1MHNA

High resolution crystal structure of the smn tudor domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
b'LQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Survival motor neuron protein
molecule tags Rna binding protein
source organism Homo sapiens
publication title High Resolution X-ray and NMR Structures of the SMN Tudor Domain: conformational variation in the binding site for symmetrically dimethylated arginine residues
pubmed doi rcsb
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1mhnA00
4B9WA 2GFUA 2RHYA 3MO8A 3OS2A 3OYJA 4FL6A 4PL6A 3QJ6A 5KE3A 3OS0A 2LVMA 4EDUA 2D9TA 2O4XB 2L3RA 4GY5A 2BIVA 5FRNA 2LDMA 4ZTFA 4QVZA 4PLIA 1OZ3A 3P8DA 3DB3A 2MWPA 4BACA 4E7LA 1RI0A 2G3RA 3ZEHA 3NTIA 3BDLA 4IUTA 2RO0A 3OYMA 3OQ5A 3OYIA 2EQJA 4QQGA 4UC4A 4NS5A 1MHNA 2F5KA 4C5GA 2E6NA 2EQMA 3OYHA 1WJSA 4L59A 2X4XA 4N4GA 2HQXA 4II1A 2PQWA 3NTHA 3UWNA 3MEUA 2B8AA 4QW2A 4A4EA 4A4HA 4FU6A 1XNIA 3FDRA 2RI2A 3LGFA 4IUQA 1OZ2A 2CKKA 2X4WA 3ME9A 4A4FA 3FC3A 3OMGA 5C6SA 3L2VA 3OYEA 4BE1A 5D6WA 3E9GA 4IURA 2QQSA 2LTOA 2M16A 2L89A 4ZTJA 2DAQA 2EFIA 4QQDA 1WGSA 2JTFA 2HQEA 2RJEA 5FROA 1WJRA 2LRQA 2R57A 2VYTA 2XK0A 4A4GA 2MWOA 2P0KA 1OI1A 3LYIA 2R5MA 5CIUA 3L2RA 4E7JA 2X4YA 3DLMA 2GF7A 3O8VA 2M0OA 2RI5A 4HCZA 3L2QA 3L2UA 4IUVA 3OYCA 3Q1JA 2RHIA 3LGLA 2RHZA 3F70A 4IUUA 3MEAA 3C4SA 2DIGA 4BE2A 3QKJA 2EKOA 2RJDA 5KE2A 2DIQA 2E5QA 5C0MA 3S3MA 2RI3A 3MEWA 4IKFA 2M1HA 3UT1A 2R58A 3H8ZA 2RJFA 1OYXA 3LH0A 3OYDA 3OA6A 3L42A 3OS1A 2RHXA 3S3NA 3QIIA 2RHUA 5IN1A 3MP8A 3PMTA 5D6YA 3PFSA 1N27A 3OYFA 3QBYA 3SD4A 3OYGA 5FRMA 4BD3A 3OYLA 2WACA 5J39A 2LCCA 1SSFA 5J26A 2RJCA 4N4IA 2JZ2A 3LX7A 3KUFA 3S6WA 2L8DA 3GOXA 2IG0A 2XDPA 2FHDA 3FLGA 3M9QA 3OB9A 4Q5WA 2X35A 3MEVA 5IAYA 1H3ZA 4C5HA 2EQKA 3L2WA 4C5IA 5M9OA 3E9FA 3PMIA 5KCHA 1G5VA 2GFAA 2BKDN 2R5AA 4E7HA 3OMCA 2K3YA 3S3OA 3NTKA 3LLRA 3OYNA 3P8HA 2K3XA 3OY9A 4CRIA 2YRVA 2NLUA 3FEOA 4LD6A 4E7IA 3META 4N4HA 4QQ6A 4BE0A 3ASKA 2QQRA 3DB4A 2BUDA 4BDZA 2O4XA 3H6ZA 4Z02A 3OYBA 4BDYA 4PLLA 5KH6A 3MP6A 1WJQA 2EQUA 4OVAA 1KHCA 4E7KA 4RG2A 3MP1A 4C5EA 3OYAA 4IUPA 4X34A 5D6XA 5KCOA 3CEYA 3PNWC 3EAEA 3OYKA 4B9XA
chains in the Genus database with same CATH superfamily
4EPCA 1S72T 1B34B 1PRMC 2D1XA 4FL6A 4J83A 4FCYA 3UA6A 2EGEA 1WXTA 1AEYA 1BU1A 2O4XB 4QVZA 2DEUA 1VUBA 3DB3A 1VYTA 2G3RA 2MK5A 2MCNA 4QQGA 4F7UF 4C5GA 1VQ6A 5ECAA 3ZBDA 8AT1B 5EG2A 3TU4K 1I0CA 3CPWA 2OAWA 2DXUA 3HPWA 1VQMT 3LGFA 3P8BB 3CCST 4F7UG 2KRMA 2DERA 4ZTJA 2RM4A 1BIAA 5FROA 1PNJA 1K9MU 8ATCB 2LJ1A 2R5MA 2HEQA 4RKUE 2JT4A 3FJ5A 2XDDA 3JRZA 3X20B 4IUUA 2HSPA 2E10A 2K9GA 2RJDA 4LDUA 2E6ZA 1WDXA 1WXBA 2R58A 3CCUQ 3V7RA 1KJWA 3QBYA 3SD4A 3ZL7C 3NPFA 1XQHA 3M0SA 5AYFA 4LDVA 2OAUA 5GANh 3H9NA 2XDPA 1BI2A 1RAHB 5IAYA 1YJWA 1WLPB 4PNOA 3L2WA 3JAME 2FRYA 2KXCA 1K8AR 1B3QA 2R5AA 2RA2A 3U23A 1R8OB 3NTKA 2K3XA 4DBQA 3OS5A 2MYSA 2KR3A 4LD6A 3A1PA 2AK5A 3EG3A 3CBMA 5KH6A 1ZUUA 3MKDA 4ZNXA 2CP3A 5D6XA 4O6JA 2QGGA 4M7AD 2V8KA 1ZHIA 4M75E 2V26A 3EGXA 1W4SA 1UHFA 1G3WA 2DTHA 2KXDA 1UGSB 1VQMQ 2DVEA 2L2PA 3VS2A 1RAIB 3ER0A 3CMEA 2LDMA 3E19A 5CK9A 1VOMA 3CC4Q 2VASA 3CXCA 2RO0A 1DJ7B 2IPOB 3EHQA 4RG8A 2O88A 2HQXA 1SHGA 4OB3B 5FW9A 2PTKA 3C95A 4A4HA 1Q81R 3OW2P 4J9FA 1MV3A 4R0KA 1BCMA 5GANe 3CC2Q 2EJ9A 1M90C 2GF7A 4HCBA 1BI1A 5KYXA 3LWIA 2RHZA 1KC8U 3E1SA 2BE9B 5KYWB 1G83A 1SEMA 4GLMA 4IKFA 3GLXA 2DETA 4NOYA 4R55A 2RJFA 3REBB 3L42A 1M30A 1UHCA 2RHXA 3QIIA 2RB6A 3G4ST 2FG0A 1YIJA 4BD3A 1VYVA 1VQ5T 1VQ7T 1AZEA 2QG9B 3LX7A 2X51A 1T0JA 1QCOA 5GMKi 3OW2S 2HDAA 3OB9A 1NPRA 4C5HA 4KGVB 3CCMQ 3RUXA 4KGXB 4FYWB 3PMIA 2YT6A 1Q81U 4XU0A 1M2VB 1WZOA 4ESRA 3OYNA 3P8HA 2J6OA 3RKYA 2HNIA 1Y96A 2W10A 2FL7A 1JXMA 2HD0A 1NZ9A 4JZ4A 3CBPA 2W0ZA 1Y96B 3TQ7P 2JTEA 3OYAA 4X34A 2NUTB 1GRIA 3QWYA 1VQ4A 3OS2A 3OYJA 4PL6A 2BZ8A 4GY5A 1OQKA 2DPPB 3JCMQ 1MMNA 1YCSB 1C1AA 5DM7R 2L0AA 1KQSP 5I2SA 3G6ET 1W2BS 2AZVA 2ZPGB 1LPLA 4PJJA 1VQ9T 1M9SA 3CCSA 2M02A 1W2BA 2ATCB 1XNIA 4FU6A 3CCMA 2DK3A 4WTOB 4P5NA 2COYA 1K9AA 2DAQA 1C6VX 4QQDA 4DA4A 2BTTA 1D0XA 1VQ7Q 2A7YA 4ELYC 1ZA2B 1SG5A 2JN0A 1GFCA 4RTZA 2OX7A 2RI5A 2QQBA 3CPWS 3EG1A 1X43A 2LNHB 2A08A 3UATA 1KSWA 4OMFB 3CC2A 2P0QA 4J6YA 2LZ6B 3KFVA 2EVRA 1QKWA 5FU6C 3VKIA 4J8OA 1W70A 4M75G 1B7TA 1HD3A 1I1JA 1YJNA 1RLQC 3UF4A 1AD5A 2ENMA 2J7IA 1VQKA 4XTWA 3A8OB 2E3IA 4JPBW 2Y4XA 5GMKe 2YRCA 2DX1A 4FYYB 1VQNA 3QUIA 4E6RA 1IB8A 1NJIC 2X4JA 2AZSA 3N5BB 4BDYA 4EMKC 2VUBA 4PFOA 2MMPA 1WXUA 5CAIA 4FYVB 4NL3A 3CEYA 1EFNA 4HCKA 2RHYA 2XKOC 3TCJA 3VV0A 2PUOB 1KQ2A 1WYXA 1AWXA 1QVGP 2DRKA 1WQ7A 3CD6Q 4E2FB 5DLQE 1N9SA 2ZCFB 2DKGA 4AG1C 2LP5A 4PFPA 5KYUA 1JBMA 3CMAT 4JJNK 3CCRT 9ATCB 5GAMh 3L1AA 2X4XA 4II1A 3HKSA 2QQ9A 1TUGB 1I81A 2KRNA 2XICA 1IRXA 1ABQA 3EG9B 3ME9A 1T0HA 4IUQA 3OMGA 2VC8A 2L89A 4KGZB 4FSXA 3JCMb 3NGPA 4JJBA 2GGRA 3LYIA 2QEXT 3VRZA 2FYKA 2QTXA 3L2UA 2DJQA 3JCMV 3C4SA 4AFQC 5GMKh 3PVLA 2EYXA 3CC7A 1BI0A 4J9EA 2M1HA 2ESWA 4HT9A 1GXIE 4CC4B 1VQOA 2EJFA 3A8HB 2MOXA 1VQ7A 2VKNA 2DD5A 2RHUA 5GANj 2RK2A 1QVFP 2VGNA 3LW5E 2RNAA 2X35A 4M7AA 4X9DA 3CBOA 5M9OA 4PK4A 2YUPA 1EIFA 4RTYA 4XTXA 3RNJA 1AHJB 1D1BA 4F7UB 3VS6A 4CRIA 4E7IA 1XOVA 2BZYA 2KSSA 4C0DB 3CCLT 1WFWA 5GAMe 3E2UA 3A5ZB 2QYZA 1QVGA 1VQLA 2DL5A 1YWOA 2VGMA 2AT1B 1YBYA 3FJPA 1G8XA 4F17A 2ECZA 3RERA 5KE3A 4HT8A 3J7AF 3M59A 4ZTFA 3CCVQ 1VQ9A 1YI2T 4ATOA 2F5KA 1VQLQ 4RCBA 2E6NA 4C92G 3MCAB 1TXQA 4F04B 2B8AA 3FIFA 1ZUYA 2KBTA 3GNFB 3I55T 2QA4Q 2EBPA 2RJEA 1P92A 2DYIA 2XK0A 4DBFA 5LJ5d 3I56T 1MNDA 3L2RA 1YJ9Q 2X4YA 1E6HA 2GTOA 3EGDB 1UEBA 4MDWA 4IUVA 3F70A 1OOTA 1VA7A 2DIGA 3A98A 2LT4A 2RI3A 3JB9G 1M1GA 2ZPBB 2MIOA 1WHHA 5GAMf 1VYUA 4OMQA 5IN1A 5D6YA 1MV0B 1LVKA 4M7AF 3OYFA 3C94A 1YJNT 3JCMe 3OYLA 3M5AA 5KYNA 1M1KC 1UB4A 1VQ4T 4OB2B 3TVTA 3QSUA 4OMLA 2DZ9A 4YTLA 4PJOE 3CPFA 5KCHA 3G71Q 1K8AC 4HXJA 4LNPA 2WSFE 2K3YA 5LJ5f 2L5QA 5GJVB 1YJWT 4M78B 4QVDA 1XJWB 4DOWA 2NLUA 5CR2A 4D8KA 3CMEQ 1YWPA 4F7UE 1M90R 3RDVA 3SB2A 1Y07A 2J05A 4XTZA 4DBRA 2LJ0A 5GAN3 5KCOA 1M5Q1 2OI3A 2QGFB 2EKHA 3OYKA 1KC8R 2X3WD 1Y57A 4PJOC 3LWHA 2OTJT 3MO8A 4HA8A 1VQOQ 2V1RA 4C8QA 2ZPEB 4AT1B 1LNXA 3EGDA 1AWJA 3JB9H 2ED0A 2HBWA 5LJ3d 3C12A 2DL8A 1M27C 1GCQA 1VQ8T 3BFMA 1YHQT 5LJ3h 4HKEA 5CKDA 4MDXA 2EQJA 3UA7A 4L59A 1AOJA 4N4GA 4HCCA 4HVVA 3LH5A 