1MHNA

High resolution crystal structure of the smn tudor domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
LQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High Resolution X-ray and NMR Structures of the SMN Tudor Domain: conformational variation in the binding site for symmetrically dimethylated arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Survival motor neuron protein
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1mhnA00
2M1HA 2F5KA 2RI3A 3E9GA 4L59A 4IUUA 3UWNA 2XDPA 3S6WA 2B8AA 2QQRA 3OQ5A 3OYHA 5FRNA 4QQGA 2BIVA 2DAQA 2EQKA 2GF7A 2X4XA 2PQWA 1WGSA 3EAEA 2EQUA 5CIUA 1H3ZA 4BDYA 2D9TA 3L2UA 3S3MA 3H8ZA 4PL6A 4E7HA 3KUFA 3M9QA 2LDMA 3NTHA 4CRIA 2O4XA 1KHCA 3OA6A 3L2QA 3OYEA 2QQSA 4RG2A 3MEWA 3FLGA 3Q1JA 5D6XA 1MHNA 2EQJA 2HQEA 2RHYA 3GOXA 4IURA 3S3NA 2L89A 3L2VA 4FL6A 5M9OA 1WJSA 4BE1A 4BE0A 2K3XA 2GFAA 2M16A 1XNIA 2XK0A 3MEAA 2MWOA 4QW2A 4A4GA 5IAYA 2L3RA 2RJDA 3OS2A 3OYMA 3QBYA 3OYKA 4E7IA 1OZ3A 4IUQA 2YRVA 4B9XA 3LX7A 2RHUA 2DIGA 4Z02A 5C0MA 4A4HA 2O4XB 2LRQA 4QVZA 3OYIA 2JTFA 4X34A 4IKFA 3ME9A 3F70A 2P0KA 3O8VA 3PFSA 5C6SA 3SD4A 4FU6A 3OYBA 2R5MA 5KH6A 3OS1A 5FRMA 2R57A 4BD3A 2RI5A 2E5QA 4N4GA 4C5GA 2L8DA 4UC4A 4E7LA 2LVMA 2RHIA 4QQDA 2FHDA 4C5IA 3PNWC 4HCZA 3MEUA 2EFIA 1N27A 3LLRA 2IG0A 1OZ2A 1OI1A 3OS0A 3OYJA 2LCCA 2RJFA 3OYGA 3OYLA 3MP6A 4BDZA 2RI2A 3OYAA 2MWPA 3P8DA 4PLLA 2VYTA 3MO8A 2X4WA 2LTOA 3ZEHA 2R5AA 2RJCA 4EDUA 5KE2A 1OYXA 3QJ6A 4PLIA 5D6WA 2NLUA 2G3RA 4NS5A 3S3OA 1WJQA 1RI0A 2WACA 3NTIA 3OYNA 2RHZA 4E7KA 2JZ2A 2GFUA 4A4FA 4II1A 3H6ZA 3OMGA 5KE3A 4Q5WA 3LGLA 3META 3OB9A 4GY5A 4OVAA 4ZTFA 4BACA 4C5HA 3OMCA 4IUPA 5KCHA 4QQ6A 3LGFA 3DLMA 3MP8A 4E7JA 2DIQA 4N4HA 3OY9A 1SSFA 2K3YA 2EKOA 3DB4A 3DB3A 3FEOA 4IUTA 4B9WA 2BKDN 3OYCA 5J39A 3QKJA 4LD6A 5KCOA 3P8HA 3L2RA 3MP1A 4BE2A 2RJEA 3FDRA 3CEYA 3C4SA 3L2WA 2EQMA 2HQXA 4C5EA 3L42A 3E9FA 1G5VA 5IN1A 2RO0A 4IUVA 3PMTA 3FC3A 5D6YA 5FROA 4ZTJA 2BUDA 1WJRA 2M0OA 2R58A 3ASKA 3LYIA 3OYFA 3BDLA 3PMIA 3OYDA 2X4YA 2X35A 3QIIA 2RHXA 3MEVA 4A4EA 4N4IA 2E6NA 3LH0A 2CKKA 3NTKA 3UT1A 5J26A
chains in the Genus database with same CATH superfamily
2M02A 4TVRA 1UGVA 2VWFA 2KR3A 4IUUA 3JB9H 1X6GA 3MJXA 3OYHA 2DL5A 3CBOA 3LWIA 1KJWA 1N8RR 4ZGDB 2EQKA 5DM7R 1QCFA 2E65A 4J9EA 4PL6A 1MV0B 2RH2A 4PKCC 3KFVA 2ZPIB 3JRZA 3VRYA 3CCET 1D3BB 1YJWT 4IURA 4KT0E 3X28B 2GTJA 2JN0A 1WFWA 2K9GA 1QP3A 3CC7A 2LJ3A 2K57A 1UB4A 1M8MA 3MEAA 9ATCB 3EG9A 4HT9A 3CCUT 4B9XA 1WQ7A 4LN2A 4Z02A 3GNGA 4RKUE 5FU6C 3A8GB 4FU6A 5FRMA 2R57A 2RI5A 2KY9A 1KQ2A 4RTTA 3PNWC 2KMTA 3N5BB 2QGGA 5FW9A 3HHTB 1QWEA 2IG0A 2DXTA 1U1SA 2RI2A 3EFSA 3OYAA 1JO8A 1M2VB 1X2QA 1P92A 2HBPA 3GIBA 2KRMA 2DTIA 4F17A 1GCQA 3DLMA 3HTRA 1VQ8Q 2CT4A 2ED0A 1I81A 3EFRA 5GANj 3CCRT 2RD1A 2KXCA 2DZ9A 2XHCA 4LDXA 2ZPHB 2MAMA 2E12A 4XU2A 3EGDA 1XOVA 6AT1B 2M0OA 3ASKA 1G3SA 4KUIA 3JSCA 3CD6T 2C0OA 2KQWA 4ME7A 2ABLA 3QDRB 1BYMA 1SKUB 1RACB 2ZAEA 1FXXA 1HK9A 4C92A 2BZ8A 1I07A 4D8DA 1WI7A 1M27C 2L3QA 1X27A 4CC4B 2OAUA 1VQ5Q 1X43A 4KULA 4AG1C 4DQ2A 2HBWA 4B6MA 4EMKB 1AVZC 2QQSA 2D8JA 2PUKB 4RG2A 1R8OB 3A8OB 1C6VX 4MMLA 2HQEA 2RHYA 1H3HA 4FIBA 1Q86C 4BE1A 2NUPB 3VS7A 2M16A 3H41A 1Q81R 1VQOA 2HZYA 5CKDA 3ZFJA 2GGRA 3M0TA 5GANg 4A63B 3VYHB 2DL8A 2DE0X 2CZ6B 2LX9A 2DXCA 4J9BA 1Y57A 1LOJA 3SFMA 2JOYA 1PKTA 2YXYA 3CCSQ 1S72A 2YUOA 1BCMA 1M30A 1AWJA 2QEXA 1JQQA 4M77D 1VQ8T 4M75D 4OMQA 5IHIA 3CMET 2I2LA 4E7KA 4PNOA 1VQ7T 1VQLQ 3OMCA 1MMGA 4JJNK 4IIMA 1B07A 2ZPGB 3G71A 4F7UB 3RUXA 2LMJA 2D8HA 2E1HA 3QG1A 2CYZB 1V29B 4J7IA 3SDZA 2K6DA 1VQMQ 3G1JA 3QPHA 7AT1B 4OP0A 1Z9ZA 3RMSA 2YRCA 3CCRA 2RN8A 1N5ZA 2PU9B 2QI2A 1B7TA 5IHKA 2HNIA 2QQRA 4OF1A 1MGQA 1GRIA 3CPWP 4QQGA 3CCEQ 1MMDA 4M7AD 4M7AG 1Y96A 3L2UA 4VUBA 2DTHA 5L8RE 4C8QD 3R6NA 3GLXA 1MHNA 1KC8R 4HVVA 5GMKl 4C8QA 3EH2A 3A1PA 2DMOA 3EGDB 1OZ3A 1IB8A 1NYGA 3VJPA 1SSHA 4QVZA 2LRQA 4JRIA 1VYTA 3PFSA 3VV0A 5GAN8 3KXTA 2DYIA 3LLRA 4AFZC 1OI1A 3OYGA 2FB7A 3CCLQ 1BBZA 2LNVA 4PLIA 3BY7A 1D3BA 1NZ9A 2NYSA 3CMEA 5GAN4 2EYXA 1LCKA 4OVAA 3JCMc 4R56A 3JB9J 3ER0A 3EG9B 2O31A 2AKKA 4MDWA 4ELZC 1YHQT 3L2RA 1VQOT 4JJCA 2L2PA 2YHTA 4ZNXA 1S1NA 5HCKA 4WCIA 4YTLA 1A0NB 1K9MC 5GAMe 2COYA 3PMIA 3OYDA 1KQSA 1YITA 5LJ5j 5GMKi 4DA4A 4J9IA 2O01E 1VQ4Q 3HP9A 3M5AA 2LQNA 2CP2A 2K7AA 2P4TA 1PG5B 2A28A 1M2VA 5CVIA 5LJ3f 3HFNA 4OMMA 2XIDA 4FSXA 5CIUA 3S3MA 3H8ZA 1UUEA 1UGQB 5IHNA 4F7UA 4J9HA 1ZA1B 3A8HB 5AYFA 5HK0A 3BE3A 2GFAA 2RQVA 1T0HA 1YCSB 2CP3A 3LX7A 1D0ZA 5C0MA 1G83A 2RMOA 4X9DA 2DA9A 1VQ5T 2PVOB 1VUBA 4M77F 2MF2A 1NPRA 2QA4T 4FW2A 4M7DC 1X6BA 2QQAA 3G6ET 3OYJA 2RJFA 4EIKA 4BDZA 2DBKA 2FEIA 2WSFE 3CC4Q 5KE2A 3X24B 2FZGB 2WACA 1M3CA 3JCMf 1VYUA 2G6FX 3JCMP 5KYUA 1HJDA 2VV5A 3RMQA 4B9WA 1D1AA 1BCOA 5J39A 3X20B 3U23A 3TQ7P 2MMPA 2RM4A 2JVVA 2HL5C 1W2BP 2RA2A 1UG1A 4BY6C 2RNAA 3I56T 1VQ7Q 4ZN1A 1TH7A 2CUBA 1UFFA 3JCMQ 2KRNA 2X35A 2L3SA 1QKWA 4C92D 1I1JA 1U5SA 2QK0A 2CZ7B 2E6NA 3OSVA 4M78F 2M1HA 4L59A 2QQBA 2DL3A 4JRPA 1YJ9Q 2LT4A 2MK5A 2DPPB 4M77C 4RTXA 4BDYA 2D9TA 5FWBA 3CC2Q 2M9UA 4BB7A 3ULRB 2JM8A 2CP5A 3QSUA 3QHSA 2DBMA 3I56A 4FL6A 1M1KU 4Z89A 1YJWA 2XK0A 5DY9A 5FU7C 2JMCA 3A8MB 1FYNA 3G7ZA 3O8VA 2CGHA 3OS1A 2QYZA 2RF0A 3CCLT 4XTXA 5A0LA 4A53A 2H3JA 2CZ1B 2F5TX 5GANf 4JS5A 2DVEA 1MMNA 1FX7A 2A37A 3UA7A 3QUIA 1TUGB 4KGXB 1I5OB 4RTZA 2VXFA 3IQLA 4II1A 4PJOG 2GCXA 4ZTFA 3OY9A 1ABOA 2EKOA 5LL6S 4PJMA 2Y4XA 3MP1A 1K8AU 3UATA 3BW1A 4XTUA 1NLOC 3E9FA 1PSEA 3PMTA 1X6OA 2XI9A 2BUDA 1ACMB 2NUTA 3FRNA 1H92A 1FMKA 1JU5C 3UPUA 2GTOA 5GAOp 3I55Q 3PVLA 4XTWA 3TVTA 3JAME 2VASA 3V8JA 4AT1B 3QYHB 4V2SA 1WYXA 3CBPA 2X9HA 2BIVA 1WXUA 4MZTA 2LQWA 2HEQA 4FYXB 1E6GA 1JB0E 3LWHA 2YSQA 3X26B 4DBHA 3UA6A 2AHJB 5I11A 2O4XA 3OW2P 1PD0A 3SWNB 3NGPA 5CCAA 2DLPA 2EQJA 3GOXA 1PRMC 3JCMg 1KG1A 2EPDA 2HKNA 2ZZDA 3GBQA 3S3NA 1K9MR 3EG0A 2EJFA 2H3EB 2HMAA 4M7AE 1PRLC 4A4HA 2CP6A 1JEGA 1JJ2S 1ARKA 4J83A 3RBBB 4RTVA 4JUVA 3CMEQ 2RHIA 4J7FA 2H8HA 1K73U 2ECZA 1OX8A 4HCZA 1V76A 1ZBXA 2ZPBB 1JRIA 2FRWA 5I2MA 1M1KR 1RUWA 3P8BB 3MCAB 3FB9A 5LJ5h 2J6FA 4JRKA 2AKLA 4HKEA 4OGCA 2BTTA 4OMOA 2RPNA 3V7SA 5KYXB 4C92F 1IGUA 1BIAA 1VQ9Q 4M75F 2K2VA 3EG3A 1KQ1A 4M7DD 4DBFA 2FG0A 1NE8A 4N4HA 1YITQ 4MZPA 2BKDN 4MDXA 1GFDA 4E7SA 2KNBB 2QG9B 2ESWA 3A5ZB 3CCQA 2LCSA 4XQ3A 3JCMb 3RNJA 4D6WA 1WPYA 2WSEE 4XTVA 1RAGB 1WIEA 4FCYA 4J9GA 2SEMA 4XAXB 1RADB 3QIIA 3MPUB 5GANd 3CC4T 3MEVA 1R77A 2YUPA 2FRYA 3VU3C 1ZSZB 1YCYA 2RI3A 4C8QG 2XDPA 1G3TA 4GLMA 4JRQA 1ZBJA 1UECA 2K5IA 1NPPA 2D1XA 1YITT 2PQWA 2EQUA 4HA8A 1BI1A 2RQUA 2YLBA 3M9QA 2HD0A 1N9SA 3FLGA 1H641 3TREA 4PJOC 1KSWA 3C95A 4C8QF 1WJSA 1XJWB 3QJYA 2VC8A 2W0ZA 1IGQA 2RJDA 