1MHNA

High resolution crystal structure of the smn tudor domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
b'LQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Survival motor neuron protein
publication title High Resolution X-ray and NMR Structures of the SMN Tudor Domain: conformational variation in the binding site for symmetrically dimethylated arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1mhnA00
3GOXA 4QQ6A 2LRQA 3OS0A 4B9XA 3LH0A 3SD4A 3NTIA 2EQMA 5CIUA 2K3XA 3O8VA 2O4XB 2RI2A 3OYMA 2RHZA 2MWOA 4E7HA 4UC4A 3LX7A 2K3YA 1WGSA 2RO0A 3PFSA 4PL6A 2O4XA 1RI0A 1SSFA 3C4SA 2R58A 3DB4A 4N4HA 3S6WA 3OYDA 3BDLA 2R5MA 4A4EA 2XDPA 4BE0A 2D9TA 2GFAA 2VYTA 2DIQA 3P8HA 3MEVA 2E5QA 3ASKA 1OZ3A 2EFIA 4QVZA 3OA6A 3FEOA 2PQWA 3OY9A 3L2UA 2NLUA 3ZEHA 3FC3A 3KUFA 2EKOA 4C5EA 3OMCA 3FDRA 4II1A 4RG2A 4C5HA 3CEYA 5D6YA 3ME9A 4C5IA 3OYCA 3S3OA 2QQSA 4IKFA 5C6SA 2L89A 1N27A 2LDMA 3MP8A 2X35A 3QIIA 2M16A 5C0MA 1OZ2A 1OI1A 2LTOA 2BUDA 3DB3A 3OYKA 4QQGA 4Z02A 3UWNA 3MEWA 3OYAA 2RJCA 5D6XA 5IN1A 1WJSA 2G3RA 3OYGA 2RHXA 2CKKA 2RHUA 3H6ZA 4IUTA 2X4YA 4N4GA 4HCZA 4E7LA 2LCCA 2BIVA 2M0OA 3P8DA 3E9FA 3OS1A 3OYIA 3OYEA 5FRMA 1H3ZA 4IUUA 1G5VA 3L2VA 2IG0A 4A4HA 5KCHA 4LD6A 2FHDA 3PNWC 3L2QA 1MHNA 3E9GA 3NTKA 4IUVA 4ZTJA 4A4FA 5J39A 2GF7A 3MO8A 3S3NA 1KHCA 5M9OA 3L2WA 3LYIA 5KH6A 4E7JA 2EQJA 2BKDN 2X4WA 2EQKA 3MP6A 3QKJA 2JTFA 2R5AA 2XK0A 3OYBA 4BE1A 2B8AA 3QBYA 3S3MA 3MEAA 4Q5WA 2L8DA 3UT1A 4IURA 1WJQA 4E7KA 1WJRA 3OB9A 2EQUA 4IUQA 4PLLA 2DAQA 4EDUA 2RJDA 2R57A 3OS2A 4BACA 5KE3A 4BD3A 3OYNA 3L2RA 4A4GA 3L42A 3MP1A 4PLIA 3OYLA 3LGLA 4ZTFA 3Q1JA 4B9WA 2HQEA 5FRNA 4QQDA 4BE2A 1OYXA 5IAYA 2RJFA 3META 5J26A 5KCOA 4L59A 3LGFA 4FL6A 5FROA 3NTHA 2WACA 4NS5A 2L3RA 4FU6A 4N4IA 2YRVA 2F5KA 3PMIA 5KE2A 3QJ6A 4E7IA 3LLRA 5D6WA 2RHIA 2JZ2A 4C5GA 4X34A 3OYFA 2GFUA 3F70A 3M9QA 3OYHA 3OMGA 2M1HA 3OQ5A 3H8ZA 3OYJA 4CRIA 3FLGA 3PMTA 4BDZA 2MWPA 3DLMA 4GY5A 2LVMA 3MEUA 2QQRA 2RHYA 4IUPA 2RI3A 2HQXA 2E6NA 4OVAA 2P0KA 2RI5A 4BDYA 1XNIA 3EAEA 2RJEA 4QW2A 2DIGA 2X4XA
chains in the Genus database with same CATH superfamily
3X25B 1KC8C 2LRQA 2HBWA 4KGVB 1WZOA 3O8VA 4MMLA 2O4XB 2RI2A 3GF5A 3M0UA 4OMMA 1C0MA 2QEXQ 1WHLA 4C8QD 1D3BA 1E7OA 5KYUA 3OW2A 2EYZA 3VS6A 5GAN4 1MV3A 4QVZA 5IXFA 2JM8A 3KUFA 1TUGB 2JMAA 2BTTA 2FO0A 2COYA 3EG0A 4OMFB 1BCMA 4DEXA 3CC2Q 1YFNA 3EGUA 3ME9A 1T3LA 4OP0A 1VQLT 4IKFA 2L89A 4CC3A 3JB9D 1VQOQ 1N8RR 2HKQB 1QCNA 1U5SA 1ZSZA 4Z02A 3MEWA 1GBRA 3WVDB 1WHMA 2G3RA 4C92F 1YHQA 2CKKA 4FYYB 5GMKh 3SEMA 2VVKA 5EG2A 1XTDA 2KK4A 4XTZA 1G3TA 1ZHIA 5GAOp 2NYSA 1NLOC 2A08A 1I07A 1G3WA 2GF7A 1VQKT 1EZZB 1X6GA 3M0TA 3X28B 1QWFA 5IHNA 4MZTA 1WLPB 1HXDA 2R5AA 2ZPIB 3MEAA 3M58A 3UT1A 1D1BA 2HZYA 3OB9A 4AMCA 1MV0B 1JEGA 2M02A 4J83A 1UEBA 2JOYA 1SRLA 2L2PA 2RJFA 2YRDA 4FU6A 4MDXA 2PVDB 2B86A 1D3BB 4F7UG 1ZA1B 1FMVA 3VYHB 4J7IA 4M7AG 3A8MB 1VIFA 2DF6A 3MEUA 2QQRA 2RHYA 1VQ4T 5GAMe 1DJ7B 3VS5A 1WX6A 2KROA 2MI6A 3LH0A 3NPFA 4KULA 1ZSZB 1OU8A 2A3LA 5HCKA 2QGFB 1AWXA 3CC4Q 1WHHA 3V7SA 1VA7A 1KC8R 3CCUA 2RPNA 3CXCP 4M7DF 2GFAA 2FZCB 2DIQA 1NG2A 2XU8A 3ZEHA 1I1JA 3I56A 1FWZA 1Y96A 1D1CA 4AG1C 3CCEA 4HT9A 1PC0A 2GTJA 1N27A 2CZ7B 2M16A 4KH0B 2BUDA 2EYXA 1Y57A 5KYWB 4ESRA 4M77D 1TG0A 2E41A 1AWWA 1JJ2P 3I35A 1R0CB 2QDYB 1R0BG 5CAIA 3JV3A 5FRMA 2K5IA 4IUUA 4KGZB 1MMNA 1GXIE 1UFFA 3E9GA 1C6VX 5J39A 3S3NA 4FIBA 3HL8A 5KH6A 2QQAA 1GRIA 5CO7A 1AZGB 1OV3A 4M78C 1UJ0A 3RMQA 3NGPA 1IGUA 4LDWA 3CCVQ 1VQPA 2D8HA 2RH2A 1M2VA 1MMGA 2DAQA 2EQUA 2P84A 3OYNA 3L2RA 1QP3A 1NJIR 2EGEA 1B34B 3WVEB 4A54A 4RMOA 5CKDA 2PUOB 2EJ9A 2WACA 5I2MA 1NYFA 4OB0B 1ABOA 4RTZA 2ZPGB 4M75E 1YNZA 1QWEA 2DXCA 2RB6A 1Y96B 2EWNA 2QA4Q 2LT1A 1G83A 5GMKe 1NEBA 2RI5A 1WHKA 3VUZA 1K9MU 4M7AA 5GAN2 3CBOA 1X75C 3MKDA 1M8VA 3LWHA 2F69A 3TQ7P 1I0CA 3VS2A 3ER0A 2ZPHB 4KBMB 2XIDA 4BY6C 2KAFA 3CMAQ 1NYGA 1Q7YU 3ZBDA 1BB9A 4R56A 2CDTA 1RAEB 2QDLA 2YUPA 1UGPB 2NLUA 2QQ9A 1LJOA 2EIFA 2F5TX 1QVGS 4J7FA 3RESA 3MP8A 3A8GB 1MUZA 1UGVA 5EC7A 3V8LA 1FMWA 2HNIA 2FYKA 5HY6A 5GANg 1QQJA 2AHJB 3H6ZA 1U8RA 2ZGWA 2VXFA 2LCCA 4PJOA 5KYXB 1E6GA 3E9FA 3OYEA 4J9CA 2DL8A 4J9FA 2QYZA 3CCLQ 1IXDA 1JQQA 5GAN3 3CCRQ 1KD1R 2LJ0A 1VQNA 4LUEA 2X4WA 2YT6A 4JS5A 3CCMT 1XOVA 1K1ZA 3EGXA 1YIJA 1Q81U 1OX9A 1YJWA 4F7UB 2CYZB 2BZYA 1W1FA 2P4RA 3EHRA 5IHKA 2KQWA 3HTRA 3CBMA 3UPUA 1X43A 3JB9J 1KG1A 1UDLA 3VU3C 5J26A 2DX1A 4FL6A 3NTHA 1KQSP 2YRVA 1VQKA 2E12A 1VUBA 4ZGEB 3OYHA 2VGNA 2JM9A 5LJ3f 5LJ5j 2RQWA 1M1FA 3FRNA 2K4YA 1T3SA 3RR6A 3QG1A 1GCPA 1QKWA 5CR2A 3P8BB 1Q86U 2E3IA 3CC7Q 1M2OA 2MWOA 1KIKA 4HVUA 3REBB 2HEQA 1K0XA 3I9QA 1D0YA 4JLIA 2FRWA 1O9SA 4K11A 2R5MA 3EGDB 3V7CA 2EFIA 3FC3A 3SDZA 2EKOA 3JCMJ 4D8KA 4RG2A 2XICA 1UGRB 4M75G 4JPBW 2J05A 4DEYA 4LUDA 3G71A 1YITQ 2LDMA 4O5VA 2YUNA 4OMNA 1B3QA 2MYSA 1VQ8Q 4RCBA 2JJ9A 4OF1A 3EGXB 3UWNA 5IHIA 1YHQT 5D6XA 3OYGA 2FRYA 2ZCFB 1BBZA 2F1LA 1GFDA 2J06A 4KUIA 1Y0MA 1TUCA 1H3ZA 2IG0A 5GAN6 3VJPA 1Q86C 2X3XD 3M0RA 1LCKA 1U1TA 1MNDA 4M77F 2DL7A 2RA2A 4C8QC 3CMEA 1VQ6A 3MP6A 4NOYA 2EJGA 3RBBB 2DMOA 1NZ9A 4Q5WA 4OMLA 2EGCA 3CXCA 1AOJA 1WJRA 2J6KA 2DRKA 4OGEA 4A4GA 2J7IA 1M30A 3LGLA 3PVQA 3RNJA 3RERA 1NBEB 3MHXA 3U23A 2LQWA 1Q95G 2CSIA 5ECAA 2L3RA 5LJ5g 3E1SA 3NFCA 3OBYA 2CZ1B 1BYMA 1B07A 2YLCA 1JJ2A 4MZMA 1X6BA 2HSEB 5GAN8 5GJVB 1RADB 4XTVA 3UATA 3HPWA 4XU0A 2G6FX 1MMDA 4ATOA 1T0HA 2ZPFB 4JUVA 2EQMA 4F14A 3JAME 2ROTA 2CS7A 3CCUT 3PVLA 1KQ1A 4M7AD 1SHFA 1PSFA 1V1CA 3I56T 2P4TA 3E19A 1AHJB 2HL5C 3CEYA 4GLMA 3CCET 1NPRA 4C5IA 1UG1A 5GAOq 5C6SA 5FU7C 2OAWA 3J7AF 3CC4T 1OI1A 2RQUA 2YWWA 4Z89A 4M75A 1WJSA 4KRTA 3G4SQ 1OPKA 5A0DA 3MJXA 1G5VA 3L2VA 4HXJA 2M51A 3PNWC 1UE9A 2LP5A 3CQTA 4A4FA 5GAMj 2L0AA 2ENMA 2AK5A 2DTIA 3LYIA 4E7JA 2DD5A 3I55Q 2NUPA 2ZAEA 1Q86R 3L1AA 1OULA 2B8AA 2SEMA 1JO8A 2DTOA 1K4US 4EDUA 2AKLA 4KT0E 5AYFA 1IB8A 4PFZA 1G3YA 4FT2A 3E2UA 2HL3A 1SEMA 2CT3A 4L59A 3UDCA 2Y90A 4WF2A 1JU5C 3TCJA 1Z9QA 5I11A 2RHIA 1YJNQ 4C5GA 1GCQC 3H9NA 4EMKA 2CT4A 1BI1A 1YWOA 4HCKA 1VIEA 1S72Q 1RLQC 1SRMA 4QT7A 1N9RA 4L5GA 2E6NA 1BU1A 1CKBA 1M9SA 1AVZC 3MCAB 3CD6A 3GOXA 4QQ6A 4M7DE 3QYHB 2RN8A 2ZPBB 1R8OB 1VYTA 3DKMA 2DBKA 1TH7A 1RI0A 4DA4A 1OU9A 3CCQQ 5GAN5 3HRUA 4C0GA 1VQ5A 3MEVA 4PJOE 3FEOA 3C12A 1WFWA 2KSSA 3JCMc 3OYYA 4DQ2A 3OBWA 3FDRA 1PD0A 1VQ7A 2KY9A 2QQSA 3QYGB 2NUPB 1YJ9Q 4LDUA 2DZCA 3URGA 2KNBB 1OOTA 3DB3A 1QW1A 2V26A 2NUTB 3V8JA 1IREB 1Q82C 4RG8A 2F2WA 1M3CA 3P8DA 2PVGB 5KYNA 4A4HA 5CKEA 5GMKj 1QVPA 1VYUA 3CCSQ 2DVJA 3SB2A 1VQNT 2KMTA 1WI7A 4HKEA 2XHCA 2V8KA 2X51A 1M90U 3JCMg 4M78F 1YIJT 5HKCA 2QTVA 1LOJA 4VUBA 2QEXA 1YJWT 4E7SA 1UJYA 2GQVA 4FM4B 2IIMA 2RJDA 