1MHNA

High resolution crystal structure of the smn tudor domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
LQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High Resolution X-ray and NMR Structures of the SMN Tudor Domain: conformational variation in the binding site for symmetrically dimethylated arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Survival motor neuron protein
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1mhnA00
2RHYA 3NTHA 3OYGA 2RI3A 2K3YA 2R57A 2B8AA 1WJRA 3L2WA 3L2QA 3PNWC 3QKJA 4IKFA 3S6WA 4ZTJA 2P0KA 4A4HA 3FC3A 3OB9A 1G5VA 2M16A 4LD6A 4E7JA 2DAQA 2R58A 4BE1A 2R5MA 3DB4A 3LYIA 3LX7A 4Q5WA 2L8DA 4C5IA 1OI1A 2G3RA 1WJQA 4RG2A 3OS0A 1RI0A 5M9OA 2HQEA 2RHZA 3MP6A 3OYDA 2L3RA 2RI2A 4BDZA 4IUUA 3OYCA 1KHCA 2EKOA 3OMCA 4NS5A 4A4GA 4II1A 4B9XA 2PQWA 2VYTA 3P8DA 5IN1A 2M0OA 3OYNA 3OYLA 2M1HA 2O4XB 3OYEA 4C5GA 5KH6A 1N27A 5C0MA 3S3MA 2RI5A 3MEUA 2X4XA 1OYXA 2BKDN 5D6YA 2FHDA 2LRQA 2XDPA 4QQDA 3OS1A 2RO0A 5KE3A 4CRIA 3OYHA 4HCZA 1MHNA 1OZ2A 3DB3A 3NTIA 4IURA 2F5KA 4QW2A 2LTOA 3PMIA 4Z02A 2X4WA 3QIIA 4C5EA 4ZTFA 3FLGA 4E7HA 3META 3S3NA 4X34A 3OYJA 4IUPA 2RJEA 2YRVA 4IUQA 3ZEHA 3OYAA 5IAYA 3M9QA 3NTKA 3QBYA 5J26A 2EQMA 2X4YA 3BDLA 2QQRA 4N4GA 3F70A 2EQJA 2BUDA 3FEOA 4OVAA 5J39A 4BE0A 2MWOA 3EAEA 3MP1A 4L59A 2DIQA 4IUTA 2MWPA 4E7LA 2RJCA 5CIUA 3SD4A 4B9WA 4EDUA 3UT1A 3L42A 2E5QA 2LVMA 1WGSA 2O4XA 2RHXA 1OZ3A 4QVZA 2CKKA 4N4IA 4PLLA 2RJDA 3MP8A 3O8VA 5D6WA 2GF7A 2LDMA 3LGFA 3OYKA 2XK0A 5KCOA 3Q1JA 3LH0A 3E9GA 3LLRA 3P8HA 4GY5A 5KCHA 3L2UA 3OYIA 2BIVA 4PL6A 4BD3A 2JZ2A 4FL6A 4PLIA 2EQUA 2RHUA 3OYBA 3OMGA 3OQ5A 4BDYA 2EFIA 2X35A 4E7KA 2JTFA 2EQKA 5FRNA 1XNIA 3UWNA 3LGLA 3CEYA 2D9TA 3FDRA 3MO8A 2HQXA 3L2VA 2GFAA 2IG0A 4UC4A 4FU6A 5FRMA 3C4SA 3H6ZA 3ASKA 2QQSA 3QJ6A 3S3OA 3ME9A 4E7IA 2LCCA 4IUVA 2RHIA 4N4HA 3OYMA 3E9FA 4BE2A 3GOXA 1WJSA 3DLMA 3OY9A 3PMTA 4A4EA 2WACA 3MEWA 3PFSA 2NLUA 2RJFA 3H8ZA 4QQ6A 3KUFA 2R5AA 4QQGA 5FROA 3OA6A 3MEAA 3L2RA 1H3ZA 3MEVA 2DIGA 3OYFA 4C5HA 2E6NA 2GFUA 5C6SA 5KE2A 2L89A 3OS2A 5D6XA 1SSFA 2K3XA 4BACA 4A4FA
chains in the Genus database with same CATH superfamily
2CUBA 4BI3A 4RTXA 5GAMf 2Y4XA 2LQNA 3JV3A 2EKHA 3OB9A 3EG3A 2QI2A 4RTZA 2EPDA 5EG2A 1VQ4Q 1QWEA 3H41A 2ZPBB 3FB9A 2L2PA 4RG2A 4M77F 1Y71A 2G6FX 2M1HA 4F14A 5IHKA 4ZGDB 1I5LA 2RI5A 3WVDB 2ED0A 5LJ3e 3C0CA 1SF9A 1BCOA 3M59A 3OS1A 5GMKl 1AEYA 1W4SA 3CCSQ 4FCYA 4IURA 4Z02A 4X9DA 3PMIA 2X4WA 4M78D 1Z9ZA 1WXBA 1XOVA 2Y4YA 4N0AC 1Q7YR 3NGPA 2MMPA 5J26A 4HVUA 2D1XA 2M0YA 3T9NA 5IH2A 4QKUA 5KYWB 2HBPA 4NOYA 3QO3A 1UFFA 2JUFA 1GCQA 2QTXA 4HA8A 5CIUA 1QQJA 3A5ZB 1JRIA 3ER0A 3HL8A 2DBMA 1WZOA 4XU0A 3VYHB 2RK2A 3OYIA 4M77B 3VS0A 3JCMe 1WFWA 1NEGA 2E3IA 2V1RA 2PUKB 1RUWA 3PIOA 2HQXA 3EG9B 3VUBA 4UC4A 1YJ9T 3HFNA 3GIBA 3QJ6A 1WQ7A 2MOXA 4ESRA 2XG8D 1ZSZB 5I21A 2ZCFB 2YT6A 1MV0B 4RG8A 3TSZA 3L2RA 3CBMA 1FXXA 4M75F 3VKIA 4NL3A 1MGQA 2L89A 2I2LA 3QG1A 1VQKA 1GXIE 4BACA 4DOWA 2YUQA 5GANg 3TQ7P 2P0KA 4J9HA 2VKNA 1V29B 4MMLA 3HRSA 1OU9A 3R6NA 2OTJQ 1CKAA 1H92A 3JCMV 2WSCE 4ANJA 1VQ9Q 1Y0MA 1X27A 2COWA 3OMCA 1VIFA 4NS5A 3EG9A 3KBGA 3L1AA 3J81E 1ZHIA 3OYEA 4JJBA 3H9NA 2X4XA 2DILA 1ZSZA 1M2VA 2COYA 2HBWA 4QQDA 3CQTA 3SB2A 5FW9A 2LTOA 5GANd 4M7AF 2K3BA 4M75B 2YRVA 3M9QA 1NM7A 3G6EQ 1YITQ 4JRIA 9ATCB 3HSBA 4C0FA 1AWWA 5CQXA 1MMDA 1VQLA 1D1CA 2P4TA 4B9WA 1WGSA 2XI9A 2CP5A 1T3LA 2DO3A 4E7ZA 5GAMj 1PSFA 4A54A 3E9GA 1T3SA 4FSSA 2CSQA 3CCMT 4XTXA 3J80E 3CCRA 4YTLA 1BI0A 2KI7A 2RQRA 3MPUB 3EFOA 3HRUA 2OI3A 3MO8A 1D0YA 2KQWA 4FU6A 1K73R 3H6ZA 3VS5A 2LJ0A 4AFUC 3G4SA 1D09B 3J7AF 1U1SA 4F7UE 3V8LA 5GAMd 1JJ2P 4XTZA 4RTVA 5GANf 4LE9A 2HSPA 4A53A 2JXBA 2XIDA 3HHTB 3WVEB 4F7UG 4IKFA 2NUZA 2M16A 2L0AA 5IHNA 2VWFA 3EGDB 1GRIA 1NYFA 4M7AB 3X24B 4J8OA 4ELZC 4C8QF 2VYTA 1HSQA 4C92C 1X6BA 2O4XB 3CCQQ 2E1HA 1W70A 2EBPA 2RM4A 1M3BA 3GBQA 3CMEQ 1NG2A 2RPNA 3FJ5A 2E6ZA 4FYVB 2HAXA 4M7DA 4LUDA 3LWIA 3SWNA 2FZKB 2KT1A 1UGRB 1W2BP 3QBYA 3M56A 1JB0E 2ZPFB 2K6DA 5GAOq 3RERA 4PJMA 2J6OA 2J05A 4OB3B 3LW5E 1N9RA 4E7LA 3BW1A 1FMVA 3TVTA 3SD4A 3VUZA 3EGDA 1VYVA 4M7AA 3QPHA 2RJDA 2J6KA 4OB1B 2H3EB 1M8MA 2ZAEA 2C06A 1K76A 4R56A 2BZ8A 5GAMh 2I0NA 1KK7A 3I35A 5CVIA 1VQOQ 3VS3A 1X01A 4LNPA 3CMAT 2JMCA 3MKDA 3O5ZA 2ROTA 3FDRA 1KJWA 2O2OA 3PVQA 3VRZA 2EYWA 3C94A 2FG0A 5FRMA 1ZLMA 3GNGA 4M7DF 2JW4A 2VV5A 3CC7Q 2EGCA 2LCCA 2FZGB 3GOXA 3PMTA 3THKA 1H641 3EFRA 3PFSA 3UPUA 4JZ4A 1K8AC 3H8ZA 3EH2A 2R5AA 1Y07A 3MEVA 3I55T 1O9SA 3RBBB 4C92E 3OS2A 4PK4A 1EZZB 1YJWT 4M7DE 1B07A 5GAN7 2L5QA 1T0HA 1MMNA 1NEBA 3G71Q 2R57A 4JS5A 5CR2A 1VQLT 3L2QA 1X6OA 3RDVA 2D0QB 2MPXC 2VXEA 4OMMA 1IHVA 3EGXA 1FWZA 4M7AD 4J9BA 1TUCA 3G71A 2CP6A 2GCXA 4B9XA 3P8DA 3OYNA 3VS2A 2KRSA 1YHQQ 1O75A 2JS2A 4J9EA 1M1FA 1UEBA 2ECZA 2X4JA 1VQ5T 1U1TA 4JUVA 1YCYA 1ZA2B 2VGMA 1Z9QA 3G4SQ 2KSSA 1R8OB 3QYGB 1AWJA 3NTKA 4RKUE 1C0MA 1ZUKA 4LDYA 3PTAA 2QASA 2KXDA 5J39A 3CCRQ 3RIRA 2DIQA 3A8HB 1WI7A 3CCEQ 2JTMA 4N4IA 1BI3A 2DTHA 1BK2A 1AD5A 3VV0A 2LJ1A 1BI2A 2J6FA 3X28B 1Q81U 1Q86R 2CT4A 4M78B 4MDXA 2KY9A 1MMAA 5HK0A 5FWBA 2EQUA 4DA4A 4E7KA 1RLPC 2CZ7B 3CXCS 2DX1A 4BY6C 1W2BS 2IG0A 3RR6A 1I8FA 4RCBA 5GMKi 2VGNA 1HJDA 1YCSB 4E7IA 1WJSA 2YDLA 3DLMA 4M75D 3OY9A 1JQQA 4A4EA 3CMAQ 4PFPA 4DEYA 4QQ6A 2MCNA 1UB4A 2LX7A 1YIJT 1I0CA 1K8AU 3QSUA 2EYZA 1YI2A 2O31A 5D6XA 1TH7A 2QXFA 1VQNT 5DY9A 2JVVA 1KD1U 1VQ9A 1WJRA 2QK0A 3S6WA 1K1ZA 3RKWA 1WLPB 4M75G 5FU7B 2XKOC 2ZPEB 4C0DC 3EG2A 1M5Q1 3CCVQ 2PVOB 4IIMA 3OW2S 5GAOr 1YWOA 2RI2A 1WPYA 3QHSA 1HXDA 3OYCA 3CC4A 4II1A 1YI2T 2LMJA 3OYLA 4PJOF 4C5GA 1YFNA 5KH6A 2HD0A 2QEXT 1VQ7T 3M57A 2QEXA 2XDBA 1KQSP 3ZL7C 3CD6A 4F17A 3A8LB 2A36A 2RO0A 5KE3A 1Y96A 4AT1B 4HCZA 3ZEHA 1SRLA 5FU6B 2EQMA 2X4YA 4J83A 2QQRA 3LH5A 3EFSA 2DL8A 2L3PA 4Z88A 2DPPB 3CCJQ 2BE7D 3X26B 5CK9A 3UF4A 2EW3A 2CZ1B 2MWPA 2QTVA 4PFZA 3A8GB 1N6AA 1ZA1B 2O9SA 1KG1A 2ZZDA 4M77D 2CP0A 2C0OA 2LQWA 4J6WA 2QA4A 1G3WA 2YHTA 3P8HA 3E2UA 4PJOA 4J9CA 4L5GA 4FT4A 2D8HA 2EYYA 2KAFA 3H0FA 2RHUA 3I5RA 3JCMf 1A0NB 4CC4B 2KE9A 3NMZC 5ECAA 5LL6S 3GPLA 1M90R 4L6V5 4XTVA 3C4SA 4OMNA 4CC2A 1X2KA 1E7OA 3HPWA 1SSHA 5GAN6 1QCFA 1J3TA 5A0DA 1M90C 2LNHB 4GLMA 1UHFA 3DLLA 3QJYA 3KXTA 2DE0X 2RQTA 5LJ5d 3JB9F 2AHJB 2OTLT 1I81A 2DZ9A 1XTDA 2XD0A 1OI1A 1E6HA 3EFOB 4EMKA 1QWFA 3TREA 3EHRA 3PT9A 4PJOD 1NZ9A 1OU8A 1PD1A 2EAYA 3MEUA 4OB2B 2EJGA 2M02A 1XQHA 3FIFA 2YRCA 3JCMc 1QVGA 4PJOE 5GANj 1UJYA 3OYHA 1YJWQ 4QW2A 1K73U 2EJFA 2GTOA 4HCBA 5L23A 2CSIA 3FLGA 3A98A 3HKSA 4M78C 1K9MC 4IUQA 1ABQA 3G7ZA 4PKCC 4HKEA 2CGHA 4N4GA 2NUPA 1Q82C 2RQWA 2EQJA 3MJXA 4BE0A 1M1KR 1TUDA 2XMFA 5LJ5e 3CPWS 1KC8C 2RHXA 1EX4A 4M77E 1B7TA 