3M4YA 3OYMA 4E7IA 1YIJA 3PVQA 1NBEB 4F7UE 2OTJA 4KBMB 2HAXA 1KIKA 3H9NA 4IKFA 4JZ4A 4MZMA 4QQDA 3OW2S 2ZGWA 4M7AA 1BI2A 2HKQB 3H0FA 4FT4A 1OZ2A 1WLPB 2CSQA 2Y4YA 3WVDB 3EFOB 1VQ8A 1NJIC 2EKHA 2VYTA 2LJ1A 2F2WA 2E64A 2R5AA 2VGMA 1N6AA 1M90U 2V8KA 1MNEA 5KE3A 1SHGA 2DTOA 2EWNA 4PFPA 5LJ5e 2MCNA 3FEOA 3CCVT 4GLKA 2VXEA 4LD6A 1VQPA 1YP5A 1UHFA 4OMNA 3VS0A 4C5EA 5ECAA 5GANh 2K79A 3FC3A 2LJ0A 4ZTJA 2FVUA 3LYIA 4OMPA 4JLGA 1AT1B 3I5RA 4J5YA 2JT4A 3CMAQ 4M78B 3A98A 1WXBA 2NWMA 1G3WA 1ZLMA 4N4IA 5GMKj 4M75A 1UGRB 2AZSA 1R0BG 1WHMA 2F5KA 4M75B 5IH2A 1PWTA 1K9AA 3QWYA 3J7AF 3I35A 4N0AC 3SB2A 1IHVA 3VS4A 5GAMf 2CSIA 2QDYB 1OEBA 1H3ZA 4CC7A 2JJ9A 3CPFA 1WHKA 3CCJA 4M78E 4CRIA 2YDLA 5L23A 1TSFA 1U3OA 1I5LA 2I0NA 3CCQT 4OGEA 3H0HA 1NJIU 3EGXB 2MYSA 3NHNA 1K73R 1GXIE 4A4GA 3INZA 4QW2A 5IAYA 1GBQA 2NUTB 1SHFA 4LDWA 2YRVA 3URGA 2QEXQ 2EIFA 2K2MA 3CBMA 3ME9A 3CXCS 5GAN7 4QVCA 3OYBA 3M0UA 3M4GA 1M8VA 1KC8U 4C5IA 3PIOA 1MUZA 2X3XD 3G6EQ 5CAIA 3TU4K 1JXOA 3OYLA 4M7DB 1WQWA 4PJOB 3G71Q 1IO6A 5GMKe 3CCJT 4NS5A 1YN8A 3WVEB 1O75A 3GPLA 4M7AC 1KK7A 1SRLA 2KXDA 1K0XA 2DNUA 4IUPA 2YRDA 2P0QA 4QQ6A 3HRSA 2RK1A 2DIQA 5DLOA 1IHWA 4IUTA 3QKJA 3P8HA 2OTLQ 5GJWB 3VS1A 3L2WA 2EBPA 2VVKA 1KHIA 2HQXA 3CCRQ 3L42A 4JS4A 4E6RA 3OYFA 2KI7A 4PJOE 1VQ6Q 4NL3A 2QAZA 2DYBA 3M0QA 2XG8D 1T0JA 3NTKA 4RCBA 3UT1A 5J26A 1RABB 1NEBA 4IIOA 3UWNA 4MMKA 2DM1A 2JM9A 2EQIA 4J9FA 4F7UF 2FPEA 1LPLA 2IIMA 3RKWA 1M1GA 1OU8A 4KGZB 1WHLA 3CCUA 4EMKC 1XTDA 2AK5A 5GAN3 1RAHB 1VQKA 5GAMj 3VS6A 1VYVA 4M78D 2L3RA 4JPBW 4E2FB 2OX7A 1RL2A 2EGCA 1D0XA 1ZA2B 1E7OA 1X2KA 1G2BA 1XQHA 2RQTA 5C6SA 1ZSZA 3J80E 3CCLA 4HCBA 2DEQA 2CT3A 2V1RA 4C0FA 4DBQA 4UC4A 2CZ0B 5CQXA 4EMHA 2EGAA 4OB2B 4E47A 1W70A 3MEUA 3RESA 3NPFA 1VA7A 1ZSGA 4LDVA 2LCCA 1QCOA 1QLYA 2V8IA 5GAN2 3ZEHA 3MHXA 3ZL7C 2J6KA 2RHZA 1N9RA 2A08A 5GAOl 3H6ZA 5I21A 1N8RC 1R0CB 2JTEA 3QZ5B 4RTWA 3LGFA 1LJOA 1E6HA 1C0MA 2AZVA 4RCCA 1QWFA 2ENMA 2E6ZA 4DOVA 8AT1B 5KCOA 3JB9I 1W2BA 3UF4A 3FDRA 3QXEB 4IUVA 1K73C 1VQ6T 3SEMA 2BZXA 1VQ4T 2HQHA 4BY6B 4FW1A 2X4YA 4DBRA 3M0RA 1I8FA 1VIEA 1QKXA 2OTLT 4KUDK 5LJ5d 4PJOA 2E3IA 2CP0A 1YJNT 1QMCA 5LJ5g 2DAQA 4HVUA 3J81E 3JCMJ 4ELYC 3CD6A 3EGUA 4RMOA 1Q82C 1SEMA 2E41A 2LX7A 4FYWB 1KHCA 3V8KA 3MEWA 1BI0A 4M77E 5CR2A 1WHJA 1M3AA 2XMFA 3HKSA 2CH4A 1NG2A 1GFCA 2JUFA 4C8QE 1XNIA 4BUGA 3SHWA 3QBYA 4DEXA 1OPLA 3GF5A 2LC4A 1VQNA 2PVDB 2GQVA 5HY6A 2Z0WA 4F14A 4C0ZA 5LJ5f 3CC2A 2CH4W 4JDSA 1SF9A 2E5QA 5GANe 1WHGA 2KYBA 4PK4A 2KK4A 2EAYA 2GNCA 2DL4A 1GBRA 3E2UA 5KYXA 4J8OA 2QA4A 3DLLA 3MP6A 1EZZB 4C8QB 2LTOA 2PUOB 5EG2A 1OYXA 2BZYA 1VQPQ 2JS0A 3OYNA 2W10A 4Q5WA 4GY5A 2RQRA 1EX4A 2C06A 4C5HA 4E7JA 1Q7YR 1D1BA 2LT1A 2M0YA 1H8KA 3CCSA 2KT8A 4FM4B 3CCEA 2BE7D 1ZUYA 2P4RA 4XTYA 1PD1A 3JB9D 5IN1A 1Q86R 1CKBA 5GAMd 4AMCA 1RI9A 3CMAT 5A0DA 5CKEA 1OV3A 3OBYA 2BE9B 4LD9K 2RHXA 3G4SQ 2E70A 1VQLA 2CKKA 3BDUA 1KD1C 1TOVA 1OQKA 4C8QC 2J06A 4JLIA 1YJNQ 3C0CA 3PGGA 2EVRA 3S6WA 2K5FA 3JV3A 1Q82U 3FIFA 3EG2A 4HCCA 1WGSA 1YJWQ 1QVFA 4C0GA 2QQ9A 4BI8B 1OULA 3KUFA 1TUDA 1LVKA 2JTMA 3TSWA 4OMLA 5D7UA 1AEYA 3O5ZA 3CC2T 5D6XA 2P84A 4BI3A 3JCMd 1EFNA 4C0DC 4WF2A 3PE0A 5M9OA 3RR6A 2DXBA 3G6EA 3CCST 3OW2A 1YWPA 3JCMV 2B86A 3EHRA 4ESRA 1QVGP 3FJ5A 1UTIA 1WX6A 2D6FA 3M0PA 3HSBA 2KGTA 2F2VA 3ZBDA 3X25B 2QTVA 3M59A 4OB1B 5GAOn 2SRCA 2QDLA 2KE9A 2RJCA 5IT9E 3QJ6A 3VRZA 2OTLA 2VB6A 4GBQA 4AFSC 4ATOA 2GFUA 4ANJA 3AT1B 5LJ3e 5KCHA 1T3SA 1Q7YC 1I0CA 1Q82R 1HXDA 2LQKA 2EYWA 3R6OA 2MIOA 2RJEA 1KQSS 1BKBA 1T3LA 4EMKA 3I55T 2QTXA 2COWA 3D7SB 1B34A 1Y7XA 5KYNA 1AWOA 1Y71A 4CI0C 1EIFA 1B34B 5GAMh 2NUPA 2OTJT 4WTOB 2XKOC 1D0YA 3EH1A 3CCMT 3VS5A 3LH0A 1VQPT 4M7DE 1K4US 2DL7A 3CCVA 2EYQA 1F1BB 1YWOA 2EJGA 2ROLA 3CCQQ 2DK3A 5FWCA 5KYWB 4F7UG 1YI2A 1K8AR 1VQKQ 2GF7A 4K11A 4PJNA 1QVGA 2AT1B 3E1SA 5KYYA 4Y28E 2ED1A 3EGXA 1VQNT 4E7HA 5CKFA 3A8LB 2LQ8A 4M75G 1KC8C 1QVFS 1WA7A 2PTKA 5CKHA 2DJZA 1RLPC 4M77A 4RUGA 3L2VA 4AFQC 3MKDA 3V7CA 1M9SA 2MWOA 3OYKA 1VQ5A 1JJ2A 1QP2A 1X69A 2COZA 2FZCB 4IUQA 2LP5A 2KEAA 3OYIA 1UHCA 1QVFP 2QGFB 5GAN6 4BD3A 1Y07A 2XU8A 1HSQA 2J7IA 1K9MU 2HSEB 4X9CA 4PFOA 1TWBA 3QDFA 1BU1A 2CP7A 4Y92A 1VQOQ 1M4ZA 3OS0A 1YHQQ 2OI3A 1AWWA 4BI4A 2KAFA 3M0SA 4LDUA 3G4ST 2EYZA 3OS2A 1VQ7A 1FMVA 2ATCB 2DJQA 2AIRB 3HRUA 3M56A 3VS2A 3OMGA 1ZQ1A 2MPXC 1M2OA 2E4HA 1TS9A 2OAWA 2QEXT 3DB4A 3OS5A 2A3LA 3PIPA 1QW1A 2FO0A 3NMZC 1IXDA 2KDSA 4KH0B 2DETA 1KQSP 1G5VA 1YFNA 5FROA 5A2QE 4M78C 2FZKB 4M78G 4PJOD 4A4KA 2GQIA 4D8KA 4PJJA 2YUNA 3OYYA 1RAEB 2MI6A 1M90C 2HCKA 4M75C 4XU0A 1VQMA 2NUZA 3CCMQ 3CC7T 1X75C 5CO7A 1Q81C 3JB9F 3L2ZA 1M1FA 1NLPC 2J05A 3L2QA 2YLCA 5GAOq 2DEUA 3Q1JA 3V8LA 1U8RA 2CUDA 2V1QA 4LE9A 4O6JA 3WXMB 2DILA 4PFZA 2JMAA 1KD1U 2EYYA 4FYYB 2X51A 3RKXA 2QA4Q 4M7AF 1RAIB 2O4XB 3JCMh 1N8RU 1TXQA 4J6XA 3SWNA 2P0KA 3REAB 3OBWA 1GL5A 3VUZA 1WDXA 2FYKA 1YI2T 2XDBA 1TU0B 1VQMT 3VYGA 3I9QA 2L8DA 4M77G 2LVMA 2DX1A 3QYGB 1N27A 3QZ9B 2VKNA 1NEGA 1RAAB 2A0FB 4AG2C 2QASA 2X4WA 4PJLA 1MMAA 2NLUA 2HDAA 1U06A 2JZ2A 2EGEA 4J9DA 4C92G 3LGLA 2WSCE 2JXBA 3OB9A 1KFZA 3JCMe 3CQTA 5I2SA 1AZEA 1M5Q1 4RG8A 5FRNA 2K3YA 1UJ0A 2DKGA 3OYCA 2DVJA 4JJBA 1IREB 1GCPA 3NFCA 2F69A 4BE2A 1ABQA 3C4SA 4J6YA 2MOXA 4QKUA 4LUEA 1G8XA 1UEBA 4M4ZA 3V7RA 1QVGS 5D6YA 1YNZA 3M58A 4HT8A 3BDLA 2Y90A 2QXFA 1SG5A 2YT6A 5IXFA 3LH5A 5FLXE 2YUQA 1NYFA 2X3WD 2DRKA 4NOYA 1ZSZC 2DZCA 3OQ5A 4RTYA 4XU3A 2ZCFB 2JW4A 5DLQE 2IPOB 3EAEA 3HL8A 4HCKA 5AT1B 4QVDA 1VQ4A 5HK3A 1W6XA 2PZ1A 3NTHA 2O2OA 3OA6A 2GBQA 4N0AA 2O9SA 3HPWA 2FPFA 4HVWA 4ZN3A 2KBTA 4CC2A 1Y96B 5FU7B 3I55A 3CXCA 4M78A 1ZX6A 1ZHIA 5CK9A 5KYUB 3HRTA 2LZ6B 2RHUA 4X34A 1J3TA 2IVWA 3C12A 1B3QA 2FL7A 1Z9QA 2OJ2A 1VQ9A 1BB9A 1IZ6A 2VUBA 4N4GA 3CPWA 3CC7Q 2V8JA 4E7LA 5KYWA 2FHDA 3VUBA 3QWXX 4J9CA 4R0KA 1PCXA 5J3BA 1G3YA 4EPCA 3GP8A 2MWPA 3P8DA 1NM7A 1WJQA 4PJOF 8ATCB 1K76A 5LJ3j 2P0PA 3META 2DFUA 4M7AB 2DF6A 3JB9G 3MP8A 1RLQC 3DB3A 5HKCA 1SRMA 3H0IA 4JZ3A 2EW3A 1M3BA 3TCJA 2K5LA 1AWXA 1AZGB 1VIFA 4C0DB 2EQMA 2KT1A 3CCVQ 4Y91A 4ZGJB 4KRTA 3EFOA 2RO0A 1BK2A 1K8AC 1WJRA 4A54A 3EHQA 1OOTA 1YI2Q 1DJ7B 2E3HA 3M53A 1RAFB 1PNJA 4A4EA 4OMFB 1NJIR 2JS2A 2F2XA 4CC3A 2C0IA 4M7DF 3REBB 4JJDA 1QCNA 2X4JA 3CCUQ 3E9GA 2V26A 3M57A 4OB3B 5GAOr 4DOWA 4LNPA 2CREA 2X4XA 2ROTA 1S72T 3EG1A 1Y0MA 2FPDA 1UGSB 2K3BA 2RK2A 3JCMX 1OPKA 2DXUA 1VQLT 2PVGB 4L5GA 2LDMA 2O9VA 2XDDA 1OU9A 5GAOm 1YIJT 4LXCA 4LUDA 1K1ZA 2D0QB 2DO3A 5GMKh 1YJ9T 4M7DG 4C92C 2KRSA 2M51A 2L89A 2VGNA 5GMKm 4BE0A 2K3XA 3DKMA 3CC4A 1WZOA 4Z8AA 2KSSA 2DIGA 2KYMA 1YHQA 2JTFA 2L0AA 4KH1B 3F70A 3I5SA 2PNIA 1PM3A 2R5MA 3I56Q 4FYVB 5GAMg 1M90R 2A7YA 4RTUA 4C5GA 2KROA 2LNHB 1BIBA 