1SKUB 1RAGB 4JRQA 3L42A 1KJWA 3Q1JA 1NM7A 4J9GA 4WTOB 3META 5I22A 3CC2A 3AT1B 2LZ6B 1VQOA 3INZA 3F70A 1UHCA 3VS4A 4RTTA 3R6NA 5GAMf 1ZSZC 3H0HA 3O5ZA 2PTKA 1G8XA 2RI3A 4XTWA 2CP6A 2GGRA 3M55A 2DIGA 4NL2A 4Z8AA 1TUDA 3FIFA 1M90C 3VKIA 4JJDA 5GANd 2FEIA 5KYUB 3C4SA 3CCJQ 3ZL7C 3EFOA 1PG5B 3TSWA 1QCFA 2V8JA 2XDPA 4PJJA 2DD4A 1KK7A 4PJLA 4RTUA 2HBPA 2LJ3A 1YI2Q 1PKTA 3G71T 5I2SA 2EVRA 4J6YA 4F7UF 4PJNA 1FX7A 2K5FA 1OX8A 4AFZC 2E1HA 2RJCA 4JJBA 2PVOB 4BB7A 4M7DG 3L2ZA 4AFSC 5KCHA 4M75D 1QLYA 1TU0B 1WYXA 1UUEA 1RAHB 4IUVA 5L8RE 1Q82R 1PNJA 1YITT 2EYYA 3EG2A 4DBHA 2H8HA 2CUDA 2EQJA 1N6AA 4PJOG 3CMET 4C0ZA 1VQ6T 3CC4A 3C95A 5D7UA 2XK0A 1K73U 3BW1A 4IUQA 3VV0A 4BACA 3KBGA 2JTMA 4DBRA 4F04B 4QKUA 5KE3A 3GLXA 1D1AA 2HQEA 1HSQA 3VS1A 1OYXA 3QDFA 2DXBA 3CPWP 4C92A 4R55A 5LJ3j 1WIEA 3EFOB 1K8AU 2JZ2A 2DBMA 2CUBA 2CREA 3M0PA 1ZBXA 2GCXA 3JCMP 4OMPA 2MWPA 2RK1A 4HA8A 2P0PA 4ORZA 3EAEA 3CXCS 1ZSGA 2HSPA 4RUGA 3G1JA 5GANh 2FG0A 3EG9A 4C0FA 1PM3A 1LVKA 1K73C 4PL6A 1A0NB 2LQNA 2C06A 1SG5A 2D9TA 1M90R 3CCVA 5A2QE 4FYXB 1WXTA 2XD0A 4RTXA 4AT1B 2K9GA 1JJ2S 3RIRA 4D6WA 2BZXA 2PZ1A 2QK0A 2WSCE 2J6OA 1K8AC 2L3QA 2D0QB 1RAFB 2LTOA 2E3HA 3M0SA 3OS5A 3QJYA 2VGMA 2L3SA 2DYBA 2IVWA 3HHTB 1AZEA 3M56A 4LN2A 4A63B 5FWBA 1BK2A 4X9DA 1VQ9Q 3MPUB 4R0KA 2DL4A 4J6WA 2QA4A 3X20B 3NTKA 1PCXA 2HCKA 3TREA 4M7DA 5M9OA 2RD1A 5LJ5d 3JCMV 4EPCA 4M7AC 2JT4A 2A7YA 4C8QF 3CMAA 1M2VB 1PRMC 4BE1A 3QBYA 1WJQA 4FW2A 2FPFA 1H3HA 3JB9I 4AFQC 5LJ3g 3VUBA 1K9MC 1IGQA 2WSEE 4AFUC 3BFMA 1VQLQ 5KCOA 1TXQA 2A0FB 3JB9F 3EH2A 5KE2A 3I55T 1Q7YC 1CSKA 2DERA 1TOVA 3JCMX 5CKBA 3OSSC 3OYJA 4CRIA 2K2MA 3FLGA 3CBPA 2MIOA 2MOXA 4IUPA 4M7AB 2HDAA 3CD6T 4QW2A 5CQYA 1QVFP 8ATCB 4PJOC 2RMOA 4BUGA 3CCLA 3NHNA 3CCRA 1X2QA 3EG1A 2F2VA 3PGGA 1HJDA 2R58A 3BDUA 4NL3A 3S6WA 3OYDA 4LDVA 4A4EA 2OTJQ 1VQ5T 1P92A 3HP9A 1QP2A 1ZX6A 4LD9K 1WNLA 4JRPA 4M7DB 4ANJA 5GMKl 1VQ7T 5IH2A 5GANf 2DILA 4E2FB 1TTHB 5C0MA 1OZ2A 2AZSA 1SF9A 2OTLQ 1K76A 2V1QA 3OW2P 1Q81C 4PJOB 1B7TA 1K8AR 2K6DA 1HYOA 3LH5A 1W2BP 1N5ZA 1H641 2BIVA 1VQ4Q 4O6JA 1BCOA 4XQ3A 4YTLA 3L2QA 2KEAA 5LJ5h 1VOMA 5DM7R 5A0GA 1SHGA 1KQ2A 3RKYA 1AEYA 1X27A 3CC7A 2AT1B 3A5ZB 3SWNA 3S3MA 5GANe 1I4K1 3WXMB 2QEXT 4IURA 4B6MA 1D0XA 5KYYA 1O75A 2DJQA 3C0CA 3V8KA 1T0JA 5FW9A 2AIRB 2ATCB 3KFVA 2C0IA 3CC2T 3QDRB 1YITA 1VQOT 4IIOA 1K9MR 1VQ8A 4XTYA 4FSSA 1EX4A 5GMKm 1PHTA 2CH4W 4N0AA 1Q7YR 4LNPA 2M0YA 4J9BA 3M59A 2JUFA 2GNCA 7AT1B 2VB6A 1OPLA 2CZ0B 6AT1B 4PFPA 4FYWB 4LDYA 2O31A 4N4HA 3BDLA 2X3WD 3JCMQ 2CP3A 3P8HA 2BE7D 1WHGA 2EYWA 3GIBA 3OMCA 4OB1B 4LDXA 4Y91A 4II1A 4XK8E 1K0SA 3OYCA 3S3OA 3CPWA 3QIIA 2QXFA 2VC8A 3TVTA 3SWNB 3JCMd 3G6EQ 2I0NA 5KYYB 2DVEA 1YCYA 2X4YA 4HCZA 4JZ3A 3TEEA 1QKXA 1JXOA 2ZPEB 3FJ5A 4LD6A 1Q81R 1YI2T 3I5RA 4M78E 4RTYA 2DA9A 1SPKA 2D8JA 4FT4A 4C92E 2KRSA 1XJWB 2DXTA 2BKDN 2E65A 1X6OA 5GAOn 1H8KA 1MGQA 1VQMQ 4BI4A 1ZQ1A 4M7DD 5FWCA 3R6OA 2DEQA 2CP5A 2QAZA 2MCNA 1Y07A 2FZGB 1UB4A 2HMAA 4OMOA 3A98A 4PJOD 1GFCA 1R77A 1RLPC 2KYMA 2M1HA 3OQ5A 4CC2A 2X9HA 2DL3A 4DOWA 1ZUYA 4XU1A 2WSFE 2DM1A 4M75C 3G4SA 3M54A 4OVAA 1W4SA 4M77A 2HD0A 3ULRB 4X9CA 3UA7A 1VYVA 3OS0A 2KVQG 5GJWB 3M57A 3OYMA 4JJNK 4C0DC 2K79A 2LT4A 2X4JA 3I55A 3D7SB 3PFSA 3CCMQ 2O4XA 1AD5A 1SSFA 2JS0A 3SHWA 2W0ZA 1X01A 3CCVT 5CKFA 2E5QA 1TS9A 1OZ3A 4EMHA 2J6FA 3BE3A 2RF0A 1NLPC 1WQ7A 4ELYC 2L5QA 3GNFB 3RUXA 3DLLA 4M75B 3JCMh 2LCSA 1RAIB 2ED0A 1S1NA 2EGAA 2D1XA 2EBPA 4ZN3A 1YJNA 4FYVB 3FJPA 4OB3B 4RKUE 4V2SA 4RTWA 1S72A 2RK2A 4EMKC 3OYIA 2QA4T 4C0DB 2DPPB 1BI0A 2KXDA 1MHNA 1QVFA 2EYQA 3PIPA 2Y4YA 4RTVA 3UF4A 3QWXX 1KQSA 3C94A 3CMAT 5I21A 2O9VA 3OYBA 2RQVA 3QSUA 3OSVA 3CCQA 1OQKA 4OMQA 2Y4XA 1E6HA 2EAYA 1QMCA 5GAMg 1D0ZA 3QWYA 4PLIA 2GQIA 3QHSA 5FRNA 4QQDA 1IHVA 3GP8A 3GNGA 2F5KA 4EMKB 1YJ9A 3QJ6A 4E7IA 2JVVA 2MF2A 3HFOA 2C0TA 1YHQQ 3M9QA 2FZKB 2DRMA 3OMGA 3EG3A 2VV5A 3PMTA 2XG8D 3A1PA 1NJIU 1H92A 4M78G 2E6ZA 3ZFJA 1W2BA 4C92G 2COZA 4PK4A 1ZUUA 2HQXA 1AT1B 2RJEA 4ELZC 2Z0WA 2H3JA 2QASA 2EJFA 3CCLT 4B9XA 4FSXA 2CH4A 3J80E 3NTIA 2RQRA 3CCRT 3CCSA 2MAMA 2QG9B 2K3YA 1WGSA 4J9IA 1U1SA 2KT1A 1UGSB 2PQWA 3T9NA 3H0FA 2VUBA 1JXMA 4LXCA 2EKHA 3GBQA 4IIMA 1X69A 1ZLMA 4QQGA 4J8OA 5FLXE 1NJIC 2OTJT 5KYWA 2LX9A 2H3EB 4E7LA 3V7RA 4HVWA 2K7AA 1M3AA 3IQLA 3LWIA 1BIBA 5LJ3d 4ZGJB 2K5LA 1YCSB 4C8QE 2RM4A 1LNXA 4CC7A 3QPHA 4ZTJA 3JCMf 4PJMA 2JXBA 1UHFA 4MDWA 1KHCA 4XU3A 3VS0A 1X2KA 3CC7T 2OTLT 1NEGA 4M7AF 2O9SA 3CCUQ 5DLOA 1PSEA 3A8LB 2AZVA 2PNIA 1JBMA 3QO3A 3CCJA 4CI0C 4PLLA 3JB9H 2R57A 3I56Q 3OYLA 1KD1U 2LQ8A 2XDDA 3CCEQ 4BE2A 1W70A 1UGQB 1YI2A 2NWMA 3NMZC 3PTAA 1B34A 2QTXA 2DO3A 3N5BB 1VQ8T 2EW3A 3LLRA 1GBQA 1ZA2B 2XKOC 5IXBA 5L23A 2DZ9A 1RACB 2E5KA 1Z9ZA 3EH1A 3JCMe 4BDZA 1U3OA 2DEUA 5CK9A 4J9EA 1IZ6A 1RL2A 4E7ZA 4CC4B 1KHIA 2CZ6B 4Z88A 3GPLA 2LMJA 1IHWA 1M1GA 4PJOF 4M78A 3SD4A 2PUKB 1PKSA 4HVVA 2RHZA 4DBQA 2I2LA 4E7HA 4L6V5 4UC4A 5HK3A 1VQPQ 2KE9A 2FPDA 1AWJA 1C1AA 2VYTA 1KD1C 2HQHA 3ASKA 2KBTA 3OY9A 5GANj 2HKNA 1M27C 5DLQE 1Y71A 1D09B 2YXYA 5GMKi 3J81E 2O01E 4Y92A 4QVCA 2X35A 5CVIA 3QZ5B 2OI3A 1WDXA 4Y28E 4J9DA 2YDLA 4C92C 2LNHB 4IUTA 2D6FA 3RKWA 1QVGP 5LJ3h 2XDBA 3H41A 1YP5A 1WQWA 2ESWA 5KYXA 1TWBA 2FHDA 1IRXA 2JTEA 4PKCC 2ZZDA 1LPLA 1KFZA 3JCMW 3L2WA 2E4HA 5A0LA 4XTXA 4BI3A 3CPWS 3G6ET 3RMSA 2BE9B 4KH1B 1FYNA 2LQKA 1EFNA 3M4GA 4BD3A 5CCAA 4F7UA 3PIOA 4B9WA 4M78B 4DOVA 4M77E 3PT9A 1PD1A 2O2OA 5IT9E 4C92B 3HKSA 1K9AA 3X24B 2CSQA 2OJ2A 4NS5A 2ED1A 2YUQA 4HCCA 1M4ZA 2DNUA 1HK9A 1VQMT 2RNAA 3DLMA 4C8QG 3EFRA 3G4ST 4OB2B 3HFNA 1VQ9A 1XNIA 2DJZA 2ROLA 4EIKA 2K3BA 1RABB 3EG9B 1VQNQ 1WA7A 2K3XA 3JB9G 3LX7A 2RO0A 2KT8A 1YIJQ 1Y7XA 4M7DC 1BI3A 1YJWQ 4BE0A 2CP7A 2MK5A 2A28A 2CP2A 3EGDA 2KXCA 4BY6B 4C5EA 1BI2A 2JN0A 4C5HA 5D6YA 1YN8A 1VQLA 1VQKQ 4MMKA 2DK3A 3AHUA 2KI7A 4J5YA 4M4ZA 1N9SA 1JRIA 3OYAA 1YJNT 2KYBA 2VASA 3VRZA 2GTOA 3CPFA 1S72T 2IPOB 2YLBA 3QXEB 4E47A 4JRIA 3RDVA 1K73R 2ABLA 2D0NA 4D8DA 1PRLC 3I5SA 4PNOA 1WHJA 2KGTA 2DETA 4X1VA 4KGXB 4F17A 3RKXA 1RI9A 3EHQA 2YHTA 4FW1A 3CCQT 3JSCA 2L8DA 4E7KA 2E70A 1J3TA 1ZBJA 2OTJA 2VKNA 3G7ZA 3TSZA 4P5NA 4E6RA 4QVDA 4XU2A 2DLPA 1FMKA 4XAXB 2MMPA 3G71Q 4RCCA 3HRSA 2AKKA 3LGFA 3SFMA 5FROA 3JCMb 1V29B 1NPPA 1YJ9T 2L3PA 1QVFS 2VXEA 1RUWA 2JW4A 2YUOA 4X34A 3OYFA 2OX7A 1TSFA 4A4KA 2OTLA 4WCIA 1MNEA 2LNVA 4F16A 3HRTA 1KQSS 1FXXA 2LCLA 1W6XA 3A8HB 2LVMA 4J6XA 1I81A 3EFSA 4M75F 2QI2A 1VQ4A 5LJ3e 8AT1B 1HD3A 3UA6A 4C8QA 3CCST 1F1BB 3CMEQ 1VQ6Q 2E64A 4HCBA 1M1KU 2MPXC 2K57A 3DB4A 4M77G 2KRMA 4M78D 2BZ8A 2A36A 4AG2C 1M5Q1 3VS3A 4C92D 3OA6A 3SWNC 5J3BA 1SSHA 2DXUA 3M5AA 3OW2S 1XQHA 2DTHA 1W2BS 5CQXA 1U06A 5HK0A 1YWPA 2KRNA 2KDSA 2EQIA 