK A;  1VQN Q;  2BE9 B;  2CP3 A;  4OB0 B;  1KQS P;  2DLP A;  2RQV A;  1NYF A;  2EIF A;  2GNC A;  1B34 A;  4N4H A;  3H0I A;  1R0C B;  4M78 E;  1YIT Q;  1FMK A;  4K11 A;  5I22 A;  4L6V 5;  2P84 A;  2ZGW A;  4FW1 A;  3JCM f;  3THK A;  3CCL Q;  3OYM A;  4O5V A;  1D09 B;  1VQ9 T;  1TWB A;  3CC2 T;  2YUN A;  1W2B P;  4PKC C;  1UTI A;  2X4J A;  1TXQ A;  4M78 F;  4M7D C;  2KT8 A;  1M9S A;  1UUE A;  1JB0 E;  3QZ9 B;  2DAQ A;  1FYN A;  2EGA A;  3CCU A;  2E3H A;  4FYX B;  4MDW A;  1OYX A;  4HVU A;  1K0X A;  5DM7 R;  2X51 A;  3HHT B;  4KH0 B;  2A36 A;  2RF0 A;  4RTV A;  1K9M U;  2P0P A;  3SDZ A;  4DEX A;  3G71 Q;  2GF7 A;  2J7I A;  4LN2 A;  4E7Z A;  1G3S A;  4C0D B;  3CCQ A;  2FG0 A;  3RMQ A;  4E2F B;  2DKG A;  1GCQ A;  3CPF A;  3ZEH A;  2M0Y A;  4RTY A;  1PC0 A;  4ESR A;  4DEY A;  2VWF A;  3PVL A;  1YHQ A;  3DLL A;  2RQR A;  4J7F A;  2JUF A;  3FJ5 A;  2KRO A;  3CXC S;  1ZA1 B;  3M58 A;  3QKJ A;  3EGD B;  3OYA A;  2PUK B;  4J9B A;  3OYY A;  2OTL Q;  4E7I A;  5HKC A;  4RCB A;  4RG2 A;  1MV0 B;  1WJQ A;  3BW1 A;  4V2S A;  5CIU A;  2KRS A;  2YHT A;  2O2O A;  4A4E A;  2DFU A;  2DXT A;  2JZ2 A;  4KGZ B;  1Q82 U;  2BZ8 A;  4N0A C;  1BB9 A;  2NLU A;  2DA9 A;  4QVZ A;  4XU3 A;  4M7D B;  2V26 A;  5LJ3 e;  4A4G A;  4M78 C;  1VQ7 A;  2HAX A;  4RTZ A;  2BE7 D;  3NTH A;  4RTU A;  3CCE Q;  1TUD A;  1B07 A;  4RKU E;  4LDU A;  1M4Z A;  2XDD A;  1UHC A;  1VQ9 Q;  3CC2 Q;  2RM4 A;  1D3B B;  1QVF S;  5KYU A;  3NMZ C;  2L3S A;  2DJZ A;  1RAE B;  4M75 A;  5I2S A;  4Z8A A;  2FEI A;  3QPH A;  2KRN A;  3JB9 J;  3UAT A;  1A0N B;  5FWB A;  3JCM V;  4ZGJ B;  1B3Q A;  4HCB A;  1IZ6 A;  4ZN1 A;  3FC3 A;  1QCN A;  2ZPI B;  2IPO B;  4OML A;  4KUL A;  4IIO A;  3CPW A;  2ED1 A;  5GAO n;  5GAN e;  2HBW A;  5CKH A;  2YT6 A;  4OGE A;  1ZBJ A;  1LJO A;  2KK4 A;  1WLP B;  2YXY A;  3CCV T;  3EGD A;  2MAM A;  4JJN K;  4M78 B;  3JCM W;  3OYD A;  2DXB A;  2LMJ A;  2KXC A;  3A5Z B;  3RR6 A;  4ZTJ A;  3EFS A;  2QTV A;  2FRW A;  3FEO A;  1JXO A;  2D1X A;  2YRD A;  2PQW A;  4M7D A;  4HCK A;  2HL5 C;  3GNG A;  5LJ5 f;  5IXF A;  4JRK A;  5GAN 6;  1ZX6 A;  2K9G A;  2PNI A;  1FMW A;  5GAO q;  4LUE A;  3GNF B;  4A4H A;  2F1L A;  3OW2 A;  3VUZ A;  4F14 A;  2QAZ A;  5KE2 A;  1AWX A;  2E5K A;  1WNL A;  2MCN A;  1B7T A;  1YNZ A;  3CQT A;  2BZX A;  2NUZ A;  3CCS Q;  3JB9 F;  5KCH A;  1YWO A;  1V29 B;  5KYY A;  4R55 A;  4IIM A;  4M77 E;  3CCM T;  2YSQ A;  1VQ8 A;  1OOT A;  2DPP B;  1N6A A;  2EYY A;  4P5N A;  4Y92 A;  2DYI A;  1VYV A;  4XTX A;  3QSU A;  3MP6 A;  4QVC A;  4XU1 A;  2J06 A;  2W10 A;  2RNA A;  3BFM A;  4M77 F;  1NPR A;  3HKS A;  1SG5 A;  1XOV A;  2DVE A;  2YDL A;  4J9F A;  2PVG B;  3AHU A;  3QDF A;  4N0A A;  4C5G A;  1VQL Q;  3E1S A;  4LDW A;  2F5T X;  4M78 A;  2P4T A;  4ZTF A;  4A4K A;  2F69 A;  3L2U A;  3HSB A;  4Z02 A;  3G4S T;  4AMC A;  3VS1 A;  4C92 E;  1K8A R;  4Z89 A;  1O75 A;  2YLC A;  3GIB A;  3UF4 A;  4IUT A;  2JM8 A;  2MMP A;  1Q82 C;  3QHS A;  2RHI A;  2CYZ B;  4R0K A;  5IHK A;  3RUX A;  1YI2 T;  2K57 A;  2M1H A;  4JJC A;  1G8X A;  2RHU A;  1GCP A;  3HFO A;  4C92 F;  3A98 A;  2VB6 A;  2A37 A;  3KUF A;  1YJN Q;  3VS7 A;  2DEQ A;  1M1G A;  1IGU A;  4NL2 A;  1VYU A;  3RIR A;  5FU7 C;  5GAM g;  1AHJ B;  5J26 A;  5LJ3 f;  5KYX A;  2DER A;  1GFD A;  3ASK A;  1W1F A;  5D6W A;  3OBW A;  5I21 A;  3I56 T;  4M77 C;  3EG9 B;  4PJL A;  3OY9 A;  4HVV A;  1SHF A;  1VQO T;  5GAN 3;  3O8V A;  1UG1 A;  1DJ7 B;  1GXI E;  3HTR A;  4C0Z A;  3SEM A;  1BU1 A;  2HBP A;  1D0Y A;  5GAO m;  4KUD K;  1OPL A;  3EAE