4EMGA 5IXBA 2EFIA 1HYOA 1MV3A 1V1CA 1W2BS 3RDVA 1VOMA 1WXTA 4XK8E 1Q81U 1GCQC 1UGPB 3MO8A 2DRMA 1YIJQ 2ZPFB 5D6WA 2EJ9A 3S3OA 2DD5A 2J6OA 2OTJQ 1BI3A 1RI0A 3PTAA 3NTIA 3CMAA 3E19A 1UDLA 4FSSA 2XD0A 5EC7A 1S72Q 5I22A 5CKBA 1PKSA 3VS3A 3RKYA 4Z88A 1PC0A 1SSFA 1ZUKA 2LCLA 4XU1A 5CQYA 4KGVB 2F1LA 4F04B 1YJ9A 1CSKA 1AD5A 4M7DA 1PHTA 2C0TA 1JBMA 1W1FA 3CCMA 5A0GA 1K0SA 1TG0A 1W4SA 2ZPEB 3L1AA 3CD6Q 1KD1R 2DERA 1PSFA 5KYYB 2B8AA 1O9SA 2KVQG 1Q86U 1UJYA 1Q95G 3RERA 2A36A 3CPWS 1ZUUA 3BFMA 4ZGEB 5LJ3h 4M77B 1M1KC 3VKIA 3HFOA 3T9NA 2YWWA 4O5VA 1VQNQ 3OYEA 1UE9A 4X1VA 3TEEA 2CDTA 2DD4A 1VQKT 3FJPA 1YJNA 2RB6A 2L5QA 1D09B 5GAN5 4HXJA 1JXMA 3CXCP 4XTZA 3AHUA 3SD4A 1QQJA 1IRXA 5KH6A 1JJ2P 3OSSC 3CCJQ 2E5KA 5LJ3d 3UDCA 3M55A 5LJ3g 4L6V5 1SPKA 4AFUC 4QT7A 1X01A 1WNLA 3QO3A 3G71T 4LDYA 2HL3A 2XICA 3M54A 4PLLA 4C92B 1AOJA 2RQWA 1TUCA 2HSPA 4E7ZA 4EDUA 3C94A 4P5NA 2G3RA 3TSZA 4A4FA 1VQ6A 3GNFB 1TTHB 4J6WA 4BACA 3LW5E 1C1AA 1LNXA 4R55A 4DEYA 2L3PA 3JCMW 2D0NA 3G4SA 2E10A 1WHHA 1OX9A 1FMWA 1MNDA 5GJVB 3CEYA 4NL2A 1AHJB 1U1TA 1D1CA 1VQ9T 3THKA 4FT2A 3SWNC 4ORZA 1YBYA 2R58A 1FWZA 4OB0B 1CKAA 2K4YA 4C92E 3RIRA 2JNGA 3PT9A 4F16A 1HD3A 2CS7A 1QVPA 1Q7YU 4M75E 5FU6B 1I4K1 2O88A 3KBGA
chains in the Genus database with same CATH topology
2MI6A 2M1HA 4L59A 4TVRA 1M90C 4IUUA 3UWNA 3JB9H 4MMKA 2QQBA 3OYHA 4JRPA 4M75C 4F7UF 3CBOA 4XU0A 1VQMA 3LWIA 2LT4A 4ZGDB 3CC7T 2EQKA 2DPPB 1X75C 4M77C 5CO7A 4BDYA 1Q81C 5DM7R 2E65A 2D9TA 1M1GA 3RKWA 3L2ZA 1M1FA 2M9UA 4BB7A 3JB9F 4PL6A 2RH2A 4PKCC 3L2QA 2ZPIB 2YLCA 3JRZA 5GAOq 3CCUA 3Q1JA 3V8LA 4EMKC 1D3BB 3QHSA 3CCET 4HCBA 1U8RA 3QSUA 1XTDA 1YJWT 4IURA 4KT0E 3X28B 3I56A 2JN0A 4O6JA 5GAN3 1VQKA 4FL6A 5GAMj 1QP3A 3CC7A 1M1KU 3WXMB 4M78D 2K57A 1UB4A 1YJWA 2XK0A 3MEAA 1KD1U 5DY9A 2L3RA 4HT9A 5FU7C 3A8MB 3CCUT 4B9XA 1WQ7A 1RL2A 3RKXA 4Z02A 3GNGA 4M7AF 2O4XB 3JCMh 1N8RU 3G7ZA 4RKUE 4J6XA 1XQHA 2P0KA 3O8VA 5FU6C 3A8GB 2CGHA 3OBWA 3SWNA 5C6SA 3J80E 3CCLA 4FU6A 3VUZA 2DEQA 5FRMA 3OS1A 4C0FA 2R57A 2RI5A 2FYKA 2KY9A 1YI2T 1VQMT 2XDBA 3VYGA 4M77G 2L8DA 4UC4A 3CCLT 1KQ2A 2LVMA 2CZ0B 4XTXA 5A0LA 5CQXA 4A53A 2H3JA 4EMHA 4OB2B 2CZ1B 3PNWC 2KMTA 4E47A 3MEUA 2F5TX 3QYGB 3N5BB 3RESA 3HHTB 1N27A 5GANf 2IG0A 4LDVA 2DXTA 2LCCA 4JS5A 2DVEA 3QZ9B 1U1SA 2RI2A 3EFSA 1FX7A 2V8IA 3OYAA 5GAN2 2X4WA 3ZEHA 3QUIA 3MHXA 2NLUA 1P92A 2RHZA 1N9RA 2JZ2A 2VXFA 5GAOl 4II1A 3H6ZA 2HBPA 4PJOG 4C92G 2GCXA 3LGLA 2WSCE 3OB9A 5I21A 3GIBA 1N8RC 3JCMe 4ZTFA 3QZ5B 2DTIA 5I2SA 3LGFA 3DLMA 1LJOA 1M5Q1 4RG8A 4RCCA 3OY9A 5FRNA 1I81A 2K3YA 2DKGA 2EKOA 3EFRA 5LL6S 5GANj 3CCRT 3OYCA 2RD1A 4DOVA 2E6ZA 1IREB 5KCOA 3JB9I 1W2BA 2Y4XA 3MP1A 2F69A 3NFCA 4BE2A 1K8AU 3BW1A 3CC2A 3FDRA 3C4SA 2DZ9A 3QXEB 2XHCA 4J6YA 4XTUA 4LDXA 2ZPHB 2MAMA 2E12A 1UEBA 1PSEA 3E9FA 4XU2A 4IUVA 3V7RA 1QVGS 1K73C 1XOVA 1X6OA 3PMTA 2XI9A 5D6YA 1VQ6T 2BUDA 2M0OA 3ASKA 1G3SA 4KUIA 1VQ4T 3JSCA 4BY6B 3CD6T 3M58A 4HT8A 3BDLA 2KQWA 2Y90A 3FRNA 2QXFA 2X4YA 4ME7A 3QDRB 1BYMA 3UPUA 5FLXE 1I8FA 5GAOp 1FXXA 1HK9A 1VIEA 4XTWA 2OTLT 4KUDK 5LJ5d 4C92A 3JAME 4PJOA 4NOYA 2DZCA 3V8JA 3QYHB 3OQ5A 4V2SA 1YJNT 4XU3A 2ZCFB 3CBPA 5LJ5g 2BIVA 2DAQA 3J81E 5DLQE 3JCMJ 3EAEA 4MZTA 3HL8A 4ELYC 3CD6A 4QVDA 4RMOA 1VQ4A 1JB0E 5HK3A 2OAUA 3LWHA 1Q82C 3X26B 2E41A 4KULA 4DQ2A 2AHJB 3NTHA 4EMKB 2O4XA 3V8KA 1KHCA 3OA6A 2QQSA 2PUKB 3MEWA 4RG2A 1BI0A 1R8OB 3A8OB 4M77E 4N0AA 3SWNB 5CCAA 4MMLA 5CR2A 2EQJA 2HQEA 2RHYA 3HPWA 3GOXA 3JCMg 4FIBA 4ZN3A 1Q86C 2ZZDA 3HKSA 3S3NA 1KG1A 1Y96B 5FU7B 3I55A 3CXCA 4M78A 4BE1A 2JUFA 4C8QE 2M16A 1XNIA 4BUGA 1ZHIA 3QBYA 2EJFA 5CK9A 3GF5A 3HRTA 1VQOA 2LC4A 2RHUA 4M7AE 5CKDA 3ZFJA 4A4HA 5GANg 1VQNA 3VYHB 2PVDB 4X34A 1JJ2S 4J83A 2IVWA 3C12A 2GQVA 2CZ6B 2FL7A 2DXCA 2LX9A 5HY6A 4C0ZA 5LJ5f 1VQ9A 1IZ6A 2VUBA 4JUVA 4JDSA 2E5QA 4N4GA 3CPWA 2V8JA 4E7LA 2RHIA 4J7FA 5GANe 2FHDA 2KK4A 1LOJA 3VUBA 4HCZA 2JOYA 3SFMA 1ZBXA 1K73U 1S72A 2EAYA 2ZPBB 1JRIA 5J3BA 1G3YA 5I2MA 4EPCA 4J8OA 2QA4A 2QEXA 3DLLA 3MP6A 3GP8A 3P8BB 4M77D 1VQ8T 2MWPA 3MCAB 3P8DA 3FB9A 4C8QB 5LJ5h 4JRKA 2LTOA 2PUOB 4M78F 5EG2A 1OYXA 4M75D 4HKEA 4OGCA 1WJQA 3CMET 2I2LA 3V7SA 3OYNA 4E7KA 4PJOF 4PNOA 4C92F 5LJ3j 1VQ7T 2P0PA 3META 4GY5A 4Q5WA 1BIAA 4M7AB 2C06A 4C5HA 3OMCA 4M75F 2K2VA 3JB9G 1KQ1A 3MP8A 4JJNK 4E7JA 4M7DD 1NE8A 4N4HA 2ZPGB 2LT1A 3DB3A 4MZPA 5HKCA 2BKDN 3G71A 4MDXA 4F7UB 3RUXA 3CCSA 3TCJA 2K5LA 3A5ZB 3CCQA 4FM4B 1VIFA 2E1HA 4XQ3A 3QG1A 2EQMA 4C0DB 3JCMb 3CCEA 4D6WA 2CYZB 1WPYA 4XTYA 2WSEE 1V29B 4XTVA 4Y91A 4ZGJB 5IN1A 2RO0A 4J7IA 3SDZA 5GAMd 3JB9D 1K8AC 1WJRA 4A54A 3CMAT 5A0DA 1DJ7B 5CKEA 4XAXB 3OBYA 3M53A 3QIIA 3QPHA 5GANd 4LD9K 3CC4T 2RHXA 3MEVA 2E70A 4OMFB 4A4EA 1VQLA 4OP0A 3RMSA 2CKKA 3BDUA 1KD1C 3VU3C 4C8QC 4M7DF 3CCRA 1YCYA 2RI3A 2X4JA 3E9GA 4JLIA 3PGGA 2PU9B 4C8QG 2QI2A 2XDPA 3M57A 3S6WA 1G3TA 2K5FA 4OB3B 5GAOr 2HNIA 2QQRA 1Q82U 4JRQA 4OF1A 2K5IA 1MGQA 1NPPA 4DOWA 3FIFA 4QQGA 4M7AD 2X4XA 1YITT 4M7AG 2PQWA 1S72T 1WGSA 4HCCA 2EQUA 1QVFA 1UGSB 4C0GA 4HA8A 1Y96A 2RK2A 3JCMX 3L2UA 2QQ9A 4VUBA 4BI8B 2DXUA 1BI1A 1VQLT 2YLBA 2PVGB 3KUFA 3M9QA 2JTMA 2DTHA 2HD0A 2LDMA 4L5GA 5L8RE 4C8QD 2XDDA 5GAOm 1N9SA 1YIJT 3FLGA 1H641 3CC2T 3GLXA 5D6XA 4BI3A 3JCMd 1MHNA 3TREA 2D0QB 2DO3A 5GMKh 1YJ9T 4M7DG 4C0DC 5J26A 4C92C 4PJOC 4WF2A 3C95A 5GMKl 2L89A 2VGNA 4C8QA 4C8QF 5M9OA 1WJSA 3QJYA 2VC8A 5GMKm 4BE0A 2K3XA 3DKMA 2RJDA 4E7IA 3M4YA 2DXBA 3OYMA 3CC4A 1YIJA 1OZ3A 3G6EA 4F7UE 3VJPA 3CCST 2OTJA 2KSSA 3OW2A 2DIGA 1YHQA 4KBMB 2LRQA 4JRIA 4QVZA 2HAXA 2JTFA 3JCMV 4IKFA 3F70A 3PFSA 2R5MA 4MZMA 5GAMg 2A7YA 4C5GA 2D6FA 4QQDA 3VV0A 5GAN8 3OW2S 2ZGWA 3HSBA 4M7AA 1BI2A 1BIBA 4EMGA 2EFIA 3ZBDA 4FT4A 3KXTA 3LLRA 1OZ2A 1OI1A 3X25B 3M59A 4XK8E 2Y4YA 1W2BS 4OB1B 3OYGA 1Q81U 3WVDB 1VQ8A 1NJIC 1UGPB 5GAOn 2VYTA 3MO8A 2FB7A 2LNVA 2R5AA 2E64A 2RJCA 5IT9E 2ZPFB 3QJ6A 2EJ9A 3BY7A 4PLIA 5D6WA 1D3BA 2DD5A 3S3OA 2VGMA 2OTLA 1BI3A 1RI0A 3PTAA 1N6AA 1NZ9A 3NTIA 3CMAA 3CMEA 1M90U 5GAN4 2V8KA 2GFUA 4ATOA 3E19A 5KE3A 4OVAA 3JCMc 5LJ3e 4R56A 2XD0A 5CKBA 3JB9J 3ER0A 5KCHA 2DTOA 1Q7YC 4MDWA 3RKYA 1HXDA 2EWNA 5LJ5e 2LCLA 1SSFA 2LQKA 3FEOA 4XU1A 5CQYA 4ELZC 1YHQT 3CCVT 4GLKA 3R6OA 2VXEA 4LD6A 3L2RA 1VQOT 1YJ9A 2RJEA 1VQPA 1KQSS 1BKBA 2YHTA 4EMKA 4C5EA 3I55T 2QTXA 5GANh 4M7DA 1B34A 3FC3A 4YTLA 2FVUA 4ZTJA 3LYIA 1JBMA 1K9MC 4JLGA 1Y7XA 5GAMe 1Y71A 4J5YA 3CCMA 5A0GA 3PMIA 3OYDA 4CI0C 1KQSA 1EIFA 1B34B 1W4SA 4M78B 2ZPEB 3L1AA 5LJ5j 5GAMh 5GMKi 1YITA 2XKOC 4DA4A 2OTJT 2O01E 1G3WA 3HP9A 3CCMT 3M5AA 4N4IA 5GMKj 4M75A 1UGRB 3LH0A 1VQPT 2P4TA 4M7DE 5CVIA 2EYQA 5LJ3f 3CCVA 2F5KA 1PSFA 4M75B 3J7AF 3HFNA 4N0AC 2B8AA 1O9SA 2EJGA 2KVQG 3SB2A 1Q86U 5GAMf 3RERA 2DK3A 