3M0QA 1JB0E 1YBYA 5IN1A 2RHXA 2LJ1A 2A37A 5LL6S 4N4GA 5GAMd 1ACMB 2F2XA 1CKAA 4LE9A 3REAB 4N0AC 3VYGA 1WXBA 3MO8A 2XI9A 4HT8A 3TU4K 1M1KC 2V1RA 3THKA 1MMAA 2EQKA 3M4YA 3CCJT 2JS2A 1RAAB 2DE0X 4C8QB 2FPEA 2LC4A 5GAOr 3JRZA 1OEBA 1N8RU 3H0IA 1V76A 2EPDA 2FL7A 2DFUA 4JJCA 3QZ9B 4MZPA 2PU9B 3FB9A 4ME7A 1ZUKA 3H8ZA 1UTIA 1I5OB 1PWTA 4TVRA 3VS7A 3G6EA 3A8OB 2ECZA 2DYIA 2M9UA 1QVGA 4J9HA 4ZNXA 1BKBA 1EIFA 2QGGA 5GAOl 3HSBA 5LJ5f 2X4XA 3QUIA 2YSQA 1I5LA 1M3BA 2O88A 5CIUA 1ABQA 3KXTA 4KUDK 2RQTA 2P0QA 2HAXA 3X26B 1VQMA 3L2UA 2C0OA 2SRCA 2W10A 2YRCA 1N8RC 1G3SA 2COWA 1UECA 1QCOA 4JZ4A 4FCYA 4JS4A 1BIAA 1GCQA 2E10A 1GL5A 5GAN7 3BY7A 4OGCA 3OYKA 2K2VA 4BI8B 1KSWA 2NUZA 5LJ5e 4A53A 1VQPT 2FB7A 2GBQA 2KR3A 2RHUA 3M53A 5FU7B 2NUTA 5GAMh 3LW5E 2M0OA 4F7UE 3OS1A 4GBQA 4ZGDB 2QQBA 2V8IA 3CD6Q 4M7AE 1M8MA 2DL5A 2OAUA 4XTUA 1ARKA 2CP0A 2XMFA 1KC8U 4M77C 4JLGA 3VRYA 3QKJA 2FVUA 5FU6C 2JTFA 5GAOm 3CCMA 2VWFA 5AT1B 1VQ5Q 4JRKA 4DBFA 3OS2A 1I8FA 4PFOA 1M1KR 1Q82U 3MP1A 4ZTFA 4ZN1A 1G2BA 1NE8A 3PE0A 1VQ7Q 2DKGA 9ATCB 5IAYA 5CKHA 2JMCA 2JNGA 4EMGA 4N4IA 3PMIA 5DY9A 1WXUA 5D6WA 2GFUA 2LX7A 4GY5A 1IO6A 1WPYA 2CGHA 4M77B 1VQ9T 1AWOA 4JDSA 2P0KA 4BDYA 4GLKA 5FU6B
chains in the Genus database with same CATH topology
3X25B 3HPWA 3GPLA 4BUGA 1KC8C 4PJOC 2LRQA 1M1GA 4XU0A 4PJOF 3CCLA 4M78A 4ATOA 2ZPFB 4JUVA 3SD4A 2EQMA 2PUKB 3O8VA 4MMLA 2O4XB 2RI2A 3CCRA 2RHZA 3GF5A 2I2LA 3JAME 4E7HA 4L6V5 4UC4A 3PGGA 2CS7A 3CCUT 1KQ1A 2R58A 3BDUA 5HK3A 4NL3A 4M7AD 3S6WA 3OYDA 4C8QD 4LDVA 1D3BA 4A4EA 1VQ5T 2VYTA 3OW2A 1P92A 1KD1C 5GAN4 1PSFA 3ASKA 3HP9A 1QP2A 4QVZA 3OY9A 3I56T 5GANj 4LD9K 2P4TA 1WNLA 3E19A 3KUFA 4JRPA 5DLQE 1Y71A 1AHJB 4OMFB 4M7DB 5GMKl 5GMKi 1VQ7T 3J81E 3CEYA 3CCET 1NPRA 2O01E 3ME9A 4C5IA 4OP0A 5GANf 5GAOq 5C6SA 1VQLT 4QVCA 2L89A 5FU7C 4IKFA 2X35A 5CVIA 5C0MA 3J7AF 3JB9D 1OZ2A 3CC4T 1OI1A 3QZ5B 4Z02A 4BE1A 3MEWA 3WVDB 4Y28E 4C92C 4M75A 1WJSA 2G3RA 4C92F 1YHQA 1Q81C 2CKKA 4PJOB 5GMKh 4IUTA 2D6FA 3RKWA 5EG2A 5LJ3h 1XTDA 2XDBA 2KK4A 1H641 2BIVA 5A0DA 4XTZA 1WQWA 4O6JA 1G3TA 1ZHIA 1G5VA 5GAOp 3L2VA 4XQ3A 2FHDA 3PNWC 4PKCC 4YTLA 3L2QA 2ZZDA 4A4FA 5LJ5h 5GAMj 2GF7A 1G3WA 1VQKT 5DM7R 3JCMW 3L2WA 2DTIA 3LYIA 3X28B 2DD5A 5A0GA 4E7JA 1KQ2A 5A0LA 3RKYA 4XTXA 3CC7A 4MZTA 4BI3A 3A5ZB 3CPWS 1HXDA 3SWNA 2R5AA 3L1AA 2ZPIB 3G6ET 2B8AA 3RMSA 3S3MA 5GANe 1I4K1 3MEAA 3WXMB 3M58A 3UT1A 2DTOA 2QEXT 4IURA 3OB9A 4EDUA 4KT0E 2LQKA 3M4GA 4BD3A 5AYFA 1O75A 5CCAA 4F7UA 3PIOA 4B9WA 4M78B 4DOVA 4J83A 4M77E 3PT9A 1UEBA 2JOYA 1G3YA 4FT2A 3V8KA 4C92B 5IT9E 3HKSA 2RJFA 3X24B 4L59A 3UDCA 3CC2T 2Y90A 4NS5A 4FU6A 3QDRB 4WF2A 4MDXA 2PVDB 3TCJA 1YITA 1VQOT 1VQ8A 1D3BB 2RHIA 4C5GA 4EMKA 4F7UG 1BI1A 3VYHB 1M4ZA 1VIEA 4HCCA 4XTYA 1HK9A 4J7IA 4M7AG 5GMKm 1VQMT 3DLMA 4C8QG 3A8MB 1VIFA 3EFRA 3G4ST 4N0AA 3MEUA 4OB2B 1N9RA 2QQRA 2RHYA 3HFNA 4L5GA 2E6NA 1VQ4T 1VQ9A 1M9SA 5GAMe 1XNIA 2DJZA 1DJ7B 3MCAB 3CD6A 3M59A 3GOXA 4QQ6A 2MI6A 2JUFA 4M7DE 3LH0A 4KULA 3QYHB 2A3LA 2K3XA 2ZPBB 1R8OB 3DKMA 3JB9G 2CZ0B 1TH7A 3LX7A 2RO0A 3V7SA 1RI0A 4DA4A 4LDYA 1Y7XA 4M7DC 3CCUA 4N4HA 4M7DF 1BI3A 3BDLA 3JCMQ 4BE0A 5GAN5 2GFAA 3HRUA 4C0GA 2DIQA 3P8HA 1VQ5A 3MEVA 4PJOE 2XU8A 3FEOA 3C12A 3ZEHA 4BY6B 3GIBA 3I56A 2KSSA 3JCMc 1FWZA 4C5EA 3OYYA 1BI2A 1Y96A 3OMCA 4OB1B 2JN0A 4Y91A 4DQ2A 3OBWA 4LDXA 3FDRA 4II1A 4C5HA 1VQ7A 5D6YA 4XK8E 3CCEA 2KY9A 3OYCA 2QQSA 3S3OA 3QYGB 3CPWA 4HT9A 1VQLA 1N27A 3QIIA 2QXFA 2VC8A 2CZ7B 2DK3A 2DZCA 2M16A 4LDUA 4MMKA 3SWNB 3URGA 3AHUA 3DB3A 2BUDA 1N9SA 4J5YA 1QW1A 1JRIA 3JCMd 3OYAA 1YJNT 4M77D 2E41A 2DVEA 3V8JA 1YCYA 1IREB 3CPFA 1S72T 2YLBA 2X4YA 4HCZA 3TEEA 1Q82C 4RG8A 3QXEB 2QDYB 4E47A 5CAIA 3P8DA 2ZPEB 4JRIA 2PVGB 5FRMA 2K5IA 4IUUA 4A4HA 4LD6A 1GXIE 1YI2T 4M78E 5CKEA 4PNOA 3E9GA 4FT4A 1QVPA 5GMKj 4C92E 5J39A 3S3NA 4FIBA 3SB2A 3HL8A 1VQNT 2KMTA 5KH6A 2QQAA 2DXTA 2BKDN 2XHCA 2E65A 2V8KA 4HKEA 5CO7A 3RKXA 1X6OA 1M90U 4M78C 3JCMg 3RMQA 5GAOn 2YHTA 4M78F 3CCQT 1YIJT 1MGQA 3JSCA 2L8DA 4LDWA 4VUBA 1LOJA 5HKCA 1VQPA 4BI4A 2QEXA 4E7KA 2E70A 1YJWT 1ZQ1A 2EQUA 2GQVA 2DAQA 2RH2A 2RJDA 3G7ZA 4FM4B 3R6OA 4M7DD 2OTJA 4P5NA 3OYNA 3L2RA 4JRQA 3L42A 2DEQA 3Q1JA 1QP3A 1Y07A 4QVDA 4XU2A 4XAXB 1B34B 2MMPA 3WVEB 4A54A 4RMOA 1UB4A 3META 4RCCA 5CKDA 2PUOB 3HRSA 3LGFA 3SFMA 2EJ9A 5FROA 1V29B 2WACA 1NPPA 3JCMb 5I2MA 3CC2A 1YJ9T 4PJOD 1QVFS 4OB0B 2VXEA 1VQOA 2ZPGB 4M75E 3OYFA 4X34A 3INZA 3F70A 4A4KA 2OTLA 2M1HA 3OQ5A 5GAMf 2LNVA 2DXCA 2RB6A 3HRTA 1KQSS 1FXXA 2LCLA 1Y96B 3A8HB 2LVMA 4DOWA 2EWNA 4XU1A 2WSFE 4J6XA 2LT1A 4M75C 3G4SA 1I81A 5GMKe 2RI3A 3EFSA 3M54A 4M75F 4OVAA 1W4SA 2QI2A 2RI5A 4XTWA 1VQ4A 3M55A 5LJ3e 4M77A 2DIGA 2HD0A 4NL2A 3VUZA 4X9CA 1K9MU 4M7AA 5GAN2 3CBOA 4C8QA 1X75C 3OS0A 2KVQG 1M8VA 3M57A 3LWHA 2F69A 3FIFA 3CCST 1M90C 3ER0A 3OYMA 4JJNK 2ZPHB 4KBMB 4C0DC 2E64A 2XIDA 4BY6C 3VKIA 2LT4A 2KAFA 2X4JA 3I55A 3PFSA 5GANd 1Q7YU 2O4XA 4HCBA 1SSFA 1M1KU 2K57A 3C4SA 3DB4A 4M77G 2V8JA 4M78D 2XDPA 3ZBDA 4R56A 1X01A 3CCVT 1M5Q1 5CKFA 4C92D 2E5QA 1OZ3A 4EMHA 1UGPB 3OA6A 3SWNC 2NLUA 5J3BA 2QQ9A 2DXUA 3M5AA 2DD4A 3OW2S 1XQHA 2HBPA 2DTHA 1LJOA 2EIFA 1WQ7A 4ELYC 1W2BS 2F5TX 2L5QA 5CQXA 4J7FA 1QVGS 3G71T 5I2SA 3RESA 3GNFB 5HK0A 3MP8A 3A8GB 4J6YA 4F7UF 3V8LA 3RUXA 3DLLA 2HNIA 4M75B 1FX7A 2KDSA 2FYKA 5HY6A 3JCMh 5GANg 2K5FA 4ZN3A 2E1HA 1YJNA 1JB0E 1YBYA 2AHJB 2RJCA 3FJPA 4OB3B 2RHXA 4RKUE 5IN1A 4V2SA 3H6ZA 2PVOB 1U8RA 4BB7A 5LL6S 2ZGWA 4N4GA 1S72A 2VXFA 2RK2A 4EMKC 2LCCA 4M7DG 4PJOA 3L2ZA 5GAMd 3E9FA 3OYIA 4C0DB 3OYEA 2QA4T 2DPPB 1BI0A 5KCHA 4M75D 1MHNA 4N0AC 2EYQA 3VYGA 1QVFA 3PIPA 4IUVA 5L8RE 5GAN3 2Y4YA 1YITT 3MO8A 2XI9A 4HT8A 1VQNA 2EQJA 3TU4K 1KQSA 1N6AA 4PJOG 1M1KC 3CMET 2X4WA 4C0ZA 3C94A 1VQ6T 3CC4A 4JS5A 3C95A 2EQKA 3CMAT 5I21A 2XK0A 3OYBA 3CCMT 3QSUA 1XOVA 3M4YA 3CCJT 3OSVA 1K73U 3BW1A 3CCQA 1YIJA 2Y4XA 1Q81U 4IUQA 3VV0A 4BACA 1YJWA 3KBGA 2JTMA 2EAYA 2CYZB 4F7UB 5KE3A 5GAMg 3GLXA 4PLIA 3QHSA 4C8QB 2KQWA 2HQEA 3CBMA 3UPUA 2LC4A 5GAOr 3JRZA 3JB9J 5FRNA 4QQDA 1N8RU 1OYXA 1KG1A 3VU3C 2DXBA 5J26A 3GP8A 4FL6A 3NTHA 2FL7A 4C92A 4R55A 4MZPA 3QZ9B 2YRVA 3GNGA 2F5KA 4EMKB 5LJ3j 2PU9B 1YJ9A 1VQKA 3QJ6A 4E7IA 3FB9A 2JVVA 1K8AU 2MF2A 2E12A 2JZ2A 1VUBA 3HFOA 3M9QA 4ZGEB 4M7AF 4ME7A 3OYHA 3OMGA 3H8ZA 2VGNA 4TVRA 1ZBXA 2VV5A 3PMTA 2GCXA 2XG8D 3A8OB 5LJ3f 3G6EA 2MWPA 3JCMP 1NJIU 5LJ5j 4M78G 2E6ZA 2RK1A 3ZFJA 2M9UA 1M1FA 1W2BA 4C92G 1QVGA 3FRNA 4HA8A 2K4YA 2HQXA 1BKBA 2P0PA 1EIFA 5GAOl 3EAEA 3CXCS 2RJEA 4ELZC 3HSBA 3QG1A 2H3JA 5LJ5f 2X4XA 2EJFA 3CCLT 3QUIA 1I5LA 4B9XA 4FSXA 3J80E 3NTIA 5CR2A 3P8BB 1Q86U 5CIUA 3CCRT 3CCSA 2MWOA 5GANh 2MAMA 4C0FA 1K73C 3KXTA 2K3YA 1WGSA 4PL6A 4KUDK 4JLIA 1O9SA 