1YJWQ 1KD1C 3TSZA 1OU9A 1U06A 1QVGS 2K5FA 2V8IA 3FC3A 3G71T 2COZA 2EJGA 3OYEA 4JLIA 2DXTA 2KAFA 4IIOA 4Z89A 3CCUA 1K73C 3I35A 4Y28E 1YJNQ 4IIMA 1PG5B 1VQKT 1FXXA 3JCMg 2LCLA 3Q1JA 1NLPC 4M78A 2EYZA 1YITT 2K2MA 4M77F 4J5YA 3KXTA 2K4YA 3JCMJ 4J9CA 3VYGA 3MEWA 4A63B 5GAN5 4PJOB 2CSQA 4PJOD 2JXBA 4JDSA 4CC7A 3OBWA 2VVKA 1VQPQ 4FIBA 2O9VA 2WACA 4OGEA 4RTVA 4LUDA 4N4IA 1PD1A 1VQPT 3GOXA 3JV3A 1D1AA 3MEVA 2H3EB 1H92A 2BKDN 3REAB 2QI2A 2QAZA 3M0QA 3LLRA 4RTTA 2MF2A 5LJ3e 1EX4A 1VQLT 3ASKA 1VQKQ 2BUDA 4KUIA 5GAN8 3CMAA 1X75C 4J9IA 3C0CA 1PRLC 1PM3A 1CKAA 2HKNA 1GBRA 2NUTA 2A3LA 1I4K1 1QP2A 2DTOA 1CSKA 4M7DD 1NLOC 4EMKA 3ULRB 3QZ9B 5A0GA 2YDLA 4GBQA 4L5GA 5DY9A 2HCKA 1YI2A 3GPLA 4DBHA 1JJ2S 1PWTA 1X2QA 2QXFA 3P8DA 3NTIA 4IUTA 3CCLQ 4M7AC 3MJXA 3OQ5A 1Q86U 4UC4A 4F16A 1B34A 4LDYA 3CC7T 1RUWA 3UWNA 1M1KR 2O01E 1N8RC 3FDRA 2K5LA 4J9HA 3M0UA 4C92A 1UGQB 3VUBA 2Z0WA 2CZ7B 4M7DF 1Y0MA 1NEGA 1OV3A 5GAN7 2JS0A 1WGSA 2YUQA 2HQEA 5EC7A 4XK8E 3VUZA 1KC8C 1UGRB 3RIRA 3JB9D 2RHIA 4O5VA 1QWEA 1E6GA 4LDXA 4MZTA 3V8KA 3EG2A 3QJYA 5LJ3g 4FYXB 3CCLA 1HXDA 3RESA 2DEQA 4RTUA 3RR6A 3QO3A 1O75A 5GAOr 2FVUA 5J26A 1FMWA 3S6WA 2JMAA 2ABLA 2C0OA 3SWNC 1M1KU 4LN2A 4Z8AA 5FU7C 4FW1A 5KYWA 4ME7A 2RD1A 5A0LA 3OMCA 1ACMB 2P4TA 3VS5A 1QLYA 3CCRQ 4BDZA 2FZGB 5GAN2 5IXFA 1MNEA 2CP2A 2NUZA 1U5SA 4E7KA 2SEMA 1D1CA 2QA4T 3TEEA 3JCMf 5LJ5j 4B9XA 3X28B 2GFUA 2J6KA 5FLXE 2QASA 1V1CA 2FPDA 1XTDA 2EAYA 2BZXA 5LJ3f 5I21A 1TG0A 4M75F 2DL7A 3I56A 5FU7B 5KYUB 2RMOA 2FB7A 2YRDA 3OYMA 4QKUA 1M8VA 3BE3A 1FX7A 1K0SA 2D8JA 5D6WA 1WI7A 4AFSC 2V8JA 1H3HA 1NYFA 3CCET 5L8RE 2R57A 4M78G 1KQSS 3O8VA 2CDTA 3OW2A 4PKCC 5IH2A 4N0AA 2YWWA 3SFMA 3URGA 2XMFA 4C8QC 4BE2A 4KULA 2RQWA 2I2LA 5C0MA 1E7OA 3UT1A 4FT4A 1OYXA 3LH0A 4FM4B 2CT4A 4K11A 4M78D 3AHUA 2O2OA 1G2BA 2DRMA 1OPKA 2GQIA 2KRSA 4OMNA 2DD4A 2RK1A 3HFNA 1N6AA 2FZCB 3HP9A 4M75B 4Q5WA 2OTJA 1AVZC 1W1FA 5DLOA 3PTAA 4C92C 1G5VA 4WF2A 5CKFA 1MUZA 3SEMA 1C0MA 1U1SA 4M78E 3G6EQ 2QEXQ 1UDLA 3H0FA 3PE0A 2COWA 4PJNA 4HVUA 3M53A 3G71A 1QCFA 3HL8A 3CCQT 2KT8A 2VV5A 1JQQA 2JM8A 2JM9A 1Q7YC 4EDUA 2LQKA 2F2VA 3GF5A 3THKA 2WSCE 1D3BA 4BACA 3ZEHA 3G7ZA 3OYIA 5GAOn 3CD6T 2QDLA 1ZSZB 4KRTA 2A37A 1Z9QA 5AT1B 3M4YA 2P84A 4CC2A 1FMVA 3PVQA 4WCIA 2GTJA 2CKKA 2O31A 2LX7A 4IURA 2M51A 2M9UA 1QQJA 1JXOA 2E70A 1JO8A 1VQ5Q 5IHNA 1RAAB 2F69A 3I55A 5CKBA 4M77B 5IXBA 1UTIA 2EGAA 1RABB 3QWXX 2HBPA 1OX9A 4M7DA 3T9NA 4Y91A 4M78F 3VYHB 3OYDA 4L6V5 3RKXA 4RMOA 3OA6A 4XAXB 4Y92A 2EYQA 4XTVA 1JJ2A 3CCVA 4KT0E 3O5ZA 5GANd 4M4ZA 1NJIU 1PKSA 5KYYB 2L8DA 1S72A 1M8MA 4M75C 1N8RU 4E7HA 3S3OA 1HSQA 4XU2A 1QP3A 1BIBA 3NHNA 1PD0A 5GAN4 1ZLMA 2QA4A 4DQ2A 2E4HA 4OB0B 1OEBA 4JZ3A 2C0TA 2C06A 4AMCA 2E1HA 5FWBA 1WJQA 4JJDA 4KUDK 3CC4T 4C5EA 4M75A 4VUBA 3TSWA 3D7SB 1QW1A 1NG2A 1IHWA 1TH7A 3RBBB 2GQVA 4M7AB 3R6NA 2K5IA 1A0NB 2ROTA 3EFOB 3TREA 4JLGA 5IT9E 2KEAA 2IVWA 2LQNA 3M57A 1VQ9Q 1BBZA 1KD1U 3SWNB 1KIKA 1M3AA 1M2OA 4BI8B 4JRKA 1RI0A 2EW3A 1ZSZA 1UUEA 1UE9A 1PC0A 2EQMA 1NPPA 1VQ8A 1YCYA 1M2VA 3VS7A 4QW2A 3A8MB 2M0YA 2XI9A 4AFUC 1Q82U 2RH2A 3CPWP 2QK0A 2RPNA 3E9GA 3WXMB 2OTLA 3PT9A 1N5ZA 3EHRA 1BB9A 1M3CA 2G6FX 2D0NA 2GNCA 1U8RA 2IIMA 4E7JA 4PJOG 3HRTA 3EG9A 4DEXA 4KBMB 4M77C 3CCUT 2MPXC 2EKOA 1YN8A 1BI3A 2X9HA 1MMDA 1ZBXA 1X01A 2KT1A 4BY6C 3VS4A 4A53A 2XDBA 3JCMW 3CCMT 2E5KA 3S3NA 2DFUA 4M7DG 4AG2C 5CCAA 5J3BA 5FRMA 4MMLA 3GBQA 2HL3A 2JZ2A 1Q86R 3G4SQ 5CO7A 3FLGA 3M9QA 4BUGA 1D0YA 1H3ZA 1MGQA 2X3XD 5GAOp 5I2MA 1QKXA 1ARKA 1Q82R 1WHJA 1VQPA 2LJ3A 2LX9A 2D8HA 5HY6A 1RAGB 2EGCA 3QG1A 2DM1A 2NUPB 2DE0X 2KDSA 4N4HA 4LXCA 5GAOl 4BE0A 1QVPA 4Z02A 3OYBA 1Q7YU 3CC2T 2YHTA 3HRSA 3CCQA 2MI6A 2K57A 3CCEQ 1TUCA 1W6XA 3UDCA 3EAEA 2PVOB 4M7AG 3CCEA 2D9TA 1FWZA 1U1TA 2LC4A 1QVFS 4BY6B 2E3HA 5A2QE 2LT1A 3CD6A 4J7IA 2QQAA 1X6GA 1OZ3A 3JB9F 2DNUA 3BDLA 2FEIA 1TOVA 1ZSGA 2PNIA 2XG8D 5IHKA 1WPYA 3M54A 2F1LA 1IREB 5GAMg 2C0IA 3OBYA 2JVVA 5KYXB 5GMKm 2QDYB 3EG0A 4FW2A 3I5RA 1Q7YR 1TSFA 3QHSA 3DLMA 1AZGB 4M77D 2CP5A 4C92F 4LE9A 1WHMA 2YLCA 2LNVA 3EFRA 4BI4A 4MMKA 1KFZA 1IZ6A 4ZGDB 1UJYA 4GLKA 3CCRA 1RI9A 3DKMA 1O9SA 4ORZA 3VS1A 1K0XA 3GIBA 3PIOA 2EQIA 1UFFA 2F2XA 2CP6A 3PMTA 4XU1A 5GAMd 4J9GA 1X6BA 2O9SA 1K9MR 1BCOA 2FHDA 4QT7A 2YLBA 3M0TA 2PUKB 2RQRA 2HL5C 1W2BP 1SPKA 4J9DA 4PFZA 3QYGB 2YRVA 3FEOA 1I07A 1PSFA 3WVEB 1R0CB 2DMOA 1TTHB 2EPDA 2DBMA 2F2WA 1ZX6A 2JUFA 2XD0A 3VJPA 1D3BB 1Y7XA 1GBQA 3DLLA 2ZGWA 3CCSQ 5GMKj 4XTYA 4ZGJB 2RQUA 1ZSZC 1K8AU 4DEYA 2ZPHB 1YFNA 4PJOA 4ZGEB 3V7CA 1RAEB 2KQWA 1QMCA 4J7FA 3MHXA 4MZPA 1H641 1U3OA 5LL6S 3OYHA 1TU0B 4RUGA 3NTHA 4JJCA 3MEUA 2I0NA 4XTUA 1S72Q 3HFOA 3BY7A 3L2VA 2CP7A 1LCKA 4E47A 2LTOA 1NYGA 5GMKl 2DA9A 2EFIA 1FYNA 2JTFA 2VYTA 4PJOF 3L2QA 2HZYA 3A8LB 3OYCA 2RQVA 3JCMP 2P0PA 2DIQA 1KHIA 1VQNT 2CZ0B 2FZKB 4X1VA 2KMTA 3H8ZA 5HKCA 2CS7A 2OJ2A 3EH2A 2GCXA 2BE7D 2JNGA 4HVWA 1CKBA 4A4KA 3CC4A 1N27A 2NUPA 3RMSA 4LD9K 1VIFA 3OYYA 2LCCA 5FU6B 4QVCA 3H0HA 6AT1B 2D0QB 2IG0A 2EQKA 4E7ZA 4LUEA 4C5IA 3QDFA 1I8FA 1PCXA 2EYWA 4M77A 2HQHA 2CREA 5FWCA 1SKUB 4Z88A 5GJWB 3GP8A 1RADB 3META 2EIFA 3M0RA 2QQRA 4OF1A 1UG1A 4C92E 2AIRB 4OVAA 1KHCA 3OSVA 4PJMA 1T3LA 1OX8A 4C0GA 4FSSA 1UGPB 1Q86C 1GCQC 1IGUA 3M58A 3QJ6A 3CCQQ 2WSEE 3OS0A 1UECA 3BDUA 2QEXA 1IGQA 1K9MC 3V7SA 4PLIA 2KGTA 2MWPA 2VXEA 4C8QE 1YHQQ 1J3TA 1PSEA 1JRIA 1Y71A 1T3SA 1VQMA 2FPFA 3VRYA 2A0FB 2KVQG 1FMKA 5HK0A 3NFCA 4RCCA 3VS3A 1VQOT 5GANg 2RI2A 4D6WA 5I22A 2OTJQ 5HCKA 1GL5A 3JCMc 3AT1B 2ZAEA 1SF9A 2P4RA 1WJRA 2P0KA 1SHFA 1R0BG 2F5TX 1V76A 1YHQA 3LGLA 2JW4A 3MEAA 4D8DA 3CCJT 3QKJA 2HKQB 1ABOA 2E5QA 5LJ5g 1SSHA 4LDWA 1VQ6Q 1G3TA 3RKWA 2VB6A 3M56A 3OS1A 4C0FA 1QVFA 3PFSA 4M77E 3OYGA 1MMGA 3JB9J 2CGHA 1X27A 2DLPA 2OTLQ 2HSEB 1SSFA 1YNZA 1UJ0A 3NMZC 3CXCP 1ZA1B 3M55A 2MAMA 2CUDA 1G3SA 4BI3A 2K6DA 3EGXB 3PIPA 4DOVA 4KH0B 3I5SA 1I5LA 2E64A 2ZPIB 3OY9A 2YUNA 5GAOm 4EMHA 4A54A 3ZFJA 2LQWA 1ZUKA 1WNLA 2VWFA 1YJ9T 1ZQ1A 3I56Q 4C0DC 4RG2A 1V29B 1JEGA 4M75D 2FRWA 2NYSA 1Q95G 2E65A 2DJZA 3HHTB 1IXDA 1RAFB 2KROA 2AKLA 1SRMA 2YXYA 1EZZB 1RLPC 2LVMA 1JU5C 4RTWA 2RN8A 2ZPFB 2BIVA 3FRNA 5GAOq 2L3SA 5IHIA 2EYYA 3CQTA 3JSCA 4JRIA 4OGCA 1MHNA 3R6OA 5I11A 2Y4YA 4J6WA 1G3YA 3GNGA 2ROLA 3EFSA 2PQWA 2JS2A 4NL2A 4A4EA 4JS5A 1Q81C 1AWOA 2CH4A 4C0ZA 2X4WA 4JRQA 4OB1B 2XIDA 