1YI2A 4F7UG 2XIDA 4FSXA 2GF7A 2QDYB 1QVGA 5CIUA 1H3ZA 3CPWS 4ZGEB 3BFMA 3E1SA 5LJ3h 4Y28E 3S3MA 3H8ZA 4M77B 1M1KC 3CPFA 3VKIA 1VQNT 3HFOA 5CKFA 3T9NA 3A8LB 4E7HA 2LQ8A 1UGQB 4M78E 4CRIA 3CCJA 4O5VA 3OYEA 4F7UA 4M75G 1KC8C 1QVFS 3UT1A 1I5LA 3TEEA 5CKHA 3CCQT 3A8HB 2DD4A 5AYFA 2DJZA 4OGEA 5HK0A 4M77A 1NJIU 1VQKT 3L2VA 3FJPA 3V7CA 1M9SA 1YJNA 2GFAA 4A4GA 3INZA 4QW2A 5IAYA 2MWOA 1GXIE 2RB6A 3OYKA 2L5QA 1VQ5A 4LDWA 5GAN5 1JJ2A 1QP2A 4IUQA 2YRVA 3URGA 3LX7A 5C0MA 3OYIA 2EIFA 4XTZA 3CBMA 3ME9A 4X9DA 3CXCS 5GAN7 3AHUA 3SD4A 4QVCA 3OYBA 5KH6A 3M4GA 5GAN6 4BD3A 1Y07A 2XU8A 3OSSC 1KC8U 1VQ5T 1M8VA 1K9MU 2PVOB 1VUBA 5LJ3d 4M77F 4X9CA 3UDCA 2MF2A 3M55A 1NPRA 2QA4T 4C5IA 5LJ3g 4L6V5 3PIOA 4M7DC 1X01A 1WNLA 2QQAA 3QO3A 3G71T 4LDYA 5CAIA 3TU4K 1M4ZA 3OS0A 3OYJA 3G6ET 2RJFA 3OYLA 4BDZA 4M7DB 2XICA 3M54A 4BI4A 1WQWA 2KAFA 4PLLA 4C92B 4PJOB 4LDUA 5GMKe 2WSFE 3G4ST 3OS2A 4EDUA 5KE2A 3CCJT 3C94A 3X24B 4P5NA 1VQ7A 2G3RA 4NS5A 3WVEB 2WACA 1O75A 3GPLA 4M7AC 3JCMf 3HRUA 3M56A 4A4FA 1VQ6A 3GNFB 3OMGA 3JCMP 1ZQ1A 4J6WA 4BACA 3LW5E 4IUPA 1LNXA 2P0QA 4QQ6A 3HRSA 4R55A 2RK1A 2VV5A 2QEXT 2DIQA 5DLOA 3RMQA 4IUTA 3DB4A 3OS5A 4B9WA 3JCMW 2A3LA 5J39A 3PIPA 1QW1A 3X20B 3G4SA 3QKJA 2MMPA 2E10A 2RM4A 3P8HA 2KDSA 3CEYA 2JVVA 4NL2A 3L2WA 1AHJB 1U1TA 1KHIA 2HQXA 3L42A 4JS4A 2RA2A 1VQ9T 1G5VA 4BY6C 4FT2A 3SWNC 5FROA 3I56T 1YBYA 2R58A 5A2QE 4ZN1A 1TH7A 4M78C 1FWZA 3OYFA 3JCMQ 4OB0B 2K4YA 4C92E 3RIRA 4PJOE 2JNGA 2X35A 4M78G 4C92D 3PT9A 4PJOD 2CS7A 1QVPA 2CZ7B 4NL3A 1Q7YU 2XG8D 2E6NA 1I4K1 4M75E 5FU6B 4A4KA 3OSVA 3NTKA 4RCBA 3OYYA 3KBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1H A;  2F5K A;  2RI3 A;  3E9G A;  4L59 A;  4IUU A;  3UWN A;  2XDP A;  3S6W A;  2B8A A;  2QQR A;  3OQ5 A;  3OYH A;  5FRN A;  4QQG A;  2BIV A;  2DAQ A;  2EQK A;  2GF7 A;  2X4X A;  2PQW A;  1WGS A;  3EAE A;  2EQU A;  5CIU A;  1H3Z A;  4BDY A;  2D9T A;  3L2U A;  3S3M A;  3H8Z A;  4PL6 A;  4E7H A;  3KUF A;  3M9Q A;  2LDM A;  3NTH A;  4CRI A;  2O4X A;  1KHC A;  3OA6 A;  3L2Q A;  3OYE A;  2QQS A;  4RG2 A;  3MEW A;  3FLG A;  3Q1J A;  5D6X A;  1MHN A;  2EQJ A;  2HQE A;  2RHY A;  3GOX A;  4IUR A;  3S3N A;  2L89 A;  3L2V A;  4FL6 A;  5M9O A;  1WJS A;  4BE1 A;  4BE0 A;  2K3X A;  2GFA A;  2M16 A;  1XNI A;  2XK0 A;  3MEA A;  2MWO A;  4QW2 A;  4A4G A;  5IAY A;  2L3R A;  2RJD A;  3OS2 A;  3OYM A;  3QBY A;  3OYK A;  4E7I A;  1OZ3 A;  4IUQ A;  2YRV A;  4B9X A;  3LX7 A;  2RHU A;  2DIG A;  4Z02 A;  5C0M A;  4A4H A;  2O4X B;  2LRQ A;  4QVZ A;  3OYI A;  2JTF A;  4X34 A;  4IKF A;  3ME9 A;  3F70 A;  2P0K A;  3O8V A;  3PFS A;  5C6S A;  3SD4 A;  4FU6 A;  3OYB A;  2R5M A;  5KH6 A;  3OS1 A;  5FRM A;  2R57 A;  4BD3 A;  2RI5 A;  2E5Q A;  4N4G A;  4C5G A;  2L8D A;  4UC4 A;  4E7L A;  2LVM A;  2RHI A;  4QQD A;  2FHD A;  4C5I A;  3PNW C;  4HCZ A;  3MEU A;  2EFI A;  1N27 A;  3LLR A;  2IG0 A;  1OZ2 A;  1OI1 A;  3OS0 A;  3OYJ A;  2LCC A;  2RJF A;  3OYG A;  3OYL A;  3MP6 A;  4BDZ A;  2RI2 A;  3OYA A;  2MWP A;  3P8D A;  4PLL A;  2VYT A;  3MO8 A;  2X4W A;  2LTO A;  3ZEH A;  2R5A A;  2RJC A;  4EDU A;  5KE2 A;  1OYX A;  3QJ6 A;  4PLI A;  5D6W A;  2NLU A;  2G3R A;  4NS5 A;  3S3O A;  1WJQ A;  1RI0 A;  2WAC A;  3NTI A;  3OYN A;  2RHZ A;  4E7K A;  2JZ2 A;  2GFU A;  4A4F A;  4II1 A;  3H6Z A;  3OMG A;  5KE3 A;  4Q5W A;  3LGL A;  3MET A;  3OB9 A;  4GY5 A;  4OVA A;  4ZTF A;  4BAC A;  4C5H A;  3OMC A;  4IUP A;  5KCH A;  4QQ6 A;  3LGF A;  3DLM A;  3MP8 A;  4E7J A;  2DIQ A;  4N4H A;  3OY9 A;  1SSF A;  2K3Y A;  2EKO A;  3DB4 A;  3DB3 A;  3FEO A;  4IUT A;  4B9W A;  2BKD N;  3OYC A;  5J39 A;  3QKJ A;  4LD6 A;  5KCO A;  3P8H A;  3L2R A;  3MP1 A;  4BE2 A;  2RJE A;  3FDR A;  3CEY A;  3C4S A;  3L2W A;  2EQM A;  2HQX A;  4C5E A;  3L42 A;  3E9F A;  1G5V A;  5IN1 A;  2RO0 A;  4IUV A;  3PMT A;  3FC3 A;  5D6Y A;  5FRO A;  4ZTJ A;  2BUD A;  1WJR A;  2M0O A;  2R58 A;  3ASK A;  3LYI A;  3OYF A;  3BDL A;  3PMI A;  3OYD A;  2X4Y A;  2X35 A;  3QII A;  2RHX A;  3MEV A;  4A4E A;  4N4I A;  2E6N A;  3LH0 A;  2CKK A;  3NTK A;  3UT1 A;  5J26 A; 
#chains in the Genus database with same CATH topology
 2M02 A;  4TVR A;  1UGV A;  2VWF A;  2KR3 A;  4IUU A;  3JB9 H;  1X6G A;  3MJX A;  3OYH A;  2DL5 A;  3CBO A;  3LWI A;  1KJW A;  1N8R R;  4ZGD B;  2EQK A;  5DM7 R;  1QCF A;  2E65 A;  4J9E A;  4PL6 A;  1MV0 B;  2RH2 A;  4PKC C;  3KFV A;  2ZPI B;  3JRZ A;  3VRY A;  3CCE T;  1D3B B;  1YJW T;  4IUR A;  4KT0 E;  3X28 B;  2GTJ A;  2JN0 A;  1WFW A;  2K9G A;  1QP3 A;  3CC7 A;  2LJ3 A;  2K57 A;  1UB4 A;  1M8M A;  3MEA A;  9ATC B;  3EG9 A;  4HT9 A;  3CCU T;  4B9X A;  1WQ7 A;  4LN2 A;  4Z02 A;  3GNG A;  4RKU E;  5FU6 C;  3A8G B;  4FU6 A;  5FRM A;  2R57 A;  2RI5 A;  2KY9 A;  1KQ2 A;  4RTT A;  3PNW C;  2KMT A;  3N5B B;  2QGG A;  5FW9 A;  3HHT B;  1QWE A;  2IG0 A;  2DXT A;  1U1S A;  2RI2 A;  3EFS A;  3OYA A;  1JO8 A;  1M2V B;  1X2Q A;  1P92 A;  2HBP A;  3GIB A;  2KRM A;  2DTI A;  4F17 A;  1GCQ A;  3DLM A;  3HTR A;  1VQ8 Q;  2CT4 A;  2ED0 A;  1I81 A;  3EFR A;  5GAN j;  3CCR T;  2RD1 A;  2KXC A;  2DZ9 A;  2XHC A;  4LDX A;  2ZPH B;  2MAM A;  2E12 A;  4XU2 A;  3EGD A;  1XOV A;  6AT1 B;  2M0O A;  3ASK A;  1G3S A;  4KUI A;  3JSC A;  3CD6 T;  2C0O A;  2KQW A;  4ME7 A;  2ABL A;  3QDR B;  1BYM A;  1SKU B;  1RAC B;  2ZAE A;  1FXX A;  1HK9 A;  4C92 A;  2BZ8 A;  1I07 A;  4D8D A;  1WI7 A;  1M27 C;  2L3Q A;  1X27 A;  4CC4 B;  2OAU A;  1VQ5 Q;  1X43 A;  4KUL A;  4AG1 C;  4DQ2 A;  2HBW A;  4B6M A;  4EMK B;  1AVZ C;  2QQS A;  2D8J A;  2PUK B;  4RG2 A;  1R8O B;  3A8O B;  1C6V X;  4MML A;  2HQE A;  2RHY A;  1H3H A;  4FIB A;  1Q86 C;  4BE1 A;  2NUP B;  3VS7 A;  2M16 A;  3H41 A;  1Q81 R;  1VQO A;  2HZY A;  5CKD A;  3ZFJ A;  2GGR A;  3M0T A;  5GAN g;  4A63 B;  3VYH B;  2DL8 A;  2DE0 X;  2CZ6 B;  2LX9 A;  2DXC A;  4J9B A;  1Y57 A;  1LOJ A;  3SFM A;  2JOY A;  1PKT A;  2YXY A;  3CCS Q;  1S72 A;  2YUO A;  1BCM A;  1M30 A;  1AWJ A;  2QEX A;  1JQQ A;  4M77 D;  1VQ8 T;  4M75 D;  4OMQ A;  5IHI A;  3CME T;  2I2L A;  4E7K A;  4PNO A;  1VQ7 T;  1VQL Q;  3OMC A;  1MMG A;  4JJN K;  4IIM A;  1B07 A;  2ZPG B;  3G71 A;  4F7U B;  3RUX A;  2LMJ A;  2D8H A;  2E1H A;  3QG1 A;  2CYZ B;  1V29 B;  4J7I A;  3SDZ A;  2K6D A;  1VQM Q;  3G1J A;  3QPH A;  7AT1 B;  4OP0 A;  1Z9Z A;  3RMS A;  2YRC A;  3CCR A;  2RN8 A;  1N5Z A;  2PU9 B;  2QI2 A;  1B7T A;  5IHK A;  2HNI A;  2QQR A;  4OF1 A;  1MGQ A;  1GRI A;  3CPW P;  4QQG A;  3CCE Q;  1MMD A;  4M7A D;  4M7A G;  1Y96 A;  3L2U A;  4VUB A;  2DTH A;  5L8R E;  4C8Q D;  3R6N A;  3GLX A;  1MHN A;  1KC8 R;  4HVV A;  5GMK l;  4C8Q A;  3EH2 A;  3A1P