3REAB 2V8IA 1VQKT 1QVFS 4RTWA 2BIVA 5DLQE 1RADB 4E2FB 1PRLC 4PLIA 2EQKA 2K5LA 3RMSA 1WQWA 2D9TA 1W2BA 4OMLA 1FYNA 3UATA 4E47A 4PJJA 6AT1B 1V76A 3JCMQ 1WIEA 4BI4A 2DRKA 3KFVA 4C92F 5KYXA 4C0DB 3CD6Q 2RA2A 5FWCA 5IXBA 3KUFA 3QYHB 4A4FA 3SWNC 3HRTA 3A1PA 4OMPA 3CCVA 1OPKA 3WXMB 4C92D 3JSCA 1M9SA 2F5TX 3DB4A 3LYIA 3LX7A 1BB9A 2HSEB 4XAXB 4DBHA 7AT1B 3D7SB 2GGRA 4D8DA 4BDZA 3I5SA 5FU6C 1IXDA 2RF0A 3NHNA 1S1NA 4R0KA 2DL4A 4OMQA 4OB0B 5C0MA 4A63B 1JXMA 1WXUA 2AZVA 4QVCA 2J06A 8AT1B 3JB9J 4M77G 2IVWA 4XU3A 1S72T 1UGQB 3QIIA 5CKFA 3META 4X34A 2YSQA 2D8JA 5LJ3f 2COZA 2OTJA 2GNCA 4KGVB 3FEOA 4MZTA 3CC2T 4LUEA 1M8VA 2E4HA 1F1BB 2A28A 1YJ9A 3VS1A 3EGXB 2Y90A 2LT1A 1I5OB 3CCEA 1UUEA 4XTWA 2HKQB 5GAN2 3OMGA 4WTOB 1PKTA 4B6MA 2GQIA 4M75A 1PHTA 1Q7YU 5GAMe 3AHUA 2OAUA 4J6XA 1G3YA 2A08A 4IUVA 5CKBA 4VUBA 2ENMA 2NUTB 1KQ1A 2XU8A 5C6SA 4KGXB 4A4KA 1QVFP 2P4RA 1K0XA 4ORZA 4ZGEB 5GMKh 4V2SA 2DL3A 2DD5A 2FVUA 4CC7A 8ATCB 1UGSB 2DAQA 1UHCA 2JM9A 1M1KC 1ZQ1A 2XDDA 2BE9B 2CREA 3V7CA 1R0CB 2ZGWA 3CCUT 4LDXA 1SHGA 4C8QD 4E7SA 1N27A 2E5KA 1PG5B 2K57A 5D7UA 1U06A 4HVVA 4RUGA 1VOMA 1IREB 1SEMA 2RN8A 1OZ2A 3CC4Q 2FPFA 1RAGB 5LJ3h 1SG5A 2SRCA 2EGAA 4M7AE 4EPCA 5CKEA 1VQ4A 2EYXA 3BDLA 3OS5A 2BUDA 3PVLA 1KD1C 1EFNA 1VYUA 3UDCA 2YLBA 3VS7A 2K2MA 2QYZA 3EG1A 2E70A 4AFZC 2LQ8A 5GANe 2FEIA 1YHQT 5I2SA 3LH0A 1M2OA 1YBYA 4GY5A 1QVFA 3CMAA 3ZBDA 4BD3A 4M77C 3QDRB 4JPBW 1BCMA 3GNFB 2RNAA 1OEBA 1Y96B 4ZN1A 2V8JA 2DLPA 4JZ3A 3EG0A 1MNDA 4PJOC 4M75E 5LJ5g 1RLQC 2ABLA 3CCQT 1U8RA 1G3TA 1JU5C 2QEXQ 1LPLA 4KULA 1TG0A 3URGA 5CAIA 1K73C 1WHKA 2OTJT 4C5HA 2GFUA 2H8HA 1K9AA 1SSFA 2DYBA 2YWWA 1IB8A 2LT4A 1WHLA 4KUDK 2O9VA 4PJOB 4LD6A 4E7JA 1Y7XA 1IRXA 1KC8R 1YJNA 4JRKA 1M1KU 1RI0A 5M9OA 4Y28E 4J9IA 1SHFA 4BUGA 5I11A 1V1CA 2FL7A 1UE9A 2FPEA 2FZCB 2WSFE 4OF1A 3GP8A 1VYTA 2FHDA 1M27C 2CP2A 4KRTA 3I56A 4JS4A 2X3XD 1ZUUA 3R6OA 4EMKC 1M3CA 1LCKA 1VQNQ 2FO0A 1HD3A 1BIAA 2MAMA 4AMCA 5GMKm 3CC7T 4OGCA 5GAMg 4C0ZA 1FMKA 4J5YA 4JDSA 4OGEA 2XHCA 1MUZA 1CKBA 2BZXA 3BE3A 3BDUA 2VVKA 4EDUA 1QP2A 2A3LA 4P5NA 3M0TA 3I55Q 3RUXA 3C95A 2E12A 1RI9A 1GCQC 4EMKB 1K0SA 2XK0A 1TWBA 1VQLQ 2OTLQ 1Q81C 2JZ2A 1QLYA 4XK8E 3RKXA 1YWPA 1RAEB 1IGUA 2A7YA 5FRNA 4RTTA 1WDXA 5KYWA 1RAHB 3VYGA 1D1BA 3CMEA 4GLKA 4N4HA 2NUPB 2ZPHB 3MEWA 1OOTA 3CXCP 4JLIA 4Y91A 1H3ZA 1VQPT 3CCQA 3OYFA 1AT1B 2E6NA 1ACMB 2F2XA 3TSWA 2QQBA 4EMHA 4M4ZA 4M77A 3HFOA 1IZ6A 5L8RE 2B8AA 4HVWA 4NL2A 1K4US 3QKJA 4M78F 3BFMA 1GL5A 4DEXA 1NJIU 2JOYA 3UA6A 3A8OB 4CC3A 3OBWA 3JB9G 4ELYC 2HQEA 2CUDA 5J3BA 3INZA 2EKOA 2KK4A 1I4K1 4LN2A 2BZYA 5IN1A 3QZ9B 1EIFA 2HZYA 1WHJA 1JJ2A 3CPWA 2DJZA 1OYXA 2RQUA 3HTRA 1NPRA 2LX9A 4KUIA 4PJNA 4BB7A 1PSEA 4CRIA 1MHNA 1PM3A 1TSFA 3MHXA 2DEUA 1KFZA 1ZSZC 3TU4K 5GAOl 4E7HA 3S3NA 2DERA 3CPFA 2PU9B 4M7AG 1TXQA 2QDYB 3CC2A 3F70A 4HXJA 1QCOA 3MP1A 2LZ6B 5AYFA 5GJWB 2EVRA 1KSWA 1AZEA 3IQLA 3CXCA 1AZGB 4MZPA 1VA7A 2VB6A 2HMAA 1M2VB 2HEQA 3LLRA 1LNXA 3M0RA 4QVDA 1YNZA 2ROLA 4BDYA 2DZCA 2EFIA 4DQ2A 3G6EA 1YITA 2JTFA 1BKBA 2K5IA 2DVJA 4M78G 1PWTA 5A2QE 5GAN4 1VQ8Q 1LJOA 1YJWA 2QQSA 4J9GA 1BI1A 2GBQA 1YI2Q 1IHWA 2DA9A 2RHIA 3OYMA 5DM7R 1VQ7Q 4HT8A 4O5VA 5FROA 4M75C 4KH0B 1NE8A 2CP3A 2DIGA 2FYKA 3VU3C 5GAOp 3L2VA 1GBQA 2CP7A 3PIPA 3TEEA 2ZPIB 3OYGA 1D3BA 2JNGA 1OX9A 2QQ9A 3PNWC 4M7DB 1M30A 1PD0A 3M0PA 1WHHA 2K2VA 5KYUB 4MDWA 3QDFA 4BE1A 1WJQA 2L3RA 2P0PA 2DL5A 1S72A 4DOVA 4A4GA 1Q81R 1TTHB 1Q86U 2FRYA 1U3OA 3E1SA 1R0BG 4M7DC 5D6YA 5CQYA 2AK5A 3M58A 2DKGA 1G2BA 3DB3A 2Z0WA 3NTIA 2QA4T 2ED1A 2M51A 3OW2P 4RTUA 4ZTFA 4AFQC 2KRNA 5GAN8 1ZBJA 2RJEA 2KYMA 3V8KA 1WYXA 2K79A 2VUBA 1YJNT 2JS0A 2F1LA 2E65A 1ARKA 2YXYA 1KQSA 4IUTA 2FPDA 5I22A 1KQSS 3UT1A 2E5QA 2LVMA 3UA7A 2O4XA 1LVKA 4PLLA 4C8QA 4EIKA 5KCOA 3Q1JA 4JJCA 4F7UF 4M7AC 3CPWP 2VASA 2HL3A 1NBEB 1VQ6T 2KVQG 3CD6T 2A0FB 4J9FA 1ZBXA 1QVGP 2SEMA 4M78E 3UWNA 1RAIB 2ESWA 4BY6B 2DMOA 3JCMh 1UJ0A 3NFCA 4LD9K 4X9CA 1G3SA 2EWNA 2DF6A 3FRNA 2NLUA 2DJQA 2JT4A 2JN0A 3HP9A 4ZGJB 3MCAB 1UGPB 1VQ8T 2DL7A 2DTIA 4FM4B 1KHIA 1QVGS 3EHQA 4D8KA 2K3XA 5LJ5f 4RMOA 2RQVA 3ULRB 5GAOm 2YUOA 1G5VA 1E6GA 3CCLQ 4JRPA 2LCSA 2AIRB 1FX7A 3M4YA 1PKSA 2G3RA 3E19A 3OYDA 1SPKA 2HL5C 4IUUA 1KHCA 4AFSC 2DXCA 3CCSA 4C92B 2DTOA 3VJPA 1HK9A 2MI6A 1H8KA 1Q86C 4CI0C 1VQPA 4DBRA 4F04B 2P0QA 1VQ4T 3SFMA 3M55A 1VQ7A 4E6RA 3CCJT 2XDPA 2KYBA 1BYMA 3CCJA 1WX6A 1CSKA 3TCJA 2AKKA 1VQ8A 4C5EA 3JCMW 1ABOA 3OYJA 1M1GA 1VUBA 3GLXA 2OAWA 5IAYA 1RL2A 5LJ5j 1M90U 5KYNA 3CCMA 2HDAA 2QAZA 1VQ9T 1GBRA 1WNLA 2QA4Q 4AG2C 4RTYA 2YRDA 2F2WA 2RK1A 1RACB 3X20B 4Z89A 2CS7A 1PCXA 5EC7A 1OX8A 4C92A 3OYKA 1YJNQ 1Y57A 3CBPA 3REBB 1MMGA 1B34A 5LJ3d 2DXBA 5GANh 3JAME 1NLOC 2HQHA 4EMGA 3CEYA 1VIEA 2CZ6B 4LDVA 3NPFA 3JB9D 3JB9I 1PNJA 2JJ9A 2MF2A 2GTJA 1QKXA 2K4YA 1K9MU 1OV3A 3VS6A 5HY6A 3M5AA 4FW1A 3DKMA 1S72Q 2VXFA 3S3OA 2RHYA 5I2MA 4M78A 1QKWA 4Y92A 1TU0B 1GFCA 1X69A 2K3YA 2O88A 3CCMQ 3FC3A 1YP5A 4R55A 3CC2Q 2QGGA 3EH1A 5GAN3 2R5MA 2DNUA 1QCNA 1B34B 1UGVA 4FYWB 4C5IA 3OW2A 1QW1A 5GAN5 1HYOA 4KGZB 2PQWA 4KBMB 2YUPA 4JJDA 1I07A 4OMFB 4LDUA 1N8RR 1VQ5A 1PRMC 4J7FA 4TVRA 4C8QC 2DVEA 4DBFA 3M0SA 3OSSC 1U5SA 4FSXA 1K8AR 1R77A 2F5KA 1Q82R 2EJ9A 4IUPA 2E41A 3JB9H 2FB7A 1JBMA 4FYYB 3OSVA 3CCLA 4OP0A 1GCPA 1C1AA 3G4ST 1BIBA 2OX7A 2DYIA 1RAFB 4JRQA 1NJIC 1YHQA 2E10A 4QVZA 1X43A 3PGGA 4C8QG 2V26A 3JRZA 1KC8U 5D6WA 2GF7A 2JM8A 5FU7C 2LDMA 1VQMQ 2LNVA 4XQ3A 2QGFB 1VQ6A 2CH4A 1X75C 2KT8A 4FYXB 2KEAA 4PL6A 1AOJA 1QVPA 3SHWA 4FL6A 5CO7A 2E3HA 1NYGA 3OYBA 3AT1B 1X2QA 1OQKA 2RMOA 5FLXE 1XJWB 2GFAA 2MIOA 3QZ5B 3OBYA 4N0AA 1ZUYA 3CCUQ 3A8MB 3RNJA 1AWXA 5LJ3j 3M0QA 5IXFA 1BBZA 2EIFA 2MYSA 3CCUA 5KE2A 3I55A 4PFOA 4WCIA 2KGTA 4A4HA 4J6YA 1X6GA 2L3SA 2K7AA 4JLGA 4D6WA 4QT7A 2KNBB 1TOVA 1VQNA 2LJ3A 2X9HA 3GF5A 1D1AA 4F16A 2DM1A 2JTEA 2X51A 5GAOn 5GMKj 1JJ2S 3S3MA 1Q7YC 2PVGB 3CCVT 3M0UA 2C0IA 3CC7A 2PVDB 1SRMA 2KROA 2EGEA 2DXTA 3G71T 4ME7A 3OYAA 3JCMd 4ZN3A 3SEMA 1VQOA 3JCMX 2QG9B 3RMQA 3CMET 5KYUA 5KYXB 1BU1A 3L42A 1VQMA 2CKKA 3MP8A 2EYQA 3ZFJA 3OYYA 5CKDA 2EQIA 1H3HA 1KIKA 3L2UA 3SDZA 3C12A 2DK3A 2RH2A 4KH1B 1UDLA 1M3AA 2V1QA 1UECA 3OQ5A 1LOJA 4J9DA 3FJPA 2NWMA 1M4ZA 5CKHA 1VQMT 3RKYA 2E64A 2HCKA 3QUIA 2IIMA 1W6XA 1N8RC 2VC8A 4Z8AA 1QMCA 4BE2A 1B3QA 1N9SA 5DLOA 4C92G 3CCRT 1VQOT 3JCMJ 1WHMA 2WACA 2J7IA 4JJNK 1NPPA 3CCET 2KR3A 3CCST 1UG1A 2L3QA 4DBQA 3PE0A 3QXEB 3NTHA 5KYYA 4M7DD 2RI3A 3VS4A 4C8QB 1JO8A 3EGUA 2YUNA 3I56T 4ZTJA 4RCCA 2QQAA 4F7UA 2CZ0B 2F69A 2RB6A 4AG1C 4Q5WA 2JMAA 3JCMg 2DXUA 2L8DA 3RESA 3X25B 4PJLA 3L2ZA 2RHZA 3MP6A 2CT3A 3CC4T 2NYSA 1UTIA 4FIBA 2M0OA 2KMTA 2KXCA 2C0TA 2V8KA 1GFDA 2BKDN 4FT2A 4HT9A 4IIOA 4FW2A 