A;  3CCJ T;  2G3R A;  2EQJ A;  2XD0 A;  5HK3 A;  1K4U S;  3O5Z A;  2A7Y A;  2K5F A;  4X34 A;  3G6E T;  1T0J A;  3G4S Q;  2PUO B;  3MJX A;  1LVK A;  1QVG P;  2DZC A;  3OB9 A;  2FZK B;  3V8L A;  3FRN A;  2DD4 A;  2V8K A;  3X28 B;  3REA B;  4M7A D;  4C92 C;  5GMK j;  1YJ9 A;  5CKE A;  5FU7 B;  5GAM d;  2EQU A;  2M16 A;  4XTW A;  4J5Y A;  2RH2 A;  3HFN A;  5GJW B;  4X9C A;  4C8Q E;  1K8A U;  4OMF B;  4M78 G;  2HZY A;  2K7A A;  2GQI A;  4JS5 A;  2NUT A;  2LQK A;  5KYN A;  4M77 B;  2M51 A;  4QQD A;  3NGP A;  2RI2 A;  1T0H A;  5EG2 A;  4B9W A;  5LJ5 h;  2JNG A;  1ACM B;  3UDC A;  4J6W A;  4ZGD B;  1D0X A;  4OB2 B;  1WHG A;  4C8Q F;  1QMC A;  2DIG A;  2AT1 B;  3I56 Q;  2KBT A;  2HDA A;  3JCM P;  1TG0 A;  1W6X A;  2B8A A;  3C12 A;  3FJP A;  3EG9 A;  2K3X A;  1ABQ A;  3R6O A;  4BI4 A;  1XJW B;  1VQ5 Q;  2XMF A;  2DL5 A;  5KYW B;  2KR3 A;  4DQ2 A;  2VGN A;  1YCS B;  2I2L A;  3TSZ A;  4F7U E;  3VU3 C;  1JJ2 A;  1TUG B;  4XAX B;  3SHW A;  5CR2 A;  1AWJ A;  4AFZ C;  2CP5 A;  2LQW A;  3JRZ A;  4C92 B;  2QEX A;  5GAN 2;  2COZ A;  3ZBD A;  1M8V A;  5FU6 C;  3CME A;  2ZCF B;  1QLY A;  4C0F A;  4F7U F;  3G6E Q;  1D1C A;  1IRX A;  4A54 A;  2HMA A;  4BE1 A;  2X4Y A;  1WQW A;  2R5A A;  3A8O B;  2L8D A;  4J8O A;  1OV3 A;  1ZSZ C;  2X3W D;  2VYT A;  1VQK Q;  1YIT A;  1ZUU A;  1TS9 A;  1BI1 A;  2F2W A;  2O88 A;  3GPL A;  5CKD A;  4OVA A;  3CCL A;  2V1Q A;  2RHX A;  2RI3 A;  1WX6 A;  1C1A A;  5GAM j;  2E6Z A;  2DTO A;  2VC8 A;  4C8Q C;  3NTI A;  4DA4 A;  2KYB A;  4QKU A;  4KGX B;  4M77 A;  3QG1 A;  3S6W A;  2L0A A;  3QO3 A;  1BK2 A;  4M4Z A;  1XTD A;  2NYS A;  1I0C A;  2O4X A;  1QKX A;  3CBM A;  3G71 A;  4CI0 C;  2LRQ A;  4M75 D;  3PIP A;  1N9R A;  3MEA A;  2RQT A;  1M30 A;  2NUP B;  1S72 Q;  1QKW A;  5LJ3 h;  5FU6 B;  2COY A;  4J6X A;  1VQM T;  3CC4 A;  1OQK A;  1PRM C;  2L89 A;  1WHH A;  3QDR B;  5FW9 A;  2FPE A;  1ZSZ B;  4HA8 A;  3EG0 A;  2OTL A;  3VS2 A;  4C92 A;  3QWY A;  4PJO F;  4JDS A;  4XQ3 A;  1U8R A;  5C0M A;  5GMK e;  2C0O A;  1MND A;  1BI3 A;  3OYG A;  1BIB A;  2K3Y A;  2HD0 A;  4N4G A;  1VUB A;  3VS0 A;  4C5H A;  1QP2 A;  1GBQ A;  4TVR A;  4C8Q B;  1VQ6 Q;  4PK4 A;  2HSE B;  2DTH A;  2AIR B;  2L2P A;  1OZ2 A;  3CCE A;  3FB9 A;  3U23 A;  2MOX A;  5HY6 A;  2MWO A;  2RA2 A;  1GL5 A;  5IH2 A;  2QYZ A;  3UT1 A;  1X2Q A;  5KE3 A;  1QCO A;  4M7D D;  2P0K A;  4PJN A;  3GBQ A;  4DOW A;  1PD0 A;  2CRE A;  3OQ5 A;  1MMD A;  2K2M A;  1HD3 A;  1K8A C;  2EYZ A;  2QI2 A;  3CD6 T;  4J9E A;  1WXB A;  4XTU A;  3SD4 A;  3JB9 G;  5CVI A;  1IHW A;  2OX7 A;  4EDU A;  1VQP T;  1N8R R;  1R0B G;  2D9T A;  2RHY A;  2KY9 A;  4JZ4 A;  3CMA T;  2CGH A;  1UGV A;  3I5S A;  2QGF B;  4WF2 A;  4KRT A;  4F7U B;  3CPW S;  2XI9 A;  4X1V A;  4FCY A;  1M27 C;  2GCX A;  3OS5 A;  2RMO A;  2QQ9 A;  1VQM Q;  1BBZ A;  2YUO A;  3BDL A;  3URG A;  2LCL A;  4M77 G;  2RK1 A;  3A8M B;  5J39 A;  4E7S A;  4JZ3 A;  3M53 A;  5KH6 A;  2JW4 A;  2D8H A;  4PFO A;  2LZ6 B;  1WHM A;  3V7R A;  4EIK A;  1G3T A;  2O9S A;  2WSE E;  1M1F A;  4A4F A;  4Q5W A;  1ZSZ A;  3MHX A;  1OEB A;  1RAC B;  2AKL A;  1WHJ A;  2R58 A;  3MPU B;  4EMK C;  1U06 A;  5GMK m;  2YUP A;  2YLB A;  1AT1 B;  3ULR B;  4KUI A;  4RTT A;  4R56 A;  5GAM e;  4C8Q A;  1KG1 A;  1K0S A;  1WHK A;  1NBE B;  1JU5 C;  1HXD A;  1M3C A;  1R77 A;  2XID A;  3OW2 S;  1UGR B;  3J80 E;  1UEC A;  2KVQ G;  1G5V A;  4C92 G;  3SFM A;  2PTK A;  1E7O A;  2M0O A;  4PLI A;  5IHI A;  2LJ1 A;  4E6R A;  2JT4 A;  2ECZ A;  3CCU T;  2ROT A;  4O6J A;  2Y4X A;  3PNW C;  3CD6 