A;  2DMO A;  3EGD B;  1OZ3 A;  1IB8 A;  1NYG A;  3VJP A;  1SSH A;  4QVZ A;  2LRQ A;  4JRI A;  1VYT A;  3PFS A;  3VV0 A;  5GAN 8;  3KXT A;  2DYI A;  3LLR A;  4AFZ C;  1OI1 A;  3OYG A;  2FB7 A;  3CCL Q;  1BBZ A;  2LNV A;  4PLI A;  3BY7 A;  1D3B A;  1NZ9 A;  2NYS A;  3CME A;  5GAN 4;  2EYX A;  1LCK A;  4OVA A;  3JCM c;  4R56 A;  3JB9 J;  3ER0 A;  3EG9 B;  2O31 A;  2AKK A;  4MDW A;  4ELZ C;  1YHQ T;  3L2R A;  1VQO T;  4JJC A;  2L2P A;  2YHT A;  4ZNX A;  1S1N A;  5HCK A;  4WCI A;  4YTL A;  1A0N B;  1K9M C;  5GAM e;  2COY A;  3PMI A;  3OYD A;  1KQS A;  1YIT A;  5LJ5 j;  5GMK i;  4DA4 A;  4J9I A;  2O01 E;  1VQ4 Q;  3HP9 A;  3M5A A;  2LQN A;  2CP2 A;  2K7A A;  2P4T A;  1PG5 B;  2A28 A;  1M2V A;  5CVI A;  5LJ3 f;  3HFN A;  4OMM A;  2XID A;  4FSX A;  5CIU A;  3S3M A;  3H8Z A;  1UUE A;  1UGQ B;  5IHN A;  4F7U A;  4J9H A;  1ZA1 B;  3A8H B;  5AYF A;  5HK0 A;  3BE3 A;  2GFA A;  2RQV A;  1T0H A;  1YCS B;  2CP3 A;  3LX7 A;  1D0Z A;  5C0M A;  1G83 A;  2RMO A;  4X9D A;  2DA9 A;  1VQ5 T;  2PVO B;  1VUB A;  4M77 F;  2MF2 A;  1NPR A;  2QA4 T;  4FW2 A;  4M7D C;  1X6B A;  2QQA A;  3G6E T;  3OYJ A;  2RJF A;  4EIK A;  4BDZ A;  2DBK A;  2FEI A;  2WSF E;  3CC4 Q;  5KE2 A;  3X24 B;  2FZG B;  2WAC A;  1M3C A;  3JCM f;  1VYU A;  2G6F X;  3JCM P;  5KYU A;  1HJD A;  2VV5 A;  3RMQ A;  4B9W A;  1D1A A;  1BCO A;  5J39 A;  3X20 B;  3U23 A;  3TQ7 P;  2MMP A;  2RM4 A;  2JVV A;  2HL5 C;  1W2B P;  2RA2 A;  1UG1 A;  4BY6 C;  2RNA A;  3I56 T;  1VQ7 Q;  4ZN1 A;  1TH7 A;  2CUB A;  1UFF A;  3JCM Q;  2KRN A;  2X35 A;  2L3S A;  1QKW A;  4C92 D;  1I1J A;  1U5S A;  2QK0 A;  2CZ7 B;  2E6N A;  3OSV A;  4M78 F;  2M1H A;  4L59 A;  2QQB A;  2DL3 A;  4JRP A;  1YJ9 Q;  2LT4 A;  2MK5 A;  2DPP B;  4M77 C;  4RTX A;  4BDY A;  2D9T A;  5FWB A;  3CC2 Q;  2M9U A;  4BB7 A;  3ULR B;  2JM8 A;  2CP5 A;  3QSU A;  3QHS A;  2DBM A;  3I56 A;  4FL6 A;  1M1K U;  4Z89 A;  1YJW A;  2XK0 A;  5DY9 A;  5FU7 C;  2JMC A;  3A8M B;  1FYN A;  3G7Z A;  3O8V A;  2CGH A;  3OS1 A;  2QYZ A;  2RF0 A;  3CCL T;  4XTX A;  5A0L A;  4A53 A;  2H3J A;  2CZ1 B;  2F5T X;  5GAN f;  4JS5 A;  2DVE A;  1MMN A;  1FX7 A;  2A37 A;  3UA7 A;  3QUI A;  1TUG B;  4KGX B;  1I5O B;  4RTZ A;  2VXF A;  3IQL A;  4II1 A;  4PJO G;  2GCX A;  4ZTF A;  3OY9 A;  1ABO A;  2EKO A;  5LL6 S;  4PJM A;  2Y4X A;  3MP1 A;  1K8A U;  3UAT A;  3BW1 A;  4XTU A;  1NLO C;  3E9F A;  1PSE A;  3PMT A;  1X6O A;  2XI9 A;  2BUD A;  1ACM B;  2NUT A;  3FRN A;  1H92 A;  1FMK A;  1JU5 C;  3UPU A;  2GTO A;  5GAO p;  3I55 Q;  3PVL A;  4XTW A;  3TVT A;  3JAM E;  2VAS A;  3V8J A;  4AT1 B;  3QYH B;  4V2S A;  1WYX A;  3CBP A;  2X9H A;  2BIV A;  1WXU A;  4MZT A;  2LQW A;  2HEQ A;  4FYX B;  1E6G A;  1JB0 E;  3LWH A;  2YSQ A;  3X26 B;  4DBH A;  3UA6 A;  2AHJ B;  5I11 A;  2O4X A;  3OW2 P;  1PD0 A;  3SWN B;  3NGP A;  5CCA A;  2DLP A;  2EQJ A;  3GOX A;  1PRM C;  3JCM g;  1KG1 A;  2EPD A;  2HKN A;  2ZZD A;  3GBQ A;  3S3N A;  1K9M R;  3EG0 A;  2EJF A;  2H3E B;  2HMA A;  4M7A E;  1PRL C;  4A4H A;  2CP6 A;  1JEG A;  1JJ2 S;  1ARK A;  4J83 A;  3RBB B;  4RTV A;  4JUV A;  3CME Q;  2RHI A;  4J7F A;  2H8H A;  1K73 U;  2ECZ A;  1OX8 A;  4HCZ A;  1V76 A;  1ZBX A;  2ZPB B;  1JRI A;  2FRW A;  5I2M A;  1M1K R;  1RUW A;  3P8B B;  3MCA B;  3FB9 A;  5LJ5 h;  2J6F A;  4JRK A;  2AKL A;  4HKE A;  4OGC A;  2BTT A;  4OMO A;  2RPN A;  3V7S A;  5KYX B;  4C92 F;  1IGU A;  1BIA A;  1VQ9 Q;  4M75 F;  2K2V A;  3EG3 A;  1KQ1 A;  4M7D D;  4DBF A;  2FG0 A;  1NE8 A;  4N4H A;  1YIT Q;  4MZP A;  2BKD N;  4MDX A;  1GFD A;  4E7S A;  2KNB B;  2QG9 B;  2ESW A;  3A5Z B;  3CCQ A;  2LCS A;  4XQ3 A;  3JCM b;  3RNJ A;  4D6W A;  1WPY A;  2WSE E;  4XTV A;  1RAG B;  1WIE A;  4FCY A;  4J9G A;  2SEM A;  4XAX B;  1RAD B;  3QII A;  3MPU B;  5GAN d;  3CC4 T;  3MEV A;  1R77 A;  2YUP A;  2FRY A;  3VU3 C;  1ZSZ B;  1YCY A;  2RI3 A;  4C8Q G;  2XDP A;  1G3T A;  4GLM A;  4JRQ A;  1ZBJ A;  1UEC A;  2K5I A;  1NPP A;  2D1X A;  1YIT T;  2PQW A;  2EQU A;  4HA8 A;  1BI1 A;  2RQU A;  2YLB A;  3M9Q A;  2HD0 A;  1N9S A;  3FLG A;  1H64 1;  3TRE A;  4PJO C;  1KSW A;  3C95 A;  4C8Q F;  1WJS A;  1XJW B;  3QJY A;  2VC8 A;  2W0Z A;  1IGQ A;  2RJD A;  3M4Y A;  3OYM A;  4E7I A;  1YIJ A;  3PVQ A;  1NBE B;  4F7U E;  2OTJ A;  4KBM B;  2HAX A;  1KIK A;  3H9N A;  4IKF A;  4JZ4 A;  4MZM A;  4QQD A;  3OW2 S;  2ZGW A;  4M7A A;  1BI2 A;  2HKQ B;  3H0F A;  4FT4 A;  1OZ2 A;  1WLP B;  2CSQ A;  2Y4Y A;  3WVD B;  3EFO B;  1VQ8 A;  1NJI C;  2EKH A;  2VYT A;  2LJ1 A;  2F2W A;  2E64 A;  2R5A A;  2VGM A;  1N6A A;  1M90 U;  2V8K A;  1MNE A;  5KE3 A;  1SHG A;  2DTO A;  2EWN A;  4PFP A;  5LJ5 e;  2MCN A;  3FEO A;  3CCV T;  4GLK A;  2VXE A;  4LD6 A;  1VQP A;  1YP5 A;  1UHF A;  4OMN A;  3VS0 A;  4C5E A;  5ECA A;  5GAN h;  2K79 A;  3FC3 A;  2LJ0 A;  4ZTJ A;  2FVU A;  3LYI A;  4OMP A;  4JLG A;  1AT1 B;  3I5R A;  4J5Y A;  2JT4 A;  3CMA Q;  4M78 B;  3A98 A;  1WXB A;  2NWM A;  1G3W A;  1ZLM A;  4N4I A;  5GMK j;  4M75 A;  1UGR B;  2AZS A;  1R0B G;  1WHM A;  2F5K A;  4M75 B;  5IH2 A;  1PWT A;  1K9A A;  3QWY A;  3J7A F;  3I35 A;  4N0A C;  3SB2 A;  1IHV A;  3VS4 A;  5GAM f;  2CSI A;  2QDY B;  1OEB A;  1H3Z A;  4CC7 A;  2JJ9 A;  3CPF A;  1WHK A;  3CCJ A;  4M78 E;  4CRI A;  2YDL A;  5L23 A;  1TSF A;  1U3O A;  1I5L A;  2I0N A;  3CCQ T;  4OGE A;  3H0H A;  1NJI U;  3EGX B;  2MYS A;  3NHN A;  1K73 R;  1GXI E;  4A4G A;  3INZ A;  4QW2 A;  5IAY A;  1GBQ A;  2NUT B;  1SHF A;  4LDW A;  2YRV A;  3URG A;  2QEX Q;  2EIF A;  2K2M A;  3CBM A;  3ME9 A;  3CXC S;  5GAN 7;  4QVC A;  3OYB A;  3M0U A;  3M4G A;  1M8V A;  1KC8 U;  4C5I A;  3PIO A;  1MUZ A;  2X3X D;  3G6E Q;  5CAI A;  3TU4 K;  1JXO A;  3OYL A;  4M7D B;  1WQW A;  4PJO B;  3G71 Q;  1IO6 A;  5GMK e;  3CCJ T;  4NS5 A;  1YN8 A;  3WVE B;  1O75 A;  3GPL A;  4M7A C;  1KK7 A;  1SRL A;  2KXD A;  1K0X A;  2DNU A;  4IUP A;  2YRD A;  2P0Q A;  4QQ6 A;  3HRS A;  2RK1 A;  2DIQ A;  5DLO A;  1IHW A;  4IUT A;  3QKJ A;  3P8H A;  2OTL Q;  5GJW B;  3VS1 A;  3L2W A;  2EBP A;  2VVK A;  1KHI A;  2HQX A;  3CCR Q;  3L42 A;  4JS4 A;  4E6R A;  3OYF A;  2KI7 A;  4PJO E;  1VQ6 Q;  4NL3 A;  2QAZ A;  2DYB A;  3M0Q A;  2XG8 D;  1T0J A;  3NTK A;  4RCB A;  3UT1 A;  5J26 A;  1RAB B;  1NEB A;  4IIO A;  3UWN A;  4MMK A;  2DM1 A;  2JM9 A;  2EQI A;  4J9F A;  4F7U F;  2FPE A;  1LPL A;  2IIM A;  3RKW A;  1M1G A;  1OU8 A;  4KGZ B;  1WHL A;  3CCU A;  4EMK C;  1XTD A;  2AK5 A;  5GAN 3;  1RAH B;  1VQK A;  5GAM j;  3VS6 A;  1VYV A;  4M78 D;  2L3R A;  4JPB W;  4E2F B;  2OX7 A;  1RL2 A;  2EGC A;  1D0X A;  1ZA2 B;  1E7O A;  1X2K A;  1G2B A;  