2DFUA 2KRMA 1WXTA 2H3JA 3G1JA 2AKLA 4MMKA 2B86A 2PTKA 2K9GA 5KYYB 4K11A 1N5ZA 3U23A 2PUOB 4OVAA 2PNIA 1I1JA 2MWOA 3EAEA 4L59A 4F7UB 1ZSGA 1W1FA 4XTYA 1JEGA 1VQPQ 2LC4A 1AVZC 1AWOA 1KD1R 2FRWA 4PJOG 1K9MR 5A0LA 1JXOA 3LGFA 5KCHA 2ATCB 3N5BB 2K5FA 1YN8A 3BY7A 1SKUB 3JCMP 2MK5A 1NJIR 2X35A 3P8BB 2DRMA 2P84A 3QWYA 3LGLA 2W0ZA 4KT0E 1AHJB 2KBTA 4X1VA 3QWXX 2WSEE 3ASKA 5HKCA 2A37A 4LXCA 1VQKQ 1PC0A 2RD1A 5HK3A 1N8RU 4WF2A 3E9FA 2HNIA 2X3WD 3V8JA 1NLPC 1RAAB 2OTLA 2GQVA 3V7SA 1VQ5Q 2RJFA 4QQGA 3OA6A 2O01E 5HCKA 1Q82U 2M9UA 2DETA 3SWNB 4HCCA 4MZMA 1T0JA 3V7RA 2YLCA 4HCKA 3L2WA 3G6ET 1YITT 2DBKA 1G83A 1Q95G 2R58A 2CH4W 1IO6A 2LQKA 1ZX6A 3OS0A 2F2VA 3H0HA 3I56Q 2DEQA 2PZ1A 2NUTA 2IPOB 4XU2A 1P92A 4ATOA 1DJ7B 1OULA 2LRQA 2QDLA 5CCAA 2ZPGB 2CYZB 3M54A 1D3BB 4C8QE 1QP3A 5GJVB 5GMKe 3H0IA 1D0XA 1MV3A 4BI8B 3M4GA 4LDWA 2KDSA 2LP5A 3CCLT 2W10A 1WHGA 2BTTA 1G8XA 2RJCA 1YIJQ 3CBOA 2XICA 1VQ6Q 1RABB 1OZ3A 2AT1B 1FMWA 2HKNA 3O8VA 4XU1A 4PNOA 4ZNXA 3VRYA 5LJ3g 1KQ2A 1MNEA 4J7IA 5LJ5h 2CDTA 1YJ9Q 1YIJA 2DD4A 1C6VX 2D6FA 1TS9A 1D0ZA 3JCMb 4OMOA 4GBQA 4M7DG 3LWHA 1OPLA 1XNIA 5IT9E 5AT1B 2OJ2A 3I9QA 2D0NA 5IHIA 1TUGB 3ME9A 1IGQA 3M53A 1WA7A 4C0GA 2LCLA 4XTUA 3MEAA 4O6JA 2AZSA 5A0GA
chains in the Genus database with same CATH topology
2RHYA 5I2MA 5DY9A 2JVVA 4M78A 4BI3A 1KD1U 2LT4A 2K3YA 5GAMf 1VQ9A 1WJRA 2Y4XA 3S6WA 4KUDK 3RKWA 3FC3A 3OB9A 4PJOB 2QI2A 4LD6A 4M75G 4R55A 4E7JA 5EG2A 5FU7B 5GAN3 2R5MA 2XKOC 2ZPEB 4C0DC 1B34B 1M5Q1 1Y7XA 2PVOB 4C5IA 3OW2S 2ZPBB 3FB9A 5GAOr 1YJNA 4JRKA 4RG2A 1M1KU 1RI0A 5M9OA 3OW2A 1QW1A 1WPYA 2RI2A 3QHSA 1HXDA 5GAN5 3OYCA 4Y28E 3CC4A 4BUGA 4M77F 4II1A 2PQWA 4KBMB 1YI2T 3OYLA 1Y71A 4PJOF 2M1HA 4C5GA 5KH6A 2FL7A 4OMFB 4ZGDB 4LDUA 2HD0A 1I5LA 1VQ5A 2QEXT 1K9MC 1VQ7T 2WSFE 2RI5A 3M57A 4J7FA 4OF1A 4TVRA 3WVDB 5LJ3e 2QEXA 3GP8A 2XDBA 3CD6A 2FHDA 4C8QC 2DVEA 3M59A 3I56A 3OS1A 3A8LB 2RO0A 5KE3A 4JS4A 5GMKl 1Y96A 1W4SA 3OSSC 4HCZA 3R6OA 4FSXA 4IURA 4X9DA 2F5KA 4Z02A 4EMKC 3PMIA 2X4WA 4M78D 1XOVA 2EJ9A 2Y4YA 4N0AC 4IUPA 3ZEHA 1BIAA 2E41A 2MAMA 2MMPA 5GMKm 5FU6B 5J26A 2FB7A 3CC7T 2EQMA 1JBMA 2X4YA 2QQRA 3OSVA 3EFSA 4J83A 4J5YA 4OGCA 3T9NA 4C0ZA 4JDSA 2DPPB 5A0GA 5GAMg 4OGEA 3CCLA 2HBPA 2XHCA 4OP0A 3X26B 5CK9A 4NOYA 3G4ST 1BIBA 3QO3A 2JUFA 2CZ1B 2MWPA 2QTXA 3BDUA 4HA8A 5CIUA 4EDUA 3A8GB 4JRQA 1QP2A 1NJIC 3A5ZB 1YHQA 2A3LA 2E10A 4QVZA 1JRIA 1N6AA 3ER0A 3PGGA 4P5NA 4C8QG 1KC8U 3HL8A 3JRZA 5D6WA 3C95A 3RUXA 1KG1A 2GF7A 2E12A 4EMKB 5FU7C 2ZZDA 2LDMA 4M77D 2LNVA 4XQ3A 1VQ6A 4J6WA 4XU0A 2XK0A 2QA4A 1G3WA 2YHTA 3P8HA 4PJOA 1X75C 3VYHB 2RK2A 4FT4A 4L5GA 4M77B 3OYIA 4PL6A 1Q81C 1QVPA 2JZ2A 2KAFA 4FL6A 5CO7A 3JCMe 4XK8E 2RHUA 3OYBA 3RKXA 3JCMf 2PUKB 2A7YA 5FRNA 3PIOA 5LL6S 2HQXA 3VUBA 2GFAA 4L6V5 5FLXE 4UC4A 4XTVA 3GPLA 1YJ9T 3C4SA 3HFNA 3QZ5B 3GIBA 3VYGA 3OBYA 3QJ6A 1WQ7A 4N0AA 3CMEA 4GLKA 3A8MB 4N4HA 3HPWA 2XG8D 5I21A 5GAN6 2ZPHB 2ZCFB 4RG8A 3MEWA 5LJ3j 4JLIA 4Y91A 3L2RA 1H3ZA 5A0DA 1M90C 1VQPT 3CCQA 2EIFA 3CBMA 3DLLA 1FXXA 4M75F 3QJYA 3VKIA 2E6NA 3OYFA 5KE2A 3CCUA 4NL3A 1MGQA 2L89A 2I2LA 3QG1A 3I55A 3KXTA 1VQKA 2QQBA 4EMHA 5LJ5d 4BACA 1GXIE 4M77A 4DOWA 3JB9F 3HFOA 1IZ6A 2AHJB 5L8RE 2B8AA 4NL2A 5GANg 3QKJA 4M78F 3BFMA 2OTLT 1I81A 2P0KA 4A4HA 1NJIU 1V29B 2DZ9A 4MMLA 1XTDA 3HRSA 3JB9H 2XD0A 4J6YA 2JOYA 3A8OB 3JCMV 2WSCE 3OBWA 4JLGA 1OI1A 4D6WA 3JB9G 4ELYC 2HQEA 5J3BA 1VQNA 3INZA 4EMKA 2EKOA 2KK4A 3OMCA 1VIFA 1I4K1 4NS5A 3PT9A 3GF5A 3KBGA 3L1AA 4PJOD 5IN1A 3J81E 1ZHIA 3QZ9B 3OYEA 1EIFA 1NZ9A 5GAOn 5GMKj 1JJ2S 2EAYA 3CPWA 1JJ2A 3S3MA 3MEUA 4OB2B 2PVGB 2DJZA 2X4XA 1OYXA 1Q7YC 2EJGA 3CCVT 1XQHA 3FIFA 4QQDA 3SB2A 1NPRA 2LX9A 3JCMc 1QVGA 4PJOE 4KUIA 5GANj 4BB7A 1PSEA 4CRIA 3CC7A 2PVDB 3OYHA 1MHNA 3MHXA 4QW2A 1K73U 2EJFA 2LTOA 4HCBA 5GANd 3TU4K 4M7AF 3FLGA 5GAOl 4E7HA 3S3NA 2DXTA 3G71T 3HKSA 3CPFA 4M78C 2PU9B 2YRVA 4IUQA 4M75B 4ME7A 3M9QA 3G7ZA 4ZN3A 3JCMd 3OYAA 4PKCC 4M7AG 4HKEA 1VQOA 2CGHA 2QDYB 4JRIA 4N4GA 3F70A 2EQJA 4C0FA 3JCMX 4BE0A 1Q82C 3CC2A 5CQXA 3MP1A 3RMQA 3CMET 5AYFA 1VQLA 5LJ5e 2P4TA 4B9WA 3CPWS 3L42A 1VQMA 1WGSA 2XI9A 1KC8C 2RHXA 3CXCA 2CKKA 2DO3A 3MP8A 4MZPA 4M77E 2EYQA 5GAMj 1PSFA 3ZFJA 3OYYA 4A54A 5CKDA 3E9GA 3LLRA 1LNXA 2V8IA 1VQKT 1QVFS 3L2UA 4QVDA 3SDZA 2BIVA 3CCMT 3C12A 5DLQE 2DK3A 2RH2A 4XTXA 3J80E 3CCRA 4YTLA 1BI0A 4PLIA 3OQ5A 4BDYA 2DZCA 2EFIA 4DQ2A 3G6EA 1YITA 2EQKA 2JTFA 2K5LA 1BKBA 2K5IA 3RMSA 1WQWA 1LOJA 3HRUA 4M78G 2D9TA 3FJPA 3MO8A 1W2BA 1M4ZA 5CKHA 5A2QE 1VQMT 2KQWA 4FU6A 3RKYA 2E64A 4E47A 5GAN4 3QUIA 3JCMQ 3H6ZA 1LJOA 4BI4A 2QQSA 1YJWA 1N8RC 1BI1A 2VC8A 4C92F 3G4SA 4BE2A 2RHIA 3OYMA 1N9SA 4C0DB 5DLOA 3J7AF 5DM7R 4C92G 3CCRT 1VQOT 3JCMJ 1U1SA 2RA2A 4F7UE 2WACA 4JJNK 1NPPA 3CCET 4HT8A 3V8LA 3KUFA 4O5VA 5FROA 4M75C 5GAMd 1NE8A 2DIGA 4XTZA 2FYKA 3QYHB 3CCST 3VU3C 5GAOp 4A4FA 5GANf 3L2VA 3QXEB 3SWNC 3NTHA 3TEEA 3PIPA 2ZPIB 3HRTA 4A53A 2RI3A 3OYGA 1D3BA 4M7DD 2XIDA 3CCVA 3HHTB 3WVEB 4F7UG 2JNGA 4IKFA 2QQ9A 3PNWC 4C8QB 4M7DB 3I56T 4ZTJA 3WXMB 2M16A 4RCCA 4C92D 2QQAA 4F7UA 2CZ0B 2F69A 2K2VA 3JSCA 4MDWA 1M9SA 2F5TX 2RB6A 3DB4A 4BE1A 3LYIA 3LX7A 4Q5WA 3JCMg 2DXUA 2L8DA 3RESA 4XAXB 3X25B 3X24B 4M7AB 1WJQA 3L2ZA 4J8OA 4BDZA 2RHZA 3MP6A 2L3RA 5FU6C 4ELZC 2P0PA 1S72A 4DOVA 4C8QF 4A4GA 3CC4T 2VYTA 4FIBA 2M0OA 4C92C 1Q86U 2O4XB 2KMTA 4OB0B 5C0MA 2V8KA 3E1SA 2E1HA 4M7DC 2BKDN 5D6YA 4FT2A 5CQYA 4QVCA 2RM4A 3JB9J 4HT9A 4M77G 3M58A 2IVWA 2DKGA 4XU3A 2E6ZA 1S72T 3DB3A 3NTIA 2QA4T 2HAXA 1UGQB 2H3JA 3QIIA 5CKFA 3LWIA 4ZTFA 4M7DA 3META 4MMKA 4X34A 3SWNA 5GAN8 2RJEA 3V8KA 5LJ3f 1UGRB 3QBYA 3M56A 1JB0E 2OTJA 2ZPFB 2PUOB 5GAOq 4OVAA 3FEOA 3RERA 4MZTA 2VUBA 1YJNT 3CC2T 2MWOA 3EAEA 2E65A 3LW5E 4OB3B 4L59A 1KQSA 1N9RA 4F7UB 1M8VA 4IUTA 4XTYA 4E7LA 3BW1A 1YJ9A 3SD4A 1KQSS 3UT1A 2LC4A 2E5QA 3VUZA 2LVMA 2Y90A 2O4XA 4M7AA 3QPHA 2RJDA 4PLLA 4OB1B 2LT1A 4PJOG 5A0LA 3LGFA 4C8QA 5KCOA 3Q1JA 3CCEA 2C06A 5KCHA 4XTWA 4F7UF 4R56A 4M7AC 3N5BB 2K5FA 5GAMh 3BY7A 1VQ6T 2KVQG 5CVIA 5GAN2 3JCMP 3CD6T 1X01A 3OMGA 2X35A 3P8BB 3CMAT 1ZBXA 4M75A 4M78E 3UWNA 3LGLA 1Q7YU 3FDRA 4BY6B 5GAMe 4KT0E 1AHJB 3C94A 3AHUA 5FRMA 2OAUA 2WSEE 3ASKA 3GNGA 4J6XA 3JCMh 2VV5A 5HKCA 4M7DF 1G3YA 2RD1A 5HK3A 1N8RU 2LCCA 3NFCA 4IUVA 4WF2A 4LD9K 3E9FA 4X9CA 2HNIA 1G3SA 3GOXA 2EWNA 5CKBA 3V8JA 3HSBA 3PMTA 2OTLA 1H641 2GQVA 3FRNA 3EFRA 3V7SA 3PFSA 3UPUA 4VUBA 2NLUA 1K8AC 2RJFA 3H8ZA 4QQGA 2R5AA 2JN0A 3OA6A 2O01E 3HP9A 1Y07A 3MEVA 1KQ1A 2XU8A 4ZGJB 3MCAB 1Q82U 1UGPB 5C6SA 2DTIA 2M9UA 1O9SA 4FM4B 4C92E 3I55T 1KHIA 3OS2A 1VQ8T 4A4KA 1YJWT 1QVGS 4M7DE 2K3XA 3SWNB 5GAN7 2L5QA 5LJ5f 4RMOA 4MZMA 4HCCA 4ZGEB 5GMKh 4JS5A 2R57A 5CR2A 3V7RA 1VQLT 4V2SA 