2C06A 2R5MA 2D9TA 1U1SA 2P0QA 2HAXA 3V7CA 1UGSB 3X26B 3CCVA 1VQMA 5A2QE 2EFIA 3FC3A 3L2UA 2PQWA 2XD0A 3T9NA 3SDZA 2EKOA 3JCMJ 1N8RC 1G3SA 2VUBA 1JJ2S 3RIRA 4RG2A 2XICA 1UGRB 4M75G 4D6WA 4JS4A 1BIAA 2E10A 2WSCE 5GAN7 3G71A 1K8AC 2LDMA 4O5VA 3BY7A 4OGCA 4RCBA 2D0QB 2LTOA 3OS5A 3QJYA 4OF1A 3OYKA 2VGMA 2K2VA 4QQGA 4J8OA 4BI8B 5LJ5e 3UWNA 2IVWA 4A53A 3HHTB 5FLXE 1YHQT 1NJIC 1VQPT 5D6XA 2FB7A 3M56A 3OYGA 2OTJT 2RHUA 2ZCFB 3M53A 5FU7B 2LX9A 5GAMh 4E7LA 3LW5E 3V7RA 4KUIA 4X9DA 3LWIA 2M0OA 1BIBA 4F7UE 5LJ3d 4J6WA 4ZGDB 3OS1A 4ZGJB 2QA4A 2QQBA 2V8IA 1H3ZA 2IG0A 3X20B 4M7AE 2K5LA 2OAUA 4C8QE 4XTUA 2RM4A 1LNXA 5GAN6 3VJPA 1Q86C 3NTKA 3QPHA 4ZTJA 3JCMf 4MDWA 3TREA 1KC8U 4M7DA 1KHCA 5M9OA 2RD1A 4XU3A 5LJ5d 1U1TA 3JCMV 4M77C 4M77F 4EPCA 3CC7T 4M7AC 4JLGA 2OTLT 2RA2A 4C8QC 3CMEA 1VQ6A 3MP6A 3QKJA 2FVUA 2EJGA 4NOYA 2A7YA 1PSEA 2JTFA 3A8LB 5FU6C 4C8QF 5DLOA 3QBYA 5GAOm 3CMAA 1JBMA 1NZ9A 3QO3A 4Q5WA 3CCMA 3CCJA 4CI0C 4JRKA 1WJQA 3CXCA 1WJRA 4PLLA 3OS2A 3JB9H 2R57A 1I8FA 3JB9I 4OGEA 1Q82U 4A4GA 3MP1A 5LJ3g 3VUBA 3OYLA 1KD1U 2LQ8A 3LGLA 4ZN1A 4ZTFA 3RERA 1K9MC 1NE8A 3MHXA 2DKGA 2XDDA 2WSEE 4BE2A 3BFMA 5IAYA 1UGQB 5KCOA 1YI2A 5CKHA 3PTAA 1B34A 3JB9F 2L3RA 2JNGA 2QTXA 4N4IA 4EMGA 5LJ5g 3PMIA 5DY9A 5KE2A 2DO3A 3N5BB 1VQ8T 3I55T 3LLRA 1Q7YC 5D6WA 2XKOC 3E1SA 2DZ9A 3NFCA 3OBYA 2GFUA 2CZ1B 3JCMX 5CKBA 3OSSC 1BYMA 3OYJA 4CRIA 3FLGA 3JCMe 4BDZA 3CBPA 2YLCA 1JJ2A 4MZMA 4GY5A 1WPYA 5CK9A 5GAN8 1IZ6A 2CGHA 4M77B 4IUPA 1VQ9T 1RL2A 4JDSA 2P0KA 4M7AB 4BDYA 4XTVA 4GLKA 3CD6T 4QW2A 1KHIA 5CQYA 5FU6B 2CZ6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GOX A;  4QQ6 A;  2LRQ A;  3OS0 A;  4B9X A;  3LH0 A;  3SD4 A;  3NTI A;  2EQM A;  5CIU A;  2K3X A;  3O8V A;  2O4X B;  2RI2 A;  3OYM A;  2RHZ A;  2MWO A;  4E7H A;  4UC4 A;  3LX7 A;  2K3Y A;  1WGS A;  2RO0 A;  3PFS A;  4PL6 A;  2O4X A;  1RI0 A;  1SSF A;  3C4S A;  2R58 A;  3DB4 A;  4N4H A;  3S6W A;  3OYD A;  3BDL A;  2R5M A;  4A4E A;  2XDP A;  4BE0 A;  2D9T A;  2GFA A;  2VYT A;  2DIQ A;  3P8H A;  3MEV A;  2E5Q A;  3ASK A;  1OZ3 A;  2EFI A;  4QVZ A;  3OA6 A;  3FEO A;  2PQW A;  3OY9 A;  3L2U A;  2NLU A;  3ZEH A;  3FC3 A;  3KUF A;  2EKO A;  4C5E A;  3OMC A;  3FDR A;  4II1 A;  4RG2 A;  4C5H A;  3CEY A;  5D6Y A;  3ME9 A;  4C5I A;  3OYC A;  3S3O A;  2QQS A;  4IKF A;  5C6S A;  2L89 A;  1N27 A;  2LDM A;  3MP8 A;  2X35 A;  3QII A;  2M16 A;  5C0M A;  1OZ2 A;  1OI1 A;  2LTO A;  2BUD A;  3DB3 A;  3OYK A;  4QQG A;  4Z02 A;  3UWN A;  3MEW A;  3OYA A;  2RJC A;  5D6X A;  5IN1 A;  1WJS A;  2G3R A;  3OYG A;  2RHX A;  2CKK A;  2RHU A;  3H6Z A;  4IUT A;  2X4Y A;  4N4G A;  4HCZ A;  4E7L A;  2LCC A;  2BIV A;  2M0O A;  3P8D A;  3E9F A;  3OS1 A;  3OYI A;  3OYE A;  5FRM A;  1H3Z A;  4IUU A;  1G5V A;  3L2V A;  2IG0 A;  4A4H A;  5KCH A;  4LD6 A;  2FHD A;  3PNW C;  3L2Q A;  1MHN A;  3E9G A;  3NTK A;  4IUV A;  4ZTJ A;  4A4F A;  5J39 A;  2GF7 A;  3MO8 A;  3S3N A;  1KHC A;  5M9O A;  3L2W A;  3LYI A;  5KH6 A;  4E7J A;  2EQJ A;  2BKD N;  2X4W A;  2EQK A;  3MP6 A;  3QKJ A;  2JTF A;  2R5A A;  2XK0 A;  3OYB A;  4BE1 A;  2B8A A;  3QBY A;  3S3M A;  3MEA A;  4Q5W A;  2L8D A;  3UT1 A;  4IUR A;  1WJQ A;  4E7K A;  1WJR A;  3OB9 A;  2EQU A;  4IUQ A;  4PLL A;  2DAQ A;  4EDU A;  2RJD A;  2R57 A;  3OS2 A;  4BAC A;  5KE3 A;  4BD3 A;  3OYN A;  3L2R A;  4A4G A;  3L42 A;  3MP1 A;  4PLI A;  3OYL A;  3LGL A;  4ZTF A;  3Q1J A;  4B9W A;  2HQE A;  5FRN A;  4QQD A;  4BE2 A;  1OYX A;  5IAY A;  2RJF A;  3MET A;  5J26 A;  5KCO A;  4L59 A;  3LGF A;  4FL6 A;  5FRO A;  3NTH A;  2WAC A;  4NS5 A;  2L3R A;  4FU6 A;  4N4I A;  2YRV A;  2F5K A;  3PMI A;  5KE2 A;  3QJ6 A;  4E7I A;  3LLR A;  5D6W A;  2RHI A;  2JZ2 A;  4C5G A;  4X34 A;  3OYF A;  2GFU A;  3F70 A;  3M9Q A;  3OYH A;  3OMG A;  2M1H A;  3OQ5 A;  3H8Z A;  3OYJ A;  4CRI A;  3FLG A;  3PMT A;  4BDZ A;  2MWP A;  3DLM A;  4GY5 A;  2LVM A;  3MEU A;  2QQR A;  2RHY A;  4IUP A;  2RI3 A;  2HQX A;  2E6N A;  4OVA A;  2P0K A;  2RI5 A;  4BDY A;  1XNI A;  3EAE A;  2RJE A;  4QW2 A;  2DIG A;  2X4X A; 
#chains in the Genus database with same CATH topology
 3X25 B;  1KC8 C;  2LRQ A;  2HBW A;  4KGV B;  1WZO A;  3O8V A;  4MML A;  2O4X B;  2RI2 A;  3GF5 A;  3M0U A;  4OMM A;  1C0M A;  2QEX Q;  1WHL A;  4C8Q D;  1D3B A;  1E7O A;  5KYU A;  3OW2 A;  2EYZ A;  3VS6 A;  5GAN 4;  1MV3 A;  4QVZ A;  5IXF A;  2JM8 A;  3KUF A;  1TUG B;  2JMA A;  2BTT A;  2FO0 A;  2COY A;  3EG0 A;  4OMF B;  1BCM A;  4DEX A;  3CC2 Q;  1YFN A;  3EGU A;  3ME9 A;  1T3L A;  4OP0 A;  1VQL T;  4IKF A;  2L89 A;  4CC3 A;  3JB9 D;  1VQO Q;  1N8R R;  2HKQ B;  1QCN A;  1U5S A;  1ZSZ A;  4Z02 A;  3MEW A;  1GBR A;  3WVD B;  1WHM A;  2G3R A;  4C92 F;  1YHQ A;  2CKK A;  4FYY B;  5GMK h;  3SEM A;  2VVK A;  5EG2 A;  1XTD A;  2KK4 A;  4XTZ A;  1G3T A;  1ZHI A;  5GAO p;  2NYS A;  1NLO C;  2A08 A;  1I07 A;  1G3W A;  2GF7 A;  1VQK T;  1EZZ B;  1X6G A;  3M0T A;  3X28 B;  1QWF A;  5IHN A;  4MZT A;  1WLP B;  1HXD A;  2R5A A;  2ZPI B;  3MEA A;  3M58 A;  3UT1 A;  1D1B A;  2HZY A;  3OB9 A;  4AMC A;  1MV0 B;  1JEG A;  2M02 A;  4J83 A;  1UEB A;  2JOY A;  1SRL A;  2L2P A;  2RJF A;  2YRD A;  4FU6 A;  4MDX A;  2PVD B;  2B86 A;  1D3B B;  4F7U G;  1ZA1 B;  1FMV A;  3VYH B;  4J7I A;  4M7A G;  3A8M B;  1VIF A;  2DF6 A;  3MEU A;  2QQR A;  2RHY A;  1VQ4 T;  5GAM e;  1DJ7 B;  3VS5 A;  1WX6 A;  2KRO A;  2MI6 A;  3LH0 A;  3NPF A;  4KUL A;  1ZSZ B;  1OU8 A;  2A3L A;  5HCK A;  2QGF B;  1AWX A;  3CC4 Q;  1WHH A;  3V7S A;  1VA7 A;  1KC8 R;  3CCU A;  2RPN A;  3CXC P;  4M7D F;  2GFA A;  2FZC B;  2DIQ A;  1NG2 A;  2XU8 A;  3ZEH A;  1I1J A;  3I56 A;  1FWZ A;  1Y96 A;  1D1C A;  4AG1 C;  3CCE A;  4HT9 A;  1PC0 A;  2GTJ A;  1N27 A;  2CZ7 B;  2M16 A;  4KH0 B;  2BUD A;  2EYX A;  1Y57 A;  5KYW B;  4ESR A;  4M77 D;  1TG0 A;  2E41 A;  1AWW A;  1JJ2 P;  3I35 A;  1R0C B;  2QDY B;  1R0B G;  5CAI A;  3JV3 A;  5FRM A;  2K5I A;  4IUU A;  4KGZ B;  1MMN A;  1GXI E;  1UFF A;  3E9G A;  1C6V X;  5J39 A;  3S3N A;  4FIB A;  3HL8 A;  5KH6 A;  2QQA A;  1GRI A;  5CO7 A;  1AZG B;  1OV3 A;  4M78 C;  1UJ0 A;  3RMQ A;  3NGP A;  1IGU A;  4LDW A;  3CCV Q;  1VQP A;  2D8H A;  2RH2 A;  1M2V A;  1MMG A;  2DAQ A;  2EQU A;  2P84 A;  3OYN A;  3L2R A;  1QP3 A;  1NJI R;  2EGE A;  1B34 B;  3WVE B;  4A54 A;  4RMO A;  5CKD A;  2PUO B;  2EJ9 A;  2WAC A;  5I2M A;  1NYF A;  4OB0 B;  1ABO A;  4RTZ A;  2ZPG B;  4M75 E;  1YNZ A;  1QWE A;  2DXC A;  2RB6 A;  1Y96 B;  2EWN A;  2QA4 Q;  2LT1 A;  1G83 A;  5GMK e;  1NEB A;  2RI5 A;  1WHK A;  3VUZ A;  1K9M U;  4M7A A;  5GAN 2;  3CBO A;  1X75 C;  3MKD A;  1M8V A;  3LWH A;  2F69 