2HMAA 1K1ZA 4XU3A 2CP0A 2LRQA 2XU8A 3HTRA 4A4GA 1K4US 2OTLT 2FO0A 2A28A 5GAN6 4HCZA 3QZ5B 2Y90A 4M7DB 1HJDA 4M7AE 1VQ6T 3S3MA 1LOJA 1TUDA 2DXCA 5D7UA 1YIJT 3QPHA 1VQ5A 2CT3A 4EIKA 4CI0C 3MP8A 2HAXA 5LJ3j 2DVJA 4OP0A 5CVIA 2J6FA 5HK3A 4ANJA 4CC3A 1N9RA 2JJ9A 4OMOA 1NE8A 1YIJQ 2KK4A 3X26B 1GCPA 4M7DE 2KYMA 4M7DC 4QQ6A 3CC7Q 1KK7A 2O4XA 2RF0A 1NBEB 3MP6A 3SHWA 2EQUA 1MMAA 2E41A 3KBGA 4X9CA 4PJLA 3FB9A 2DILA 3PNWC 2DTIA 2KNBB 1OPLA 2DO3A 3SWNA 3M4GA 1OULA 3V8JA 1OU8A 5FRNA 3G6EA 2PU9B 3CMAQ 5GAMj 1YITA 2EWNA 5CQYA 4NS5A 3J80E 3M0PA 1HK9A 2AKKA 4EMGA 4M78C 4OMPA 1QCNA 3PGGA 1OZ2A 4A4FA 1YP5A 1RACB 4BE1A 2AHJB 2CUBA 3HRUA 2M16A 4ZN1A 1HYOA 1LJOA 3X24B 5CQXA 4TVRA 5A0DA 7AT1B 1GFDA 2D6FA 2SRCA 2K3BA 3CCJA 1BYMA 2KY9A 1R77A 2MWOA 5CIUA 1KG1A 2J06A 2V1QA 2JOYA 3A8GB 2DBKA 3BW1A 4RTXA 5KE2A 1IHVA 3VU3C 2CZ1B 3G1JA 1VQNQ 1I5OB 5GANf 2H8HA 1K73U 3H41A 1JB0E 2DL3A 3EFOA 1WA7A 1YITQ 1M90U 2RQTA 1AT1B 3INZA 4OMMA 3EH1A 4JRPA 2PVGB 5J39A 1WHGA 3UPUA 2DXBA 4C8QF 1X2KA 1PKTA 2L3QA 4MZMA 1UGVA 5LJ5e 1AWWA 1SRLA 2DYBA 1KD1R 1BK2A 1PHTA 4N0AC 1F1BB 3CCJQ 2A36A 4XQ3A 1WQWA 1S1NA 2YSQA 3H6ZA 1WIEA 1NM7A 2KE9A 2KYBA 1Z9ZA 1VIEA 4PLLA 3G4SA 4C8QB 4F14A 1VQ8Q 3QXEB 3MPUB 1M3BA 1NJIR 3JCMd 4B9WA 1M4ZA 1TS9A 2PZ1A 3JB9I 1K73R 3CXCS 1X6OA 1N8RR 2K2VA 2L3RA 4KH1B 4FT2A 2DL4A 4E7LA 1M1FA 4C92B 4JS4A 3X25B 3CMET 2NWMA 1WJSA 2ZZDA 2JMCA 3RMQA 3EGUA 1KQSA 3H0IA 4BB7A 4R56A 3QYHB 1KQ1A 1TWBA 4F7UA 5C6SA 3L2ZA 3IQLA 3J81E 3I9QA 2KI7A 2QQSA 2JTMA 3JCMh 4ELZC 2CH4W 5L23A 1D0ZA 2XHCA 1WX6A 1BKBA 1VQ4Q 3OSSC 2E12A 1ZBJA 2DF6A 4C92D 3HSBA 2FPEA 4J9BA 1OI1A 1RL2A 2K79A 4B6MA 2M0OA 5LJ5h 5CKEA 1NEBA 3JCMX 1B07A 2LQ8A 2LCSA 5KYYA 2YUOA 1QWFA 2LMJA 2B86A 1Q82C 4V2SA 1WHKA 2QTVA 1YJ9A 4C8QD 1JJ2P 2CSIA 4E7SA 2RJCA 3WVDB 1D09B 3KUFA 3I55Q 2DZCA 2VXFA 3E9FA 5CKHA 2GFAA 2GBQA 4ZN3A 2PVDB 1IO6A 2CYZB 4J6XA 2K7AA 3VS0A 3SDZA 1WHLA 2ED1A 4AFZC 1X69A 3DB4A 4EMKB 3V8LA 1YI2Q 3CCVT 3MP1A 3QDRB 4IUPA 4JUVA 4M77G 1H8KA 4C8QG 2H3JA 2L3PA 1K76A 2CZ6B
chains in the Genus database with same CATH topology
2VV5A 3FJPA 4EPCA 1S72T 1B34B 3RERA 4FL6A 4J83A 3M58A 3QJ6A 5KE3A 4HT8A 2WSEE 3OS0A 1Q7YC 3M59A 4EDUA 3J7AF 2LQKA 2O4XB 3BDUA 3GF5A 2QEXA 2WSCE 4ZTFA 1K9MC 1D3BA 4QVZA 4PLIA 3V7SA 1VUBA 3DB3A 2MWPA 4BACA 1YI2T 2VXEA 2G3RA 3ZEHA 4C8QE 1VQ9A 4ATOA 3G7ZA 3OYIA 1PSEA 1JRIA 1Y71A 4QQGA 1VQMA 4F7UF 2F5KA 4C5GA 1VQ6A 4RCBA 2E6NA 2KVQG 5GAOn 3ZBDA 4C92G 3MCAB 5HK0A 5EG2A 3CD6T 3TU4K 3NFCA 3M4YA 2B8AA 4RCCA 2DXUA 3FIFA 3HPWA 3CPWA 1VQOT 5GANg 1VQMT 2RI2A 3LGFA 4D6WA 2CKKA 3JCMc 3P8BB 4IURA 3CCST 3GNFB 4F7UG 4ZTJA 2M9UA 3I55T 2E70A 2RM4A 2RJEA 1BIAA 1P92A 1WJRA 2XK0A 5FROA 1K9MU 5LJ5d 3I56T 2P0KA 2R5MA 3L2RA 4RKUE 2X4YA 2F69A 3I55A 2F5TX 2XDDA 1UEBA 4MDWA 3JRZA 4IUVA 4M77B 5CKBA 3LGLA 3X20B 1YHQA 3F70A 4IUUA 3MEAA 2DIGA 3CCJT 3QKJA 2E10A 2HBPA 2RJDA 4M7DA 2LT4A 2E5QA 3T9NA 4LDUA 2RI3A 2E6ZA 5LJ5g 4Y91A 1M1GA 3JB9G 2ZPBB 4M78F 4LDWA 2R58A 3VYHB 3OYDA 4L6V5 1G3TA 3RKXA 4RMOA 3OA6A 5GAMf 3RKWA 4XAXB 3M56A 3OS1A 3V7RA 2EYQA 5IN1A 4XTVA 4C0FA 5D6YA 3CCVA 4KT0E 1JJ2A 1QVFA 3PFSA 4M77E 3OYFA 3QBYA 3C94A 1YJNT 4M7AF 3SD4A 3JCMe 3OYGA 3OYLA 3JB9J 2CGHA 3M5AA 5GANd 1SSFA 1NJIU 1XQHA 5AYFA 4LDVA 2OAUA 1M1KC 1UB4A 2L8DA 5GANh 1VQ4T 2XDPA 4OB2B 3M55A 2MAMA 1BI2A 1S72A 3QSUA 4M75C 1G3SA 5IAYA 1YJWA 2DZ9A 4YTLA 4PJOE 4PNOA 3L2WA 3CPFA 4BI3A 3JAME 3PIPA 5KCHA 1N8RU 4DOVA 2RA2A 2R5AA 1K8AC 1R8OB 1I5LA 4E7HA 2WSFE 2E64A 2K3YA 3S3OA 2ZPIB 3NTKA 2L5QA 1QP3A 1BIBA 4M78B 4XU2A 4QVDA 2K3XA 5LJ5f 1YJWT 4DOWA 3OY9A 3OS5A 2NLUA 5CR2A 5GAN4 4LD6A 2QA4A 4DQ2A 5GAOm 4EMHA 4A54A 4OB0B 3ZFJA 2C06A 4F7UE 1YJ9T 1WNLA 2E1HA 3CBMA 5KH6A 1ZQ1A 1WJQA 4KUDK 4C0DC 3SB2A 4RG2A 1V29B 4C5EA 3CC4T 1Y07A 4M75D 4M75A 4XTZA 4VUBA 2E65A 2DJZA 5GAN3 1QW1A 5D6XA 4O6JA 4M7AD 5KCOA 1M5Q1 2V8KA 1TH7A 1ZHIA 2GQVA 4PJOC 3OYKA 3HHTB 4M7AB 2K5IA 4M75E 3LWHA 2OTJT 1W4SA 2DTHA 1G3WA 3MO8A 3TREA 4JLGA 1UGSB 4HA8A 2DVEA 5IT9E 2IVWA 4C8QA 2ZPEB 3M57A 1LNXA 2LVMA 1KD1U 3SWNB 3JB9H 2ZPFB 2BIVA 3FRNA 3C12A 3ER0A 5LJ3d 5GAOq 3CMEA 2LDMA 3E19A 5CK9A 4BI8B 1VQ8T 3BFMA 1YHQT 4JRKA 1RI0A 4HKEA 5LJ3h 5CKDA 3CXCA 4MDXA 2RO0A 1DJ7B 3JSCA 2EQJA 4JRIA 4OGCA 1MHNA 3R6OA 4RG8A 2Y4YA 2EQMA 1NPPA 1G3YA 3GNGA 4J6WA 4L59A 3CCQT 1YCYA 3EFSA 1VQ8A 4N4GA 2HQXA 4HCCA 2PQWA 4OB3B 4NL2A 4QW2A 4A4EA 3C95A 4A4HA 3A8MB 4JS5A 1KD1C 2XI9A 1Q81C 1QVGS 4C0ZA 2RH2A 2X4WA 2K5FA 2V8IA 3FC3A 3G71T 4JRQA 1Q82U 2EJGA 3OYEA 4OB1B 2XIDA 3E9GA 4JLIA 3WXMB 2OTLA 2DXTA 3PT9A 2KAFA 4XU3A 2LRQA 2XU8A 5GANe 3CCUA 4A4GA 1K73C 1U8RA 2OTLT 4E7JA 4PJOG 2EJ9A 4Y28E 3HRTA 2GF7A 5GAN6 1M90C 4HCZA 3QZ5B 4HCBA 1VQKT 1BI1A 1FXXA 3JCMg 4KBMB 2LCLA 3Q1JA 4M78A 2Y90A 2RHZA 3LWIA 1YITT 4M77C 3CCUT 3E1SA 1KC8U 4M77F 4M7AE 4J5YA 4M7DB 3KXTA 2EKOA 2K4YA 3JCMJ 1VQ6T 1BI3A 3S3MA 1LOJA 3VYGA 3MEWA 4IKFA 1ZBXA 1X01A 2DXCA 3GLXA 5GAN5 4NOYA 4PJOB 4BY6C 4R55A 2RJFA 1YIJT 4A53A 2XDBA 3JCMW 3CCMT 3L42A 3QPHA 4PJOD 2RHXA 3S3NA 1VQ5A 3QIIA 4M7DG 2RB6A 4JDSA 3MP8A 4CI0C 3G4ST 3OBWA 5CCAA 5LJ3j 2HAXA 4FIBA 5J3BA 1YIJA 5FRMA 4MMLA 4BD3A 2WACA 4OP0A 4OGEA 5CVIA 5HK3A 1VQ5T 4N4IA 1VQ7T 2JZ2A 3LX7A 1VQPT 1N9RA 3GOXA 5CO7A 5GMKi 3OW2S 3FLGA 3M9QA 3OB9A 4BUGA 3MEVA 1H3ZA 1NE8A 1NPRA 4C5HA 1MGQA 3RUXA 5GAOp 5I2MA 3PMIA 1Q81U 2KK4A 1VQPA 2LX9A 4XU0A 3X26B 2BKDN 2QI2A 5HY6A 4M7DE 3LLRA 3OYNA 3P8HA 2MF2A 3RKYA 2HNIA 3QG1A 5LJ3e 4M7DC 1Y96A 2KDSA 4N4HA 4QQ6A 5GAOl 4BE0A 2FL7A 3ASKA 1VQLT 2BUDA 4KUIA 1QVPA 2HD0A 2O4XA 1X75C 4Z02A 5GAN8 1NZ9A 3OYBA 3CMAA 1Q7YU 3CBPA 3CC2T 3MP6A 2YHTA 2EQUA 3HRSA 2E41A 1Y96B 3CCQA 3KBGA 2MI6A 4X9CA 2K57A 3OYAA 2A3LA 4X34A 1I4K1 3FB9A 1QP2A 3PNWC 3UDCA 2DTOA 2DTIA 3EAEA 4M7DD 1VQ4A 4EMKA 3QZ9B 2PVOB 5A0GA 3OS2A 4M7AG 3OYJA 4L5GA 5DY9A 4PL6A 2DO3A 3SWNA 3CCEA 3M4GA 1YI2A 3V8JA 2D9TA 1FWZA 1U1TA 3GPLA 2LC4A 4GY5A 1JJ2S 1QVFS 4BY6B 5FRNA 3G6EA 2DPPB 2PU9B 5A2QE 2LT1A 3JCMQ 4J7IA 2QQAA 5GAMj 1OZ3A 3CD6A 2QXFA 3P8DA 3NTIA 3BDLA 4IUTA 5DM7R 1YITA 3OQ5A 1Q86U 4M7AC 2EWNA 5CQYA 4UC4A 4NS5A 3J80E 1B34A 4LDYA 5I2SA 3G6ET 3CC7T 1W2BS 2XG8D 2ZPGB 1WPYA 3M54A 1HK9A 1VQ9T 1M9SA 3CCSA 3UWNA 4EMGA 4M78C 2O01E 1IREB 1W2BA 1N8RC 4FU6A 1XNIA 3CCMA 3FDRA 2DK3A 3PGGA 1OZ2A 5GAMg 2K5LA 4A4FA 4C92A 3OBYA 4P5NA 1UGQB 4BE1A 2AHJB 2JVVA 3HRUA 3VUBA 