2YLCA 3L2WA 3L2QA 1X6OA 5GAOm 3G6ET 1YITT 2D0QB 1G5VA 2DD5A 2FVUA 4JRPA 1UGSB 2DAQA 2R58A 2VXEA 1FX7A 3M4YA 2LQKA 1FWZA 1M1KC 4M7AD 3G71A 1ZQ1A 2G3RA 2XDDA 3OS0A 3E19A 3OYDA 4IUUA 3V7CA 1KHCA 2DXCA 2GCXA 3CCSA 4B9XA 3P8DA 2DTOA 4C92B 2ZGWA 3VJPA 3OYNA 1HK9A 3CCUT 2MI6A 2DEQA 4LDXA 4C8QD 1Q86C 4CI0C 1O75A 1VQPA 4XU2A 2P0QA 1N27A 1VQ4T 3SFMA 1M1FA 3M55A 1UEBA 1P92A 4ATOA 2X4JA 1DJ7B 2K57A 1VQ5T 1VQ7A 1U1TA 4JUVA 2LRQA 1YCYA 2XDPA 3CCJT 1BYMA 5CCAA 3CCJA 2VGMA 2ZPGB 2CYZB 1IREB 3M54A 1D3BB 4C8QE 1QP3A 3TCJA 1OZ2A 5GMKe 1VQ8A 2KSSA 5LJ3h 1R8OB 4C5EA 3JCMW 4BI8B 3QYGB 3OYJA 4M7AE 1M1GA 1VUBA 3GLXA 3M4GA 5IAYA 4LDWA 3NTKA 1RL2A 4RKUE 5CKEA 4LDYA 4EPCA 3BDLA 2KDSA 3OS5A 5LJ5j 1VQ4A 1M90U 3CCLT 3PTAA 2BUDA 5J39A 1KD1C 3CCMA 3RIRA 2DIQA 3UDCA 3A8HB 1VQ9T 2RJCA 1WNLA 3CBOA 2XICA 2RK1A 2YLBA 1OZ3A 3X20B 2JTMA 4N4IA 2CS7A 3O8VA 4XU1A 1BI3A 2DTHA 4PNOA 3VV0A 2E70A 3TREA 5LJ3g 1KQ2A 2LQ8A 4J7IA 5GANe 4C92A 5LJ5h 5I2SA 3OYKA 1YHQT 1BI2A 3X28B 3LH0A 1YBYA 4GY5A 2DD4A 3CBPA 1YIJA 3CMAA 1Q81U 1QVFA 2D6FA 3ZBDA 4BD3A 4M78B 4M77C 1SSFA 3QDRB 4MDXA 3JCMb 2KY9A 1B34A 5HK0A 2EQUA 4M7DG 5LJ3d 2DXBA 5GANh 3LWHA 4DA4A 3JAME 4E7KA 2CZ7B 3GNFB 1XNIA 4EMGA 3CXCS 5IT9E 3CEYA 1Y96B 4BY6C 1W2BS 1VIEA 4ZN1A 2CZ6B 2IG0A 2V8JA 1I8FA 4RCBA 4LDVA 5GMKi 2VGNA 3JB9D 3ME9A 3JB9I 4E7IA 4PJOC 4M75E 5LJ5g 2MF2A 3CCQT 3M53A 1U8RA 1WJSA 3DLMA 4M75D 1G3TA 3OY9A 4C0GA 4A4EA 3URGA 4KULA 1K73C 2LCLA 5CAIA 4XTUA 4QQ6A 1YIJT 1UB4A 3MEAA 2K4YA 1K8AU 2OTJT 1K9MU 5HY6A 4C5HA 4O6JA 2GFUA 3M5AA 3QSUA 1YI2A 3DKMA 5D6XA 2VXFA 3S3OA 1TH7A 2QXFA 1VQNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHY A;  3NTH A;  3OYG A;  2RI3 A;  2K3Y A;  2R57 A;  2B8A A;  1WJR A;  3L2W A;  3L2Q A;  3PNW C;  3QKJ A;  4IKF A;  3S6W A;  4ZTJ A;  2P0K A;  4A4H A;  3FC3 A;  3OB9 A;  1G5V A;  2M16 A;  4LD6 A;  4E7J A;  2DAQ A;  2R58 A;  4BE1 A;  2R5M A;  3DB4 A;  3LYI A;  3LX7 A;  4Q5W A;  2L8D A;  4C5I A;  1OI1 A;  2G3R A;  1WJQ A;  4RG2 A;  3OS0 A;  1RI0 A;  5M9O A;  2HQE A;  2RHZ A;  3MP6 A;  3OYD A;  2L3R A;  2RI2 A;  4BDZ A;  4IUU A;  3OYC A;  1KHC A;  2EKO A;  3OMC A;  4NS5 A;  4A4G A;  4II1 A;  4B9X A;  2PQW A;  2VYT A;  3P8D A;  5IN1 A;  2M0O A;  3OYN A;  3OYL A;  2M1H A;  2O4X B;  3OYE A;  4C5G A;  5KH6 A;  1N27 A;  5C0M A;  3S3M A;  2RI5 A;  3MEU A;  2X4X A;  1OYX A;  2BKD N;  5D6Y A;  2FHD A;  2LRQ A;  2XDP A;  4QQD A;  3OS1 A;  2RO0 A;  5KE3 A;  4CRI A;  3OYH A;  4HCZ A;  1MHN A;  1OZ2 A;  3DB3 A;  3NTI A;  4IUR A;  2F5K A;  4QW2 A;  2LTO A;  3PMI A;  4Z02 A;  2X4W A;  3QII A;  4C5E A;  4ZTF A;  3FLG A;  4E7H A;  3MET A;  3S3N A;  4X34 A;  3OYJ A;  4IUP A;  2RJE A;  2YRV A;  4IUQ A;  3ZEH A;  3OYA A;  5IAY A;  3M9Q A;  3NTK A;  3QBY A;  5J26 A;  2EQM A;  2X4Y A;  3BDL A;  2QQR A;  4N4G A;  3F70 A;  2EQJ A;  2BUD A;  3FEO A;  4OVA A;  5J39 A;  4BE0 A;  2MWO A;  3EAE A;  3MP1 A;  4L59 A;  2DIQ A;  4IUT A;  2MWP A;  4E7L A;  2RJC A;  5CIU A;  3SD4 A;  4B9W A;  4EDU A;  3UT1 A;  3L42 A;  2E5Q A;  2LVM A;  1WGS A;  2O4X A;  2RHX A;  1OZ3 A;  4QVZ A;  2CKK A;  4N4I A;  4PLL A;  2RJD A;  3MP8 A;  3O8V A;  5D6W A;  2GF7 A;  2LDM A;  3LGF A;  3OYK A;  2XK0 A;  5KCO A;  3Q1J A;  3LH0 A;  3E9G A;  3LLR A;  3P8H A;  4GY5 A;  5KCH A;  3L2U A;  3OYI A;  2BIV A;  4PL6 A;  4BD3 A;  2JZ2 A;  4FL6 A;  4PLI A;  2EQU A;  2RHU A;  3OYB A;  3OMG A;  3OQ5 A;  4BDY A;  2EFI A;  2X35 A;  4E7K A;  2JTF A;  2EQK A;  5FRN A;  1XNI A;  3UWN A;  3LGL A;  3CEY A;  2D9T A;  3FDR A;  3MO8 A;  2HQX A;  3L2V A;  2GFA A;  2IG0 A;  4UC4 A;  4FU6 A;  5FRM A;  3C4S A;  3H6Z A;  3ASK A;  2QQS A;  3QJ6 A;  3S3O A;  3ME9 A;  4E7I A;  2LCC A;  4IUV A;  2RHI A;  4N4H A;  3OYM A;  3E9F A;  4BE2 A;  3GOX A;  1WJS A;  3DLM A;  3OY9 A;  3PMT A;  4A4E A;  2WAC A;  3MEW A;  3PFS A;  2NLU A;  2RJF A;  3H8Z A;  4QQ6 A;  3KUF A;  2R5A A;  4QQG A;  5FRO A;  3OA6 A;  3MEA A;  3L2R A;  1H3Z A;  3MEV A;  2DIG A;  3OYF A;  4C5H A;  2E6N A;  2GFU A;  5C6S A;  5KE2 A;  2L89 A;  3OS2 A;  5D6X A;  1SSF A;  2K3X A;  4BAC A;  4A4F A; 
#chains in the Genus database with same CATH topology
 2CUB A;  4BI3 A;  4RTX A;  5GAM f;  2Y4X A;  2LQN A;  3JV3 A;  2EKH A;  3OB9 A;  3EG3 A;  2QI2 A;  4RTZ A;  2EPD A;  5EG2 A;  1VQ4 Q;  1QWE A;  3H41 A;  2ZPB B;  3FB9 A;  2L2P A;  4RG2 A;  4M77 F;  1Y71 A;  2G6F X;  2M1H A;  4F14 A;  5IHK A;  4ZGD B;  1I5L A;  2RI5 A;  3WVD B;  2ED0 A;  5LJ3 e;  3C0C A;  1SF9 A;  1BCO A;  3M59 A;  3OS1 A;  5GMK l;  1AEY A;  1W4S A;  3CCS Q;  4FCY A;  4IUR A;  4Z02 A;  4X9D A;  3PMI A;  2X4W A;  4M78 D;  1Z9Z A;  1WXB A;  1XOV A;  2Y4Y A;  4N0A C;  1Q7Y R;  3NGP A;  2MMP A;  5J26 A;  4HVU A;  2D1X A;  2M0Y A;  3T9N A;  5IH2 A;  4QKU A;  5KYW B;  2HBP A;  4NOY A;  3QO3 A;  1UFF A;  2JUF A;  1GCQ A;  2QTX A;  4HA8 A;  5CIU A;  1QQJ A;  3A5Z B;  1JRI A;  3ER0 A;  3HL8 A;  2DBM A;  1WZO A;  4XU0 A;  3VYH B;  2RK2 A;  3OYI A;  4M77 B;  3VS0 A;  3JCM e;  1WFW A;  1NEG A;  2E3I A;  2V1R A;  2PUK B;  1RUW A;  3PIO A;  2HQX A;  3EG9 B;  3VUB A;  4UC4 A;  1YJ9 T;  3HFN A;  3GIB A;  3QJ6 A;  1WQ7 A;  2MOX A;  4ESR A;  2XG8 D;  1ZSZ B;  5I21 A;  2ZCF B;  2YT6 A;  1MV0 B;  4RG8 A;  3TSZ A;  3L2R A;  3CBM A;  1FXX A;  4M75 F;  3VKI A;  4NL3 A;  1MGQ A;  2L89 A;  2I2L A;  3QG1 A;  1VQK A;  1GXI E;  4BAC A;  4DOW A;  2YUQ A;  5GAN g;  3TQ7 P;  2P0K A;  4J9H A;  2VKN A;  1V29 B;  4MML A;  3HRS A;  1OU9 A;  3R6N A;  2OTJ Q;  1CKA A;  1H92 A;  3JCM V;  2WSC E;  4ANJ A;  1VQ9 Q;  1Y0M A;  1X27 A;  2COW A;  3OMC A;  1VIF A;  4NS5 A;  3EG9 A;  3KBG A;  3L1A A;  3J81 E;  1ZHI A;  3OYE A;  4JJB A;  3H9N A;  2X4X A;  2DIL A;  1ZSZ A;  1M2V A;  2COY A;  2HBW A;  4QQD A;  3CQT A;  3SB2 A;  5FW9 A;  2LTO A;  5GAN d;  4M7A F;  2K3B A;  4M75 B;  2YRV A;  3M9Q A;  1NM7 A;  3G6E Q;  1YIT Q;  4JRI A;  9ATC B;  3HSB A;  4C0F A;  1AWW A;  5CQX A;  1MMD A;  1VQL A;  1D1C A;  2P4T A;  4B9W A;  1WGS A;  2XI9 A;  2CP5 A;  1T3L A;  2DO3 A;  4E7Z A;  5GAM j;  1PSF A;  4A54 A;  3E9G A;  1T3S A;  4FSS A;  2CSQ A;  3CCM T;  4XTX A;  3J80 E;  3CCR A;  4YTL A;  1BI0 A;  2KI7 A;  2RQR A;  3MPU B;  3EFO A;  3HRU A;  2OI3 A;  3MO8 A;  1D0Y A;  2KQW A;  4FU6 A;  1K73 R;  3H6Z A;  3VS5 A;  2LJ0 A;  4AFU C;  3G4S A;  1D09 B;  3J7A F;  1U1S A;  4F7U E;  3V8L A;  5GAM d;  1JJ2 P;  4XTZ A;  4RTV A;  5GAN f;  4LE9 A;  2HSP A;  4A53 A;  2JXB A;  2XID A;  3HHT B;  3WVE B;  4F7U G;  4IKF A;  2NUZ A;  2M16 A;  2L0A A;  5IHN A;  2VWF A;  3EGD B;  1GRI A;  1NYF A;  4M7A B;  3X24 B;  4J8O A;  4ELZ C;  4C8Q F;  2VYT A;  1HSQ A;  4C92 C;  1X6B A;  2O4X