A;  3TQ7 P;  1I0C A;  3VS2 A;  3ER0 A;  2ZPH B;  4KBM B;  2XID A;  4BY6 C;  2KAF A;  3CMA Q;  1NYG A;  1Q7Y U;  3ZBD A;  1BB9 A;  4R56 A;  2CDT A;  1RAE B;  2QDL A;  2YUP A;  1UGP B;  2NLU A;  2QQ9 A;  1LJO A;  2EIF A;  2F5T X;  1QVG S;  4J7F A;  3RES A;  3MP8 A;  3A8G B;  1MUZ A;  1UGV A;  5EC7 A;  3V8L A;  1FMW A;  2HNI A;  2FYK A;  5HY6 A;  5GAN g;  1QQJ A;  2AHJ B;  3H6Z A;  1U8R A;  2ZGW A;  2VXF A;  2LCC A;  4PJO A;  5KYX B;  1E6G A;  3E9F A;  3OYE A;  4J9C A;  2DL8 A;  4J9F A;  2QYZ A;  3CCL Q;  1IXD A;  1JQQ A;  5GAN 3;  3CCR Q;  1KD1 R;  2LJ0 A;  1VQN A;  4LUE A;  2X4W A;  2YT6 A;  4JS5 A;  3CCM T;  1XOV A;  1K1Z A;  3EGX A;  1YIJ A;  1Q81 U;  1OX9 A;  1YJW A;  4F7U B;  2CYZ B;  2BZY A;  1W1F A;  2P4R A;  3EHR A;  5IHK A;  2KQW A;  3HTR A;  3CBM A;  3UPU A;  1X43 A;  3JB9 J;  1KG1 A;  1UDL A;  3VU3 C;  5J26 A;  2DX1 A;  4FL6 A;  3NTH A;  1KQS P;  2YRV A;  1VQK A;  2E12 A;  1VUB A;  4ZGE B;  3OYH A;  2VGN A;  2JM9 A;  5LJ3 f;  5LJ5 j;  2RQW A;  1M1F A;  3FRN A;  2K4Y A;  1T3S A;  3RR6 A;  3QG1 A;  1GCP A;  1QKW A;  5CR2 A;  3P8B B;  1Q86 U;  2E3I A;  3CC7 Q;  1M2O A;  2MWO A;  1KIK A;  4HVU A;  3REB B;  2HEQ A;  1K0X A;  3I9Q A;  1D0Y A;  4JLI A;  2FRW A;  1O9S A;  4K11 A;  2R5M A;  3EGD B;  3V7C A;  2EFI A;  3FC3 A;  3SDZ A;  2EKO A;  3JCM J;  4D8K A;  4RG2 A;  2XIC A;  1UGR B;  4M75 G;  4JPB W;  2J05 A;  4DEY A;  4LUD A;  3G71 A;  1YIT Q;  2LDM A;  4O5V A;  2YUN A;  4OMN A;  1B3Q A;  2MYS A;  1VQ8 Q;  4RCB A;  2JJ9 A;  4OF1 A;  3EGX B;  3UWN A;  5IHI A;  1YHQ T;  5D6X A;  3OYG A;  2FRY A;  2ZCF B;  1BBZ A;  2F1L A;  1GFD A;  2J06 A;  4KUI A;  1Y0M A;  1TUC A;  1H3Z A;  2IG0 A;  5GAN 6;  3VJP A;  1Q86 C;  2X3X D;  3M0R A;  1LCK A;  1U1T A;  1MND A;  4M77 F;  2DL7 A;  2RA2 A;  4C8Q C;  3CME A;  1VQ6 A;  3MP6 A;  4NOY A;  2EJG A;  3RBB B;  2DMO A;  1NZ9 A;  4Q5W A;  4OML A;  2EGC A;  3CXC A;  1AOJ A;  1WJR A;  2J6K A;  2DRK A;  4OGE A;  4A4G A;  2J7I A;  1M30 A;  3LGL A;  3PVQ A;  3RNJ A;  3RER A;  1NBE B;  3MHX A;  3U23 A;  2LQW A;  1Q95 G;  2CSI A;  5ECA A;  2L3R A;  5LJ5 g;  3E1S A;  3NFC A;  3OBY A;  2CZ1 B;  1BYM A;  1B07 A;  2YLC A;  1JJ2 A;  4MZM A;  1X6B A;  2HSE B;  5GAN 8;  5GJV B;  1RAD B;  4XTV A;  3UAT A;  3HPW A;  4XU0 A;  2G6F X;  1MMD A;  4ATO A;  1T0H A;  2ZPF B;  4JUV A;  2EQM A;  4F14 A;  3JAM E;  2ROT A;  2CS7 A;  3CCU T;  3PVL A;  1KQ1 A;  4M7A D;  1SHF A;  1PSF A;  1V1C A;  3I56 T;  2P4T A;  3E19 A;  1AHJ B;  2HL5 C;  3CEY A;  4GLM A;  3CCE T;  1NPR A;  4C5I A;  1UG1 A;  5GAO q;  5C6S A;  5FU7 C;  2OAW A;  3J7A F;  3CC4 T;  1OI1 A;  2RQU A;  2YWW A;  4Z89 A;  4M75 A;  1WJS A;  4KRT A;  3G4S Q;  1OPK A;  5A0D A;  3MJX A;  1G5V A;  3L2V A;  4HXJ A;  2M51 A;  3PNW C;  1UE9 A;  2LP5 A;  3CQT A;  4A4F A;  5GAM j;  2L0A A;  2ENM A;  2AK5 A;  2DTI A;  3LYI A;  4E7J A;  2DD5 A;  3I55 Q;  2NUP A;  2ZAE A;  1Q86 R;  3L1A A;  1OUL A;  2B8A A;  2SEM A;  1JO8 A;  2DTO A;  1K4U S;  4EDU A;  2AKL A;  4KT0 E;  5AYF A;  1IB8 A;  4PFZ A;  1G3Y A;  4FT2 A;  3E2U A;  2HL3 A;  1SEM A;  2CT3 A;  4L59 A;  3UDC A;  2Y90 A;  4WF2 A;  1JU5 C;  3TCJ A;  1Z9Q A;  5I11 A;  2RHI A;  1YJN Q;  4C5G A;  1GCQ C;  3H9N A;  4EMK A;  2CT4 A;  1BI1 A;  1YWO A;  4HCK A;  1VIE A;  1S72 Q;  1RLQ C;  1SRM A;  4QT7 A;  1N9R A;  4L5G A;  2E6N A;  1BU1 A;  1CKB A;  1M9S A;  1AVZ C;  3MCA B;  3CD6 A;  3GOX A;  4QQ6 A;  4M7D E;  3QYH B;  2RN8 A;  2ZPB B;  1R8O B;  1VYT A;  3DKM A;  2DBK A;  1TH7 A;  1RI0 A;  4DA4 A;  1OU9 A;  3CCQ Q;  5GAN 5;  3HRU A;  4C0G A;  1VQ5 A;  3MEV A;  4PJO E;  3FEO A;  3C12 A;  1WFW A;  2KSS A;  3JCM c;  3OYY A;  4DQ2 A;  3OBW A;  3FDR A;  1PD0 A;  1VQ7 A;  2KY9 A;  2QQS A;  3QYG B;  2NUP B;  1YJ9 Q;  4LDU A;  2DZC A;  3URG A;  2KNB B;  1OOT A;  3DB3 A;  1QW1 A;  2V26 A;  2NUT B;  3V8J A;  1IRE B;  1Q82 C;  4RG8 A;  2F2W A;  1M3C A;  3P8D A;  2PVG B;  5KYN A;  4A4H A;  5CKE A;  5GMK j;  1QVP A;  1VYU A;  3CCS Q;  2DVJ A;  3SB2 A;  1VQN T;  2KMT A;  1WI7 A;  4HKE A;  2XHC A;  2V8K A;  2X51 A;  1M90 U;  3JCM g;  4M78 F;  1YIJ T;  5HKC A;  2QTV A;  1LOJ A;  4VUB A;  2QEX A;  1YJW T;  4E7S A;  1UJY A;  2GQV A;  4FM4 B;  2IIM A;  2RJD A;  1SKU B;  1RAG B;  4JRQ A;  3L42 A;  1KJW A;  3Q1J A;  1NM7 A;  4J9G A;  4WTO B;  3MET A;  5I22 A;  3CC2 A;  3AT1 B;  2LZ6 B;  1VQO A;  3INZ A;  3F70 A;  1UHC A;  3VS4 A;  4RTT A;  3R6N A;  5GAM f;  1ZSZ C;  3H0H A;  3O5Z A;  2PTK A;  1G8X A;  2RI3 A;  4XTW A;  2CP6 A;  2GGR A;  3M55 A;  2DIG A;  4NL2 A;  4Z8A A;  1TUD A;  3FIF A;  1M90 C;  3VKI A;  4JJD A;  5GAN d;  2FEI A;  5KYU B;  3C4S A;  3CCJ Q;  3ZL7 C;  3EFO A;  1PG5 B;  3TSW A;  1QCF A;  2V8J A;  2XDP A;  4PJJ A;  2DD4 A;  1KK7 A;  4PJL A;  4RTU A;  2HBP A;  2LJ3 A;  1YI2 Q;  1PKT A;  3G71 T;  5I2S A;  2EVR A;  4J6Y A;  4F7U F;  4PJN A;  1FX7 A;  2K5F A;  1OX8 A;  4AFZ C;  2E1H A;  2RJC A;  4JJB A;  2PVO B;  4BB7 A;  4M7D G;  3L2Z A;  4AFS C;  5KCH A;  4M75 D;  1QLY A;  1TU0 B;  1WYX A;  1UUE A;  1RAH B;  4IUV A;  5L8R E;  1Q82 R;  1PNJ A;  1YIT T;  2EYY A;  3EG2 A;  4DBH A;  2H8H A;  2CUD A;  2EQJ A;  1N6A A;  4PJO G;  3CME T;  4C0Z A;  1VQ6 T;  3CC4 A;  3C95 A;  5D7U A;  2XK0 A;  1K73 U;  3BW1 A;  4IUQ A;  3VV0 A;  4BAC A;  3KBG A;  2JTM A;  4DBR A;  4F04 B;  4QKU A;  5KE3 A;  3GLX A;  1D1A A;  2HQE A;  1HSQ A;  3VS1 A;  1OYX A;  3QDF A;  2DXB A;  3CPW P;  4C92 A;  4R55 A;  5LJ3 j;  1WIE A;  3EFO B;  1K8A U;  2JZ2 A;  2DBM A;  2CUB A;  2CRE A;  3M0P A;  1ZBX A;  2GCX A;  3JCM P;  4OMP A;  2MWP A;  2RK1 A;  4HA8 A;  2P0P A;  4ORZ A;  3EAE A;  3CXC S;  1ZSG A;  2HSP A;  4RUG A;  3G1J A;  5GAN h;  2FG0 A;  3EG9 A;  4C0F A;  1PM3 A;  1LVK A;  1K73 C;  4PL6 A;  1A0N B;  2LQN A;  2C06 A;  1SG5 A;  2D9T A;  1M90 R;  3CCV A;  5A2Q E;  4FYX B;  1WXT A;  2XD0 A;  4RTX A;  4AT1 B;  2K9G A;  1JJ2 S;  3RIR A;  4D6W A;  2BZX A;  2PZ1 A;  2QK0 A;  2WSC E;  2J6O A;  1K8A C;  2L3Q A;  2D0Q B;  1RAF B;  2LTO A;  2E3H A;  3M0S A;  3OS5 A;  3QJY A;  2VGM A;  2L3S A;  2DYB A;  2IVW A;  3HHT B;  1AZE A;  3M56 A;  4LN2 A;  4A63 B;  5FWB A;  1BK2 A;  4X9D A;  1VQ9 Q;  3MPU B;  4R0K A;  2DL4 A;  4J6W A;  2QA4 A;  3X20 B;  3NTK A;  1PCX A;  2HCK A;  3TRE A;  4M7D A;  5M9O A;  2RD1 A;  5LJ5 d;  3JCM V;  4EPC A;  4M7A C;  2JT4 A;  2A7Y A;  4C8Q F;  3CMA A;  1M2V B;  1PRM C;  4BE1 A;  3QBY A;  1WJQ A;  4FW2 A;  2FPF A;  1H3H A;  3JB9 I;  4AFQ C;  5LJ3 g;  3VUB A;  1K9M C;  1IGQ A;  2WSE E;  4AFU C;  3BFM A;  1VQL Q;  5KCO A;  1TXQ A;  2A0F B;  3JB9 F;  3EH2 A;  5KE2 A;  3I55 T;  1Q7Y C;  1CSK A;  2DER