2CZ7B 2M16A 4ZN1A 4M7DF 5GMKm 2QDYB 2DAQA 1LJOA 3X24B 4TVRA 4QQDA 5CQXA 5A0DA 5GAN7 1WGSA 4DA4A 2HQEA 4XK8E 2D6FA 3VUZA 2A7YA 4ELYC 3CCJA 3QHSA 2KY9A 1BYMA 2MWOA 5CIUA 2JN0A 1KG1A 3DLMA 4M77D 1KC8C 2RI5A 2QQBA 4C92F 1UGRB 3RIRA 3JB9D 2RHIA 2YLCA 3CPWS 2JOYA 3A8GB 4O5VA 2LNVA 3EFRA 4BI4A 4MMKA 1IZ6A 4ZGDB 3BW1A 4GLKA 5KE2A 4LDXA 3CCRA 3VU3C 2CZ1B 4MZTA 3V8KA 3DKMA 1O9SA 5GANf 4OMFB 1K73U 3GIBA 1JB0E 3QJYA 3PIOA 5LJ3g 3CC2A 2P0QA 3CCLA 1HXDA 1M90U 4J6YA 3PMTA 3INZA 3RESA 2DEQA 4JRPA 2PVGB 3QO3A 1O75A 4XU1A 5GAMd 5FU6C 3VKIA 5GAOr 5J39A 4J8OA 2FVUA 5J26A 4M75G 3UPUA 2DXBA 3S6WA 4C8QF 2FHDA 1YJNA 3SWNC 1M1KU 5FU7C 2YLBA 4MZMA 1VQKA 4XTWA 3A8OB 5LJ5e 4ME7A 2Y4XA 2PUKB 5GMKe 2RD1A 5A0LA 3OMCA 4N0AC 2P4TA 3QYGB 1VQNA 2YRVA 3FEOA 1PSFA 4XQ3A 1WQWA 3WVEB 3QUIA 1NJIC 2X4JA 4BDZA 3H6ZA 1VIEA 3N5BB 4PLLA 4BDYA 4EMKC 5GAN2 2VUBA 2MMPA 3G4SA 4E7KA 4C8QB 5CAIA 3QXEB 3JB9F 2QA4T 2JUFA 2XD0A 3TEEA 3VJPA 1D3BB 1Y7XA 3CEYA 4NL3A 3DLLA 2ZGWA 3JCMf 5LJ5j 3JCMd 4B9XA 3X28B 4B9WA 2GFUA 1M4ZA 5GMKj 2RHYA 2XKOC 4XTYA 3TCJA 3VV0A 5FLXE 2PUOB 1KQ2A 4ZGJB 3JB9I 1XTDA 2EAYA 5LJ3f 3CXCS 1X6OA 1K8AU 5I21A 2K2VA 2ZPHB 4M75F 3I56A 1WQ7A 2L3RA 5FU7B 3V7CA 4ZGEB 4PJOA 4FT2A 2FB7A 2KQWA 4J7FA 5DLQE 4E7LA 1N9SA 2ZCFB 2DKGA 1M1FA 3MHXA 1JBMA 4MZPA 3OYMA 4C92B 4JS4A 3X25B 1H641 3CMAT 5LL6S 3CMET 3CCRT 4JJNK 3OYHA 1M8VA 1WJSA 5GAMh 2ZZDA 3L1AA 2X4XA 3RMQA 4II1A 3NTHA 1KQSA 4R56A 3MEUA 4BB7A 1FX7A 3HKSA 3QYHB 1KQ1A 2QQ9A 4XTUA 1I81A 2XICA 4F7UA 4IUQA 3ME9A 3HFOA 3OMGA 5C6SA 3L2ZA 3BY7A 3L2VA 5D6WA 3J81E 4E47A 2VC8A 2QQSA 2JTMA 2LTOA 2V8JA 2L89A 3JCMh 4ELZC 2XHCA 5GMKl 2EFIA 1BKBA 2JTFA 3OSSC 4FSXA 3JCMb 3CCET 2E12A 5L8RE 2VYTA 2R57A 4C92D 3HSBA 4M78G 3LYIA 1OI1A 1RL2A 1KQSS 2QEXT 3O8VA 4PJOF 2M0OA 3L2QA 3OW2A 2FYKA 3A8LB 2QTXA 4PKCC 5LJ5h 3OYCA 3L2UA 5CKEA 4N0AA 3SFMA 3URGA 3JCMV 3JCMP 3C4SA 5GMKh 4C8QC 4BE2A 4KULA 3JCMX 2P0PA 2DIQA 1KHIA 2I2LA 1BI0A 5C0MA 3CC7A 2LQ8A 1VQNT 2CZ0B 2M1HA 4HT9A 2KMTA 3UT1A 1GXIE 4FT4A 3H8ZA 5HKCA 1OYXA 3LH0A 2CS7A 1Q82C 1VQOA 2EJFA 3A8HB 4FM4B 1YJ9A 4V2SA 2GCXA 4M78D 1VQ7A 3AHUA 2JNGA 2DD5A 2RHUA 4A4KA 3CC4A 5GANj 1N27A 4LD9K 3RMSA 4C8QD 1VIFA 2RK2A 3OYYA 2LCCA 5FU6B 2VGNA 2RJCA 2DD4A 3LW5E 2RK1A 3HFNA 1N6AA 3HP9A 3WVDB 4QVCA 3KUFA 2D0QB 2IG0A 4M75B 4Q5WA 2OTJA 2X35A 5DLOA 2EQKA 4X9DA 4C92C 3CBOA 3PTAA 4M7AA 4C5IA 2DZCA 5M9OA 2VXFA 3E9FA 1G5VA 1EIFA 5CKHA 2GFAA 4XTXA 4WF2A 5CKFA 1I8FA 4ZN3A 2PVDB 1AHJB 4M77A 4F7UB 2CYZB 4J6XA 4CRIA 3SDZA 1U1SA 4M78E 3GP8A 4E7IA 3META 2EIFA 1XOVA 2QQRA 3DB4A 4OF1A 4EMKB 2KSSA 4C0DB 3V8LA 3CCLT 5GAMe 4C92E 3A5ZB 1KHCA 4OVAA 3CCVT 3MP1A 3QDRB 4IUPA 3OSVA 4JUVA 1QVGA 4M77G 1VQLA 4C0GA 2VGMA 3M53A 4C8QG 1UGPB 1Q86C 2H3JA 3G71A 3HL8A 2CZ6B 1YBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9W A;  2GFU A;  2RHY A;  3MO8 A;  3OS2 A;  3OYJ A;  4FL6 A;  4PL6 A;  3QJ6 A;  5KE3 A;  3OS0 A;  2LVM A;  4EDU A;  2D9T A;  2O4X B;  2L3R A;  4GY5 A;  2BIV A;  5FRN A;  2LDM A;  4ZTF A;  4QVZ A;  4PLI A;  1OZ3 A;  3P8D A;  3DB3 A;  2MWP A;  4BAC A;  4E7L A;  1RI0 A;  2G3R A;  3ZEH A;  3NTI A;  3BDL A;  4IUT A;  2RO0 A;  3OYM A;  3OQ5 A;  3OYI A;  2EQJ A;  4QQG A;  4UC4 A;  4NS5 A;  1MHN A;  2F5K A;  4C5G A;  2E6N A;  2EQM A;  3OYH A;  1WJS A;  4L59 A;  2X4X A;  4N4G A;  2HQX A;  4II1 A;  2PQW A;  3NTH A;  3UWN A;  3MEU A;  2B8A A;  4QW2 A;  4A4E A;  4A4H A;  4FU6 A;  1XNI A;  3FDR A;  2RI2 A;  3LGF A;  4IUQ A;  1OZ2 A;  2CKK A;  2X4W A;  3ME9 A;  4A4F A;  3FC3 A;  3OMG A;  5C6S A;  3L2V A;  3OYE A;  4BE1 A;  5D6W A;  3E9G A;  4IUR A;  2QQS A;  2LTO A;  2M16 A;  2L89 A;  4ZTJ A;  2DAQ A;  2EFI A;  4QQD A;  1WGS A;  2JTF A;  2HQE A;  2RJE A;  5FRO A;  1WJR A;  2LRQ A;  2R57 A;  2VYT A;  2XK0 A;  4A4G A;  2MWO A;  2P0K A;  1OI1 A;  3LYI A;  2R5M A;  5CIU A;  3L2R A;  4E7J A;  2X4Y A;  3DLM A;  2GF7 A;  3O8V A;  2M0O A;  2RI5 A;  4HCZ A;  3L2Q A;  3L2U A;  4IUV A;  3OYC A;  3Q1J A;  2RHI A;  3LGL A;  2RHZ A;  3F70 A;  4IUU A;  3MEA A;  3C4S A;  2DIG A;  4BE2 A;  3QKJ A;  2EKO A;  2RJD A;  5KE2 A;  2DIQ A;  2E5Q A;  5C0M A;  3S3M A;  2RI3 A;  3MEW A;  4IKF A;  2M1H A;  3UT1 A;  2R58 A;  3H8Z A;  2RJF A;  1OYX A;  3LH0 A;  3OYD A;  3OA6 A;  3L42 A;  3OS1 A;  2RHX A;  3S3N A;  3QII A;  2RHU A;  5IN1 A;  3MP8 A;  3PMT A;  5D6Y A;  3PFS A;  1N27 A;  3OYF A;  3QBY A;  3SD4 A;  3OYG A;  5FRM A;  4BD3 A;  3OYL A;  2WAC A;  5J39 A;  2LCC A;  1SSF A;  5J26 A;  2RJC A;  4N4I A;  2JZ2 A;  3LX7 A;  3KUF A;  3S6W A;  2L8D A;  3GOX A;  2IG0 A;  2XDP A;  2FHD A;  3FLG A;  3M9Q A;  3OB9 A;  4Q5W A;  2X35 A;  3MEV A;  5IAY A;  1H3Z A;  4C5H A;  2EQK A;  3L2W A;  4C5I A;  5M9O A;  3E9F A;  3PMI A;  5KCH A;  1G5V A;  2GFA A;  2BKD N;  2R5A A;  4E7H A;  3OMC A;  2K3Y A;  3S3O A;  3NTK A;  3LLR A;  3OYN A;  3P8H A;  2K3X A;  3OY9 A;  4CRI A;  2YRV A;  2NLU A;  3FEO A;  4LD6 A;  4E7I A;  3MET A;  4N4H A;  4QQ6 A;  4BE0 A;  3ASK A;  2QQR A;  3DB4 A;  2BUD A;  4BDZ A;  2O4X A;  3H6Z A;  4Z02 A;  3OYB A;  4BDY A;  4PLL A;  5KH6 A;  3MP6 A;  1WJQ A;  2EQU A;  4OVA A;  1KHC A;  4E7K A;  4RG2 A;  3MP1 A;  4C5E A;  3OYA A;  4IUP A;  4X34 A;  5D6X A;  5KCO A;  3CEY A;  3PNW C;  3EAE A;  3OYK A;  4B9X A; 
#chains in the Genus database with same CATH topology
 4EPC A;  1S72 T;  1B34 B;  1PRM C;  2D1X A;  4FL6 A;  4J83 A;  4FCY A;  3UA6 A;  2EGE A;  1WXT A;  1AEY A;  1BU1 A;  2O4X B;  4QVZ A;  2DEU A;  1VUB A;  3DB3 A;  1VYT A;  2G3R A;  2MK5 A;  2MCN A;  4QQG A;  4F7U F;  4C5G A;  1VQ6 A;  5ECA A;  3ZBD A;  8AT1 B;  5EG2 A;  3TU4 K;  1I0C A;  3CPW A;  2OAW A;  2DXU A;  3HPW A;  1VQM T;  3LGF A;  3P8B B;  3CCS T;  4F7U G;  2KRM A;  2DER A;  4ZTJ A;  2RM4 A;  1BIA A;  5FRO A;  1PNJ A;  1K9M U;  8ATC B;  2LJ1 A;  2R5M A;  2HEQ A;  4RKU E;  2JT4 A;  3FJ5 A;  2XDD A;  3JRZ A;  3X20 B;  4IUU A;  2HSP A;  2E10 A;  2K9G A;  2RJD A;  4LDU A;  2E6Z A;  1WDX A;  1WXB A;  2R58 A;  3CCU Q;  3V7R A;  1KJW A;  3QBY A;  3SD4 A;  3ZL7 C;  3NPF A;  1XQH A;  3M0S A;  5AYF A;  4LDV A;  2OAU A;  5GAN h;  3H9N A;  2XDP A;  1BI2 A;  1RAH B;  5IAY A;  1YJW A;  1WLP B;  4PNO A;  3L2W A;  3JAM E;  2FRY A;  2KXC A;  1K8A R;  1B3Q A;  2R5A A;  2RA2 A;  3U23 A;  1R8O B;  3NTK A;  2K3X A;  4DBQ A;  3OS5 A;  2MYS A;  2KR3 A;  4LD6 A;  3A1P A;  2AK5 A;  3EG3 A;  3CBM A;  5KH6 A;  1ZUU A;  3MKD A;  4ZNX A;  2CP3 A;  5D6X A;  4O6J A;  2QGG A;  4M7A D;  2V8K A;  1ZHI A;  4M75 E;  2V26 A;  3EGX A;  1W4S A;  1UHF A;  1G3W A;  2DTH A;  2KXD A;  1UGS B;  1VQM Q;  2DVE A;  2L2P A;  3VS2 A;  1RAI B;  3ER0 A;  3CME A;  2LDM A;  3E19 A;  5CK9 A;  1VOM A;  3CC4 Q;  2VAS A;  3CXC A;  2RO0 A;  1DJ7 B;  2IPO B;  3EHQ A;  4RG8 A;  2O88 A;  2HQX A;  1SHG A;  4OB3 B;  5FW9 A;  2PTK A;  3C95 A;  4A4H A;  1Q81 R;  3OW2 P;  4J9F A;  1MV3 A;  4R0K A;  1BCM A;  5GAN e;  3CC2 Q;  2EJ9 A;  1M90 C;  2GF7 A;  4HCB A;  1BI1 A;  5KYX A;  3LWI A;  2RHZ A;  1KC8 U;  3E1S A;  2BE9 B;  5KYW B;  1G83 A;  1SEM A;  4GLM A;  4IKF A;  3GLX A;  2DET A;  4NOY A;  4R55 A;  2RJF A;  3REB B;  3L42 A;  1M30 A;  1UHC A;  2RHX A;  3QII A;  2RB6 A;  3G4S T;  2FG0 A;  1YIJ A;  4BD3 A;  1VYV A;  1VQ5 T;  1VQ7 T;  1AZE A;  2QG9 B;  3LX7 A;  2X51 A;  1T0J A;  1QCO A;  5GMK i;  3OW2 S;  2HDA A;  3OB9 A;  1NPR A;  4C5H A;  4KGV B;  3CCM Q;  3RUX A;  4KGX B;  4FYW B;  3PMI A;  2YT6 A;  1Q81 U;  4XU0 A;  1M2V B;  1WZO A;  4ESR A;  3OYN A;  3P8H A;  2J6O A;  3RKY A;  2HNI A;  1Y96 A;  2W10 A;  2FL7 A;  1JXM A;  2HD0 A;  1NZ9 A;  4JZ4 A;  3CBP A;  2W0Z A;  1Y96 B;  3TQ7 P;  2JTE A;  3OYA A;  4X34 A;  2NUT B;  1GRI A;  3QWY A;  1VQ4 A;  3OS2 A;  3OYJ A;  4PL6 A;  2BZ8 A;  4GY5 A;  1OQK A;  2DPP B;  3JCM Q;  1MMN A;  1YCS B;  1C1A A;  5DM7 R;  2L0A A;  1KQS P;  5I2S A;  3G6E T;  1W2B S;  2AZV A;  2ZPG B;  1LPL A;  4PJJ A;  1VQ9 T;  1M9S A;  3CCS A;  2M02 A;  1W2B A;  2ATC B;  1XNI A;  4FU6 A;  3CCM A;  2DK3 A;  4WTO B;  4P5N A;  2COY A;  1K9A A;  2DAQ A;  1C6V X;  4QQD A;  4DA4 A;  2BTT A;  1D0X A;  1VQ7 Q;  2A7Y A;  4ELY C;  1ZA2 B;  1SG5 A;  2JN0 A;  1GFC A;  4RTZ A;  2OX7 A;  2RI5 A;  2QQB A;  3CPW S;  3EG1 A;  1X43 A;  2LNH B;  2A08 A;  3UAT A;  1KSW A;  4OMF B;  3CC2 A;  2P0Q A;  4J6Y A;  2LZ6 B;  3KFV A;  2EVR A;  1QKW A;  5FU6 C;  3VKI A;  4J8O A;  1W70 A;  4M75 G;  1B7T A;  1HD3 A;  1I1J A;  1YJN A;  1RLQ C;  3UF4 A;  1AD5 A;  2ENM A;  2J7I A;  1VQK A;  4XTW A;  3A8O B;  2E3I A;  4JPB W;  2Y4X A;  5GMK e;  2YRC A;  2DX1 A;  4FYY B;  1VQN A;  3QUI A;  4E6R A;  1IB8 A;  1NJI C;  2X4J A;  2AZS A;  3N5B B;  4BDY A;  4EMK C;  2VUB A;  4PFO A;  2MMP A;  1WXU A;  5CAI A;  4FYV B;  4NL3 A;  3CEY A;  1EFN A;  4HCK A;  2RHY A;  2XKO C;  3TCJ A;  3VV0 A;  2PUO B;  1KQ2 A;  1WYX A;  1AWX A;  1QVG P;  2DRK A;  1WQ7 A;  3CD6 Q;  4E2F B;  5DLQ E;  1N9S A;  2ZCF B;  2DKG A;  4AG1 C;  2LP5 A;  4PFP A;  5KYU A;  1JBM A;  3CMA T;  4JJN K;  3CCR T;  9ATC B;  5GAM h;  3L1A A;  2X4X A;  4II1 A;  3HKS A;  2QQ9 A;  1TUG B;  1I81 A;  2KRN A;  2XIC A;  1IRX A;  1ABQ A;  3EG9 B;  3ME9 A;  1T0H A;  4IUQ A;  3OMG A;  2VC8 A;  2L89 A;  4KGZ B;  4FSX A;  3JCM b;  3NGP A;  4JJB A;  2GGR A;  3LYI A;  2QEX T;  3VRZ A;  2FYK A;  2QTX A;  3L2U A;  2DJQ A;  3JCM V;  3C4S A;  4AFQ C;  5GMK h;  3PVL A;  2EYX A;  3CC7 A;  1BI0 A;  4J9E A;  2M1H A;  2ESW A;  4HT9 A;  1GXI E;  4CC4 B;  1VQO A;  2EJF A;  3A8H B;  2MOX A;  1VQ7 A;  2VKN A;  2DD5 A;  2RHU A;  5GAN j;  2RK2 A;  1QVF P;  2VGN A;  3LW5 E;  2RNA A;  2X35 A;  4M7A A;  4X9D A;  3CBO A;  5M9O A;  4PK4 A;  2YUP A;  1EIF A;  4RTY A;  4XTX A;  3RNJ A;  1AHJ B;  1D1B A;  4F7U B;  3VS6 A;  4CRI A;  4E7I A;  1XOV A;  2BZY A;  2KSS A;  4C0D B;  3CCL T;  1WFW A;  5GAM e;  3E2U A;  3A5Z B;  2QYZ A;  1QVG A;  1VQL A;  2DL5 A;  1YWO A;  2VGM A;  2AT1 B;  1YBY A;  3FJP A;  1G8X A;  4F17 A;  2ECZ A;  3RER A;  5KE3 A;  4HT8 A;  3J7A F;  3M59 A;  4ZTF A;  3CCV Q;  1VQ9 A;  1YI2 T;  4ATO A;  2F5K A;  1VQL Q;  4RCB A;  2E6N A;  4C92 G;  3MCA B;  1TXQ A;  4F04 B;  2B8A A;  3FIF A;  1ZUY A;  2KBT A;  3GNF B;  3I55 T;  2QA4 Q;  2EBP A;  2RJE A;  1P92 A;  2DYI A;  2XK0 A;  4DBF A;  5LJ5 d;  3I56 T;  1MND A;  3L2R A;  1YJ9 Q;  2X4Y A;  1E6H A;  2GTO A;  3EGD B;  1UEB A;  4MDW A;  4IUV A;  3F70 A;  1OOT A;  1VA7 A;  2DIG A;  3A98 A;  2LT4 A;  2RI3 A;  3JB9 G;  1M1G A;  2ZPB B;  2MIO A;  1WHH A;  5GAM f;  1VYU A;  4OMQ A;  5IN1 A;  5D6Y A;  1MV0 B;  1LVK A;  4M7A F;  3OYF A;  3C94 A;  1YJN T;  3JCM e;  3OYL A;  3M5A A;  5KYN A;  1M1K C;  1UB4 A;  1VQ4 T;  4OB2 B;  3TVT A;  3QSU A;  4OML A;  2DZ9 A;  4YTL A;  4PJO E;  3CPF A;  5KCH A;  3G71 Q;  1K8A C;  4HXJ A;  4LNP A;  2WSF E;  2K3Y A;  5LJ5 f;  2L5Q A;  5GJV B;  1YJW T;  4M78 B;  4QVD A;  1XJW B;  4DOW A;  2NLU A;  5CR2 A;  4D8K A;  3CME Q;  1YWP A;  4F7U E;  1M90 R;  3RDV A;  3SB2 A;  1Y07 A;  2J05 A;  4XTZ A;  4DBR A;  2LJ0 A;  5GAN 3;  5KCO A;  1M5Q 1;  2OI3 A;  2QGF B;  2EKH A;  3OYK A;  1KC8 R;  2X3W D;  1Y57 A;  4PJO C;  3LWH A;  2OTJ T;  3MO8 A;  4HA8 A;  1VQO Q;  2V1R A;  4C8Q A;  2ZPE B;  4AT1 B;  1LNX A;  3EGD A;  1AWJ A;  3JB9 H;  2ED0 A;  2HBW A;  5LJ3 d;  3C12 A;  2DL8 A;  1M27 C;  1GCQ A;  1VQ8 T;  3BFM A;  1YHQ T;  5LJ3 h;  4HKE A;  5CKD A;  4MDX A;  2EQJ A;  3UA7 A;  4L59 A;  1AOJ A;  4N4G A;  4HCC A;  4HVV A;  3LH5 A;  1YJW Q;  1KD1 C;  3TSZ A;  1OU9 A;  1U06 A;  1QVG S;  2K5F A;  2V8I A;  3FC3 A;  3G71 T;  2COZ A;  2EJG A;  3OYE A;  4JLI A;  2DXT A;  2KAF A;  4IIO A;  4Z89 A;  3CCU A;  1K73 C;  3I35 A;  4Y28 E;  1YJN Q;  4IIM A;  1PG5 B;  1VQK T;  1FXX A;  3JCM g;  2LCL A;  3Q1J A;  1NLP C;  4M78 A;  2EYZ A;  1YIT T;  2K2M A;  4M77 F;  4J5Y A;  3KXT A;  2K4Y A;  3JCM J;  4J9C A;  3VYG A;  3MEW A;  4A63 B;  5GAN 5;  4PJO B;  2CSQ A;  4PJO D;  2JXB A;  4JDS A;  4CC7 A;  3OBW A;  2VVK A;  1VQP Q;  4FIB A;  2O9V A;  2WAC A;  4OGE A;  4RTV A;  4LUD A;  4N4I A;  1PD1 A;  1VQP T;  3GOX A;  3JV3 A;  1D1A A;  3MEV A;  2H3E B;  1H92 A;  2BKD N;  3REA B;  2QI2 A;  2QAZ A;  3M0Q A;  3LLR A;  4RTT A;  2MF2 A;  5LJ3 e;  1EX4 A;  1VQL T;  3ASK A;  1VQK Q;  2BUD A;  4KUI A;  5GAN 8;  3CMA A;  1X75 C;  4J9I A;  3C0C A;  1PRL C;  1PM3 A;  1CKA A;  2HKN A;  1GBR A;  2NUT A;  2A3L A;  1I4K 1;  1QP2 A;  2DTO A;  1CSK A;  4M7D D;  1NLO C;  4EMK A;  3ULR B;  3QZ9 B;  5A0G A;  2YDL A;  4GBQ A;  4L5G A;  5DY9 A;  2HCK A;  1YI2 A;  3GPL A;  4DBH A;  1JJ2 S;  1PWT A;  1X2Q A;  2QXF A;  3P8D A;  3NTI A;  4IUT A;  3CCL Q;  4M7A C;  3MJX A;  3OQ5 