B;  3CCQ Q;  2E1H A;  1W70 A;  2EBP A;  2RM4 A;  1M3B A;  3GBQ A;  3CME Q;  1NG2 A;  2RPN A;  3FJ5 A;  2E6Z A;  4FYV B;  2HAX A;  4M7D A;  4LUD A;  3LWI A;  3SWN A;  2FZK B;  2KT1 A;  1UGR B;  1W2B P;  3QBY A;  3M56 A;  1JB0 E;  2ZPF B;  2K6D A;  5GAO q;  3RER A;  4PJM A;  2J6O A;  2J05 A;  4OB3 B;  3LW5 E;  1N9R A;  4E7L A;  3BW1 A;  1FMV A;  3TVT A;  3SD4 A;  3VUZ A;  3EGD A;  1VYV A;  4M7A A;  3QPH A;  2RJD A;  2J6K A;  4OB1 B;  2H3E B;  1M8M A;  2ZAE A;  2C06 A;  1K76 A;  4R56 A;  2BZ8 A;  5GAM h;  2I0N A;  1KK7 A;  3I35 A;  5CVI A;  1VQO Q;  3VS3 A;  1X01 A;  4LNP A;  3CMA T;  2JMC A;  3MKD A;  3O5Z A;  2ROT A;  3FDR A;  1KJW A;  2O2O A;  3PVQ A;  3VRZ A;  2EYW A;  3C94 A;  2FG0 A;  5FRM A;  1ZLM A;  3GNG A;  4M7D F;  2JW4 A;  2VV5 A;  3CC7 Q;  2EGC A;  2LCC A;  2FZG B;  3GOX A;  3PMT A;  3THK A;  1H64 1;  3EFR A;  3PFS A;  3UPU A;  4JZ4 A;  1K8A C;  3H8Z A;  3EH2 A;  2R5A A;  1Y07 A;  3MEV A;  3I55 T;  1O9S A;  3RBB B;  4C92 E;  3OS2 A;  4PK4 A;  1EZZ B;  1YJW T;  4M7D E;  1B07 A;  5GAN 7;  2L5Q A;  1T0H A;  1MMN A;  1NEB A;  3G71 Q;  2R57 A;  4JS5 A;  5CR2 A;  1VQL T;  3L2Q A;  1X6O A;  3RDV A;  2D0Q B;  2MPX C;  2VXE A;  4OMM A;  1IHV A;  3EGX A;  1FWZ A;  4M7A D;  4J9B A;  1TUC A;  3G71 A;  2CP6 A;  2GCX A;  4B9X A;  3P8D A;  3OYN A;  3VS2 A;  2KRS A;  1YHQ Q;  1O75 A;  2JS2 A;  4J9E A;  1M1F A;  1UEB A;  2ECZ A;  2X4J A;  1VQ5 T;  1U1T A;  4JUV A;  1YCY A;  1ZA2 B;  2VGM A;  1Z9Q A;  3G4S Q;  2KSS A;  1R8O B;  3QYG B;  1AWJ A;  3NTK A;  4RKU E;  1C0M A;  1ZUK A;  4LDY A;  3PTA A;  2QAS A;  2KXD A;  5J39 A;  3CCR Q;  3RIR A;  2DIQ A;  3A8H B;  1WI7 A;  3CCE Q;  2JTM A;  4N4I A;  1BI3 A;  2DTH A;  1BK2 A;  1AD5 A;  3VV0 A;  2LJ1 A;  1BI2 A;  2J6F A;  3X28 B;  1Q81 U;  1Q86 R;  2CT4 A;  4M78 B;  4MDX A;  2KY9 A;  1MMA A;  5HK0 A;  5FWB A;  2EQU A;  4DA4 A;  4E7K A;  1RLP C;  2CZ7 B;  3CXC S;  2DX1 A;  4BY6 C;  1W2B S;  2IG0 A;  3RR6 A;  1I8F A;  4RCB A;  5GMK i;  2VGN A;  1HJD A;  1YCS B;  4E7I A;  1WJS A;  2YDL A;  3DLM A;  4M75 D;  3OY9 A;  1JQQ A;  4A4E A;  3CMA Q;  4PFP A;  4DEY A;  4QQ6 A;  2MCN A;  1UB4 A;  2LX7 A;  1YIJ T;  1I0C A;  1K8A U;  3QSU A;  2EYZ A;  1YI2 A;  2O31 A;  5D6X A;  1TH7 A;  2QXF A;  1VQN T;  5DY9 A;  2JVV A;  1KD1 U;  1VQ9 A;  1WJR A;  2QK0 A;  3S6W A;  1K1Z A;  3RKW A;  1WLP B;  4M75 G;  5FU7 B;  2XKO C;  2ZPE B;  4C0D C;  3EG2 A;  1M5Q 1;  3CCV Q;  2PVO B;  4IIM A;  3OW2 S;  5GAO r;  1YWO A;  2RI2 A;  1WPY A;  3QHS A;  1HXD A;  3OYC A;  3CC4 A;  4II1 A;  1YI2 T;  2LMJ A;  3OYL A;  4PJO F;  4C5G A;  1YFN A;  5KH6 A;  2HD0 A;  2QEX T;  1VQ7 T;  3M57 A;  2QEX A;  2XDB A;  1KQS P;  3ZL7 C;  3CD6 A;  4F17 A;  3A8L B;  2A36 A;  2RO0 A;  5KE3 A;  1Y96 A;  4AT1 B;  4HCZ A;  3ZEH A;  1SRL A;  5FU6 B;  2EQM A;  2X4Y A;  4J83 A;  2QQR A;  3LH5 A;  3EFS A;  2DL8 A;  2L3P A;  4Z88 A;  2DPP B;  3CCJ Q;  2BE7 D;  3X26 B;  5CK9 A;  3UF4 A;  2EW3 A;  2CZ1 B;  2MWP A;  2QTV A;  4PFZ A;  3A8G B;  1N6A A;  1ZA1 B;  2O9S A;  1KG1 A;  2ZZD A;  4M77 D;  2CP0 A;  2C0O A;  2LQW A;  4J6W A;  2QA4 A;  1G3W A;  2YHT A;  3P8H A;  3E2U A;  4PJO A;  4J9C A;  4L5G A;  4FT4 A;  2D8H A;  2EYY A;  2KAF A;  3H0F A;  2RHU A;  3I5R A;  3JCM f;  1A0N B;  4CC4 B;  2KE9 A;  3NMZ C;  5ECA A;  5LL6 S;  3GPL A;  1M90 R;  4L6V 5;  4XTV A;  3C4S A;  4OMN A;  4CC2 A;  1X2K A;  1E7O A;  3HPW A;  1SSH A;  5GAN 6;  1QCF A;  1J3T A;  5A0D A;  1M90 C;  2LNH B;  4GLM A;  1UHF A;  3DLL A;  3QJY A;  3KXT A;  2DE0 X;  2RQT A;  5LJ5 d;  3JB9 F;  2AHJ B;  2OTL T;  1I81 A;  2DZ9 A;  1XTD A;  2XD0 A;  1OI1 A;  1E6H A;  3EFO B;  4EMK A;  1QWF A;  3TRE A;  3EHR A;  3PT9 A;  4PJO D;  1NZ9 A;  1OU8 A;  1PD1 A;  2EAY A;  3MEU A;  4OB2 B;  2EJG A;  2M02 A;  1XQH A;  3FIF A;  2YRC A;  3JCM c;  1QVG A;  4PJO E;  5GAN j;  1UJY A;  3OYH A;  1YJW Q;  4QW2 A;  1K73 U;  2EJF A;  2GTO A;  4HCB A;  5L23 A;  2CSI A;  3FLG A;  3A98 A;  3HKS A;  4M78 C;  1K9M C;  4IUQ A;  1ABQ A;  3G7Z A;  4PKC C;  4HKE A;  2CGH A;  4N4G A;  2NUP A;  1Q82 C;  2RQW A;  2EQJ A;  3MJX A;  4BE0 A;  1M1K R;  1TUD A;  2XMF A;  5LJ5 e;  3CPW S;  1KC8 C;  2RHX A;  1EX4 A;  4M77 E;  1B7T A;  3REA B;  2V8I A;  1VQK T;  1QVF S;  4RTW A;  2BIV A;  5DLQ E;  1RAD B;  4E2F B;  1PRL C;  4PLI A;  2EQK A;  2K5L A;  3RMS A;  1WQW A;  2D9T A;  1W2B A;  4OML A;  1FYN A;  3UAT A;  4E47 A;  4PJJ A;  6AT1 B;  1V76 A;  3JCM Q;  1WIE A;  4BI4 A;  2DRK A;  3KFV A;  4C92 F;  5KYX A;  4C0D B;  3CD6 Q;  2RA2 A;  5FWC A;  5IXB A;  3KUF A;  3QYH B;  4A4F A;  3SWN C;  3HRT A;  3A1P A;  4OMP A;  3CCV A;  1OPK A;  3WXM B;  4C92 D;  3JSC A;  1M9S A;  2F5T X;  3DB4 A;  3LYI A;  3LX7 A;  1BB9 A;  2HSE B;  4XAX B;  4DBH A;  7AT1 B;  3D7S B;  2GGR A;  4D8D A;  4BDZ A;  3I5S A;  5FU6 C;  1IXD A;  2RF0 A;  3NHN A;  1S1N A;  4R0K A;  2DL4 A;  4OMQ A;  4OB0 B;  5C0M A;  4A63 B;  1JXM A;  1WXU A;  2AZV A;  4QVC A;  2J06 A;  8AT1 B;  3JB9 J;  4M77 G;  2IVW A;  4XU3 A;  1S72 T;  1UGQ B;  3QII A;  5CKF A;  3MET A;  4X34 A;  2YSQ A;  2D8J A;  5LJ3 f;  2COZ A;  2OTJ A;  2GNC A;  4KGV B;  3FEO A;  4MZT A;  3CC2 T;  4LUE A;  1M8V A;  2E4H A;  1F1B B;  2A28 A;  1YJ9 A;  3VS1 A;  3EGX B;  2Y90 A;  2LT1 A;  1I5O B;  3CCE A;  1UUE A;  4XTW A;  2HKQ B;  5GAN 2;  3OMG A;  4WTO B;  1PKT A;  4B6M A;  2GQI A;  4M75 A;  1PHT A;  1Q7Y U;  5GAM e;  3AHU A;  2OAU A;  4J6X A;  1G3Y A;  2A08 A;  4IUV A;  5CKB A;  4VUB A;  2ENM A;  2NUT B;  1KQ1 A;  2XU8 A;  5C6S A;  4KGX B;  4A4K A;  1QVF P;  2P4R A;  1K0X A;  4ORZ A;  4ZGE B;  5GMK h;  4V2S A;  2DL3 A;  2DD5 A;  2FVU A;  4CC7 A;  8ATC B;  1UGS B;  2DAQ A;  1UHC A;  2JM9 A;  1M1K C;  1ZQ1 A;  2XDD A;  2BE9 B;  2CRE A;  3V7C A;  1R0C B;  2ZGW A;  3CCU T;  4LDX A;  1SHG A;  4C8Q D;  4E7S A;  1N27 A;  2E5K A;  1PG5 B;  2K57 A;  5D7U A;  1U06 A;  4HVV A;  4RUG A;  1VOM A;  1IRE B;  1SEM A;  2RN8 A;  1OZ2 A;  3CC4 Q;  2FPF A;  1RAG B;  5LJ3 h;  1SG5 A;  2SRC A;  2EGA A;  4M7A E;  4EPC A;  5CKE A;  1VQ4 A;  2EYX A;  3BDL A;  3OS5 A;  2BUD A;  3PVL A;  1KD1 C;  1EFN A;  1VYU A;  3UDC A;  2YLB A;  3VS7 A;  2K2M A;  2QYZ A;  3EG1 A;  2E70 A;  4AFZ C;  2LQ8 A;  5GAN e;  2FEI A;  1YHQ T;  5I2S A;  3LH0 A;  1M2O A;  1YBY A;  4GY5 A;  1QVF A;  3CMA A;  3ZBD A;  4BD3 A;  4M77 C;  3QDR B;  4JPB W;  1BCM A;  3GNF B;  2RNA A;  1OEB A;  1Y96 B;  4ZN1 A;  2V8J A;  2DLP A;  4JZ3 A;  3EG0 A;  1MND A;  4PJO C;  4M75 E;  5LJ5 g;  1RLQ C;  2ABL A;  3CCQ T;  1U8R A;  1G3T A;  1JU5 C;  2QEX Q;  1LPL A;  4KUL A;  1TG0 A;  3URG A;  5CAI A;  1K73 C;  1WHK A;  2OTJ T;  4C5H A;  