Q;  2EPD A;  1PCX A;  3X25 B;  3CCS A;  2EGE A;  1VQP Q;  1SEM A;  5CAI A;  3CMA Q;  2KYM A;  2QG9 B;  3JCM J;  4PJO B;  1VIE A;  3EGU A;  2CP2 A;  3CCQ T;  3OYB A;  2EJF A;  1KK7 A;  3QBY A;  4F7U A;  2ABL A;  3OYJ A;  3M56 A;  4OF1 A;  1OUL A;  3ZL7 C;  2AZV A;  1YJW T;  1N8R U;  3RKX A;  1OU9 A;  3L2V A;  1WQ7 A;  4EMK B;  2CKK A;  3OS1 A;  1NLP C;  2EQM A;  5KCO A;  2E1H A;  2FB7 A;  1VQL A;  1WI7 A;  4LDX A;  1VA7 A;  5IAY A;  2FVU A;  2LJ3 A;  1Q86 R;  1MMA A;  4HT8 A;  1T3L A;  2HKQ B;  3OYE A;  4CC3 A;  2RQW A;  2VXF A;  1WDX A;  1NJI R;  1OX9 A;  4HVW A;  1PRL C;  2AKK A;  1V1C A;  2RB6 A;  3CPW P;  2EVR A;  2VUB A;  2FL7 A;  3RBB B;  3HRT A;  4WCI A;  3OMC A;  2ZPB B;  4J9C A;  1HYO A;  3V7S A;  3H9N A;  2COW A;  3EG2 A;  2D0N A;  1X75 C;  2GBQ A;  5D7U A;  2RK2 A;  1IO6 A;  3PMI A;  1D1B A;  1YJN A;  1JQQ A;  1M2V B;  3E19 A;  3JSC A;  3P8B B;  2CS7 A;  1M5Q 1;  1U5S A;  4RTX A;  1WHL A;  4AFS C;  2DL3 A;  1QWF A;  2L5Q A;  4C8Q G;  2E10 A;  4CC2 A;  2ROL A;  2HQH A;  4PJM A;  2JTE A;  3CCQ Q;  1WPY A;  1X69 A;  1VYT A;  2AK5 A;  2DBK A;  4FU6 A;  3CXC P;  2EJG A;  2VVK A;  1D3B A;  2EKO A;  1YJW Q;  1MHN A;  1K1Z A;  4GY5 A;  1UJY A;  2LT4 A;  3MKD A;  3QZ5 B;  4PFZ A;  3D7S B;  2MWP A;  3OW2 P;  1NG2 A;  1KQ2 A;  2ZZD A;  4LNP A;  2XK0 A;  4HCC A;  1PKS A;  3JCM h;  4XTY A;  3MEV A;  4BUG A;  4EMK A;  3CBO A;  3E9F A;  1KIK A;  4AG1 C;  3F70 A;  4QW2 A;  3C0C A;  3PTA A;  2XKO C;  2NWM A;  4DBH A;  1WXU A;  2E5Q A;  3L2W A;  3I9Q A;  3OBY A;  2J6O A;  3QWX X;  1UDL A;  2DTI A;  2EYW A;  4F7U G;  4F04 B;  3G4S A;  1WJS A;  2XDP A;  3TCJ A;  2ZPE B;  4AFU C;  5GAN 4;  3P8D A;  1ZA2 B;  2J6K A;  2CH4 A;  4C0G A;  1QVF P;  5IT9 E;  5LJ5 g;  1WFW A;  3L1A A;  1Q7Y R;  1Q86 U;  2DEU A;  3CCV Q;  1Q95 G;  1KQ1 A;  4AFQ C;  1EX4 A;  1NJI U;  2F2X A;  3DLM A;  3EHR A;  1YP5 A;  2KE9 A;  3S3M A;  3HP9 A;  3JCM c;  4KGV B;  3GF5 A;  4QVD A;  1FXX A;  4BDY A;  2LNH B;  2KGT A;  4A53 A;  5GMK i;  2X3X D;  2QTX A;  1RAB B;  2QDL A;  1EZZ B;  3DKM A;  5CQX A;  4MMK A;  5FRO A;  1U1S A;  2JN0 A;  1TUC A;  4HT9 A;  2D0Q B;  2KDS A;  4DBQ A;  3NPF A;  4HKE A;  3EFR A;  1BI2 A;  5GAN 7;  2LT1 A;  2YUQ A;  2EFI A;  2JJ9 A;  4OMQ A;  1VIF A;  1KC8 R;  1KHI A;  4CRI A;  2CP6 A;  3MEU A;  1RAI B;  2L3P A;  1SSH A;  4DBF A;  4EMG A;  4BDZ A;  1OZ3 A;  3M5A A;  4J9H A;  1YIJ T;  1VQ5 A;  3JB9 H;  4ORZ A;  2YRV A;  4J6Y A;  1GFC A;  1JJ2 S;  3GOX A;  1N8R C;  4FL6 A;  3RER A;  4GLM A;  1SHG A;  1TSF A;  3JCM b;  2RJF A;  1RL2 A;  2XG8 D;  5IHN A;  3FIF A;  2DE0 X;  5LJ5 d;  1TTH B;  1Y96 B;  3CCM Q;  4ZNX A;  3KFV A;  1Y0M A;  4PJO G;  2GTJ A;  1W4S A;  2JMA A;  2FPD A;  4NOY A;  3OYI A;  2L3Q A;  2M9U A;  3G6E A;  3LLR A;  1G83 A;  4YTL A;  4RTW A;  3R6N A;  4M7A E;  1BIA A;  2WSF E;  5HK0 A;  5EC7 A;  4FW2 A;  1VQK A;  3OYC A;  4C92 D;  2J6F A;  1QWE A;  3CCR T;  5AT1 B;  1NEG A;  1PSE A;  2IVW A;  5CQY A;  4L5G A;  4IKF A;  3T9N A;  4M7A F;  3SWN C;  2OTJ T;  5CO7 A;  2SEM A;  2HQE A;  2QQA A;  3LWH A;  2MIO A;  5L8R E;  3MO8 A;  2EYX A;  5GAN f;  1M90 R;  1Q7Y U;  1OI1 A;  4DBR A;  5LJ3 g;  2H3J A;  1M3B A;  3I55 T;  2DET A;  4D8K A;  3HRU A;  5GAO p;  2DM1 A;  3M0R A;  3J81 E;  2KMT A;  2DL7 A;  3M0S A;  3C95 A;  1UEB A;  4QQG A;  2CZ6 B;  2BIV A;  1QVG A;  1Q81 R;  1YI2 Q;  3A8H B;  2JOY A;  3DB4 A;  3LX7 A;  2Y4Y A;  3VYG A;  1S72 A;  5FWC A;  1UGP B;  2JS0 A;  2GQV A;  1YIJ Q;  1RLP C;  2W0Z A;  2QXF A;  1Y7X A;  1UB4 A;  3E9G A;  1KC8 U;  1IB8 A;  