A;  1Q86 U;  4UC4 A;  4F16 A;  1B34 A;  4LDY A;  3CC7 T;  1RUW A;  3UWN A;  1M1K R;  2O01 E;  1N8R C;  3FDR A;  2K5L A;  4J9H A;  3M0U A;  4C92 A;  1UGQ B;  3VUB A;  2Z0W A;  2CZ7 B;  4M7D F;  1Y0M A;  1NEG A;  1OV3 A;  5GAN 7;  2JS0 A;  1WGS A;  2YUQ A;  2HQE A;  5EC7 A;  4XK8 E;  3VUZ A;  1KC8 C;  1UGR B;  3RIR A;  3JB9 D;  2RHI A;  4O5V A;  1QWE A;  1E6G A;  4LDX A;  4MZT A;  3V8K A;  3EG2 A;  3QJY A;  5LJ3 g;  4FYX B;  3CCL A;  1HXD A;  3RES A;  2DEQ A;  4RTU A;  3RR6 A;  3QO3 A;  1O75 A;  5GAO r;  2FVU A;  5J26 A;  1FMW A;  3S6W A;  2JMA A;  2ABL A;  2C0O A;  3SWN C;  1M1K U;  4LN2 A;  4Z8A A;  5FU7 C;  4FW1 A;  5KYW A;  4ME7 A;  2RD1 A;  5A0L A;  3OMC A;  1ACM B;  2P4T A;  3VS5 A;  1QLY A;  3CCR Q;  4BDZ A;  2FZG B;  5GAN 2;  5IXF A;  1MNE A;  2CP2 A;  2NUZ A;  1U5S A;  4E7K A;  2SEM A;  1D1C A;  2QA4 T;  3TEE A;  3JCM f;  5LJ5 j;  4B9X A;  3X28 B;  2GFU A;  2J6K A;  5FLX E;  2QAS A;  1V1C A;  2FPD A;  1XTD A;  2EAY A;  2BZX A;  5LJ3 f;  5I21 A;  1TG0 A;  4M75 F;  2DL7 A;  3I56 A;  5FU7 B;  5KYU B;  2RMO A;  2FB7 A;  2YRD A;  3OYM A;  4QKU A;  1M8V A;  3BE3 A;  1FX7 A;  1K0S A;  2D8J A;  5D6W A;  1WI7 A;  4AFS C;  2V8J A;  1H3H A;  1NYF A;  3CCE T;  5L8R E;  2R57 A;  4M78 G;  1KQS S;  3O8V A;  2CDT A;  3OW2 A;  4PKC C;  5IH2 A;  4N0A A;  2YWW A;  3SFM A;  3URG A;  2XMF A;  4C8Q C;  4BE2 A;  4KUL A;  2RQW A;  2I2L A;  5C0M A;  1E7O A;  3UT1 A;  4FT4 A;  1OYX A;  3LH0 A;  4FM4 B;  2CT4 A;  4K11 A;  4M78 D;  3AHU A;  2O2O A;  1G2B A;  2DRM A;  1OPK A;  2GQI A;  2KRS A;  4OMN A;  2DD4 A;  2RK1 A;  3HFN A;  1N6A A;  2FZC B;  3HP9 A;  4M75 B;  4Q5W A;  2OTJ A;  1AVZ C;  1W1F A;  5DLO A;  3PTA A;  4C92 C;  1G5V A;  4WF2 A;  5CKF A;  1MUZ A;  3SEM A;  1C0M A;  1U1S A;  4M78 E;  3G6E Q;  2QEX Q;  1UDL A;  3H0F A;  3PE0 A;  2COW A;  4PJN A;  4HVU A;  3M53 A;  3G71 A;  1QCF A;  3HL8 A;  3CCQ T;  2KT8 A;  2VV5 A;  1JQQ A;  2JM8 A;  2JM9 A;  1Q7Y C;  4EDU A;  2LQK A;  2F2V A;  3GF5 A;  3THK A;  2WSC E;  1D3B A;  4BAC A;  3ZEH A;  3G7Z A;  3OYI A;  5GAO n;  3CD6 T;  2QDL A;  1ZSZ B;  4KRT A;  2A37 A;  1Z9Q A;  5AT1 B;  3M4Y A;  2P84 A;  4CC2 A;  1FMV A;  3PVQ A;  4WCI A;  2GTJ A;  2CKK A;  2O31 A;  2LX7 A;  4IUR A;  2M51 A;  2M9U A;  1QQJ A;  1JXO A;  2E70 A;  1JO8 A;  1VQ5 Q;  5IHN A;  1RAA B;  2F69 A;  3I55 A;  5CKB A;  4M77 B;  5IXB A;  1UTI A;  2EGA A;  1RAB B;  3QWX X;  2HBP A;  1OX9 A;  4M7D A;  3T9N A;  4Y91 A;  4M78 F;  3VYH B;  3OYD A;  4L6V 5;  3RKX A;  4RMO A;  3OA6 A;  4XAX B;  4Y92 A;  2EYQ A;  4XTV A;  1JJ2 A;  3CCV A;  4KT0 E;  3O5Z A;  5GAN d;  4M4Z A;  1NJI U;  1PKS A;  5KYY B;  2L8D A;  1S72 A;  1M8M A;  4M75 C;  1N8R U;  4E7H A;  3S3O A;  1HSQ A;  4XU2 A;  1QP3 A;  1BIB A;  3NHN A;  1PD0 A;  5GAN 4;  1ZLM A;  2QA4 A;  4DQ2 A;  2E4H A;  4OB0 B;  1OEB A;  4JZ3 A;  2C0T A;  2C06 A;  4AMC A;  2E1H A;  5FWB A;  1WJQ A;  4JJD A;  4KUD K;  3CC4 T;  4C5E A;  4M75 A;  4VUB A;  3TSW A;  3D7S B;  1QW1 A;  1NG2 A;  1IHW A;  1TH7 A;  3RBB B;  2GQV A;  4M7A B;  3R6N A;  2K5I A;  1A0N B;  2ROT A;  3EFO B;  3TRE A;  4JLG A;  5IT9 E;  2KEA A;  2IVW A;  2LQN A;  3M57 A;  1VQ9 Q;  1BBZ A;  1KD1 U;  3SWN B;  1KIK A;  1M3A A;  1M2O A;  4BI8 B;  4JRK A;  1RI0 A;  2EW3 A;  1ZSZ A;  1UUE A;  1UE9 A;  1PC0 A;  2EQM A;  1NPP A;  1VQ8 A;  1YCY A;  1M2V A;  3VS7 A;  4QW2 A;  3A8M B;  2M0Y A;  2XI9 A;  4AFU C;  1Q82 U;  2RH2 A;  3CPW P;  2QK0 A;  2RPN A;  3E9G A;  3WXM B;  2OTL A;  3PT9 A;  1N5Z A;  3EHR A;  1BB9 A;  1M3C A;  2G6F X;  2D0N A;  2GNC A;  1U8R A;  2IIM A;  4E7J A;  4PJO G;  3HRT A;  3EG9 A;  4DEX A;  4KBM B;  4M77 C;  3CCU T;  2MPX C;  2EKO A;  1YN8 A;  1BI3 A;  2X9H A;  1MMD A;  1ZBX A;  1X01 A;  2KT1 A;  4BY6 C;  3VS4 A;  4A53 A;  2XDB A;  3JCM W;  3CCM T;  2E5K A;  3S3N A;  2DFU A;  4M7D G;  4AG2 C;  5CCA A;  5J3B A;  5FRM A;  4MML A;  3GBQ A;  2HL3 A;  2JZ2 A;  1Q86 R;  3G4S Q;  5CO7 A;  3FLG A;  3M9Q A;  4BUG A;  1D0Y A;  1H3Z A;  1MGQ A;  2X3X D;  5GAO p;  5I2M A;  1QKX A;  1ARK A;  1Q82 R;  1WHJ A;  1VQP A;  2LJ3 A;  2LX9 A;  2D8H A;  5HY6 A;  1RAG B;  2EGC A;  3QG1 A;  2DM1 A;  2NUP B;  2DE0 X;  2KDS A;  4N4H A;  4LXC A;  5GAO l;  4BE0 A;  1QVP A;  4Z02 A;  3OYB A;  1Q7Y U;  3CC2 T;  2YHT A;  3HRS A;  3CCQ A;  2MI6 A;  2K57 A;  3CCE Q;  1TUC A;  1W6X A;  3UDC A;  3EAE A;  2PVO B;  4M7A G;  3CCE A;  2D9T A;  1FWZ A;  1U1T A;  2LC4 A;  1QVF S;  4BY6 B;  2E3H A;  5A2Q E;  2LT1 A;  3CD6 A;  4J7I A;  2QQA A;  1X6G A;  1OZ3 A;  3JB9 F;  2DNU A;  3BDL A;  2FEI A;  1TOV A;  1ZSG A;  2PNI A;  2XG8 D;  5IHK A;  1WPY A;  3M54 A;  2F1L A;  1IRE B;  5GAM g;  2C0I A;  3OBY A;  2JVV A;  5KYX B;  5GMK m;  2QDY B;  3EG0 A;  4FW2 A;  3I5R A;  1Q7Y R;  1TSF A;  3QHS A;  3DLM A;  1AZG B;  4M77 D;  2CP5 A;  4C92 F;  4LE9 A;  1WHM A;  2YLC A;  2LNV A;  3EFR A;  4BI4 A;  4MMK A;  1KFZ A;  1IZ6 A;  4ZGD B;  1UJY A;  4GLK A;  3CCR A;  1RI9 A;  3DKM A;  1O9S A;  4ORZ A;  3VS1 A;  1K0X A;  3GIB A;  3PIO A;  2EQI A;  1UFF A;  2F2X A;  2CP6 A;  3PMT A;  4XU1 A;  5GAM d;  4J9G A;  1X6B A;  2O9S A;  1K9M R;  1BCO A;  2FHD A;  4QT7 A;  2YLB A;  3M0T A;  2PUK B;  2RQR A;  2HL5 C;  1W2B P;  1SPK A;  4J9D A;  4PFZ A;  3QYG B;  2YRV A;  3FEO A;  1I07 A;  1PSF A;  3WVE B;  1R0C B;  2DMO A;  1TTH B;  2EPD A;  2DBM A;  2F2W A;  1ZX6 A;  2JUF A;  2XD0 A;  3VJP A;  1D3B B;  1Y7X A;  1GBQ A;  3DLL A;  2ZGW A;  3CCS Q;  5GMK j;  4XTY A;  4ZGJ B;  2RQU A;  1ZSZ C;  1K8A U;  4DEY A;  2ZPH B;  1YFN A;  4PJO A;  4ZGE B;  3V7C A;  1RAE B;  2KQW A;  1QMC A;  4J7F A;  3MHX A;  4MZP A;  1H64 1;  1U3O A;  5LL6 S;  3OYH A;  1TU0 B;  4RUG A;  3NTH A;  4JJC A;  3MEU A;  2I0N A;  4XTU A;  1S72 Q;  3HFO A;  3BY7 A;  3L2V A;  2CP7 A;  1LCK A;  4E47 A;  2LTO A;  1NYG A;  5GMK l;  2DA9 A;  2EFI A;  1FYN A;  2JTF A;  2VYT A;  4PJO F;  3L2Q A;  2HZY A;  3A8L B;  3OYC A;  2RQV A;  3JCM P;  2P0P A;  2DIQ A;  1KHI A;  1VQN T;  2CZ0 B;  2FZK B;  4X1V A;  2KMT A;  3H8Z A;  5HKC A;  2CS7 A;  2OJ2 A;  3EH2 A;  2GCX A;  2BE7 D;  2JNG A;  4HVW A;  1CKB A;  4A4K A;  3CC4 A;  1N27 A;  2NUP A;  3RMS A;  4LD9 K;  1VIF A;  3OYY A;  2LCC A;  5FU6 B;  4QVC A;  3H0H A;  6AT1 B;  2D0Q B;  2IG0 A;  2EQK A;  4E7Z A;  