2GFU A;  2H8H A;  1K9A A;  1SSF A;  2DYB A;  2YWW A;  1IB8 A;  2LT4 A;  1WHL A;  4KUD K;  2O9V A;  4PJO B;  4LD6 A;  4E7J A;  1Y7X A;  1IRX A;  1KC8 R;  1YJN A;  4JRK A;  1M1K U;  1RI0 A;  5M9O A;  4Y28 E;  4J9I A;  1SHF A;  4BUG A;  5I11 A;  1V1C A;  2FL7 A;  1UE9 A;  2FPE A;  2FZC B;  2WSF E;  4OF1 A;  3GP8 A;  1VYT A;  2FHD A;  1M27 C;  2CP2 A;  4KRT A;  3I56 A;  4JS4 A;  2X3X D;  1ZUU A;  3R6O A;  4EMK C;  1M3C A;  1LCK A;  1VQN Q;  2FO0 A;  1HD3 A;  1BIA A;  2MAM A;  4AMC A;  5GMK m;  3CC7 T;  4OGC A;  5GAM g;  4C0Z A;  1FMK A;  4J5Y A;  4JDS A;  4OGE A;  2XHC A;  1MUZ A;  1CKB A;  2BZX A;  3BE3 A;  3BDU A;  2VVK A;  4EDU A;  1QP2 A;  2A3L A;  4P5N A;  3M0T A;  3I55 Q;  3RUX A;  3C95 A;  2E12 A;  1RI9 A;  1GCQ C;  4EMK B;  1K0S A;  2XK0 A;  1TWB A;  1VQL Q;  2OTL Q;  1Q81 C;  2JZ2 A;  1QLY A;  4XK8 E;  3RKX A;  1YWP A;  1RAE B;  1IGU A;  2A7Y A;  5FRN A;  4RTT A;  1WDX A;  5KYW A;  1RAH B;  3VYG A;  1D1B A;  3CME A;  4GLK A;  4N4H A;  2NUP B;  2ZPH B;  3MEW A;  1OOT A;  3CXC P;  4JLI A;  4Y91 A;  1H3Z A;  1VQP T;  3CCQ A;  3OYF A;  1AT1 B;  2E6N A;  1ACM B;  2F2X A;  3TSW A;  2QQB A;  4EMH A;  4M4Z A;  4M77 A;  3HFO A;  1IZ6 A;  5L8R E;  2B8A A;  4HVW A;  4NL2 A;  1K4U S;  3QKJ A;  4M78 F;  3BFM A;  1GL5 A;  4DEX A;  1NJI U;  2JOY A;  3UA6 A;  3A8O B;  4CC3 A;  3OBW A;  3JB9 G;  4ELY C;  2HQE A;  2CUD A;  5J3B A;  3INZ A;  2EKO A;  2KK4 A;  1I4K 1;  4LN2 A;  2BZY A;  5IN1 A;  3QZ9 B;  1EIF A;  2HZY A;  1WHJ A;  1JJ2 A;  3CPW A;  2DJZ A;  1OYX A;  2RQU A;  3HTR A;  1NPR A;  2LX9 A;  4KUI A;  4PJN A;  4BB7 A;  1PSE A;  4CRI A;  1MHN A;  1PM3 A;  1TSF A;  3MHX A;  2DEU A;  1KFZ A;  1ZSZ C;  3TU4 K;  5GAO l;  4E7H A;  3S3N A;  2DER A;  3CPF A;  2PU9 B;  4M7A G;  1TXQ A;  2QDY B;  3CC2 A;  3F70 A;  4HXJ A;  1QCO A;  3MP1 A;  2LZ6 B;  5AYF A;  5GJW B;  2EVR A;  1KSW A;  1AZE A;  3IQL A;  3CXC A;  1AZG B;  4MZP A;  1VA7 A;  2VB6 A;  2HMA A;  1M2V B;  2HEQ A;  3LLR A;  1LNX A;  3M0R A;  4QVD A;  1YNZ A;  2ROL A;  4BDY A;  2DZC A;  2EFI A;  4DQ2 A;  3G6E A;  1YIT A;  2JTF A;  1BKB A;  2K5I A;  2DVJ A;  4M78 G;  1PWT A;  5A2Q E;  5GAN 4;  1VQ8 Q;  1LJO A;  1YJW A;  2QQS A;  4J9G A;  1BI1 A;  2GBQ A;  1YI2 Q;  1IHW A;  2DA9 A;  2RHI A;  3OYM A;  5DM7 R;  1VQ7 Q;  4HT8 A;  4O5V A;  5FRO A;  4M75 C;  4KH0 B;  1NE8 A;  2CP3 A;  2DIG A;  2FYK A;  3VU3 C;  5GAO p;  3L2V A;  1GBQ A;  2CP7 A;  3PIP A;  3TEE A;  2ZPI B;  3OYG A;  1D3B A;  2JNG A;  1OX9 A;  2QQ9 A;  3PNW C;  4M7D B;  1M30 A;  1PD0 A;  3M0P A;  1WHH A;  2K2V A;  5KYU B;  4MDW A;  3QDF A;  4BE1 A;  1WJQ A;  2L3R A;  2P0P A;  2DL5 A;  1S72 A;  4DOV A;  4A4G A;  1Q81 R;  1TTH B;  1Q86 U;  2FRY A;  1U3O A;  3E1S A;  1R0B G;  4M7D C;  5D6Y A;  5CQY A;  2AK5 A;  3M58 A;  2DKG A;  1G2B A;  3DB3 A;  2Z0W A;  3NTI A;  2QA4 T;  2ED1 A;  2M51 A;  3OW2 P;  4RTU A;  4ZTF A;  4AFQ C;  2KRN A;  5GAN 8;  1ZBJ A;  2RJE A;  2KYM A;  3V8K A;  1WYX A;  2K79 A;  2VUB A;  1YJN T;  2JS0 A;  2F1L A;  2E65 A;  1ARK A;  2YXY A;  1KQS A;  4IUT A;  2FPD A;  5I22 A;  1KQS S;  3UT1 A;  2E5Q A;  2LVM A;  3UA7 A;  2O4X A;  1LVK A;  4PLL A;  4C8Q A;  4EIK A;  5KCO A;  3Q1J A;  4JJC A;  4F7U F;  4M7A C;  3CPW P;  2VAS A;  2HL3 A;  1NBE B;  1VQ6 T;  2KVQ G;  3CD6 T;  2A0F B;  4J9F A;  1ZBX A;  1QVG P;  2SEM A;  4M78 E;  3UWN A;  1RAI B;  2ESW A;  4BY6 B;  2DMO A;  3JCM h;  1UJ0 A;  3NFC A;  4LD9 K;  4X9C A;  1G3S A;  2EWN A;  2DF6 A;  3FRN A;  2NLU A;  2DJQ A;  2JT4 A;  2JN0 A;  3HP9 A;  4ZGJ B;  3MCA B;  1UGP B;  1VQ8 T;  2DL7 A;  2DTI A;  4FM4 B;  1KHI A;  1QVG S;  3EHQ A;  4D8K A;  2K3X A;  5LJ5 f;  4RMO A;  2RQV A;  3ULR B;  5GAO m;  2YUO A;  1G5V A;  1E6G A;  3CCL Q;  4JRP A;  2LCS A;  2AIR B;  1FX7 A;  3M4Y A;  1PKS A;  2G3R A;  3E19 A;  3OYD A;  1SPK A;  2HL5 C;  4IUU A;  1KHC A;  4AFS C;  2DXC A;  3CCS A;  4C92 B;  2DTO A;  3VJP A;  1HK9 A;  2MI6 A;  1H8K A;  1Q86 C;  4CI0 C;  1VQP A;  4DBR A;  4F04 B;  2P0Q A;  1VQ4 T;  3SFM A;  3M55 A;  1VQ7 A;  4E6R A;  3CCJ T;  2XDP A;  2KYB A;  1BYM A;  3CCJ A;  1WX6 A;  1CSK A;  3TCJ A;  2AKK A;  1VQ8 A;  4C5E A;  3JCM W;  1ABO A;  3OYJ A;  1M1G A;  1VUB A;  3GLX A;  2OAW A;  5IAY A;  1RL2 A;  5LJ5 j;  1M90 U;  5KYN A;  3CCM A;  2HDA A;  2QAZ A;  1VQ9 T;  1GBR A;  1WNL A;  2QA4 Q;  4AG2 C;  4RTY A;  2YRD A;  2F2W A;  2RK1 A;  1RAC B;  3X20 B;  4Z89 A;  2CS7 A;  1PCX A;  5EC7 A;  1OX8 A;  4C92 A;  3OYK A;  1YJN Q;  1Y57 A;  3CBP A;  3REB B;  1MMG A;  1B34 A;  5LJ3 d;  2DXB A;  5GAN h;  3JAM E;  1NLO C;  2HQH A;  4EMG A;  3CEY A;  1VIE A;  2CZ6 B;  4LDV A;  3NPF A;  3JB9 D;  3JB9 I;  1PNJ A;  2JJ9 A;  2MF2 A;  2GTJ A;  1QKX A;  2K4Y A;  1K9M U;  1OV3 A;  3VS6 A;  5HY6 A;  3M5A A;  4FW1 A;  3DKM A;  1S72 Q;  2VXF A;  3S3O A;  2RHY A;  5I2M A;  4M78 A;  1QKW A;  4Y92 A;  1TU0 B;  1GFC A;  1X69 A;  2K3Y A;  2O88 A;  3CCM Q;  3FC3 A;  1YP5 A;  4R55 A;  3CC2 Q;  2QGG A;  3EH1 A;  5GAN 3;  2R5M A;  2DNU A;  1QCN A;  1B34 B;  1UGV A;  4FYW B;  4C5I A;  3OW2 A;  1QW1 A;  5GAN 5;  1HYO A;  4KGZ B;  2PQW A;  4KBM B;  2YUP A;  4JJD A;  1I07 A;  4OMF B;  4LDU A;  1N8R R;  1VQ5 A;  1PRM C;  4J7F A;  4TVR A;  4C8Q C;  2DVE A;  4DBF A;  3M0S A;  3OSS C;  1U5S A;  4FSX A;  1K8A R;  1R77 A;  2F5K A;  1Q82 R;  2EJ9 A;  4IUP A;  2E41 A;  3JB9 H;  2FB7 A;  1JBM A;  4FYY B;  3OSV A;  3CCL A;  4OP0 A;  1GCP A;  1C1A A;  3G4S T;  1BIB A;  2OX7 A;  2DYI A;  1RAF B;  4JRQ A;  1NJI C;  1YHQ A;  2E10 A;  4QVZ A;  1X43 A;  3PGG A;  4C8Q G;  2V26 A;  3JRZ A;  1KC8 U;  5D6W A;  2GF7 A;  2JM8 A;  5FU7 C;  2LDM A;  1VQM Q;  2LNV A;  4XQ3 A;  2QGF B;  1VQ6 A;  2CH4 A;  1X75 C;  2KT8 A;  4FYX B;  2KEA A;  4PL6 A;  1AOJ A;  1QVP A;  3SHW A;  4FL6 A;  5CO7 A;  2E3H A;  1NYG A;  3OYB A;  3AT1 B;  1X2Q A;  1OQK A;  2RMO A;  5FLX E;  1XJW B;  2GFA A;  2MIO A;  3QZ5 B;  3OBY A;  4N0A A;  1ZUY A;  3CCU Q;  3A8M B;  3RNJ A;  1AWX A;  5LJ3 j;  3M0Q A;  5IXF A;  1BBZ A;  2EIF A;  2MYS A;  3CCU A;  5KE2 A;  3I55 A;  4PFO A;  4WCI A;  2KGT A;  4A4H A;  4J6Y A;  1X6G A;  2L3S A;  2K7A A;  4JLG A;  4D6W A;  4QT7 A;  2KNB B;  1TOV A;  1VQN A;  2LJ3 A;  2X9H A;  3GF5 A;  1D1A A;  4F16 A;  2DM1 A;  2JTE A;  2X51 A;  5GAO n;  5GMK j;  1JJ2 S;  3S3M A;  1Q7Y C;  2PVG B;  3CCV T;  3M0U A;  2C0I A;  3CC7 A;  2PVD B;  1SRM A;  2KRO A;  2EGE A;  2DXT A;  3G71 T;  4ME7 A;  3OYA A;  3JCM d;  4ZN3 A;  3SEM A;  1VQO A;  3JCM X;  2QG9 B;  3RMQ A;  3CME T;  5KYU A;  5KYX B;  1BU1 A;  3L42 A;  1VQM A;  2CKK A;  3MP8 A;  2EYQ A;  3ZFJ A;  3OYY A;  5CKD A;  2EQI A;  1H3H A;  1KIK A;  3L2U A;  3SDZ A;  3C12 A;  2DK3 A;  2RH2 A;  4KH1 B;  1UDL A;  1M3A A;  2V1Q A;  1UEC A;  3OQ5 A;  1LOJ A;  4J9D A;  3FJP A;  2NWM A;  1M4Z A;  5CKH A;  1VQM T;  3RKY A;  2E64 A;  2HCK A;  3QUI A;  2IIM A;  1W6X A;  1N8R C;  2VC8 A;  4Z8A A;  1QMC A;  4BE2 A;  1B3Q A;  1N9S A;  5DLO A;  4C92 G;  3CCR T;  1VQO T;  3JCM J;  1WHM A;  2WAC A;  2J7I A;  4JJN K;  1NPP A;  3CCE T;  2KR3 A;  3CCS T;  1UG1 A;  2L3Q A;  4DBQ A;  3PE0 A;  3QXE B;  3NTH A;  5KYY A;  4M7D D;  2RI3 A;  3VS4 A;  4C8Q B;  1JO8 A;  3EGU A;  2YUN A;  3I56 T;  4ZTJ A;  4RCC A;  2QQA A;  4F7U A;  2CZ0 B;  2F69 A;  2RB6 A;  4AG1 C;  4Q5W A;  2JMA A;  3JCM g;  2DXU A;  2L8D A;  3RES A;  3X25 B;  4PJL A;  3L2Z A;  2RHZ A;  3MP6 A;  2CT3 A;  3CC4 T;  2NYS A;  1UTI A;  4FIB A;  2M0O A;  2KMT A;  2KXC A;  2C0T A;  2V8K A;  1GFD A;  2BKD N;  4FT2 A;  4HT9 A;  4IIO A;  4FW2 A;  2DFU A;  2KRM A;  1WXT A;  2H3J A;  3G1J A;  2AKL A;  4MMK A;  2B86 A;  2PTK A;  2K9G A;  5KYY B;  4K11 A;  1N5Z A;  3U23 A;  2PUO B;  4OVA A;  2PNI A;  1I1J A;  2MWO A;  3EAE A;  4L59 A;  4F7U B;  1ZSG A;  1W1F A;  4XTY A;  1JEG A;  1VQP Q;  2LC4 A;  1AVZ C;  1AWO A;  1KD1 R;  2FRW A;  4PJO G;  1K9M R;  5A0L A;  1JXO A;  3LGF A;  5KCH A;  2ATC B;  3N5B B;  2K5F A;  1YN8 A;  3BY7 A;  1SKU B;  3JCM P;  2MK5 A;  1NJI R;  2X35 A;  3P8B B;  2DRM A;  2P84 A;  3QWY A;  3LGL A;  2W0Z A;  4KT0 E;  1AHJ B;  2KBT A;  4X1V A;  3QWX X;  2WSE E;  3ASK A;  5HKC A;  2A37 A;  4LXC A;  1VQK Q;  1PC0 A;  2RD1 A;  5HK3 A;  1N8R U;  4WF2 A;  3E9F A;  2HNI A;  2X3W D;  3V8J A;  1NLP C;  1RAA B;  2OTL A;  2GQV A;  3V7S A;  1VQ5 Q;  2RJF A;  4QQG A;  3OA6 A;  2O01 E;  5HCK A;  1Q82 U;  2M9U A;  2DET A;  3SWN B;  4HCC A;  4MZM A;  1T0J A;  3V7R A;  2YLC A;  4HCK A;  3L2W A;  3G6E T;  1YIT T;  2DBK A;  1G83 A;  1Q95 G;  2R58 A;  2CH4 W;  1IO6 A;  2LQK A;  1ZX6 A;  3OS0 A;  2F2V A;  3H0H A;  3I56 Q;  2DEQ A;  2PZ1 A;  2NUT A;  2IPO B;  4XU2 A;  1P92 A;  4ATO A;  1DJ7 B;  1OUL A;  2LRQ A;  2QDL A;  5CCA A;  2ZPG B;  2CYZ B;  3M54 A;  1D3B B;  4C8Q E;  1QP3 A;  5GJV B;  5GMK e;  3H0I A;  1D0X A;  1MV3 A;  4BI8 B;  3M4G A;  4LDW A;  2KDS A;  2LP5 A;  3CCL T;  2W10 A;  1WHG A;  2BTT A;  1G8X A;  2RJC A;  1YIJ Q;  3CBO A;  2XIC A;  1VQ6 Q;  1RAB B;  1OZ3 A;  2AT1 B;  1FMW A;  2HKN A;  3O8V A;  4XU1 A;  4PNO A;  4ZNX A;  3VRY A;  5LJ3 g;  1KQ2 A;  1MNE A;  4J7I A;  5LJ5 h;  2CDT A;  1YJ9 Q;  1YIJ A;  2DD4 A;  1C6V X;  2D6F A;  1TS9 A;  1D0Z A;  3JCM b;  4OMO A;  4GBQ A;  4M7D G;  3LWH A;  1OPL A;  1XNI A;  5IT9 E;  5AT1 B;  2OJ2 A;  3I9Q A;  2D0N A;  5IHI A;  1TUG B;  3ME9 A;  1IGQ A;  3M53 A;  1WA7 A;  4C0G A;  2LCL A;  4XTU A;  3MEA A;  4O6J A;  2AZS A;  5A0G A; 
#chains in the Genus database with same CATH homology
 2RHY A;  5I2M A;  5DY9 A;  2JVV A;  4M78 A;  4BI3 A;  1KD1 U;  2LT4 A;  2K3Y A;  5GAM f;  1VQ9 A;  1WJR A;  2Y4X A;  3S6W A;  4KUD K;  3RKW A;  3FC3 A;  3OB9 A;  4PJO B;  2QI2 A;  4LD6 A;  4M75 G;  4R55 A;  4E7J A;  5EG2 A;  5FU7 B;  5GAN 3;  2R5M A;  2XKO C;  2ZPE B;  4C0D C;  1B34 B;  1M5Q 1;  1Y7X A;  2PVO B;  4C5I A;  3OW2 S;  2ZPB B;  3FB9 A;  5GAO r;  1YJN A;  4JRK A;  4RG2 A;  1M1K U;  1RI0 A;  5M9O A;  3OW2 A;  1QW1 A;  1WPY A;  2RI2 A;  3QHS A;  1HXD A;  5GAN 5;  3OYC A;  4Y28 E;  3CC4 A;  4BUG A;  4M77 F;  4II1 A;  2PQW A;  4KBM B;  1YI2 T;  3OYL A;  1Y71 A;  4PJO F;  2M1H A;  4C5G A;  5KH6 A;  2FL7 A;  4OMF B;  4ZGD B;  4LDU A;  2HD0 A;  1I5L A;  1VQ5 A;  2QEX T;  1K9M C;  1VQ7 T;  2WSF E;  2RI5 A;  3M57 A;  4J7F A;  4OF1 A;  4TVR A;  3WVD B;  5LJ3 e;  2QEX A;  3GP8 A;  2XDB A;  3CD6 A;  2FHD A;  4C8Q C;  2DVE A;  3M59 A;  3I56 A;  3OS1 A;  3A8L B;  2RO0 A;  5KE3 A;  4JS4 A;  5GMK l;  1Y96 A;  1W4S A;  3OSS C;  4HCZ A;  3R6O A;  4FSX A;  4IUR A;  4X9D A;  2F5K A;  4Z02 A;  4EMK C;  3PMI A;  2X4W A;  4M78 D;  1XOV A;  2EJ9 A;  2Y4Y A;  4N0A C;  4IUP A;  3ZEH A;  1BIA A;  2E41 A;  2MAM A;  2MMP A;  5GMK m;  5FU6 B;  5J26 A;  2FB7 A;  3CC7 T;  2EQM A;  1JBM A;  2X4Y A;  2QQR A;  3OSV A;  3EFS A;  4J83 A;  4J5Y A;  4OGC A;  3T9N A;  4C0Z A;  4JDS A;  2DPP B;  5A0G A;  5GAM g;  4OGE A;  3CCL A;  2HBP A;  2XHC A;  4OP0 A;  3X26 B;  5CK9 A;  4NOY A;  3G4S T;  1BIB A;  3QO3 A;  2JUF A;  2CZ1 B;  2MWP A;  2QTX A;  3BDU A;  4HA8 A;  5CIU A;  4EDU A;  3A8G B;  4JRQ A;  1QP2 A;  1NJI C;  3A5Z B;  1YHQ A;  2A3L A;  2E10 A;  4QVZ A;  1JRI A;  1N6A A;  3ER0 A;  3PGG A;  4P5N A;  4C8Q G;  1KC8 U;  3HL8 A;  3JRZ A;  5D6W A;  3C95 A;  3RUX A;  1KG1 A;  2GF7 A;  2E12 A;  4EMK B;  5FU7 C;  2ZZD A;  2LDM A;  4M77 D;  2LNV A;  4XQ3 A;  1VQ6 A;  4J6W A;  4XU0 A;  2XK0 A;  2QA4 A;  1G3W A;  2YHT A;  3P8H A;  4PJO A;  1X75 C;  3VYH B;  2RK2 A;  4FT4 A;  4L5G A;  4M77 B;  3OYI A;  4PL6 A;  1Q81 C;  1QVP A;  2JZ2 A;  2KAF A;  4FL6 A;  5CO7 A;  3JCM e;  4XK8 E;  2RHU A;  3OYB A;  3RKX A;  3JCM f;  2PUK B;  2A7Y A;  5FRN A;  3PIO A;  5LL6 S;  2HQX A;  3VUB A;  2GFA A;  4L6V 5;  5FLX E;  4UC4 A;  4XTV A;  3GPL A;  1YJ9 T;  3C4S A;  3HFN A;  3QZ5 B;  3GIB A;  3VYG A;  3OBY A;  3QJ6 A;  1WQ7 A;  4N0A A;  3CME A;  4GLK A;  3A8M B;  4N4H A;  3HPW A;  2XG8 D;  5I21 A;  5GAN 6;  2ZPH B;  2ZCF B;  4RG8 A;  3MEW A;  5LJ3 j;  4JLI A;  4Y91 A;  3L2R A;  1H3Z A;  5A0D A;  1M90 C;  1VQP T;  3CCQ A;  2EIF A;  3CBM A;  3DLL A;  1FXX A;  4M75 F;  3QJY A;  3VKI A;  2E6N A;  3OYF A;  5KE2 A;  3CCU A;  4NL3 A;  1MGQ A;  2L89 A;  2I2L A;  3QG1 A;  3I55 A;  3KXT A;  1VQK A;  2QQB A;  4EMH A;  5LJ5 d;  4BAC A;  1GXI E;  4M77 A;  4DOW A;  3JB9 F;  3HFO A;  1IZ6 A;  2AHJ B;  5L8R E;  2B8A A;  4NL2 A;  5GAN g;  3QKJ A;  4M78 F;  3BFM A;  2OTL T;  1I81 A;  2P0K A;  4A4H A;  1NJI U;  1V29 B;  2DZ9 A;  4MML A;  1XTD A;  3HRS A;  3JB9 H;  2XD0 A;  4J6Y A;  2JOY A;  3A8O B;  3JCM V;  2WSC E;  3OBW A;  4JLG A;  1OI1 A;  4D6W A;  3JB9 G;  4ELY C;  2HQE A;  5J3B A;  1VQN A;  3INZ A;  4EMK A;  2EKO A;  2KK4 A;  3OMC A;  1VIF A;  1I4K 1;  4NS5 A;  3PT9 A;  3GF5 A;  3KBG A;  3L1A A;  4PJO D;  5IN1 A;  3J81 E;  1ZHI A;  3QZ9 B;  3OYE A;  1EIF A;  1NZ9 A;  5GAO n;  5GMK j;  1JJ2 S;  2EAY A;  3CPW A;  1JJ2 A;  3S3M A;  3MEU A;  4OB2 B;  2PVG B;  2DJZ A;  2X4X A;  1OYX A;  1Q7Y C;  2EJG A;  3CCV T;  1XQH A;  3FIF A;  4QQD A;  3SB2 A;  1NPR A;  2LX9 A;  3JCM c;  1QVG A;  4PJO E;  4KUI A;  5GAN j;  4BB7 A;  1PSE A;  4CRI A;  3CC7 A;  2PVD B;  3OYH A;  1MHN A;  3MHX A;  4QW2 A;  1K73 U;  2EJF A;  2LTO A;  4HCB A;  5GAN d;  3TU4 K;  4M7A F;  3FLG A;  5GAO l;  4E7H A;  3S3N A;  2DXT A;  3G71 T;  3HKS A;  3CPF A;  4M78 C;  