A;  1TOV A;  3JCM X;  5CKB A;  3OSS C;  3OYJ A;  4CRI A;  2K2M A;  3FLG A;  3CBP A;  2MIO A;  2MOX A;  4IUP A;  4M7A B;  2HDA A;  3CD6 T;  4QW2 A;  5CQY A;  1QVF P;  8ATC B;  4PJO C;  2RMO A;  4BUG A;  3CCL A;  3NHN A;  3CCR A;  1X2Q A;  3EG1 A;  2F2V A;  3PGG A;  1HJD A;  2R58 A;  3BDU A;  4NL3 A;  3S6W A;  3OYD A;  4LDV A;  4A4E A;  2OTJ Q;  1VQ5 T;  1P92 A;  3HP9 A;  1QP2 A;  1ZX6 A;  4LD9 K;  1WNL A;  4JRP A;  4M7D B;  4ANJ A;  5GMK l;  1VQ7 T;  5IH2 A;  5GAN f;  2DIL A;  4E2F B;  1TTH B;  5C0M A;  1OZ2 A;  2AZS A;  1SF9 A;  2OTL Q;  1K76 A;  2V1Q A;  3OW2 P;  1Q81 C;  4PJO B;  1B7T A;  1K8A R;  2K6D A;  1HYO A;  3LH5 A;  1W2B P;  1N5Z A;  1H64 1;  2BIV A;  1VQ4 Q;  4O6J A;  1BCO A;  4XQ3 A;  4YTL A;  3L2Q A;  2KEA A;  5LJ5 h;  1VOM A;  5DM7 R;  5A0G A;  1SHG A;  1KQ2 A;  3RKY A;  1AEY A;  1X27 A;  3CC7 A;  2AT1 B;  3A5Z B;  3SWN A;  3S3M A;  5GAN e;  1I4K 1;  3WXM B;  2QEX T;  4IUR A;  4B6M A;  1D0X A;  5KYY A;  1O75 A;  2DJQ A;  3C0C A;  3V8K A;  1T0J A;  5FW9 A;  2AIR B;  2ATC B;  3KFV A;  2C0I A;  3CC2 T;  3QDR B;  1YIT A;  1VQO T;  4IIO A;  1K9M R;  1VQ8 A;  4XTY A;  4FSS A;  1EX4 A;  5GMK m;  1PHT A;  2CH4 W;  4N0A A;  1Q7Y R;  4LNP A;  2M0Y A;  4J9B A;  3M59 A;  2JUF A;  2GNC A;  7AT1 B;  2VB6 A;  1OPL A;  2CZ0 B;  6AT1 B;  4PFP A;  4FYW B;  4LDY A;  2O31 A;  4N4H A;  3BDL A;  2X3W D;  3JCM Q;  2CP3 A;  3P8H A;  2BE7 D;  1WHG A;  2EYW A;  3GIB A;  3OMC A;  4OB1 B;  4LDX A;  4Y91 A;  4II1 A;  4XK8 E;  1K0S A;  3OYC A;  3S3O A;  3CPW A;  3QII A;  2QXF A;  2VC8 A;  3TVT A;  3SWN B;  3JCM d;  3G6E Q;  2I0N A;  5KYY B;  2DVE A;  1YCY A;  2X4Y A;  4HCZ A;  4JZ3 A;  3TEE A;  1QKX A;  1JXO A;  2ZPE B;  3FJ5 A;  4LD6 A;  1Q81 R;  1YI2 T;  3I5R A;  4M78 E;  4RTY A;  2DA9 A;  1SPK A;  2D8J A;  4FT4 A;  4C92 E;  2KRS A;  1XJW B;  2DXT A;  2BKD N;  2E65 A;  1X6O A;  5GAO n;  1H8K A;  1MGQ A;  1VQM Q;  4BI4 A;  1ZQ1 A;  4M7D D;  5FWC A;  3R6O A;  2DEQ A;  2CP5 A;  2QAZ A;  2MCN A;  1Y07 A;  2FZG B;  1UB4 A;  2HMA A;  4OMO A;  3A98 A;  4PJO D;  1GFC A;  1R77 A;  1RLP C;  2KYM A;  2M1H A;  3OQ5 A;  4CC2 A;  2X9H A;  2DL3 A;  4DOW A;  1ZUY A;  4XU1 A;  2WSF E;  2DM1 A;  4M75 C;  3G4S A;  3M54 A;  4OVA A;  1W4S A;  4M77 A;  2HD0 A;  3ULR B;  4X9C A;  3UA7 A;  1VYV A;  3OS0 A;  2KVQ G;  5GJW B;  3M57 A;  3OYM A;  4JJN K;  4C0D C;  2K79 A;  2LT4 A;  2X4J A;  3I55 A;  3D7S B;  3PFS A;  3CCM Q;  2O4X A;  1AD5 A;  1SSF A;  2JS0 A;  3SHW A;  2W0Z A;  1X01 A;  3CCV T;  5CKF A;  2E5Q A;  1TS9 A;  1OZ3 A;  4EMH A;  2J6F A;  3BE3 A;  2RF0 A;  1NLP C;  1WQ7 A;  4ELY C;  2L5Q A;  3GNF B;  3RUX A;  3DLL A;  4M75 B;  3JCM h;  2LCS A;  1RAI B;  2ED0 A;  1S1N A;  2EGA A;  2D1X A;  2EBP A;  4ZN3 A;  1YJN A;  4FYV B;  3FJP A;  4OB3 B;  4RKU E;  4V2S A;  4RTW A;  1S72 A;  2RK2 A;  4EMK C;  3OYI A;  2QA4 T;  4C0D B;  2DPP B;  1BI0 A;  2KXD A;  1MHN A;  1QVF A;  2EYQ A;  3PIP A;  2Y4Y A;  4RTV A;  3UF4 A;  3QWX X;  1KQS A;  3C94 A;  3CMA T;  5I21 A;  2O9V A;  3OYB A;  2RQV A;  3QSU A;  3OSV A;  3CCQ A;  1OQK A;  4OMQ A;  2Y4X A;  1E6H A;  2EAY A;  1QMC A;  5GAM g;  1D0Z A;  3QWY A;  4PLI A;  2GQI A;  3QHS A;  5FRN A;  4QQD A;  1IHV A;  3GP8 A;  3GNG A;  2F5K A;  4EMK B;  1YJ9 A;  3QJ6 A;  4E7I A;  2JVV A;  2MF2 A;  3HFO A;  2C0T A;  1YHQ Q;  3M9Q A;  2FZK B;  2DRM A;  3OMG A;  3EG3 A;  2VV5 A;  3PMT A;  2XG8 D;  3A1P A;  1NJI U;  1H92 A;  4M78 G;  2E6Z A;  3ZFJ A;  1W2B A;  4C92 G;  2COZ A;  4PK4 A;  1ZUU A;  2HQX A;  1AT1 B;  2RJE A;  4ELZ C;  2Z0W A;  2H3J A;  2QAS A;  2EJF A;  3CCL T;  4B9X A;  4FSX A;  2CH4 A;  3J80 E;  3NTI A;  2RQR A;  3CCR T;  3CCS A;  2MAM A;  2QG9 B;  2K3Y A;  1WGS A;  4J9I A;  1U1S A;  2KT1 A;  1UGS B;  2PQW A;  3T9N A;  3H0F A;  2VUB A;  1JXM A;  4LXC A;  2EKH A;  3GBQ A;  4IIM A;  1X69 A;  1ZLM A;  4QQG A;  4J8O A;  5FLX E;  1NJI C;  2OTJ T;  5KYW A;  2LX9 A;  2H3E B;  4E7L A;  3V7R A;  4HVW A;  2K7A A;  1M3A A;  3IQL A;  3LWI A;  1BIB A;  5LJ3 d;  4ZGJ B;  2K5L A;  1YCS B;  4C8Q E;  2RM4 A;  1LNX A;  4CC7 A;  3QPH A;  4ZTJ A;  3JCM f;  4PJM A;  2JXB A;  1UHF A;  4MDW A;  1KHC A;  4XU3 A;  3VS0 A;  1X2K A;  3CC7 T;  2OTL T;  1NEG A;  4M7A F;  2O9S A;  3CCU Q;  5DLO A;  1PSE A;  3A8L B;  2AZV A;  2PNI A;  1JBM A;  3QO3 A;  3CCJ A;  4CI0 C;  4PLL A;  3JB9 H;  2R57 A;  3I56 Q;  3OYL A;  1KD1 U;  2LQ8 A;  2XDD A;  3CCE Q;  4BE2 A;  1W70 A;  1UGQ B;  1YI2 A;  2NWM A;  3NMZ C;  3PTA A;  1B34 A;  2QTX A;  2DO3 A;  3N5B B;  1VQ8 T;  2EW3 A;  3LLR A;  1GBQ A;  1ZA2 B;  2XKO C;  5IXB A;  5L23 A;  2DZ9 A;  1RAC B;  2E5K A;  1Z9Z A;  3EH1 A;  3JCM e;  4BDZ A;  1U3O A;  2DEU A;  5CK9 A;  4J9E A;  1IZ6 A;  1RL2 A;  4E7Z A;  4CC4 B;  1KHI A;  2CZ6 B;  4Z88 A;  3GPL A;  2LMJ A;  1IHW A;  1M1G A;  4PJO F;  4M78 A;  3SD4 A;  2PUK B;  1PKS A;  4HVV A;  2RHZ A;  4DBQ A;  2I2L A;  4E7H A;  4L6V 5;  4UC4 A;  5HK3 A;  1VQP Q;  2KE9 A;  2FPD A;  1AWJ A;  1C1A A;  2VYT A;  1KD1 C;  2HQH A;  3ASK A;  2KBT A;  3OY9 A;  5GAN j;  2HKN A;  1M27 C;  5DLQ E;  1Y71 A;  1D09 B;  2YXY A;  5GMK i;  3J81 E;  2O01 E;  4Y92 A;  4QVC A;  2X35 A;  5CVI A;  3QZ5 B;  2OI3 A;  1WDX A;  4Y28 E;  4J9D A;  2YDL A;  4C92 C;  2LNH B;  4IUT A;  2D6F A;  3RKW A;  1QVG P;  5LJ3 h;  2XDB A;  3H41 A;  1YP5 A;  1WQW A;  2ESW A;  5KYX A;  1TWB A;  2FHD A;  1IRX A;  2JTE A;  4PKC C;  2ZZD A;  1LPL A;  1KFZ A;  3JCM W;  3L2W A;  2E4H A;  5A0L A;  4XTX A;  4BI3 A;  3CPW S;  3G6E T;  3RMS A;  2BE9 B;  4KH1 B;  1FYN A;  2LQK A;  1EFN A;  3M4G A;  4BD3 A;  5CCA A;  4F7U A;  3PIO A;  4B9W A;  4M78 B;  4DOV A;  4M77 E;  3PT9 A;  1PD1 A;  2O2O A;  5IT9 E;  4C92 B;  3HKS A;  1K9A A;  3X24 B;  2CSQ A;  2OJ2 A;  4NS5 A;  2ED1 A;  2YUQ A;  4HCC A;  1M4Z A;  2DNU A;  1HK9 A;  1VQM T;  2RNA A;  3DLM A;  4C8Q G;  3EFR A;  3G4S T;  4OB2 B;  3HFN A;  1VQ9 A;  1XNI A;  2DJZ A;  2ROL A;  4EIK A;  2K3B A;  1RAB B;  3EG9 B;  1VQN Q;  1WA7 A;  2K3X A;  3JB9 G;  3LX7 A;  2RO0 A;  2KT8 A;  1YIJ Q;  1Y7X A;  4M7D C;  1BI3 A;  1YJW Q;  4BE0 A;  2CP7 A;  2MK5 A;  2A28 A;  2CP2 A;  3EGD A;  2KXC A;  4BY6 B;  4C5E A;  1BI2 A;  2JN0 A;  4C5H A;  5D6Y A;  1YN8 A;  1VQL A;  1VQK Q;  4MMK A;  2DK3 A;  3AHU A;  2KI7 A;  4J5Y A;  4M4Z A;  1N9S A;  1JRI A;  3OYA A;  1YJN T;  2KYB A;  2VAS A;  3VRZ A;  2GTO A;  3CPF A;  1S72 T;  2IPO B;  2YLB A;  3QXE B;  4E47 A;  4JRI A;  3RDV A;  1K73 R;  2ABL A;  2D0N A;  4D8D A;  1PRL C;  3I5S A;  4PNO A;  1WHJ A;  2KGT A;  2DET A;  4X1V A;  4KGX B;  4F17 A;  3RKX A;  1RI9 A;  3EHQ A;  2YHT A;  4FW1 A;  3CCQ T;  3JSC A;  2L8D