4LUE A;  4C5I A;  3QDF A;  1I8F A;  1PCX A;  2EYW A;  4M77 A;  2HQH A;  2CRE A;  5FWC A;  1SKU B;  4Z88 A;  5GJW B;  3GP8 A;  1RAD B;  3MET A;  2EIF A;  3M0R A;  2QQR A;  4OF1 A;  1UG1 A;  4C92 E;  2AIR B;  4OVA A;  1KHC A;  3OSV A;  4PJM A;  1T3L A;  1OX8 A;  4C0G A;  4FSS A;  1UGP B;  1Q86 C;  1GCQ C;  1IGU A;  3M58 A;  3QJ6 A;  3CCQ Q;  2WSE E;  3OS0 A;  1UEC A;  3BDU A;  2QEX A;  1IGQ A;  1K9M C;  3V7S A;  4PLI A;  2KGT A;  2MWP A;  2VXE A;  4C8Q E;  1YHQ Q;  1J3T A;  1PSE A;  1JRI A;  1Y71 A;  1T3S A;  1VQM A;  2FPF A;  3VRY A;  2A0F B;  2KVQ G;  1FMK A;  5HK0 A;  3NFC A;  4RCC A;  3VS3 A;  1VQO T;  5GAN g;  2RI2 A;  4D6W A;  5I22 A;  2OTJ Q;  5HCK A;  1GL5 A;  3JCM c;  3AT1 B;  2ZAE A;  1SF9 A;  2P4R A;  1WJR A;  2P0K A;  1SHF A;  1R0B G;  2F5T X;  1V76 A;  1YHQ A;  3LGL A;  2JW4 A;  3MEA A;  4D8D A;  3CCJ T;  3QKJ A;  2HKQ B;  1ABO A;  2E5Q A;  5LJ5 g;  1SSH A;  4LDW A;  1VQ6 Q;  1G3T A;  3RKW A;  2VB6 A;  3M56 A;  3OS1 A;  4C0F A;  1QVF A;  3PFS A;  4M77 E;  3OYG A;  1MMG A;  3JB9 J;  2CGH A;  1X27 A;  2DLP A;  2OTL Q;  2HSE B;  1SSF A;  1YNZ A;  1UJ0 A;  3NMZ C;  3CXC P;  1ZA1 B;  3M55 A;  2MAM A;  2CUD A;  1G3S A;  4BI3 A;  2K6D A;  3EGX B;  3PIP A;  4DOV A;  4KH0 B;  3I5S A;  1I5L A;  2E64 A;  2ZPI B;  3OY9 A;  2YUN A;  5GAO m;  4EMH A;  4A54 A;  3ZFJ A;  2LQW A;  1ZUK A;  1WNL A;  2VWF A;  1YJ9 T;  1ZQ1 A;  3I56 Q;  4C0D C;  4RG2 A;  1V29 B;  1JEG A;  4M75 D;  2FRW A;  2NYS A;  1Q95 G;  2E65 A;  2DJZ A;  3HHT B;  1IXD A;  1RAF B;  2KRO A;  2AKL A;  1SRM A;  2YXY A;  1EZZ B;  1RLP C;  2LVM A;  1JU5 C;  4RTW A;  2RN8 A;  2ZPF B;  2BIV A;  3FRN A;  5GAO q;  2L3S A;  5IHI A;  2EYY A;  3CQT A;  3JSC A;  4JRI A;  4OGC A;  1MHN A;  3R6O A;  5I11 A;  2Y4Y A;  4J6W A;  1G3Y A;  3GNG A;  2ROL A;  3EFS A;  2PQW A;  2JS2 A;  4NL2 A;  4A4E A;  4JS5 A;  1Q81 C;  1AWO A;  2CH4 A;  4C0Z A;  2X4W A;  4JRQ A;  4OB1 B;  2XID A;  2HMA A;  1K1Z A;  4XU3 A;  2CP0 A;  2LRQ A;  2XU8 A;  3HTR A;  4A4G A;  1K4U S;  2OTL T;  2FO0 A;  2A28 A;  5GAN 6;  4HCZ A;  3QZ5 B;  2Y90 A;  4M7D B;  1HJD A;  4M7A E;  1VQ6 T;  3S3M A;  1LOJ A;  1TUD A;  2DXC A;  5D7U A;  1YIJ T;  3QPH A;  1VQ5 A;  2CT3 A;  4EIK A;  4CI0 C;  3MP8 A;  2HAX A;  5LJ3 j;  2DVJ A;  4OP0 A;  5CVI A;  2J6F A;  5HK3 A;  4ANJ A;  4CC3 A;  1N9R A;  2JJ9 A;  4OMO A;  1NE8 A;  1YIJ Q;  2KK4 A;  3X26 B;  1GCP A;  4M7D E;  2KYM A;  4M7D C;  4QQ6 A;  3CC7 Q;  1KK7 A;  2O4X A;  2RF0 A;  1NBE B;  3MP6 A;  3SHW A;  2EQU A;  1MMA A;  2E41 A;  3KBG A;  4X9C A;  4PJL A;  3FB9 A;  2DIL A;  3PNW C;  2DTI A;  2KNB B;  1OPL A;  2DO3 A;  3SWN A;  3M4G A;  1OUL A;  3V8J A;  1OU8 A;  5FRN A;  3G6E A;  2PU9 B;  3CMA Q;  5GAM j;  1YIT A;  2EWN A;  5CQY A;  4NS5 A;  3J80 E;  3M0P A;  1HK9 A;  2AKK A;  4EMG A;  4M78 C;  4OMP A;  1QCN A;  3PGG A;  1OZ2 A;  4A4F A;  1YP5 A;  1RAC B;  4BE1 A;  2AHJ B;  2CUB A;  3HRU A;  2M16 A;  4ZN1 A;  1HYO A;  1LJO A;  3X24 B;  5CQX A;  4TVR A;  5A0D A;  7AT1 B;  1GFD A;  2D6F A;  2SRC A;  2K3B A;  3CCJ A;  1BYM A;  2KY9 A;  1R77 A;  2MWO A;  5CIU A;  1KG1 A;  2J06 A;  2V1Q A;  2JOY A;  3A8G B;  2DBK A;  3BW1 A;  4RTX A;  5KE2 A;  1IHV A;  3VU3 C;  2CZ1 B;  3G1J A;  1VQN Q;  1I5O B;  5GAN f;  2H8H A;  1K73 U;  3H41 A;  1JB0 E;  2DL3 A;  3EFO A;  1WA7 A;  1YIT Q;  1M90 U;  2RQT A;  1AT1 B;  3INZ A;  4OMM A;  3EH1 A;  4JRP A;  2PVG B;  5J39 A;  1WHG A;  3UPU A;  2DXB A;  4C8Q F;  1X2K A;  1PKT A;  2L3Q A;  4MZM A;  1UGV A;  5LJ5 e;  1AWW A;  1SRL A;  2DYB A;  1KD1 R;  1BK2 A;  1PHT A;  4N0A C;  1F1B B;  3CCJ Q;  2A36 A;  4XQ3 A;  1WQW A;  1S1N A;  2YSQ A;  3H6Z A;  1WIE A;  1NM7 A;  2KE9 A;  2KYB A;  1Z9Z A;  1VIE A;  4PLL A;  3G4S A;  4C8Q B;  4F14 A;  1VQ8 Q;  3QXE B;  3MPU B;  1M3B A;  1NJI R;  3JCM d;  4B9W A;  1M4Z A;  1TS9 A;  2PZ1 A;  3JB9 I;  1K73 R;  3CXC S;  1X6O A;  1N8R R;  2K2V A;  2L3R A;  4KH1 B;  4FT2 A;  2DL4 A;  4E7L A;  1M1F A;  4C92 B;  4JS4 A;  3X25 B;  3CME T;  2NWM A;  1WJS A;  2ZZD A;  2JMC A;  3RMQ A;  3EGU A;  1KQS A;  3H0I A;  4BB7 A;  4R56 A;  3QYH B;  1KQ1 A;  1TWB A;  4F7U A;  5C6S A;  3L2Z A;  3IQL A;  3J81 E;  3I9Q A;  2KI7 A;  2QQS A;  2JTM A;  3JCM h;  4ELZ C;  2CH4 W;  5L23 A;  1D0Z A;  2XHC A;  1WX6 A;  1BKB A;  1VQ4 Q;  3OSS C;  2E12 A;  1ZBJ A;  2DF6 A;  4C92 D;  3HSB A;  2FPE A;  4J9B A;  1OI1 A;  1RL2 A;  2K79 A;  4B6M A;  2M0O A;  5LJ5 h;  5CKE A;  1NEB A;  3JCM X;  1B07 A;  2LQ8 A;  2LCS A;  5KYY A;  2YUO A;  1QWF A;  2LMJ A;  2B86 A;  1Q82 C;  4V2S A;  1WHK A;  2QTV A;  1YJ9 A;  4C8Q D;  1JJ2 P;  2CSI A;  4E7S A;  2RJC A;  3WVD B;  1D09 B;  3KUF A;  3I55 Q;  2DZC A;  2VXF A;  3E9F A;  5CKH A;  2GFA A;  2GBQ A;  4ZN3 A;  2PVD B;  1IO6 A;  2CYZ B;  4J6X A;  2K7A A;  3VS0 A;  3SDZ A;  1WHL A;  2ED1 A;  4AFZ C;  1X69 A;  3DB4 A;  4EMK B;  3V8L A;  1YI2 Q;  3CCV T;  3MP1 A;  3QDR B;  4IUP A;  4JUV A;  4M77 G;  1H8K A;  4C8Q G;  2H3J A;  2L3P A;  1K76 A;  2CZ6 B; 
#chains in the Genus database with same CATH homology
 2VV5 A;  3FJP A;  4EPC A;  1S72 T;  1B34 B;  3RER A;  4FL6 A;  4J83 A;  3M58 A;  3QJ6 A;  5KE3 A;  4HT8 A;  2WSE E;  3OS0 A;  1Q7Y C;  3M59 A;  4EDU A;  3J7A F;  2LQK A;  2O4X B;  3BDU A;  3GF5 A;  2QEX A;  2WSC E;  4ZTF A;  1K9M C;  1D3B A;  4QVZ A;  4PLI A;  3V7S A;  1VUB A;  3DB3 A;  2MWP A;  4BAC A;  1YI2 T;  2VXE A;  2G3R A;  3ZEH A;  4C8Q E;  1VQ9 A;  4ATO A;  3G7Z A;  3OYI A;  1PSE A;  1JRI A;  1Y71 A;  4QQG A;  1VQM A;  4F7U F;  2F5K A;  4C5G A;  1VQ6 A;  4RCB A;  2E6N A;  2KVQ G;  5GAO n;  3ZBD A;  4C92 G;  3MCA B;  5HK0 A;  5EG2 A;  3CD6 T;  3TU4 K;  3NFC A;  3M4Y A;  2B8A A;  4RCC A;  2DXU A;  3FIF A;  3HPW A;  3CPW A;  1VQO T;  5GAN g;  1VQM T;  2RI2 A;  3LGF A;  4D6W A;  2CKK A;  3JCM c;  3P8B B;  4IUR A;  3CCS T;  3GNF B;  4F7U G;  4ZTJ A;  2M9U A;  3I55 T;  2E70 A;  2RM4 A;  2RJE A;  1BIA A;  1P92 A;  1WJR A;  2XK0 A;  5FRO A;  1K9M U;  5LJ5 d;  3I56 T;  2P0K A;  2R5M A;  3L2R A;  4RKU E;  2X4Y A;  2F69 A;  3I55 A;  2F5T X;  2XDD A;  1UEB A;  4MDW A;  3JRZ A;  4IUV A;  4M77 B;  5CKB A;  3LGL A;  3X20 B;  1YHQ A;  3F70 A;  4IUU A;  3MEA A;  2DIG A;  3CCJ T;  3QKJ A;  2E10 A;  2HBP A;  2RJD A;  4M7D A;  2LT4 A;  2E5Q A;  