1XQH A;  2RQT A;  5C6S A;  1ZSZ A;  3J80 E;  3CCL A;  4HCB A;  2DEQ A;  2CT3 A;  2V1R A;  4C0F A;  4DBQ A;  4UC4 A;  2CZ0 B;  5CQX A;  4EMH A;  2EGA A;  4OB2 B;  4E47 A;  1W70 A;  3MEU A;  3RES A;  3NPF A;  1VA7 A;  1ZSG A;  4LDV A;  2LCC A;  1QCO A;  1QLY A;  2V8I A;  5GAN 2;  3ZEH A;  3MHX A;  3ZL7 C;  2J6K A;  2RHZ A;  1N9R A;  2A08 A;  5GAO l;  3H6Z A;  5I21 A;  1N8R C;  1R0C B;  2JTE A;  3QZ5 B;  4RTW A;  3LGF A;  1LJO A;  1E6H A;  1C0M A;  2AZV A;  4RCC A;  1QWF A;  2ENM A;  2E6Z A;  4DOV A;  8AT1 B;  5KCO A;  3JB9 I;  1W2B A;  3UF4 A;  3FDR A;  3QXE B;  4IUV A;  1K73 C;  1VQ6 T;  3SEM A;  2BZX A;  1VQ4 T;  2HQH A;  4BY6 B;  4FW1 A;  2X4Y A;  4DBR A;  3M0R A;  1I8F A;  1VIE A;  1QKX A;  2OTL T;  4KUD K;  5LJ5 d;  4PJO A;  2E3I A;  2CP0 A;  1YJN T;  1QMC A;  5LJ5 g;  2DAQ A;  4HVU A;  3J81 E;  3JCM J;  4ELY C;  3CD6 A;  3EGU A;  4RMO A;  1Q82 C;  1SEM A;  2E41 A;  2LX7 A;  4FYW B;  1KHC A;  3V8K A;  3MEW A;  1BI0 A;  4M77 E;  5CR2 A;  1WHJ A;  1M3A A;  2XMF A;  3HKS A;  2CH4 A;  1NG2 A;  1GFC A;  2JUF A;  4C8Q E;  1XNI A;  4BUG A;  3SHW A;  3QBY A;  4DEX A;  1OPL A;  3GF5 A;  2LC4 A;  1VQN A;  2PVD B;  2GQV A;  5HY6 A;  2Z0W A;  4F14 A;  4C0Z A;  5LJ5 f;  3CC2 A;  2CH4 W;  4JDS A;  1SF9 A;  2E5Q A;  5GAN e;  1WHG A;  2KYB A;  4PK4 A;  2KK4 A;  2EAY A;  2GNC A;  2DL4 A;  1GBR A;  3E2U A;  5KYX A;  4J8O A;  2QA4 A;  3DLL A;  3MP6 A;  1EZZ B;  4C8Q B;  2LTO A;  2PUO B;  5EG2 A;  1OYX A;  2BZY A;  1VQP Q;  2JS0 A;  3OYN A;  2W10 A;  4Q5W A;  4GY5 A;  2RQR A;  1EX4 A;  2C06 A;  4C5H A;  4E7J A;  1Q7Y R;  1D1B A;  2LT1 A;  2M0Y A;  1H8K A;  3CCS A;  2KT8 A;  4FM4 B;  3CCE A;  2BE7 D;  1ZUY A;  2P4R A;  4XTY A;  1PD1 A;  3JB9 D;  5IN1 A;  1Q86 R;  1CKB A;  5GAM d;  4AMC A;  1RI9 A;  3CMA T;  5A0D A;  5CKE A;  1OV3 A;  3OBY A;  2BE9 B;  4LD9 K;  2RHX A;  3G4S Q;  2E70 A;  1VQL A;  2CKK A;  3BDU A;  1KD1 C;  1TOV A;  1OQK A;  4C8Q C;  2J06 A;  4JLI A;  1YJN Q;  3C0C A;  3PGG A;  2EVR A;  3S6W A;  2K5F A;  3JV3 A;  1Q82 U;  3FIF A;  3EG2 A;  4HCC A;  1WGS A;  1YJW Q;  1QVF A;  4C0G A;  2QQ9 A;  4BI8 B;  1OUL A;  3KUF A;  1TUD A;  1LVK A;  2JTM A;  3TSW A;  4OML A;  5D7U A;  1AEY A;  3O5Z A;  3CC2 T;  5D6X A;  2P84 A;  4BI3 A;  3JCM d;  1EFN A;  4C0D C;  4WF2 A;  3PE0 A;  5M9O A;  3RR6 A;  2DXB A;  3G6E A;  3CCS T;  3OW2 A;  1YWP A;  3JCM V;  2B86 A;  3EHR A;  4ESR A;  1QVG P;  3FJ5 A;  1UTI A;  1WX6 A;  2D6F A;  3M0P A;  3HSB A;  2KGT A;  2F2V A;  3ZBD A;  3X25 B;  2QTV A;  3M59 A;  4OB1 B;  5GAO n;  2SRC A;  2QDL A;  2KE9 A;  2RJC A;  5IT9 E;  3QJ6 A;  3VRZ A;  2OTL A;  2VB6 A;  4GBQ A;  4AFS C;  4ATO A;  2GFU A;  4ANJ A;  3AT1 B;  5LJ3 e;  5KCH A;  1T3S A;  1Q7Y C;  1I0C A;  1Q82 R;  1HXD A;  2LQK A;  2EYW A;  3R6O A;  2MIO A;  2RJE A;  1KQS S;  1BKB A;  1T3L A;  4EMK A;  3I55 T;  2QTX A;  2COW A;  3D7S B;  1B34 A;  1Y7X A;  5KYN A;  1AWO A;  1Y71 A;  4CI0 C;  1EIF A;  1B34 B;  5GAM h;  2NUP A;  2OTJ T;  4WTO B;  2XKO C;  1D0Y A;  3EH1 A;  3CCM T;  3VS5 A;  3LH0 A;  1VQP T;  4M7D E;  1K4U S;  2DL7 A;  3CCV A;  2EYQ A;  1F1B B;  1YWO A;  2EJG A;  2ROL A;  3CCQ Q;  2DK3 A;  5FWC A;  5KYW B;  4F7U G;  1YI2 A;  1K8A R;  1VQK Q;  2GF7 A;  4K11 A;  4PJN A;  1QVG A;  2AT1 B;  3E1S A;  5KYY A;  4Y28 E;  2ED1 A;  3EGX A;  1VQN T;  4E7H A;  5CKF A;  3A8L B;  2LQ8 A;  4M75 G;  1KC8 C;  1QVF S;  1WA7 A;  2PTK A;  5CKH A;  2DJZ A;  1RLP C;  4M77 A;  4RUG A;  3L2V A;  4AFQ C;  3MKD A;  3V7C A;  1M9S A;  2MWO A;  3OYK A;  1VQ5 A;  1JJ2 A;  1QP2 A;  1X69 A;  2COZ A;  2FZC B;  4IUQ A;  2LP5 A;  2KEA A;  3OYI A;  1UHC A;  1QVF P;  2QGF B;  5GAN 6;  4BD3 A;  1Y07 A;  2XU8 A;  1HSQ A;  2J7I A;  1K9M U;  2HSE B;  4X9C A;  4PFO A;  1TWB A;  3QDF A;  1BU1 A;  2CP7 A;  4Y92 A;  1VQO Q;  1M4Z A;  3OS0 A;  1YHQ Q;  2OI3 A;  1AWW A;  4BI4 A;  2KAF A;  3M0S A;  4LDU A;  3G4S T;  2EYZ A;  3OS2 A;  1VQ7 A;  1FMV A;  2ATC B;  2DJQ A;  2AIR B;  3HRU A;  3M56 A;  3VS2 A;  3OMG A;  1ZQ1 A;  2MPX C;  1M2O A;  2E4H A;  1TS9 A;  2OAW A;  2QEX T;  3DB4 A;  3OS5 A;  2A3L A;  3PIP A;  1QW1 A;  2FO0 A;  3NMZ C;  1IXD A;  2KDS A;  4KH0 B;  2DET A;  1KQS P;  1G5V A;  1YFN A;  5FRO A;  5A2Q E;  4M78 C;  2FZK B;  4M78 G;  4PJO D;  4A4K A;  2GQI A;  4D8K A;  4PJJ A;  2YUN A;  3OYY A;  1RAE B;  2MI6 A;  1M90 C;  2HCK A;  4M75 C;  4XU0 A;  1VQM A;  2NUZ A;  3CCM Q;  3CC7 T;  1X75 C;  5CO7 A;  1Q81 C;  3JB9 F;  3L2Z A;  1M1F A;  1NLP C;  2J05 A;  3L2Q A;  2YLC A;  5GAO q;  2DEU A;  3Q1J A;  3V8L A;  1U8R A;  2CUD A;  2V1Q A;  4LE9 A;  4O6J A;  3WXM B;  2DIL A;  4PFZ A;  2JMA A;  1KD1 U;  2EYY A;  4FYY B;  2X51 A;  3RKX A;  2QA4 Q;  4M7A F;  1RAI B;  2O4X B;  3JCM h;  1N8R U;  1TXQ A;  4J6X A;  3SWN A;  2P0K A;  3REA B;  3OBW A;  1GL5 A;  3VUZ A;  1WDX A;  2FYK A;  1YI2 T;  2XDB A;  1TU0 B;  1VQM T;  3VYG A;  3I9Q A;  2L8D A;  4M77 G;  2LVM A;  2DX1 A;  3QYG B;  1N27 A;  3QZ9 B;  2VKN A;  1NEG A;  1RAA B;  2A0F B;  4AG2 C;  2QAS A;  2X4W A;  4PJL A;  1MMA A;  2NLU A;  2HDA A;  1U06 A;  2JZ2 A;  2EGE A;  4J9D A;  4C92 G;  3LGL A;  2WSC E;  2JXB A;  3OB9 A;  1KFZ A;  3JCM e;  3CQT A;  5I2S A;  1AZE A;  1M5Q 1;  4RG8 A;  5FRN A;  2K3Y A;  1UJ0 A;  2DKG A;  3OYC A;  2DVJ A;  4JJB A;  1IRE B;  1GCP A;  3NFC A;  2F69 A;  4BE2 A;  1ABQ A;  3C4S A;  4J6Y A;  2MOX A;  4QKU A;  4LUE A;  1G8X A;  1UEB A;  4M4Z A;  3V7R A;  1QVG S;  5D6Y A;  1YNZ A;  3M58 A;  4HT8 A;  3BDL A;  2Y90 A;  2QXF A;  1SG5 A;  2YT6 A;  5IXF A;  3LH5 A;  5FLX E;  2YUQ A;  1NYF A;  2X3W D;  2DRK A;  4NOY A;  1ZSZ C;  2DZC A;  3OQ5 A;  4RTY A;  4XU3 A;  2ZCF B;  2JW4 A;  5DLQ E;  2IPO B;  3EAE A;  3HL8 A;  4HCK A;  5AT1 B;  4QVD A;  1VQ4 A;  5HK3 A;  1W6X A;  2PZ1 A;  3NTH A;  2O2O A;  3OA6 A;  2GBQ A;  4N0A A;  2O9S A;  3HPW A;  2FPF A;  4HVW A;  4ZN3 A;  2KBT A;  4CC2 A;  1Y96 B;  5FU7 B;  3I55 A;  3CXC A;  4M78 A;  1ZX6 A;  1ZHI A;  5CK9 A;  5KYU B;  3HRT A;  2LZ6 B;  2RHU A;  4X34 A;  1J3T A;  2IVW A;  3C12 A;  1B3Q A;  2FL7 A;  1Z9Q A;  2OJ2 A;  1VQ9 A;  1BB9 A;  1IZ6 A;  2VUB A;  4N4G A;  3CPW A;  3CC7 Q;  2V8J A;  4E7L A;  5KYW A;  2FHD A;  3VUB A;  3QWX X;  4J9C A;  4R0K A;  1PCX A;  5J3B A;  1G3Y A;  4EPC A;  3GP8 A;  2MWP A;  3P8D A;  1NM7 A;  1WJQ A;  4PJO F;  8ATC B;  1K76 A;  5LJ3 j;  2P0P A;  3MET A;  2DFU A;  4M7A B;  2DF6 A;  3JB9 G;  3MP8 A;  1RLQ C;  3DB3 A;  5HKC A;  1SRM A;  3H0I A;  4JZ3 A;  2EW3 A;  1M3B A;  3TCJ A;  2K5L A;  1AWX A;  1AZG B;  1VIF A;  4C0D B;  2EQM A;  2KT1 A;  3CCV Q;  4Y91 A;  4ZGJ B;  4KRT A;  3EFO A;  2RO0 A;  1BK2 A;  1K8A