4D6W A;  8ATC B;  4JUV A;  3M0U A;  4IUR A;  3BY7 A;  4OMM A;  3HPW A;  1JBM A;  2X9H A;  4NL3 A;  3EH2 A;  2DL4 A;  2K3B A;  3I5R A;  2CUB A;  4E7J A;  1VQO Q;  4JLG A;  2EWN A;  1QW1 A;  3SWN B;  5LJ5 j;  2CDT A;  4PJJ A;  2CZ7 B;  2EGC A;  2ZPF B;  2QQS A;  1O9S A;  1H64 1;  4KBM B;  2H3E B;  4M7A C;  1VQ6 A;  2E3I A;  5LJ3 d;  3CCR Q;  1X2K A;  4J9D A;  3CCJ Q;  2DK3 A;  5GAO r;  2ESW A;  1YN8 A;  5FRN A;  2OTJ Q;  1Q86 C;  1UFF A;  2GGR A;  1KHC A;  1VQN A;  3UPU A;  5D6Y A;  1NJI C;  3N5B B;  1UE9 A;  3MP1 A;  1C0M A;  1OPK A;  1PG5 B;  5ECA A;  1YCY A;  1M2O A;  4LE9 A;  3I55 Q;  2K5L A;  4Y28 E;  4MZP A;  4XU0 A;  1RAG B;  4M75 E;  3A1P A;  3TQ7 P;  2EYQ A;  2JVV A;  5M9O A;  1AEY A;  1M90 U;  1K73 R;  2E6N A;  2A28 A;  3EFO B;  3QJ6 A;  4QQ6 A;  3J7A F;  4X9D A;  3TVT A;  1VQM A;  2DBM A;  4M75 F;  2KEA A;  2ZPH B;  1JXM A;  1W2B S;  2FZC B;  3RES A;  3QYH B;  1Q81 U;  2V8J A;  3M54 A;  3RKY A;  3CC7 T;  4XK8 E;  4M7A B;  2QEX T;  3VS4 A;  1LNX A;  2DXU A;  1BCM A;  3CME T;  3PVQ A;  1B34 B;  3EGX B;  3SWN A;  3VYH B;  4PJO E;  3QII A;  4ZGE B;  2Z0W A;  5KYW A;  2C06 A;  2DZ9 A;  3OSS C;  1LOJ A;  4PNO A;  1AD5 A;  1UJ0 A;  5DLQ E;  3LGL A;  1K9M R;  1QVP A;  3PMT A;  1AZE A;  1VQ4 T;  1P92 A;  1UGS B;  4DOV A;  1UGQ B;  4M7D F;  1Q7Y C;  1VQP A;  3JCM Q;  3G71 T;  3X20 B;  1G3W A;  2QA4 T;  3CMA A;  3QXE B;  1U1T A;  1YBY A;  3PT9 A;  4M75 C;  5GAN h;  3G1J A;  1VQ9 A;  1E6G A;  3CC2 A;  3TEE A;  3INZ A;  1QQJ A;  4KH1 B;  4J9G A;  1AWW A;  5IXB A;  3CC4 T;  1HJD A;  3H0F A;  5C6S A;  1X01 A;  5J3B A;  5DLO A;  2PZ1 A;  3WVD B;  1K73 U;  2KT1 A;  3KBG A;  3OYL A;  4BAC A;  2CH4 W;  2OTL T;  2XHC A;  3MET A;  5LJ5 e;  3CC7 Q;  2QEX Q;  1U3O A;  4RMO A;  2Y90 A;  1BI0 A;  4M7A A;  1KQS A;  3CME Q;  5AYF A;  1KC8 C;  4ANJ A;  3LWI A;  1CSK A;  3HRS A;  2JTM A;  1X43 A;  1NEB A;  5CKB A;  1FWZ A;  2EQI A;  4FT2 A;  1Y71 A;  2PU9 B;  3EGX A;  2NUP A;  2LVM A;  2X4X A;  2JM9 A;  3GP8 A;  1IGQ A;  1CKB A;  3REB B;  1NLO C;  2VGM A;  2DYB A;  4PJO C;  1W2B A;  2RJD A;  3CCE T;  1M8M A;  2ED0 A;  2K79 A;  3EG1 A;  3PGG A;  4LXC A;  5LL6 S;  3JB9 I;  1MMG A;  3FDR A;  2QGG A;  3A8G B;  3H41 A;  3MP8 A;  5KYU B;  3RKW A;  2DO3 A;  1VQ4 Q;  4MML A;  3ME9 A;  4FYV B;  3OMG A;  1RAH B;  4M75 B;  3Q1J A;  1H8K A;  3RNJ A;  2MI6 A;  5FLX E;  1N5Z A;  3VS5 A;  3WVE B;  1PSF A;  1NPP A;  2MK5 A;  2O01 E;  1SKU B;  2QQR A;  1AZG B;  3JCM g;  2XIC A;  2QA4 Q;  1YWP A;  3S3N A;  4M78 D;  2KQW A;  2QQB A;  1PHT A;  1LPL A;  3PFS A;  3CBP A;  2WAC A;  3E2U A;  2CUD A;  2GFU A;  4LUD A;  4FYY B;  3VS3 A;  3CC4 Q;  4RCC A;  1SRM A;  1M90 C;  1JO8 A;  1YJW A;  2LX7 A;  1G2B A;  4BB7 A;  3TSW A;  2VXE A;  1HSQ A;  2R57 A;  4FYW B;  2K5I A;  3M0T A;  4UC4 A;  4JRI A;  1Q81 C;  5GJV B;  3VKI A;  5L23 A;  2ENM A;  4Y91 A;  2CZ0 B;  4J7I A;  1J3T A;  1PWT A;  2EQK A;  2FPF A;  1YHQ T;  4OP0 A;  4E47 A;  4WTO B;  5CKF A;  3C94 A;  1PD1 A;  1KJW A;  3A8L B;  1M1K R;  2DD5 A;  3EHQ A;  3S3O A;  2CP0 A;  4MDX A;  3CCV A;  2CT4 A;  2RD1 A;  3JCM d;  3PIO A;  4E7L A;  2LX9 A;  1ZSG A;  2OI3 A;  4M7A G;  2O31 A;  4D8D A;  4B6M A;  2DIQ A;  1BCO A;  4F17 A;  3L42 A;  1T3S A;  4BI8 B;  3M0Q A;  2F2V A;  3CCS T;  1NM7 A;  1K76 A;  1BYM A;  2LP5 A;  2AHJ B;  1X27 A;  2IIM A;  5KYY B;  3JV3 A;  1VQ7 T;  2LDM A;  2E12 A;  4ZN3 A;  3VV0 A;  4PLL A;  3OYK A;  1I81 A;  1HK9 A;  1LCK A;  4LDY A;  4FSS A;  1N9S A;  2LCC A;  2ZPG B;  1KFZ A;  4IUQ A;  1RI9 A;  9ATC B;  1NE8 A;  