A;  4E7K A;  2E70 A;  1J3T A;  1ZBJ A;  2OTJ A;  2VKN A;  3G7Z A;  3TSZ A;  4P5N A;  4E6R A;  4QVD A;  4XU2 A;  2DLP A;  1FMK A;  4XAX B;  2MMP A;  3G71 Q;  4RCC A;  3HRS A;  2AKK A;  3LGF A;  3SFM A;  5FRO A;  3JCM b;  1V29 B;  1NPP A;  1YJ9 T;  2L3P A;  1QVF S;  2VXE A;  1RUW A;  2JW4 A;  2YUO A;  4X34 A;  3OYF A;  2OX7 A;  1TSF A;  4A4K A;  2OTL A;  4WCI A;  1MNE A;  2LNV A;  4F16 A;  3HRT A;  1KQS S;  1FXX A;  2LCL A;  1W6X A;  3A8H B;  2LVM A;  4J6X A;  1I81 A;  3EFS A;  4M75 F;  2QI2 A;  1VQ4 A;  5LJ3 e;  8AT1 B;  1HD3 A;  3UA6 A;  4C8Q A;  3CCS T;  1F1B B;  3CME Q;  1VQ6 Q;  2E64 A;  4HCB A;  1M1K U;  2MPX C;  2K57 A;  3DB4 A;  4M77 G;  2KRM A;  4M78 D;  2BZ8 A;  2A36 A;  4AG2 C;  1M5Q 1;  3VS3 A;  4C92 D;  3OA6 A;  3SWN C;  5J3B A;  1SSH A;  2DXU A;  3M5A A;  3OW2 S;  1XQH A;  2DTH A;  1W2B S;  5CQX A;  1U06 A;  5HK0 A;  1YWP A;  2KRN A;  2KDS A;  2EQI A;  3M0Q A;  1JB0 E;  1YBY A;  5IN1 A;  2RHX A;  2LJ1 A;  2A37 A;  5LL6 S;  4N4G A;  5GAM d;  1ACM B;  2F2X A;  1CKA A;  4LE9 A;  3REA B;  4N0A C;  3VYG A;  1WXB A;  3MO8 A;  2XI9 A;  4HT8 A;  3TU4 K;  1M1K C;  2V1R A;  3THK A;  1MMA A;  2EQK A;  3M4Y A;  3CCJ T;  2JS2 A;  1RAA B;  2DE0 X;  4C8Q B;  2FPE A;  2LC4 A;  5GAO r;  3JRZ A;  1OEB A;  1N8R U;  3H0I A;  1V76 A;  2EPD A;  2FL7 A;  2DFU A;  4JJC A;  3QZ9 B;  4MZP A;  2PU9 B;  3FB9 A;  4ME7 A;  1ZUK A;  3H8Z A;  1UTI A;  1I5O B;  1PWT A;  4TVR A;  3VS7 A;  3G6E A;  3A8O B;  2ECZ A;  2DYI A;  2M9U A;  1QVG A;  4J9H A;  4ZNX A;  1BKB A;  1EIF A;  2QGG A;  5GAO l;  3HSB A;  5LJ5 f;  2X4X A;  3QUI A;  2YSQ A;  1I5L A;  1M3B A;  2O88 A;  5CIU A;  1ABQ A;  3KXT A;  4KUD K;  2RQT A;  2P0Q A;  2HAX A;  3X26 B;  1VQM A;  3L2U A;  2C0O A;  2SRC A;  2W10 A;  2YRC A;  1N8R C;  1G3S A;  2COW A;  1UEC A;  1QCO A;  4JZ4 A;  4FCY A;  4JS4 A;  1BIA A;  1GCQ A;  2E10 A;  1GL5 A;  5GAN 7;  3BY7 A;  4OGC A;  3OYK A;  2K2V A;  4BI8 B;  1KSW A;  2NUZ A;  5LJ5 e;  4A53 A;  1VQP T;  2FB7 A;  2GBQ A;  2KR3 A;  2RHU A;  3M53 A;  5FU7 B;  2NUT A;  5GAM h;  3LW5 E;  2M0O A;  4F7U E;  3OS1 A;  4GBQ A;  4ZGD B;  2QQB A;  2V8I A;  3CD6 Q;  4M7A E;  1M8M A;  2DL5 A;  2OAU A;  4XTU A;  1ARK A;  2CP0 A;  2XMF A;  1KC8 U;  4M77 C;  4JLG A;  3VRY A;  3QKJ A;  2FVU A;  5FU6 C;  2JTF A;  5GAO m;  3CCM A;  2VWF A;  5AT1 B;  1VQ5 Q;  4JRK A;  4DBF A;  3OS2 A;  1I8F A;  4PFO A;  1M1K R;  1Q82 U;  3MP1 A;  4ZTF A;  4ZN1 A;  1G2B A;  1NE8 A;  3PE0 A;  1VQ7 Q;  2DKG A;  9ATC B;  5IAY A;  5CKH A;  2JMC A;  2JNG A;  4EMG A;  4N4I A;  3PMI A;  5DY9 A;  1WXU A;  5D6W A;  2GFU A;  2LX7 A;  4GY5 A;  1IO6 A;  1WPY A;  2CGH A;  4M77 B;  1VQ9 T;  1AWO A;  4JDS A;  2P0K A;  4BDY A;  4GLK A;  5FU6 B; 
#chains in the Genus database with same CATH homology
 3X25 B;  3HPW A;  3GPL A;  4BUG A;  1KC8 C;  4PJO C;  2LRQ A;  1M1G A;  4XU0 A;  4PJO F;  3CCL A;  4M78 A;  4ATO A;  2ZPF B;  4JUV A;  3SD4 A;  2EQM A;  2PUK B;  3O8V A;  4MML A;  2O4X B;  2RI2 A;  3CCR A;  2RHZ A;  3GF5 A;  2I2L A;  3JAM E;  4E7H A;  4L6V 5;  4UC4 A;  3PGG A;  2CS7 A;  3CCU T;  1KQ1 A;  2R58 A;  3BDU A;  5HK3 A;  4NL3 A;  4M7A D;  3S6W A;  3OYD A;  4C8Q D;  4LDV A;  1D3B A;  4A4E A;  1VQ5 T;  2VYT A;  3OW2 A;  1P92 A;  1KD1 C;  5GAN 4;  1PSF A;  3ASK A;  3HP9 A;  1QP2 A;  4QVZ A;  3OY9 A;  3I56 T;  5GAN j;  4LD9 K;  2P4T A;  1WNL A;  3E19 A;  3KUF A;  4JRP A;  5DLQ E;  1Y71 A;  1AHJ B;  4OMF B;  4M7D B;  5GMK l;  5GMK i;  1VQ7 T;  3J81 E;  3CEY A;  3CCE T;  1NPR A;  2O01 E;  3ME9 A;  4C5I A;  4OP0 A;  5GAN f;  5GAO q;  5C6S A;  1VQL T;  4QVC A;  2L89 A;  5FU7 C;  4IKF A;  2X35 A;  5CVI A;  5C0M A;  3J7A F;  3JB9 D;  1OZ2 A;  3CC4 T;  1OI1 A;  3QZ5 B;  4Z02 A;  4BE1 A;  3MEW A;  3WVD B;  4Y28 E;  4C92 C;  4M75 A;  1WJS A;  2G3R A;  4C92 F;  1YHQ A;  1Q81 C;  2CKK A;  4PJO B;  5GMK h;  4IUT A;  2D6F A;  3RKW A;  5EG2 A;  5LJ3 h;  1XTD A;  2XDB A;  2KK4 A;  1H64 1;  2BIV A;  5A0D A;  4XTZ A;  1WQW A;  4O6J A;  1G3T A;  1ZHI A;  1G5V A;  5GAO p;  3L2V A;  4XQ3 A;  2FHD A;  3PNW C;  4PKC C;  4YTL A;  3L2Q A;  2ZZD A;  4A4F A;  5LJ5 h;  5GAM j;  2GF7 A;  1G3W A;  1VQK T;  5DM7 R;  3JCM W;  3L2W A;  2DTI A;  3LYI A;  3X28 B;  2DD5 A;  5A0G A;  4E7J A;  1KQ2 A;  5A0L A;  3RKY A;  4XTX A;  3CC7 A;  4MZT A;  4BI3 A;  3A5Z B;  3CPW S;  1HXD A;  3SWN A;  2R5A A;  3L1A A;  2ZPI B;  3G6E T;  2B8A A;  3RMS A;  3S3M A;  5GAN e;  1I4K 1;  3MEA A;  3WXM B;  3M58 A;  3UT1 A;  2DTO A;  2QEX T;  4IUR A;  3OB9 A;  4EDU A;  4KT0 E;  2LQK A;  3M4G A;  4BD3 A;  5AYF A;  1O75 A;  5CCA A;  4F7U A;  3PIO A;  4B9W A;  4M78 B;  4DOV A;  4J83 A;  4M77 E;  3PT9 A;  1UEB A;  2JOY A;  1G3Y A;  4FT2 A;  3V8K A;  4C92 B;  5IT9 E;  3HKS A;  2RJF A;  3X24 B;  4L59 A;  3UDC A;  3CC2 T;  2Y90 A;  4NS5 A;  4FU6 A;  3QDR B;  4WF2 A;  4MDX A;  2PVD B;  3TCJ A;  1YIT A;  1VQO T;  1VQ8 A;  1D3B B;  2RHI A;  4C5G A;  4EMK A;  4F7U G;  1BI1 A;  3VYH B;  1M4Z A;  1VIE A;  4HCC A;  4XTY A;  1HK9 A;  4J7I A;  4M7A G;  5GMK m;  1VQM T;  3DLM A;  4C8Q G;  3A8M B;  1VIF A;  3EFR A;  3G4S T;  4N0A A;  3MEU A;  4OB2 B;  1N9R A;  2QQR A;  2RHY A;  3HFN A;  4L5G A;  2E6N A;  1VQ4 T;  1VQ9 A;  1M9S A;  5GAM e;  1XNI A;  2DJZ A;  1DJ7 B;  3MCA B;  3CD6 A;  3M59 A;  3GOX A;  4QQ6 A;  2MI6 A;  2JUF A;  4M7D E;  3LH0 A;  4KUL A;  3QYH B;  2A3L A;  2K3X A;  2ZPB B;  1R8O B;  3DKM A;  3JB9 G;  2CZ0 B;  1TH7 A;  3LX7 A;  2RO0 A;  3V7S A;  1RI0 A;  4DA4 A;  4LDY A;  1Y7X A;  4M7D C;  3CCU A;  4N4H A;  4M7D F;  1BI3 A;  3BDL A;  3JCM Q;  4BE0 A;  5GAN 5;  2GFA A;  3HRU A;  4C0G A;  2DIQ A;  3P8H A;  1VQ5 A;  3MEV A;  4PJO E;  2XU8 A;  3FEO A;  3C12 A;  3ZEH A;  4BY6 B;  3GIB A;  3I56 A;  2KSS A;  3JCM c;  1FWZ A;  4C5E A;  3OYY A;  1BI2 A;  1Y96 A;  3OMC A;  4OB1 B;  2JN0 A;  4Y91 A;  4DQ2 A;  3OBW A;  4LDX A;  3FDR A;  4II1 A;  4C5H A;  1VQ7 A;  5D6Y A;  4XK8 E;  3CCE A;  2KY9 A;  3OYC A;  2QQS A;  3S3O A;  3QYG B;  3CPW A;  4HT9 A;  1VQL A;  1N27 A;  3QII A;  2QXF A;  2VC8 A;  2CZ7 B;  2DK3 A;  2DZC A;  2M16 A;  4LDU A;  4MMK A;  3SWN B;  3URG A;  3AHU A;  3DB3 A;  2BUD A;  1N9S A;  4J5Y A;  1QW1 A;  1JRI A;  3JCM d;  3OYA A;  1YJN T;  4M77 D;  2E41 A;  2DVE A;  3V8J A;  1YCY A;  1IRE B;  3CPF A;  1S72 T;  2YLB A;  2X4Y A;  4HCZ A;  3TEE A;  1Q82 C;  4RG8 A;  3QXE B;  2QDY B;  4E47 A;  5CAI A;  3P8D A;  2ZPE B;  4JRI A;  2PVG B;  5FRM A;  2K5I A;  4IUU A;  4A4H A;  4LD6 A;  1GXI E;  1YI2 T;  4M78 E;  5CKE A;  4PNO A;  3E9G A;  4FT4 A;  1QVP A;  5GMK j;  4C92 E;  5J39 A;  3S3N A;  4FIB A;  3SB2 A;  3HL8 A;  1VQN