2PU9 B;  2YRV A;  4IUQ A;  4M75 B;  4ME7 A;  3M9Q A;  3G7Z A;  4ZN3 A;  3JCM d;  3OYA A;  4PKC C;  4M7A G;  4HKE A;  1VQO A;  2CGH A;  2QDY B;  4JRI A;  4N4G A;  3F70 A;  2EQJ A;  4C0F A;  3JCM X;  4BE0 A;  1Q82 C;  3CC2 A;  5CQX A;  3MP1 A;  3RMQ A;  3CME T;  5AYF A;  1VQL A;  5LJ5 e;  2P4T A;  4B9W A;  3CPW S;  3L42 A;  1VQM A;  1WGS A;  2XI9 A;  1KC8 C;  2RHX A;  3CXC A;  2CKK A;  2DO3 A;  3MP8 A;  4MZP A;  4M77 E;  2EYQ A;  5GAM j;  1PSF A;  3ZFJ A;  3OYY A;  4A54 A;  5CKD A;  3E9G A;  3LLR A;  1LNX A;  2V8I A;  1VQK T;  1QVF S;  3L2U A;  4QVD A;  3SDZ A;  2BIV A;  3CCM T;  3C12 A;  5DLQ E;  2DK3 A;  2RH2 A;  4XTX A;  3J80 E;  3CCR A;  4YTL A;  1BI0 A;  4PLI A;  3OQ5 A;  4BDY A;  2DZC A;  2EFI A;  4DQ2 A;  3G6E A;  1YIT A;  2EQK A;  2JTF A;  2K5L A;  1BKB A;  2K5I A;  3RMS A;  1WQW A;  1LOJ A;  3HRU A;  4M78 G;  2D9T A;  3FJP A;  3MO8 A;  1W2B A;  1M4Z A;  5CKH A;  5A2Q E;  1VQM T;  2KQW A;  4FU6 A;  3RKY A;  2E64 A;  4E47 A;  5GAN 4;  3QUI A;  3JCM Q;  3H6Z A;  1LJO A;  4BI4 A;  2QQS A;  1YJW A;  1N8R C;  1BI1 A;  2VC8 A;  4C92 F;  3G4S A;  4BE2 A;  2RHI A;  3OYM A;  1N9S A;  4C0D B;  5DLO A;  3J7A F;  5DM7 R;  4C92 G;  3CCR T;  1VQO T;  3JCM J;  1U1S A;  2RA2 A;  4F7U E;  2WAC A;  4JJN K;  1NPP A;  3CCE T;  4HT8 A;  3V8L A;  3KUF A;  4O5V A;  5FRO A;  4M75 C;  5GAM d;  1NE8 A;  2DIG A;  4XTZ A;  2FYK A;  3QYH B;  3CCS T;  3VU3 C;  5GAO p;  4A4F A;  5GAN f;  3L2V A;  3QXE B;  3SWN C;  3NTH A;  3TEE A;  3PIP A;  2ZPI B;  3HRT A;  4A53 A;  2RI3 A;  3OYG A;  1D3B A;  4M7D D;  2XID A;  3CCV A;  3HHT B;  3WVE B;  4F7U G;  2JNG A;  4IKF A;  2QQ9 A;  3PNW C;  4C8Q B;  4M7D B;  3I56 T;  4ZTJ A;  3WXM B;  2M16 A;  4RCC A;  4C92 D;  2QQA A;  4F7U A;  2CZ0 B;  2F69 A;  2K2V A;  3JSC A;  4MDW A;  1M9S A;  2F5T X;  2RB6 A;  3DB4 A;  4BE1 A;  3LYI A;  3LX7 A;  4Q5W A;  3JCM g;  2DXU A;  2L8D A;  3RES A;  4XAX B;  3X25 B;  3X24 B;  4M7A B;  1WJQ A;  3L2Z A;  4J8O A;  4BDZ A;  2RHZ A;  3MP6 A;  2L3R A;  5FU6 C;  4ELZ C;  2P0P A;  1S72 A;  4DOV A;  4C8Q F;  4A4G A;  3CC4 T;  2VYT A;  4FIB A;  2M0O A;  4C92 C;  1Q86 U;  2O4X B;  2KMT A;  4OB0 B;  5C0M A;  2V8K A;  3E1S A;  2E1H A;  4M7D C;  2BKD N;  5D6Y A;  4FT2 A;  5CQY A;  4QVC A;  2RM4 A;  3JB9 J;  4HT9 A;  4M77 G;  3M58 A;  2IVW A;  2DKG A;  4XU3 A;  2E6Z A;  1S72 T;  3DB3 A;  3NTI A;  2QA4 T;  2HAX A;  1UGQ B;  2H3J A;  3QII A;  5CKF A;  3LWI A;  4ZTF A;  4M7D A;  3MET A;  4MMK A;  4X34 A;  3SWN A;  5GAN 8;  2RJE A;  3V8K A;  5LJ3 f;  1UGR B;  3QBY A;  3M56 A;  1JB0 E;  2OTJ A;  2ZPF B;  2PUO B;  5GAO q;  4OVA A;  3FEO A;  3RER A;  4MZT A;  2VUB A;  1YJN T;  3CC2 T;  2MWO A;  3EAE A;  2E65 A;  3LW5 E;  4OB3 B;  4L59 A;  1KQS A;  1N9R A;  4F7U B;  1M8V A;  4IUT A;  4XTY A;  4E7L A;  3BW1 A;  1YJ9 A;  3SD4 A;  1KQS S;  3UT1 A;  2LC4 A;  2E5Q A;  3VUZ A;  2LVM A;  2Y90 A;  2O4X A;  4M7A A;  3QPH A;  2RJD A;  4PLL A;  4OB1 B;  2LT1 A;  4PJO G;  5A0L A;  3LGF A;  4C8Q A;  5KCO A;  3Q1J A;  3CCE A;  2C06 A;  5KCH A;  4XTW A;  4F7U F;  4R56 A;  4M7A C;  3N5B B;  2K5F A;  5GAM h;  3BY7 A;  1VQ6 T;  2KVQ G;  5CVI A;  5GAN 2;  3JCM P;  3CD6 T;  1X01 A;  3OMG A;  2X35 A;  3P8B B;  3CMA T;  1ZBX A;  4M75 A;  4M78 E;  3UWN A;  3LGL A;  1Q7Y U;  3FDR A;  4BY6 B;  5GAM e;  4KT0 E;  1AHJ B;  3C94 A;  3AHU A;  5FRM A;  2OAU A;  2WSE E;  3ASK A;  3GNG A;  4J6X A;  3JCM h;  2VV5 A;  5HKC A;  4M7D F;  1G3Y A;  2RD1 A;  5HK3 A;  1N8R U;  2LCC A;  3NFC A;  4IUV A;  4WF2 A;  4LD9 K;  3E9F A;  4X9C A;  2HNI A;  1G3S A;  3GOX A;  2EWN A;  5CKB A;  3V8J A;  3HSB A;  3PMT A;  2OTL A;  1H64 1;  2GQV A;  3FRN A;  3EFR A;  3V7S A;  3PFS A;  3UPU A;  4VUB A;  2NLU A;  1K8A C;  2RJF A;  3H8Z A;  4QQG A;  2R5A A;  2JN0 A;  3OA6 A;  2O01 E;  3HP9 A;  1Y07 A;  3MEV A;  1KQ1 A;  2XU8 A;  4ZGJ B;  3MCA B;  1Q82 U;  1UGP B;  5C6S A;  2DTI A;  2M9U A;  1O9S A;  4FM4 B;  4C92 E;  3I55 T;  1KHI A;  3OS2 A;  1VQ8 T;  4A4K A;  1YJW T;  1QVG S;  4M7D E;  2K3X A;  3SWN B;  5GAN 7;  2L5Q A;  5LJ5 f;  4RMO A;  4MZM A;  4HCC A;  4ZGE B;  5GMK h;  4JS5 A;  2R57 A;  5CR2 A;  3V7R A;  1VQL T;  4V2S A;  2YLC A;  3L2W A;  3L2Q A;  1X6O A;  5GAO m;  3G6E T;  1YIT T;  2D0Q B;  1G5V A;  2DD5 A;  2FVU A;  4JRP A;  1UGS B;  2DAQ A;  2R58 A;  2VXE A;  1FX7 A;  3M4Y A;  2LQK A;  1FWZ A;  1M1K C;  4M7A D;  3G71 A;  1ZQ1 A;  2G3R A;  2XDD A;  3OS0 A;  3E19 A;  3OYD A;  4IUU A;  3V7C A;  1KHC A;  2DXC A;  2GCX A;  3CCS A;  4B9X A;  3P8D A;  2DTO A;  4C92 B;  2ZGW A;  3VJP A;  3OYN A;  1HK9 A;  3CCU T;  2MI6 A;  2DEQ A;  4LDX A;  4C8Q D;  1Q86 C;  4CI0 C;  1O75 A;  1VQP A;  4XU2 A;  2P0Q A;  1N27 A;  1VQ4 T;  3SFM A;  1M1F A;  3M55 A;  1UEB A;  1P92 A;  4ATO A;  2X4J A;  1DJ7 B;  2K57 A;  1VQ5 T;  1VQ7 A;  1U1T A;  4JUV A;  2LRQ A;  1YCY A;  2XDP A;  3CCJ T;  1BYM A;  5CCA A;  3CCJ A;  2VGM A;  2ZPG B;  2CYZ B;  1IRE B;  3M54 A;  1D3B B;  4C8Q E;  1QP3 A;  3TCJ A;  1OZ2 A;  5GMK e;  1VQ8 A;  2KSS A;  5LJ3 h;  1R8O B;  4C5E A;  3JCM W;  4BI8 B;  3QYG B;  3OYJ A;  4M7A E;  1M1G A;  1VUB A;  3GLX A;  3M4G A;  5IAY A;  4LDW A;  3NTK A;  1RL2 A;  4RKU E;  5CKE A;  4LDY A;  4EPC A;  3BDL A;  2KDS A;  3OS5 A;  5LJ5 j;  1VQ4 A;  1M90 U;  3CCL T;  3PTA A;  2BUD A;  5J39 A;  1KD1 C;  3CCM A;  3RIR A;  2DIQ A;  3UDC A;  3A8H B;  1VQ9 T;  2RJC A;  1WNL A;  3CBO A;  2XIC A;  2RK1 A;  2YLB A;  1OZ3 A;  3X20 B;  2JTM A;  4N4I A;  2CS7 A;  3O8V A;  4XU1 A;  1BI3 A;  2DTH A;  4PNO A;  3VV0 A;  2E70 A;  3TRE A;  5LJ3 g;  1KQ2 A;  2LQ8 A;  4J7I A;  5GAN e;  4C92 A;  5LJ5 h;  5I2S A;  3OYK A;  1YHQ T;  1BI2 A;  3X28 B;  3LH0 A;  1YBY A;  4GY5 A;  2DD4 A;  3CBP A;  1YIJ A;  3CMA A;  1Q81 U;  1QVF A;  2D6F A;  3ZBD A;  4BD3 A;  4M78 B;  4M77 C;  1SSF A;  3QDR B;  4MDX A;  3JCM b;  2KY9 A;  1B34 A;  5HK0 A;  2EQU A;  4M7D G;  5LJ3 d;  2DXB A;  5GAN h;  3LWH A;  4DA4 A;  3JAM E;  4E7K A;  2CZ7 B;  3GNF B;  1XNI A;  4EMG A;  3CXC S;  5IT9 E;  3CEY A;  1Y96 B;  4BY6 C;  1W2B S;  1VIE A;  4ZN1 A;  2CZ6 B;  2IG0 A;  2V8J A;  1I8F A;  4RCB A;  4LDV A;  5GMK i;  2VGN A;  3JB9 D;  3ME9 A;  3JB9 I;  4E7I A;  4PJO C;  4M75 E;  5LJ5 g;  2MF2 A;  3CCQ T;  3M53 A;  1U8R A;  1WJS A;  3DLM A;  4M75 D;  1G3T A;  3OY9 A;  4C0G A;  4A4E A;  3URG A;  4KUL A;  1K73 C;  2LCL A;  5CAI A;  4XTU A;  4QQ6 A;  1YIJ T;  1UB4 A;  3MEA A;  2K4Y A;  1K8A U;  2OTJ T;  1K9M U;  5HY6 A;  4C5H A;  4O6J A;  2GFU A;  3M5A A;  3QSU A;  1YI2 A;  3DKM A;  5D6X A;  2VXF A;  3S3O A;  1TH7 A;  2QXF A;  1VQN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...