3CEY A;  3V7C A;  5GAO l;  3M4Y A;  1D0Z A;  1IHV A;  2EKH A;  3VJP A;  2EAY A;  3CCU Q;  2KAF A;  3V8K A;  4J83 A;  3M55 A;  1ZUY A;  1G3Y A;  1H92 A;  1RAD B;  1VQL T;  3EG3 A;  4FSX A;  3UA6 A;  2C0I A;  3FLG A;  3L2Z A;  3V8J A;  1XNI A;  2BZY A;  1ZBX A;  1K73 C;  3CCM A;  4PJO A;  3OS0 A;  1S1N A;  4E7K A;  2RN8 A;  4EPC A;  3MEW A;  1YHQ Q;  4B9X A;  2LQ8 A;  1KD1 R;  3NFC A;  3X24 B;  3P8H A;  1RAA B;  3CXC A;  1F1B B;  4BD3 A;  2LCS A;  3IQL A;  4JJB A;  1MNE A;  4CC4 B;  1ABO A;  3ER0 A;  2JXB A;  1RUW A;  1YJN T;  1M1K U;  5CCA A;  1ZHI A;  3JAM E;  5KYX B;  1MV3 A;  2B86 A;  2FHD A;  1WXT A;  1VQ7 Q;  2V8I A;  1WA7 A;  4RG8 A;  1BKB A;  3NHN A;  1QVG S;  4OMN A;  1NZ9 A;  1K9M C;  1I07 A;  2YWW A;  4ELY C;  1MGQ A;  1YI2 A;  3WXM B;  3JB9 D;  1XQH A;  1I1J A;  1N27 A;  3M0P A;  1QVF A;  4II1 A;  4IUU A;  2MF2 A;  2DRK A;  2JMC A;  4M75 G;  2DF6 A;  1YIJ A;  2LQN A;  1M2V A;  4XU2 A;  1RAF B;  4A63 B;  5GAM f;  2CP7 A;  1RLQ C;  1E6H A;  2PVD B;  2HEQ A;  2E65 A;  3LYI A;  2DX1 A;  4QT7 A;  1VQ8 T;  4HXJ A;  3I56 A;  2P4R A;  2D6F A;  4M77 D;  2BTT A;  3QJY A;  1QCF A;  2DMO A;  4N4I A;  2LC4 A;  1VQO A;  2LNV A;  1SRL A;  5I11 A;  1WGS A;  4AT1 B;  1K9A A;  4JS4 A;  4BE2 A;  3LH0 A;  4L59 A;  4JRP A;  2DRM A;  3ZFJ A;  1UHF A;  3CCR A;  2E4H A;  1NYG A;  3CCJ A;  4ATO A;  3LW5 E;  2OTJ A;  2NUT B;  1KD1 U;  2E64 A;  4ME7 A;  2HSP A;  3HL8 A;  3EH1 A;  1FMV A;  3I55 A;  3OA6 A;  4GBQ A;  4E7H A;  4OMO A;  4M7D G;  3QUI A;  1SSF A;  3RMS A;  2V1R A;  1RI0 A;  2KI7 A;  2QDY B;  2C0T A;  3M57 A;  2E41 A;  4OMP A;  1OX8 A;  3M59 A;  3QYG B;  2VV5 A;  4PFP A;  1WYX A;  1SF9 A;  2HKN A;  5FRM A;  3VUB A;  1X6B A;  3G7Z A;  4AG2 C;  4F16 A;  2RJC A;  7AT1 B;  3L2R A;  1MMN A;  1H3Z A;  1VQ5 T;  4ELZ C;  5DY9 A;  2RPN A;  1WIE A;  2CSI A;  2YRC A;  2WSC E;  2KNB B;  2VAS A;  1KSW A;  1AWO A;  2DVJ A;  2FO0 A;  3PE0 A;  1D1A A;  2HNI A;  5GMK h;  1TOV A;  1VQ8 Q;  8AT1 B;  4BE0 A;  1MUZ A;  2M02 A;  2R5M A;  2XU8 A;  4IUV A;  4VUB A;  4FM4 B;  2KRM A;  1CKA A;  1VOM A;  4Z88 A;  2H8H A;  2BUD A;  1VQK T;  2GFA A;  2XDB A;  4C5E A;  1I5O B;  4MZM A;  3I35 A;  1AVZ C;  4JPB W;  3JCM e;  2LTO A;  1Z9Q A;  2GTO A;  3AT1 B;  3DB3 A;  3SB2 A;  2DJQ A;  3JCM X;  1X6O A;  2SRC A;  2RQU A;  1Y96 A;  5GAN g;  3H6Z A;  2HL3 A;  2I0N A;  4BY6 C;  4OB3 B;  3GLX A;  5HCK A;  2E70 A;  1M1K C;  2O4X B;  2G6F X;  2K6D A;  2K4Y A;  1YJ9 T;  4LDV A;  1W70 A;  5I2M A;  3LGF A;  5GAN 8;  1TU0 B;  2KXD A;  1JJ2 P;  4FT4 A;  2EJ9 A;  1S72 T;  1PNJ A;  1Z9Z A;  2PVO B;  4JLI A;  2ZAE A;  3M4G A;  3OYH A;  2QK0 A;  4OGC A;  2HCK A;  4OB1 B;  4RUG A;  1IXD A;  4C8Q D;  2K2V A;  1I8F A;  1AOJ A;  2JTF A;  5GAN 5;  2D8J A;  1KQS S;  3UA7 A;  3CC7 A;  5A0D A;  1JEG A;  6AT1 B;  1PKT A;  5GMK l;  2FYK A;  2JS2 A;  4IUP A;  1PM3 A;  1ZQ1 A;  3KXT A;  1WJR A;  3C4S A;  3UWN A;  5GAM h;  5GAN d;  2OAW A;  5IN1 A;  3VS6 A;  4XTV A;  1QP3 A;  4BY6 B;  2DIL A;  2RJE A;  1VQ6 T;  1X6G A;  2MPX C;  2HQX A;  2EBP A;  1ARK A;  1YFN A;  3X26 B;  3TRE A;  3VRY A;  2CZ1 B;  1GCQ C;  2DL8 A;  2LJ0 A;  4MZT A;  5D6X A;  4C5I A;  2DNU A;  3M9Q A;  2X4W A;  3OYN A;  2AZS A;  5A0G A;  2RO0 A;  1EIF A;  1VQN T;  1C6V X;  2O9V A;  5CK9 A;  1VQ4 A;  3LH5 A;  4PL6 A;  2OJ2 A;  3MCA B;  2A3L A;  5A0L A;  1WZO A;  4JRQ A;  5A2Q E;  2CT3 A;  1KD1 C;  1M3A A;  1YIT T;  1YJ9 Q;  4XTZ A;  2P0Q A;  1IRE B;  3OYF A;  4GLK A;  1JRI A;  2FRY A;  2QA4 A;  3CCL T;  2RHZ A;  2MYS A;  1V76 A;  4FIB A;  3BDU A;  1I4K 1;  4NS5 A;  4M7D E;  1Y57 A;  2L3R A;  5LJ3 j;  4BI3 A;  2X35 A;  2IG0 A;  1R8O B;  4EMH A;  1ZLM A;  2EW3 A;  1GBR A;  3CD6 A;  2A08 A;  2A0F B;  3OSV A;  2RI5 A;  2KSS A;  2F5K A;  1I5L A;  4LD9 K;  2CSQ A;  1GRI A; 