T;  2KMT A;  5KH6 A;  2QQA A;  2DXT A;  2BKD N;  2XHC A;  2E65 A;  2V8K A;  4HKE A;  5CO7 A;  3RKX A;  1X6O A;  1M90 U;  4M78 C;  3JCM g;  3RMQ A;  5GAO n;  2YHT A;  4M78 F;  3CCQ T;  1YIJ T;  1MGQ A;  3JSC A;  2L8D A;  4LDW A;  4VUB A;  1LOJ A;  5HKC A;  1VQP A;  4BI4 A;  2QEX A;  4E7K A;  2E70 A;  1YJW T;  1ZQ1 A;  2EQU A;  2GQV A;  2DAQ A;  2RH2 A;  2RJD A;  3G7Z A;  4FM4 B;  3R6O A;  4M7D D;  2OTJ A;  4P5N A;  3OYN A;  3L2R A;  4JRQ A;  3L42 A;  2DEQ A;  3Q1J A;  1QP3 A;  1Y07 A;  4QVD A;  4XU2 A;  4XAX B;  1B34 B;  2MMP A;  3WVE B;  4A54 A;  4RMO A;  1UB4 A;  3MET A;  4RCC A;  5CKD A;  2PUO B;  3HRS A;  3LGF A;  3SFM A;  2EJ9 A;  5FRO A;  1V29 B;  2WAC A;  1NPP A;  3JCM b;  5I2M A;  3CC2 A;  1YJ9 T;  4PJO D;  1QVF S;  4OB0 B;  2VXE A;  1VQO A;  2ZPG B;  4M75 E;  3OYF A;  4X34 A;  3INZ A;  3F70 A;  4A4K A;  2OTL A;  2M1H A;  3OQ5 A;  5GAM f;  2LNV A;  2DXC A;  2RB6 A;  3HRT A;  1KQS S;  1FXX A;  2LCL A;  1Y96 B;  3A8H B;  2LVM A;  4DOW A;  2EWN A;  4XU1 A;  2WSF E;  4J6X A;  2LT1 A;  4M75 C;  3G4S A;  1I81 A;  5GMK e;  2RI3 A;  3EFS A;  3M54 A;  4M75 F;  4OVA A;  1W4S A;  2QI2 A;  2RI5 A;  4XTW A;  1VQ4 A;  3M55 A;  5LJ3 e;  4M77 A;  2DIG A;  2HD0 A;  4NL2 A;  3VUZ A;  4X9C A;  1K9M U;  4M7A A;  5GAN 2;  3CBO A;  4C8Q A;  1X75 C;  3OS0 A;  2KVQ G;  1M8V A;  3M57 A;  3LWH A;  2F69 A;  3FIF A;  3CCS T;  1M90 C;  3ER0 A;  3OYM A;  4JJN K;  2ZPH B;  4KBM B;  4C0D C;  2E64 A;  2XID A;  4BY6 C;  3VKI A;  2LT4 A;  2KAF A;  2X4J A;  3I55 A;  3PFS A;  5GAN d;  1Q7Y U;  2O4X A;  4HCB A;  1SSF A;  1M1K U;  2K57 A;  3C4S A;  3DB4 A;  4M77 G;  2V8J A;  4M78 D;  2XDP A;  3ZBD A;  4R56 A;  1X01 A;  3CCV T;  1M5Q 1;  5CKF A;  4C92 D;  2E5Q A;  1OZ3 A;  4EMH A;  1UGP B;  3OA6 A;  3SWN C;  2NLU A;  5J3B A;  2QQ9 A;  2DXU A;  3M5A A;  2DD4 A;  3OW2 S;  1XQH A;  2HBP A;  2DTH A;  1LJO A;  2EIF A;  1WQ7 A;  4ELY C;  1W2B S;  2F5T X;  2L5Q A;  5CQX A;  4J7F A;  1QVG S;  3G71 T;  5I2S A;  3RES A;  3GNF B;  5HK0 A;  3MP8 A;  3A8G B;  4J6Y A;  4F7U F;  3V8L A;  3RUX A;  3DLL A;  2HNI A;  4M75 B;  1FX7 A;  2KDS A;  2FYK A;  5HY6 A;  3JCM h;  5GAN g;  2K5F A;  4ZN3 A;  2E1H A;  1YJN A;  1JB0 E;  1YBY A;  2AHJ B;  2RJC A;  3FJP A;  4OB3 B;  2RHX A;  4RKU E;  5IN1 A;  4V2S A;  3H6Z A;  2PVO B;  1U8R A;  4BB7 A;  5LL6 S;  2ZGW A;  4N4G A;  1S72 A;  2VXF A;  2RK2 A;  4EMK C;  2LCC A;  4M7D G;  4PJO A;  3L2Z A;  5GAM d;  3E9F A;  3OYI A;  4C0D B;  3OYE A;  2QA4 T;  2DPP B;  1BI0 A;  5KCH A;  4M75 D;  1MHN A;  4N0A C;  2EYQ A;  3VYG A;  1QVF A;  3PIP A;  4IUV A;  5L8R E;  5GAN 3;  2Y4Y A;  1YIT T;  3MO8 A;  2XI9 A;  4HT8 A;  1VQN A;  2EQJ A;  3TU4 K;  1KQS A;  1N6A A;  4PJO G;  1M1K C;  3CME T;  2X4W A;  4C0Z A;  3C94 A;  1VQ6 T;  3CC4 A;  4JS5 A;  3C95 A;  2EQK A;  3CMA T;  5I21 A;  2XK0 A;  3OYB A;  3CCM T;  3QSU A;  1XOV A;  3M4Y A;  3CCJ T;  3OSV A;  1K73 U;  3BW1 A;  3CCQ A;  1YIJ A;  2Y4X A;  1Q81 U;  4IUQ A;  3VV0 A;  4BAC A;  1YJW A;  3KBG A;  2JTM A;  2EAY A;  2CYZ B;  4F7U B;  5KE3 A;  5GAM g;  3GLX A;  4PLI A;  3QHS A;  4C8Q B;  2KQW A;  2HQE A;  3CBM A;  3UPU A;  2LC4 A;  5GAO r;  3JRZ A;  3JB9 J;  5FRN A;  4QQD A;  1N8R U;  1OYX A;  1KG1 A;  3VU3 C;  2DXB A;  5J26 A;  3GP8 A;  4FL6 A;  3NTH A;  2FL7 A;  4C92 A;  4R55 A;  4MZP A;  3QZ9 B;  2YRV A;  3GNG A;  2F5K A;  4EMK B;  5LJ3 j;  2PU9 B;  1YJ9 A;  1VQK A;  3QJ6 A;  4E7I A;  3FB9 A;  2JVV A;  1K8A U;  2MF2 A;  2E12 A;  2JZ2 A;  1VUB A;  3HFO A;  3M9Q A;  4ZGE B;  4M7A F;  4ME7 A;  3OYH A;  3OMG A;  3H8Z A;  2VGN A;  4TVR A;  1ZBX A;  2VV5 A;  3PMT A;  2GCX A;  2XG8 D;  3A8O B;  5LJ3 f;  3G6E A;  2MWP A;  3JCM P;  1NJI U;  5LJ5 j;  4M78 G;  2E6Z A;  2RK1 A;  3ZFJ A;  2M9U A;  1M1F A;  1W2B A;  4C92 G;  1QVG A;  3FRN A;  4HA8 A;  2K4Y A;  2HQX A;  1BKB A;  2P0P A;  1EIF A;  5GAO l;  3EAE A;  3CXC S;  2RJE A;  4ELZ C;  3HSB A;  3QG1 A;  2H3J A;  5LJ5 f;  2X4X A;  2EJF A;  3CCL T;  3QUI A;  1I5L A;  4B9X A;  4FSX A;  3J80 E;  3NTI A;  5CR2 A;  3P8B B;  1Q86 U;  5CIU A;  3CCR T;  3CCS A;  2MWO A;  5GAN h;  2MAM A;  4C0F A;  1K73 C;  3KXT A;  2K3Y A;  1WGS A;  4PL6 A;  4KUD K;  4JLI A;  1O9S A;  2C06 A;  2R5M A;  2D9T A;  1U1S A;  2P0Q A;  2HAX A;  3V7C A;  1UGS B;  3X26 B;  3CCV A;  1VQM A;  5A2Q E;  2EFI A;  3FC3 A;  3L2U A;  2PQW A;  2XD0 A;  3T9N A;  3SDZ A;  2EKO A;  3JCM J;  1N8R C;  1G3S A;  2VUB A;  1JJ2 S;  3RIR A;  4RG2 A;  2XIC A;  1UGR B;  4M75 G;  4D6W A;  4JS4 A;  1BIA A;  2E10 A;  2WSC E;  5GAN 7;  3G71 A;  1K8A C;  2LDM A;  4O5V A;  3BY7 A;  4OGC A;  4RCB A;  2D0Q B;  2LTO A;  3OS5 A;  3QJY A;  4OF1 A;  3OYK A;  2VGM A;  2K2V A;  4QQG A;  4J8O A;  4BI8 B;  5LJ5 e;  3UWN A;  2IVW A;  4A53 A;  3HHT B;  5FLX E;  1YHQ T;  1NJI C;  1VQP T;  5D6X A;  2FB7 A;  3M56 A;  3OYG A;  2OTJ T;  2RHU A;  2ZCF B;  3M53 A;  5FU7 B;  2LX9 A;  5GAM h;  4E7L A;  3LW5 E;  3V7R A;  4KUI A;  4X9D A;  3LWI A;  2M0O A;  1BIB A;  4F7U E;  5LJ3 d;  4J6W A;  4ZGD B;  3OS1 A;  4ZGJ B;  2QA4 A;  2QQB A;  2V8I A;  1H3Z A;  2IG0 A;  3X20 B;  4M7A E;  2K5L A;  2OAU A;  4C8Q E;  4XTU A;  2RM4 A;  1LNX A;  5GAN 6;  3VJP A;  1Q86 C;  3NTK A;  3QPH A;  4ZTJ A;  3JCM f;  4MDW A;  3TRE A;  1KC8 U;  4M7D A;  1KHC A;  5M9O A;  2RD1 A;  4XU3 A;  5LJ5 d;  1U1T A;  3JCM V;  4M77 C;  4M77 F;  4EPC A;  3CC7 T;  4M7A C;  4JLG A;  2OTL T;  2RA2 A;  4C8Q C;  3CME A;  1VQ6 A;  3MP6 A;  3QKJ A;  2FVU A;  2EJG A;  4NOY A;  2A7Y A;  1PSE A;  2JTF A;  3A8L B;  5FU6 C;  4C8Q F;  5DLO A;  3QBY A;  5GAO m;  3CMA A;  1JBM A;  1NZ9 A;  3QO3 A;  4Q5W A;  3CCM A;  3CCJ A;  4CI0 C;  4JRK A;  1WJQ A;  3CXC A;  1WJR A;  4PLL A;  3OS2 A;  3JB9 H;  2R57 A;  1I8F A;  3JB9 I;  4OGE A;  1Q82 U;  4A4G A;  3MP1 A;  5LJ3 g;  3VUB A;  3OYL A;  1KD1 U;  2LQ8 A;  3LGL A;  4ZN1 A;  4ZTF A;  3RER A;  1K9M C;  1NE8 A;  3MHX A;  2DKG A;  2XDD A;  2WSE E;  4BE2 A;  3BFM A;  5IAY A;  1UGQ B;  5KCO A;  1YI2 A;  5CKH A;  3PTA A;  1B34 A;  3JB9 F;  2L3R A;  2JNG A;  2QTX A;  4N4I A;  4EMG A;  5LJ5 g;  3PMI A;  5DY9 A;  5KE2 A;  2DO3 A;  3N5B B;  1VQ8 T;  3I55 T;  3LLR A;  1Q7Y C;  5D6W A;  2XKO C;  3E1S A;  2DZ9 A;  3NFC A;  3OBY A;  2GFU A;  2CZ1 B;  3JCM X;  5CKB A;  3OSS C;  1BYM A;  3OYJ A;  4CRI A;  3FLG A;  3JCM e;  4BDZ A;  3CBP A;  2YLC A;  1JJ2 A;  4MZM A;  4GY5 A;  1WPY A;  5CK9 A;  5GAN 8;  1IZ6 A;  2CGH A;  4M77 B;  4IUP A;  1VQ9 T;  1RL2 A;  4JDS A;  2P0K A;  4M7A B;  4BDY A;  4XTV A;  4GLK A;  3CD6 T;  4QW2 A;  1KHI A;  5CQY A;  5FU6 B;  2CZ6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...