C;  1WJR A;  4A54 A;  3EHQ A;  1OOT A;  1YI2 Q;  1DJ7 B;  2E3H A;  3M53 A;  1RAF B;  1PNJ A;  4A4E A;  4OMF B;  1NJI R;  2JS2 A;  2F2X A;  4CC3 A;  2C0I A;  4M7D F;  3REB B;  4JJD A;  1QCN A;  2X4J A;  3CCU Q;  3E9G A;  2V26 A;  3M57 A;  4OB3 B;  5GAO r;  4DOW A;  4LNP A;  2CRE A;  2X4X A;  2ROT A;  1S72 T;  3EG1 A;  1Y0M A;  2FPD A;  1UGS B;  2K3B A;  2RK2 A;  3JCM X;  1OPK A;  2DXU A;  1VQL T;  2PVG B;  4L5G A;  2LDM A;  2O9V A;  2XDD A;  1OU9 A;  5GAO m;  1YIJ T;  4LXC A;  4LUD A;  1K1Z A;  2D0Q B;  2DO3 A;  5GMK h;  1YJ9 T;  4M7D G;  4C92 C;  2KRS A;  2M51 A;  2L89 A;  2VGN A;  5GMK m;  4BE0 A;  2K3X A;  3DKM A;  3CC4 A;  1WZO A;  4Z8A A;  2KSS A;  2DIG A;  2KYM A;  1YHQ A;  2JTF A;  2L0A A;  4KH1 B;  3F70 A;  3I5S A;  2PNI A;  1PM3 A;  2R5M A;  3I56 Q;  4FYV B;  5GAM g;  1M90 R;  2A7Y A;  4RTU A;  4C5G A;  2KRO A;  2LNH B;  1BIB A;  4EMG A;  5IXB A;  2EFI A;  1HYO A;  1MV3 A;  1V1C A;  1W2B S;  3RDV A;  1VOM A;  1WXT A;  4XK8 E;  1Q81 U;  1GCQ C;  1UGP B;  3MO8 A;  2DRM A;  1YIJ Q;  2ZPF B;  5D6W A;  2EJ9 A;  3S3O A;  2DD5 A;  2J6O A;  2OTJ Q;  1BI3 A;  1RI0 A;  3PTA A;  3NTI A;  3CMA A;  3E19 A;  1UDL A;  4FSS A;  2XD0 A;  5EC7 A;  1S72 Q;  5I22 A;  5CKB A;  1PKS A;  3VS3 A;  3RKY A;  4Z88 A;  1PC0 A;  1SSF A;  1ZUK A;  2LCL A;  4XU1 A;  5CQY A;  4KGV B;  2F1L A;  4F04 B;  1YJ9 A;  1CSK A;  1AD5 A;  4M7D A;  1PHT A;  2C0T A;  1JBM A;  1W1F A;  3CCM A;  5A0G A;  1K0S A;  1TG0 A;  1W4S A;  2ZPE B;  3L1A A;  3CD6 Q;  1KD1 R;  2DER A;  1PSF A;  5KYY B;  2B8A A;  1O9S A;  2KVQ G;  1Q86 U;  1UJY A;  1Q95 G;  3RER A;  2A36 A;  3CPW S;  1ZUU A;  3BFM A;  4ZGE B;  5LJ3 h;  4M77 B;  1M1K C;  3VKI A;  3HFO A;  3T9N A;  2YWW A;  4O5V A;  1VQN Q;  3OYE A;  1UE9 A;  4X1V A;  3TEE A;  2CDT A;  2DD4 A;  1VQK T;  3FJP A;  1YJN A;  2RB6 A;  2L5Q A;  1D09 B;  5GAN 5;  4HXJ A;  1JXM A;  3CXC P;  4XTZ A;  3AHU A;  3SD4 A;  1QQJ A;  1IRX A;  5KH6 A;  1JJ2 P;  3OSS C;  3CCJ Q;  2E5K A;  5LJ3 d;  3UDC A;  3M55 A;  5LJ3 g;  4L6V 5;  1SPK A;  4AFU C;  4QT7 A;  1X01 A;  1WNL A;  3QO3 A;  3G71 T;  4LDY A;  2HL3 A;  2XIC A;  3M54 A;  4PLL A;  4C92 B;  1AOJ A;  2RQW A;  1TUC A;  2HSP A;  4E7Z A;  4EDU A;  3C94 A;  4P5N A;  2G3R A;  3TSZ A;  4A4F A;  1VQ6 A;  3GNF B;  1TTH B;  4J6W A;  4BAC A;  3LW5 E;  1C1A A;  1LNX A;  4R55 A;  4DEY A;  2L3P A;  3JCM W;  2D0N A;  3G4S A;  2E10 A;  1WHH A;  1OX9 A;  1FMW A;  1MND A;  5GJV B;  3CEY A;  4NL2 A;  1AHJ B;  1U1T A;  1D1C A;  1VQ9 T;  3THK A;  4FT2 A;  3SWN C;  4ORZ A;  1YBY A;  2R58 A;  1FWZ A;  4OB0 B;  1CKA A;  2K4Y A;  4C92 E;  3RIR A;  2JNG A;  3PT9 A;  4F16 A;  1HD3 A;  2CS7 A;  1QVP A;  1Q7Y U;  4M75 E;  5FU6 B;  1I4K 1;  2O88 A;  3KBG A; 
#chains in the Genus database with same CATH homology
 2MI6 A;  2M1H A;  4L59 A;  4TVR A;  1M90 C;  4IUU A;  3UWN A;  3JB9 H;  4MMK A;  2QQB A;  3OYH A;  4JRP A;  4M75 C;  4F7U F;  3CBO A;  4XU0 A;  1VQM A;  3LWI A;  2LT4 A;  4ZGD B;  3CC7 T;  2EQK A;  2DPP B;  1X75 C;  4M77 C;  5CO7 A;  4BDY A;  1Q81 C;  5DM7 R;  2E65 A;  2D9T A;  1M1G A;  3RKW A;  3L2Z A;  1M1F A;  2M9U A;  4BB7 A;  3JB9 F;  4PL6 A;  2RH2 A;  4PKC C;  3L2Q A;  2ZPI B;  2YLC A;  3JRZ A;  5GAO q;  3CCU A;  3Q1J A;  3V8L A;  4EMK C;  1D3B B;  3QHS A;  3CCE T;  4HCB A;  1U8R A;  3QSU A;  1XTD A;  1YJW T;  4IUR A;  4KT0 E;  3X28 B;  3I56 A;  2JN0 A;  4O6J A;  5GAN 3;  1VQK A;  4FL6 A;  5GAM j;  1QP3 A;  3CC7 A;  1M1K U;  3WXM B;  4M78 D;  2K57 A;  1UB4 A;  1YJW A;  2XK0 A;  3MEA A;  1KD1 U;  5DY9 A;  2L3R A;  4HT9 A;  5FU7 C;  3A8M B;  3CCU T;  4B9X A;  1WQ7 A;  1RL2 A;  3RKX A;  4Z02 A;  3GNG A;  4M7A F;  2O4X B;  3JCM h;  1N8R U;  3G7Z A;  4RKU E;  4J6X A;  1XQH A;  2P0K A;  3O8V A;  5FU6 C;  3A8G B;  2CGH A;  3OBW A;  3SWN A;  5C6S A;  3J80 E;  3CCL A;  4FU6 A;  3VUZ A;  2DEQ A;  5FRM A;  3OS1 A;  4C0F A;  2R57 A;  2RI5 A;  2FYK A;  2KY9 A;  1YI2 T;  1VQM T;  2XDB A;  3VYG A;  4M77 G;  2L8D A;  4UC4 A;  3CCL T;  1KQ2 A;  2LVM A;  2CZ0 B;  4XTX A;  5A0L A;  5CQX A;  4A53 A;  2H3J A;  4EMH A;  4OB2 B;  2CZ1 B;  3PNW C;  2KMT A;  4E47 A;  3MEU A;  2F5T X;  3QYG B;  3N5B B;  3RES A;  3HHT B;  1N27 A;  5GAN f;  2IG0 A;  4LDV A;  2DXT A;  2LCC A;  4JS5 A;  2DVE A;  3QZ9 B;  1U1S A;  2RI2 A;  3EFS A;  1FX7 A;  2V8I A;  3OYA A;  5GAN 2;  2X4W A;  3ZEH A;  3QUI A;  3MHX A;  2NLU A;  1P92 A;  2RHZ A;  1N9R A;  2JZ2 A;  2VXF A;  5GAO l;  4II1 A;  3H6Z A;  2HBP A;  4PJO G;  4C92 G;  2GCX A;  3LGL A;  2WSC E;  3OB9 A;  5I21 A;  3GIB A;  1N8R C;  3JCM e;  4ZTF A;  3QZ5 B;  2DTI A;  5I2S A;  3LGF A;  3DLM A;  1LJO A;  1M5Q 1;  4RG8 A;  4RCC A;  3OY9 A;  5FRN A;  1I81 A;  2K3Y A;  2DKG A;  2EKO A;  3EFR A;  5LL6 S;  5GAN j;  3CCR T;  3OYC A;  2RD1 A;  4DOV A;  2E6Z A;  1IRE B;  5KCO A;  3JB9 I;  1W2B A;  2Y4X A;  3MP1 A;  2F69 A;  3NFC A;  4BE2 A;  1K8A U;  3BW1 A;  3CC2 A;  3FDR A;  3C4S A;  2DZ9 A;  3QXE B;  2XHC A;  4J6Y A;  4XTU A;  4LDX A;  2ZPH B;  2MAM A;  2E12 A;  1UEB A;  1PSE A;  3E9F A;  4XU2 A;  4IUV A;  3V7R A;  1QVG S;  1K73 C;  1XOV A;  1X6O A;  3PMT A;  2XI9 A;  5D6Y A;  1VQ6 T;  2BUD A;  2M0O A;  3ASK A;  1G3S A;  4KUI A;  1VQ4 T;  3JSC A;  4BY6 B;  3CD6 T;  3M58 A;  4HT8 A;  3BDL A;  2KQW A;  2Y90 A;  3FRN A;  2QXF A;  2X4Y A;  4ME7 A;  3QDR B;  1BYM A;  3UPU A;  5FLX E;  1I8F A;  5GAO p;  1FXX A;  1HK9 A;  1VIE A;  4XTW A;  2OTL T;  4KUD K;  5LJ5 d;  4C92 A;  3JAM E;  4PJO A;  4NOY A;  2DZC A;  3V8J A;  3QYH B;  3OQ5 A;  4V2S A;  1YJN T;  4XU3 A;  2ZCF B;  3CBP A;  5LJ5 g;  2BIV A;  2DAQ A;  3J81 E;  5DLQ E;  3JCM J;  3EAE A;  4MZT A;  3HL8 A;  4ELY C;  3CD6 A;  4QVD A;  4RMO A;  1VQ4 A;  1JB0 E;  5HK3 A;  2OAU A;  3LWH A;  1Q82 C;  3X26 B;  2E41 A;  4KUL A;  4DQ2 A;  2AHJ B;  3NTH A;  4EMK B;  2O4X A;  3V8K A;  1KHC A;  3OA6 A;  2QQS A;  2PUK B;  3MEW A;  4RG2 A;  1BI0 A;  1R8O B;  3A8O B;  4M77 E;  4N0A A;  3SWN B;  5CCA A;  4MML A;  5CR2 A;  2EQJ A;  2HQE A;  2RHY A;  3HPW A;  3GOX A;  3JCM g;  4FIB A;  4ZN3 A;  1Q86 C;  2ZZD A;  3HKS A;  3S3N A;  1KG1 A;  1Y96 B;  5FU7 B;  3I55 A;  3CXC A;  4M78 A;  4BE1 A;  2JUF A;  4C8Q E;  2M16 A;  1XNI A;  4BUG A;  1ZHI A;  3QBY A;  2EJF A;  5CK9 A;  3GF5 A;  3HRT A;  1VQO A;  2LC4 A;  2RHU A;  4M7A E;  5CKD A;  3ZFJ A;  4A4H A;  5GAN g;  1VQN A;  3VYH B;  2PVD B;  4X34 A;  1JJ2 S;  4J83 A;  2IVW A;  3C12 A;  2GQV A;  2CZ6 B;  2FL7 A;  2DXC A;  2LX9 A;  5HY6 A;  4C0Z A;  5LJ5 f;  1VQ9 A;  1IZ6 A;  2VUB A;  4JUV A;  4JDS A;  2E5Q A;  4N4G A;  3CPW A;  2V8J A;  4E7L A;  2RHI A;  4J7F A;  5GAN e;  2FHD A;  