#chains in the Genus database with same CATH homology
 1NJI U;  3A8L B;  3DLM A;  2OAU A;  5EG2 A;  4B9W A;  5LJ5 h;  2DD5 A;  2JNG A;  3S3M A;  3HP9 A;  4J6W A;  3JCM c;  3UDC A;  4ZGD B;  3S3O A;  3GF5 A;  4OB2 B;  4HCZ A;  4QVD A;  1TH7 A;  1FXX A;  4C8Q F;  4LD6 A;  2DXC A;  4BDY A;  2DIG A;  4MDX A;  5GMK i;  4A53 A;  3CCV A;  2QTX A;  2RD1 A;  3JCM d;  3PIO A;  2LX9 A;  3DKM A;  5CQX A;  3L2Q A;  4E7L A;  4MMK A;  4M7A G;  3OS2 A;  5FRO A;  1U1S A;  3H8Z A;  3JCM P;  2JN0 A;  2B8A A;  3C12 A;  3FJP A;  4HT9 A;  2K3X A;  4PJO D;  2D0Q B;  4KT0 E;  2KDS A;  2DIQ A;  4C0D C;  1FX7 A;  4HKE A;  3TU4 K;  3R6O A;  5GAN j;  4BI4 A;  2BKD N;  3EFR A;  1BI2 A;  3L42 A;  4BI8 B;  5GAN 7;  1Y07 A;  2LT1 A;  3CCS T;  3NTK A;  2EFI A;  4DQ2 A;  1VIF A;  2VGN A;  4F7U E;  1KHI A;  2I2L A;  4CRI A;  1BYM A;  3MEU A;  3VU3 C;  2AHJ B;  1JJ2 A;  1VQ7 T;  2LDM A;  4XAX B;  2E12 A;  4OB0 B;  5CR2 A;  4EMG A;  4BDZ A;  4ZN3 A;  3VV0 A;  2EIF A;  4PLL A;  1OZ3 A;  3OYK A;  1B34 A;  1I81 A;  4N4H A;  1HK9 A;  3JRZ A;  3M5A A;  4LDY A;  4C92 B;  5GAN 2;  2QEX A;  1N9S A;  2LCC A;  2ZPG B;  1YIJ T;  1VQ5 A;  2YRV A;  4J6Y A;  3ZBD A;  1JJ2 S;  4M78 E;  3JB9 H;  1M8V A;  3GOX A;  4IUQ A;  5FU6 C;  3CME A;  1N8R C;  1NE8 A;  4FL6 A;  3RER A;  3CEY A;  2ZCF B;  4C0F A;  4F7U F;  4L6V 5;  3V7C A;  5GAO l;  3M4Y A;  2ZGW A;  3JCM f;  3JCM b;  2RJF A;  4A54 A;  1RL2 A;  2XG8 D;  4BE1 A;  3OYM A;  2X4Y A;  3FIF A;  2EAY A;  4O5V A;  3VJP A;  1WQW A;  5LJ5 d;  1VQ9 T;  3CC2 T;  1Y96 B;  2KAF A;  2R5A A;  2L8D A;  3A8O B;  4J8O A;  3V8K A;  4J83 A;  4PKC C;  4PJO G;  2VYT A;  1W4S A;  2X4J A;  1YIT A;  3M55 A;  4M78 F;  1BI1 A;  4NOY A;  1G3Y A;  3OYI A;  1VQL T;  4M7D C;  2M9U A;  3G6E A;  4FSX A;  3GPL A;  1M9S A;  3LLR A;  3FLG A;  3L2Z A;  4YTL A;  3V8J A;  5CKD A;  1BIA A;  4M7A E;  4OVA A;  1JB0 E;  1XNI A;  2DAQ A;  2WSF E;  3QZ9 B;  2RHX A;  3CCL A;  1ZBX A;  5HK0 A;  3CCU A;  1K73 C;  4MDW A;  1OYX A;  3CCM A;  4PJO A;  2RI3 A;  3OS0 A;  5DM7 R;  5GAM j;  2E6Z A;  3HHT B;  3OYC A;  4C92 D;  1VQK A;  2DTO A;  2VC8 A;  3CCR T;  1K9M U;  4E7K A;  2P0P A;  3SDZ A;  1PSE A;  2IVW A;  2GF7 A;  4C8Q C;  3NTI A;  4EPC A;  4DA4 A;  5CQY A;  3MEW A;  4L5G A;  4IKF A;  4M77 A;  3S6W A;  3QG1 A;  4B9X A;  2LQ8 A;  1G3S A;  3T9N A;  4M7A F;  3SWN C;  4C0D B;  2OTJ T;  5CO7 A;  3NFC A;  3CCQ A;  3QO3 A;  3RMQ A;  2HQE A;  3X24 B;  2DKG A;  2QQA A;  3P8H A;  3LWH A;  3CPF A;  3ZEH A;  5L8R E;  1XTD A;  3X26 B;  3CXC A;  2O4X A;  4BD3 A;  3CBM A;  3MO8 A;  5GAN f;  3G71 A;  1Q7Y U;  1YHQ A;  1OI1 A;  5LJ3 g;  3DLL A;  2H3J A;  3I55 T;  4CI0 C;  4J7F A;  2LRQ A;  2JUF A;  4M75 D;  3ER0 A;  3CXC S;  3PIP A;  1N9R A;  3M58 A;  3MEA A;  3QKJ A;  3OYA A;  2PUK B;  3HRU A;  1YJN T;  5GAO p;  3OYY A;  3J81 E;  2KMT A;  4E7I A;  1M1K U;  5LJ3 h;  5FU6 B;  3C95 A;  1UEB A;  4J6X A;  4QQG A;  5CCA A;  5HKC A;  1VQM T;  1ZHI A;  4RCB A;  4RG2 A;  3CC4 A;  1WJQ A;  3JAM E;  3BW1 A;  2CZ6 B;  4V2S A;  5CIU A;  2BIV A;  2L89 A;  1QVG A;  2YHT A;  3QDR B;  3A8H B;  2JOY A;  3DB4 A;  2FHD A;  3LX7 A;  4A4E A;  2DXT A;  2V8I A;  2JZ2 A;  2Y4Y A;  3VYG A;  1S72 A;  4HA8 A;  4RG8 A;  1UGP B;  1BKB A;  1Q82 U;  1QVG S;  2OTL A;  4N0A C;  1NZ9 A;  2GQV A;  2NLU A;  1K9M C;  4QVZ A;  2QXF A;  4XU3 A;  4C92 A;  4M7D B;  4PJO F;  4ELY C;  1MGQ A;  4JDS A;  1Y7X A;  1UB4 A;  4XQ3 A;  5C0M A;  1YI2 A;  3WXM B;  4A4G A;  5GMK e;  5LJ3 e;  1U8R A;  1BI3 A;  4M78 C;  1XQH A;  3E9G A;  3OYG A;  3JB9 D;  1VQ7 A;  1N27 A;  1KC8 U;  4D6W A;  4II1 A;  2HAX A;  1QVF A;  3NTH A;  4IUU A;  4RKU E;  4LDU A;  1M4Z A;  1BIB A;  4JUV A;  2XDD A;  2MF2 A;  4IUR A;  2K3Y A;  3BY7 A;  2RM4 A;  2HD0 A;  4M75 G;  1YIJ A;  1D3B B;  4N4G A;  1VUB A;  1JBM A;  3HPW A;  4C5H A;  1QP2 A;  4NL3 A;  4TVR A;  4C8Q B;  1QVF S;  4XU2 A;  5GAM f;  2DTH A;  4E7J A;  4JLG A;  2EWN A;  2DJZ A;  1QW1 A;  3SWN B;  5LJ5 j;  2PVD B;  2CZ7 B;  1OZ2 A;  3CCE A;  2E65 A;  3FB9 A;  2ZPF B;  3LYI A;  4M75 A;  5I2S A;  5HY6 A;  2MWO A;  2RA2 A;  2QQS A;  1O9S A;  1H64 1;  4KBM B;  1VQ8 T;  4M7A C;  3I56 A;  3QPH A;  3UT1 A;  2D6F A;  3JB9 J;  4M77 D;  1VQ6 A;  5KE3 A;  5LJ3 d;  3QJY A;  4N4I A;  4M7D D;  2P0K A;  2LC4 A;  1VQO A;  2LNV A;  2DK3 A;  4DOW A;  5GAO r;  3OQ5 A;  3JCM V;  4ZGJ B;  5FRN A;  4HCB A;  1WGS A;  1IZ6 A;  1K8A C;  2QI2 A;  4JS4 A;  4ZN1 A;  3CD6 T;  3FC3 A;  4BE2 A;  3LH0 A;  2ZPI B;  4L59 A;  4XTU A;  3SD4 A;  3JB9 G;  1Q86 C;  5CVI A;  4JRP A;  4KUL A;  4EDU A;  1KHC A;  1VQP T;  3ZFJ A;  3CPW A;  2D9T A;  2RHY A;  3UPU A;  1VQN A;  5D6Y A;  2KY9 A;  5GAO n;  5GAN e;  3CCR A;  3CMA T;  2CGH A;  3N5B B;  5CKH A;  1NJI C;  3MP1 A;  3CCJ A;  1YCY A;  4WF2 A;  4OGE A;  2K5L A;  4ATO A;  1LJO A;  3LW5 E;  4Y28 E;  4F7U B;  3CPW S;  2XI9 A;  2OTJ A;  4MZP A;  2KK4 A;  1KD1 U;  2GCX A;  4XU0 A;  2E64 A;  3OS5 A;  4ME7 A;  3CCV T;  4M75 E;  2QQ9 A;  3HL8 A;  2EYQ A;  2MAM A;  4JJN K;  2JVV A;  4M78 B;  3BDL A;  3URG A;  2LCL A;  5M9O A;  3OYD A;  3JCM W;  3I55 A;  3OA6 A;  1M90 U;  4M77 G;  2DXB A;  2E6N A;  2RK1 A;  3A8M B;  5J39 A;  4E7H A;  3M53 A;  3A5Z B;  5KH6 A;  4M7D G;  3QUI A;  4ZTJ A;  3EFS A;  3QJ6 A;  1SSF A;  3RMS A;  4QQ6 A;  3V7R A;  1RI0 A;  2QDY B;  3FEO A;  1G3T A;  2WSE E;  3J7A F;  1M1F A;  3M57 A;  2E41 A;  4A4F A;  4Q5W A;  4X9D A;  3M59 A;  3QYG B;  1VQM A;  2VV5 A;  3MHX A;  4M75 F;  1W2B S;  2ZPH B;  2PQW A;  5FRM A;  3VUB A;  4M7D A;  3G7Z A;  3RES A;  2R58 A;  2RJC A;  3QYH B;  1Q81 U;  2V8J A;  3M54 A;  3RKY A;  3L2R A;  1H3Z A;  3CC7 T;  4XK8 E;  3GNG A;  4EMK C;  4M7A B;  2QEX T;  1VQ5 T;  5GMK m;  5LJ5 f;  1LNX A;  2DXU A;  4JRK A;  4ELZ C;  5GAN 6;  5DY9 A;  3CME T;  2YLB A;  4KUI A;  4R56 A;  5GAM e;  5GAO q;  2WSC E;  3GNF B;  4A4H A;  3OW2 A;  1B34 B;  3VUZ A;  4C8Q A;  1KG1 A;  5KE2 A;  2HNI A;  1WNL A;  3SWN A;  3VYH B;  5GMK h;  1HXD A;  2XID A;  4PJO E;  3OW2 S;  1UGR B;  3J80 E;  3QII A;  4ZGE B;  3JB9 F;  2KVQ G;  1G5V A;  5KCH A;  4C92 G;  4BE0 A;  3SFM A;  2M0O A;  2R5M A;  2XU8 A;  4IUV A;  4PLI A;  4VUB A;  4FM4 B;  2C06 A;  2DZ9 A;  1V29 B;  3OSS C;  1LOJ A;  4R55 A;  3CCU T;  4PNO A;  4M77 E;  3CCM T;  5DLQ E;  3LGL A;  2BUD A;  2Y4X A;  1QVP A;  3PNW C;  4O6J A;  1VQK T;  2GFA A;  1VQ8 A;  3X25 B;  4C5E A;  3PMT A;  2XDB A;  3CCS A;  1VQ4 T;  4MZM A;  2DPP B;  1N6A A;  5CAI A;  4P5N A;  1P92 A;  4XTX A;  3JCM e;  3QSU A;  1UGS B;  2LTO A;  3MP6 A;  4QVC A;  4XU1 A;  3JCM J;  4PJO B;  3DB3 A;  1VIE A;  4DOV A;  3SB2 A;  3CCQ T;  3JCM X;  3OYB A;  1X6O A;  2EJF A;  3BFM A;  1UGQ B;  4M77 F;  1NPR A;  3HKS A;  3QBY A;  4F7U A;  4M7D F;  1Y96 A;  5GAN g;  1XOV A;  3H6Z A;  3OYJ A;  2DVE A;  1Q7Y C;  3M56 A;  1VQP A;  4OF1 A;  3JCM Q;  3G71 T;  2PVG B;  3X20 B;  1G3W A;  4BY6 C;  2QA4 T;  4N0A