2KK4 A;  1LOJ A;  3VUB A;  4HCZ A;  2JOY A;  3SFM A;  1ZBX A;  1K73 U;  1S72 A;  2EAY A;  2ZPB B;  1JRI A;  5J3B A;  1G3Y A;  5I2M A;  4EPC A;  4J8O A;  2QA4 A;  2QEX A;  3DLL A;  3MP6 A;  3GP8 A;  3P8B B;  4M77 D;  1VQ8 T;  2MWP A;  3MCA B;  3P8D A;  3FB9 A;  4C8Q B;  5LJ5 h;  4JRK A;  2LTO A;  2PUO B;  4M78 F;  5EG2 A;  1OYX A;  4M75 D;  4HKE A;  4OGC A;  1WJQ A;  3CME T;  2I2L A;  3V7S A;  3OYN A;  4E7K A;  4PJO F;  4PNO A;  4C92 F;  5LJ3 j;  1VQ7 T;  2P0P A;  3MET A;  4GY5 A;  4Q5W A;  1BIA A;  4M7A B;  2C06 A;  4C5H A;  3OMC A;  4M75 F;  2K2V A;  3JB9 G;  1KQ1 A;  3MP8 A;  4JJN K;  4E7J A;  4M7D D;  1NE8 A;  4N4H A;  2ZPG B;  2LT1 A;  3DB3 A;  4MZP A;  5HKC A;  2BKD N;  3G71 A;  4MDX A;  4F7U B;  3RUX A;  3CCS A;  3TCJ A;  2K5L A;  3A5Z B;  3CCQ A;  4FM4 B;  1VIF A;  2E1H A;  4XQ3 A;  3QG1 A;  2EQM A;  4C0D B;  3JCM b;  3CCE A;  4D6W A;  2CYZ B;  1WPY A;  4XTY A;  2WSE E;  1V29 B;  4XTV A;  4Y91 A;  4ZGJ B;  5IN1 A;  2RO0 A;  4J7I A;  3SDZ A;  5GAM d;  3JB9 D;  1K8A C;  1WJR A;  4A54 A;  3CMA T;  5A0D A;  1DJ7 B;  5CKE A;  4XAX B;  3OBY A;  3M53 A;  3QII A;  3QPH A;  5GAN d;  4LD9 K;  3CC4 T;  2RHX A;  3MEV A;  2E70 A;  4OMF B;  4A4E A;  1VQL A;  4OP0 A;  3RMS A;  2CKK A;  3BDU A;  1KD1 C;  3VU3 C;  4C8Q C;  4M7D F;  3CCR A;  1YCY A;  2RI3 A;  2X4J A;  3E9G A;  4JLI A;  3PGG A;  2PU9 B;  4C8Q G;  2QI2 A;  2XDP A;  3M57 A;  3S6W A;  1G3T A;  2K5F A;  4OB3 B;  5GAO r;  2HNI A;  2QQR A;  1Q82 U;  4JRQ A;  4OF1 A;  2K5I A;  1MGQ A;  1NPP A;  4DOW A;  3FIF A;  4QQG A;  4M7A D;  2X4X A;  1YIT T;  4M7A G;  2PQW A;  1S72 T;  1WGS A;  4HCC A;  2EQU A;  1QVF A;  1UGS B;  4C0G A;  4HA8 A;  1Y96 A;  2RK2 A;  3JCM X;  3L2U A;  2QQ9 A;  4VUB A;  4BI8 B;  2DXU A;  1BI1 A;  1VQL T;  2YLB A;  2PVG B;  3KUF A;  3M9Q A;  2JTM A;  2DTH A;  2HD0 A;  2LDM A;  4L5G A;  5L8R E;  4C8Q D;  2XDD A;  5GAO m;  1N9S A;  1YIJ T;  3FLG A;  1H64 1;  3CC2 T;  3GLX A;  5D6X A;  4BI3 A;  3JCM d;  1MHN A;  3TRE A;  2D0Q B;  2DO3 A;  5GMK h;  1YJ9 T;  4M7D G;  4C0D C;  5J26 A;  4C92 C;  4PJO C;  4WF2 A;  3C95 A;  5GMK l;  2L89 A;  2VGN A;  4C8Q A;  4C8Q F;  5M9O A;  1WJS A;  3QJY A;  2VC8 A;  5GMK m;  4BE0 A;  2K3X A;  3DKM A;  2RJD A;  4E7I A;  3M4Y A;  2DXB A;  3OYM A;  3CC4 A;  1YIJ A;  1OZ3 A;  3G6E A;  4F7U E;  3VJP A;  3CCS T;  2OTJ A;  2KSS A;  3OW2 A;  2DIG A;  1YHQ A;  4KBM B;  2LRQ A;  4JRI A;  4QVZ A;  2HAX A;  2JTF A;  3JCM V;  4IKF A;  3F70 A;  3PFS A;  2R5M A;  4MZM A;  5GAM g;  2A7Y A;  4C5G A;  2D6F A;  4QQD A;  3VV0 A;  5GAN 8;  3OW2 S;  2ZGW A;  3HSB A;  4M7A A;  1BI2 A;  1BIB A;  4EMG A;  2EFI A;  3ZBD A;  4FT4 A;  3KXT A;  3LLR A;  1OZ2 A;  1OI1 A;  3X25 B;  3M59 A;  4XK8 E;  2Y4Y A;  1W2B S;  4OB1 B;  3OYG A;  1Q81 U;  3WVD B;  1VQ8 A;  1NJI C;  1UGP B;  5GAO n;  2VYT A;  3MO8 A;  2FB7 A;  2LNV A;  2R5A A;  2E64 A;  2RJC A;  5IT9 E;  2ZPF B;  3QJ6 A;  2EJ9 A;  3BY7 A;  4PLI A;  5D6W A;  1D3B A;  2DD5 A;  3S3O A;  2VGM A;  2OTL A;  1BI3 A;  1RI0 A;  3PTA A;  1N6A A;  1NZ9 A;  3NTI A;  3CMA A;  3CME A;  1M90 U;  5GAN 4;  2V8K A;  2GFU A;  4ATO A;  3E19 A;  5KE3 A;  4OVA A;  3JCM c;  5LJ3 e;  4R56 A;  2XD0 A;  5CKB A;  3JB9 J;  3ER0 A;  5KCH A;  2DTO A;  1Q7Y C;  4MDW A;  3RKY A;  1HXD A;  2EWN A;  5LJ5 e;  2LCL A;  1SSF A;  2LQK A;  3FEO A;  4XU1 A;  5CQY A;  4ELZ C;  1YHQ T;  3CCV T;  4GLK A;  3R6O A;  2VXE A;  4LD6 A;  3L2R A;  1VQO T;  1YJ9 A;  2RJE A;  1VQP A;  1KQS S;  1BKB A;  2YHT A;  4EMK A;  4C5E A;  3I55 T;  2QTX A;  5GAN h;  4M7D A;  1B34 A;  3FC3 A;  4YTL A;  2FVU A;  4ZTJ A;  3LYI A;  1JBM A;  1K9M C;  4JLG A;  1Y7X A;  5GAM e;  1Y71 A;  4J5Y A;  3CCM A;  5A0G A;  3PMI A;  3OYD A;  4CI0 C;  1KQS A;  1EIF A;  1B34 B;  1W4S A;  4M78 B;  2ZPE B;  3L1A A;  5LJ5 j;  5GAM h;  5GMK i;  1YIT A;  2XKO C;  4DA4 A;  2OTJ T;  2O01 E;  1G3W A;  3HP9 A;  3CCM T;  3M5A A;  4N4I A;  5GMK j;  4M75 A;  1UGR B;  3LH0 A;  1VQP T;  2P4T A;  4M7D E;  5CVI A;  2EYQ A;  5LJ3 f;  3CCV A;  2F5K A;  1PSF A;  4M75 B;  3J7A F;  3HFN A;  4N0A C;  2B8A A;  1O9S A;  2EJG A;  2KVQ G;  3SB2 A;  1Q86 U;  5GAM f;  3RER A;  2DK3 A;  1YI2 A;  4F7U G;  2XID A;  4FSX A;  2GF7 A;  2QDY B;  1QVG A;  5CIU A;  1H3Z A;  3CPW S;  4ZGE B;  3BFM A;  3E1S A;  5LJ3 h;  4Y28 E;  3S3M A;  3H8Z A;  4M77 B;  1M1K C;  3CPF A;  3VKI A;  1VQN T;  3HFO A;  5CKF A;  3T9N A;  3A8L B;  4E7H A;  2LQ8 A;  1UGQ B;  4M78 E;  4CRI A;  3CCJ A;  4O5V A;  3OYE A;  4F7U A;  4M75 G;  1KC8 C;  1QVF S;  3UT1 A;  1I5L A;  3TEE A;  5CKH A;  3CCQ T;  3A8H B;  2DD4 A;  5AYF A;  2DJZ A;  4OGE A;  5HK0 A;  4M77 A;  1NJI U;  1VQK T;  3L2V A;  3FJP A;  3V7C A;  1M9S A;  1YJN A;  2GFA A;  4A4G A;  3INZ A;  4QW2 A;  5IAY A;  2MWO A;  1GXI E;  2RB6 A;  3OYK A;  2L5Q A;  1VQ5 A;  4LDW A;  5GAN 5;  1JJ2 A;  1QP2 A;  4IUQ A;  2YRV A;  3URG A;  3LX7 A;  5C0M A;  3OYI A;  2EIF A;  4XTZ A;  3CBM A;  3ME9 A;  4X9D A;  3CXC S;  5GAN 7;  3AHU A;  3SD4 A;  4QVC A;  3OYB A;  5KH6 A;  3M4G A;  5GAN 6;  4BD3 A;  1Y07 A;  2XU8 A;  3OSS C;  1KC8 U;  1VQ5 T;  1M8V A;  1K9M U;  2PVO B;  1VUB A;  5LJ3 d;  4M77 F;  4X9C A;  3UDC A;  2MF2 A;  3M55 A;  1NPR A;  2QA4 T;  4C5I A;  5LJ3 g;  4L6V 5;  3PIO A;  4M7D C;  1X01 A;  1WNL A;  2QQA A;  3QO3 A;  3G71 T;  4LDY A;  5CAI A;  3TU4 K;  1M4Z A;  3OS0 A;  3OYJ A;  3G6E T;  2RJF A;  3OYL A;  4BDZ A;  4M7D B;  2XIC A;  3M54 A;  4BI4 A;  1WQW A;  2KAF A;  4PLL A;  4C92 B;  4PJO B;  4LDU A;  5GMK e;  2WSF E;  3G4S T;  3OS2 A;  4EDU A;  5KE2 A;  3CCJ T;  3C94 A;  3X24 B;  4P5N A;  1VQ7 A;  2G3R A;  4NS5 A;  3WVE B;  2WAC A;  1O75 A;  3GPL A;  4M7A C;  3JCM f;  3HRU A;  3M56 A;  4A4F A;  1VQ6 A;  3GNF B;  3OMG A;  3JCM P;  1ZQ1 A;  4J6W A;  4BAC A;  3LW5 E;  4IUP A;  1LNX A;  2P0Q A;  4QQ6 A;  3HRS A;  4R55 A;  2RK1 A;  2VV5 A;  2QEX T;  2DIQ A;  5DLO A;  3RMQ A;  4IUT A;  3DB4 A;  3OS5 A;  4B9W A;  3JCM W;  2A3L A;  5J39 A;  3PIP A;  1QW1 A;  3X20 B;  3G4S A;  3QKJ A;  2MMP A;  2E10 A;  2RM4 A;  3P8H A;  2KDS A;  3CEY A;  2JVV A;  4NL2 A;  3L2W A;  1AHJ B;  1U1T A;  1KHI A;  2HQX A;  3L42 A;  4JS4 A;  2RA2 A;  1VQ9 T;  1G5V A;  4BY6 C;  4FT2 A;  3SWN C;  5FRO A;  3I56 T;  1YBY A;  2R58 A;  5A2Q E;  4ZN1 A;  1TH7 A;  4M78 C;  1FWZ A;  3OYF A;  3JCM Q;  4OB0 B;  2K4Y A;  4C92 E;  3RIR A;  4PJO E;  2JNG A;  2X35 A;  4M78 G;  4C92 D;  3PT9 A;  4PJO D;  2CS7 A;  1QVP A;  2CZ7 B;  4NL3 A;  1Q7Y U;  2XG8 D;  2E6N A;  1I4K 1;  4M75 E;  5FU6 B;  4A4K A;  3OSV A;  3NTK A;  4RCB A;  3OYY A;  3KBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...