A;  4OB3 B;  4C5G A;  3CMA A;  3QXE B;  1YJW T;  3AHU A;  3E1S A;  1N8R U;  3RKX A;  1U1T A;  1YBY A;  3GLX A;  3L2V A;  4LDW A;  3PT9 A;  4M75 C;  5GAN h;  1WQ7 A;  2E70 A;  2F5T X;  4M78 A;  4EMK B;  2P4T A;  1VQ9 A;  1M1K C;  2O4X B;  3CC2 A;  1YJ9 T;  2K4Y A;  3INZ A;  3TEE A;  4ZTF A;  4LDV A;  2CKK A;  2F69 A;  4A4K A;  3L2U A;  3OS1 A;  5I2M A;  3HSB A;  3CC4 T;  3LGF A;  4Z02 A;  3G4S T;  2EQM A;  5KCO A;  2E1H A;  5C6S A;  2FB7 A;  1VQL A;  5GAN 8;  1X01 A;  5J3B A;  4LDX A;  4C92 E;  5IAY A;  1O75 A;  2YLC A;  5DLO A;  2FVU A;  3GIB A;  4FT4 A;  2EJ9 A;  4IUT A;  4HT8 A;  3WVD B;  2MMP A;  1S72 T;  1Q82 C;  3OYE A;  1K73 U;  3KBG A;  2VXF A;  3OYL A;  4BAC A;  2OTL T;  2PVO B;  4JLI A;  2XHC A;  3MET A;  3QHS A;  3M4G A;  2RHI A;  5LJ5 e;  3OYH A;  4OGC A;  4RMO A;  2Y90 A;  2CYZ B;  4OB1 B;  1BI0 A;  4C8Q D;  4M7A A;  1KQS A;  2K2V A;  2RB6 A;  5AYF A;  1I8F A;  3RUX A;  1YI2 T;  2K57 A;  2M1H A;  2RHU A;  1KC8 C;  2VUB A;  3HFO A;  2FL7 A;  4C92 F;  3LWI A;  3HRS A;  2JTF A;  2JTM A;  5GAN 5;  3HRT A;  3OMC A;  2ZPB B;  5CKB A;  3KUF A;  1FWZ A;  3V7S A;  1KQS S;  2DEQ A;  3CC7 A;  4FT2 A;  5A0D A;  1M1G A;  1Y71 A;  2PU9 B;  2LVM A;  2X4X A;  4NL2 A;  5GMK l;  3RIR A;  5FU7 C;  5GAM g;  3GP8 A;  1AHJ B;  2FYK A;  5J26 A;  1X75 C;  5LJ3 f;  4IUP A;  2RK2 A;  2VGM A;  4PJO C;  1ZQ1 A;  1W2B A;  3PMI A;  2RJD A;  3KXT A;  3CCE T;  3PGG A;  3ASK A;  5LL6 S;  3JB9 I;  1YJN A;  1WJR A;  3FDR A;  5D6W A;  3C4S A;  3UWN A;  5GAM h;  5GAN d;  3OBW A;  5IN1 A;  5I21 A;  4XTV A;  3A8G B;  1QP3 A;  3I56 T;  3E19 A;  3JSC A;  4BY6 B;  3MP8 A;  2RJE A;  1VQ6 T;  4M77 C;  3RKW A;  3P8B B;  2DO3 A;  2CS7 A;  2HQX A;  3OY9 A;  1M5Q 1;  1VQO T;  5GAN 3;  4MML A;  3ME9 A;  3O8V A;  3OMG A;  2CZ1 B;  1DJ7 B;  4M75 B;  2L5Q A;  3TRE A;  3Q1J A;  4MZT A;  2E10 A;  5D6X A;  4C8Q G;  1GXI E;  2MI6 A;  4C0Z A;  4C5I A;  3M9Q A;  2X4W A;  5FLX E;  3WVE B;  3OYN A;  2HBP A;  1WPY A;  1PSF A;  5A0G A;  1NPP A;  2O01 E;  2RO0 A;  1EIF A;  2QQR A;  1VQN T;  4FU6 A;  5GAO m;  4KUD K;  2EJG A;  5CK9 A;  1D3B A;  3JCM g;  3EAE A;  3CCJ T;  1VQ4 A;  2XIC A;  4PL6 A;  2EKO A;  3S3N A;  4M78 D;  2KQW A;  1MHN A;  3MCA B;  4GY5 A;  2QQB A;  2A3L A;  2G3R A;  5A0L A;  2LT4 A;  3PFS A;  4JRQ A;  5A2Q E;  3QZ5 B;  3CBP A;  2EQJ A;  2MWP A;  2WAC A;  1KD1 C;  5HK3 A;  2XD0 A;  1KQ2 A;  2ZZD A;  2XK0 A;  4HCC A;  3JCM h;  4XTY A;  1YIT T;  3MEV A;  2GFU A;  4XTZ A;  2A7Y A;  4BUG A;  2P0Q A;  1IRE B;  2K5F A;  3CBO A;  4X34 A;  4EMK A;  3E9F A;  3G6E T;  3OYF A;  4GLK A;  3F70 A;  1JRI A;  4RCC A;  1M90 C;  2QA4 A;  4QW2 A;  1YJW A;  2PUO B;  2RHZ A;  3CCL T;  2DZC A;  2XKO C;  3OB9 A;  3PTA A;  3V8L A;  3FRN A;  2E5Q A;  2DD4 A;  2V8K A;  4FIB A;  3X28 B;  3BDU A;  1I4K 1;  4NS5 A;  3L2W A;  4M7D E;  4BB7 A;  4M7A D;  2L3R A;  5LJ3 j;  4C92 C;  5GMK j;  3OBY A;  1YJ9 A;  2DTI A;  4BI3 A;  2VXE A;  4F7U G;  2X35 A;  5CKE A;  5FU7 B;  5GAM d;  2R57 A;  2IG0 A;  2K5I A;  3G4S A;  1R8O B;  1WJS A;  4EMH A;  2XDP A;  2EQU A;  2M16 A;  4UC4 A;  3TCJ A;  2ZPE B;  5GAN 4;  4JRI A;  3P8D A;  4XTW A;  1Q81 C;  4J5Y A;  2RH2 A;  4C0G A;  3HFN A;  3VKI A;  4X9C A;  3CD6 A;  5IT9 E;  4C8Q E;  1K8A U;  4OMF B;  4M78 G;  5LJ5 g;  3OSV A;  2RI5 A;  3L1A A;  4Y91 A;  4JS5 A;  1Q86 U;  2KSS A;  2CZ0 B;  2LQK A;  4J7I A;  2F5K A;  1I5L A;  4LD9 K;  4M77 B;  2EQK A;  1YHQ T;  4OP0 A;  4E47 A;  4QQD A;  1KQ1 A;  2RI2 A;  5CKF A;  3C94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...