3T9N A;  4LDU A;  2RI3 A;  2E6Z A;  5LJ5 g;  4Y91 A;  1M1G A;  3JB9 G;  2ZPB B;  4M78 F;  4LDW A;  2R58 A;  3VYH B;  3OYD A;  4L6V 5;  1G3T A;  3RKX A;  4RMO A;  3OA6 A;  5GAM f;  3RKW A;  4XAX B;  3M56 A;  3OS1 A;  3V7R A;  2EYQ A;  5IN1 A;  4XTV A;  4C0F A;  5D6Y A;  3CCV A;  4KT0 E;  1JJ2 A;  1QVF A;  3PFS A;  4M77 E;  3OYF A;  3QBY A;  3C94 A;  1YJN T;  4M7A F;  3SD4 A;  3JCM e;  3OYG A;  3OYL A;  3JB9 J;  2CGH A;  3M5A A;  5GAN d;  1SSF A;  1NJI U;  1XQH A;  5AYF A;  4LDV A;  2OAU A;  1M1K C;  1UB4 A;  2L8D A;  5GAN h;  1VQ4 T;  2XDP A;  4OB2 B;  3M55 A;  2MAM A;  1BI2 A;  1S72 A;  3QSU A;  4M75 C;  1G3S A;  5IAY A;  1YJW A;  2DZ9 A;  4YTL A;  4PJO E;  4PNO A;  3L2W A;  3CPF A;  4BI3 A;  3JAM E;  3PIP A;  5KCH A;  1N8R U;  4DOV A;  2RA2 A;  2R5A A;  1K8A C;  1R8O B;  1I5L A;  4E7H A;  2WSF E;  2E64 A;  2K3Y A;  3S3O A;  2ZPI B;  3NTK A;  2L5Q A;  1QP3 A;  1BIB A;  4M78 B;  4XU2 A;  4QVD A;  2K3X A;  5LJ5 f;  1YJW T;  4DOW A;  3OY9 A;  3OS5 A;  2NLU A;  5CR2 A;  5GAN 4;  4LD6 A;  2QA4 A;  4DQ2 A;  5GAO m;  4EMH A;  4A54 A;  4OB0 B;  3ZFJ A;  2C06 A;  4F7U E;  1YJ9 T;  1WNL A;  2E1H A;  3CBM A;  5KH6 A;  1ZQ1 A;  1WJQ A;  4KUD K;  4C0D C;  3SB2 A;  4RG2 A;  1V29 B;  4C5E A;  3CC4 T;  1Y07 A;  4M75 D;  4M75 A;  4XTZ A;  4VUB A;  2E65 A;  2DJZ A;  5GAN 3;  1QW1 A;  5D6X A;  4O6J A;  4M7A D;  5KCO A;  1M5Q 1;  2V8K A;  1TH7 A;  1ZHI A;  2GQV A;  4PJO C;  3OYK A;  3HHT B;  4M7A B;  2K5I A;  4M75 E;  3LWH A;  2OTJ T;  1W4S A;  2DTH A;  1G3W A;  3MO8 A;  3TRE A;  4JLG A;  1UGS B;  4HA8 A;  2DVE A;  5IT9 E;  2IVW A;  4C8Q A;  2ZPE B;  3M57 A;  1LNX A;  2LVM A;  1KD1 U;  3SWN B;  3JB9 H;  2ZPF B;  2BIV A;  3FRN A;  3C12 A;  3ER0 A;  5LJ3 d;  5GAO q;  3CME A;  2LDM A;  3E19 A;  5CK9 A;  4BI8 B;  1VQ8 T;  3BFM A;  1YHQ T;  4JRK A;  1RI0 A;  4HKE A;  5LJ3 h;  5CKD A;  3CXC A;  4MDX A;  2RO0 A;  1DJ7 B;  3JSC A;  2EQJ A;  4JRI A;  4OGC A;  1MHN A;  3R6O A;  4RG8 A;  2Y4Y A;  2EQM A;  1NPP A;  1G3Y A;  3GNG A;  4J6W A;  4L59 A;  3CCQ T;  1YCY A;  3EFS A;  1VQ8 A;  4N4G A;  2HQX A;  4HCC A;  2PQW A;  4OB3 B;  4NL2 A;  4QW2 A;  4A4E A;  3C95 A;  4A4H A;  3A8M B;  4JS5 A;  1KD1 C;  2XI9 A;  1Q81 C;  1QVG S;  4C0Z A;  2RH2 A;  2X4W A;  2K5F A;  2V8I A;  3FC3 A;  3G71 T;  4JRQ A;  1Q82 U;  2EJG A;  3OYE A;  4OB1 B;  2XID A;  3E9G A;  4JLI A;  3WXM B;  2OTL A;  2DXT A;  3PT9 A;  2KAF A;  4XU3 A;  2LRQ A;  2XU8 A;  5GAN e;  3CCU A;  4A4G A;  1K73 C;  1U8R A;  2OTL T;  4E7J A;  4PJO G;  2EJ9 A;  4Y28 E;  3HRT A;  2GF7 A;  5GAN 6;  1M90 C;  4HCZ A;  3QZ5 B;  4HCB A;  1VQK T;  1BI1 A;  1FXX A;  3JCM g;  4KBM B;  2LCL A;  3Q1J A;  4M78 A;  2Y90 A;  2RHZ A;  3LWI A;  1YIT T;  4M77 C;  3CCU T;  3E1S A;  1KC8 U;  4M77 F;  4M7A E;  4J5Y A;  4M7D B;  3KXT A;  2EKO A;  2K4Y A;  3JCM J;  1VQ6 T;  1BI3 A;  3S3M A;  1LOJ A;  3VYG A;  3MEW A;  4IKF A;  1ZBX A;  1X01 A;  2DXC A;  3GLX A;  5GAN 5;  4NOY A;  4PJO B;  4BY6 C;  4R55 A;  2RJF A;  1YIJ T;  4A53 A;  2XDB A;  3JCM W;  3CCM T;  3L42 A;  3QPH A;  4PJO D;  2RHX A;  3S3N A;  1VQ5 A;  3QII A;  4M7D G;  2RB6 A;  4JDS A;  3MP8 A;  4CI0 C;  3G4S T;  3OBW A;  5CCA A;  5LJ3 j;  2HAX A;  4FIB A;  5J3B A;  1YIJ A;  5FRM A;  4MML A;  4BD3 A;  2WAC A;  4OP0 A;  4OGE A;  5CVI A;  5HK3 A;  1VQ5 T;  4N4I A;  1VQ7 T;  2JZ2 A;  3LX7 A;  1VQP T;  1N9R A;  3GOX A;  5CO7 A;  5GMK i;  3OW2 S;  3FLG A;  3M9Q A;  3OB9 A;  4BUG A;  3MEV A;  1H3Z A;  1NE8 A;  1NPR A;  4C5H A;  1MGQ A;  3RUX A;  5GAO p;  5I2M A;  3PMI A;  1Q81 U;  2KK4 A;  1VQP A;  2LX9 A;  4XU0 A;  3X26 B;  2BKD N;  2QI2 A;  5HY6 A;  4M7D E;  3LLR A;  3OYN A;  3P8H A;  2MF2 A;  3RKY A;  2HNI A;  3QG1 A;  5LJ3 e;  4M7D C;  1Y96 A;  2KDS A;  4N4H A;  4QQ6 A;  5GAO l;  4BE0 A;  2FL7 A;  3ASK A;  1VQL T;  2BUD A;  4KUI A;  1QVP A;  2HD0 A;  2O4X A;  1X75 C;  4Z02 A;  5GAN 8;  1NZ9 A;  3OYB A;  3CMA A;  1Q7Y U;  3CBP A;  3CC2 T;  3MP6 A;  2YHT A;  2EQU A;  3HRS A;  2E41 A;  1Y96 B;  3CCQ A;  3KBG A;  2MI6 A;  4X9C A;  2K57 A;  3OYA A;  2A3L A;  4X34 A;  1I4K 1;  3FB9 A;  1QP2 A;  3PNW C;  3UDC A;  2DTO A;  2DTI A;  3EAE A;  4M7D D;  1VQ4 A;  4EMK A;  3QZ9 B;  2PVO B;  5A0G A;  3OS2 A;  4M7A G;  3OYJ A;  4L5G A;  5DY9 A;  4PL6 A;  2DO3 A;  3SWN A;  3CCE A;  3M4G A;  1YI2 A;  3V8J A;  2D9T A;  1FWZ A;  1U1T A;  3GPL A;  2LC4 A;  4GY5 A;  1JJ2 S;  1QVF S;  4BY6 B;  5FRN A;  3G6E A;  2DPP B;  2PU9 B;  5A2Q E;  2LT1 A;  3JCM Q;  4J7I A;  2QQA A;  5GAM j;  1OZ3 A;  3CD6 A;  2QXF A;  3P8D A;  3NTI A;  3BDL A;  4IUT A;  5DM7 R;  1YIT A;  3OQ5 A;  1Q86 U;  4M7A C;  2EWN A;  5CQY A;  4UC4 A;  4NS5 A;  3J80 E;  1B34 A;  4LDY A;  5I2S A;  3G6E T;  3CC7 T;  1W2B S;  2XG8 D;  2ZPG B;  1WPY A;  3M54 A;  1HK9 A;  1VQ9 T;  1M9S A;  3CCS A;  3UWN A;  4EMG A;  4M78 C;  2O01 E;  1IRE B;  1W2B A;  1N8R C;  4FU6 A;  1XNI A;  3CCM A;  3FDR A;  2DK3 A;  3PGG A;  1OZ2 A;  5GAM g;  2K5L A;  4A4F A;  4C92 A;  3OBY A;  4P5N A;  1UGQ B;  4BE1 A;  2AHJ B;  2JVV A;  3HRU A;  3VUB A;  2CZ7 B;  2M16 A;  4ZN1 A;  4M7D F;  5GMK m;  2QDY B;  2DAQ A;  1LJO A;  3X24 B;  4TVR A;  4QQD A;  5CQX A;  5A0D A;  5GAN 7;  1WGS A;  4DA4 A;  2HQE A;  4XK8 E;  2D6F A;  3VUZ A;  2A7Y A;  4ELY C;  3CCJ A;  3QHS A;  2KY9 A;  1BYM A;  2MWO A;  5CIU A;  2JN0 A;  1KG1 A;  3DLM A;  4M77 D;  1KC8 C;  2RI5 A;  2QQB A;  4C92 F;  1UGR B;  3RIR A;  3JB9 D;  2RHI A;  2YLC A;  3CPW S;  2JOY A;  3A8G B;  4O5V A;  2LNV A;  3EFR A;  4BI4 A;  4MMK A;  1IZ6 A;  4ZGD B;  3BW1 A;  4GLK A;  5KE2 A;  4LDX A;  3CCR A;  3VU3 C;  2CZ1 B;  4MZT A;  3V8K A;  3DKM A;  1O9S A;  5GAN f;  4OMF B;  1K73 U;  3GIB A;  1JB0 E;  3QJY A;  3PIO A;  5LJ3 g;  3CC2 A;  2P0Q A;  3CCL A;  1HXD A;  1M90 U;  4J6Y A;  3PMT A;  3INZ A;  3RES A;  2DEQ A;  4JRP A;  2PVG B;  3QO3 A;  1O75 A;  4XU1 A;  5GAM d;  5FU6 C;  3VKI A;  5GAO r;  5J39 A;  4J8O A;  2FVU A;  5J26 A;  4M75 G;  3UPU A;  2DXB A;  3S6W A;  4C8Q F;  2FHD A;  1YJN A;  3SWN C;  1M1K U;  5FU7 C;  2YLB A;  4MZM A;  1VQK A;  4XTW A;  3A8O B;  5LJ5 e;  4ME7 A;  2Y4X A;  2PUK B;  5GMK e;  2RD1 A;  5A0L A;  3OMC A;  4N0A C;  2P4T A;  3QYG B;  1VQN A;  2YRV A;  3FEO A;  1PSF A;  4XQ3 A;  1WQW A;  3WVE B;  3QUI A;  1NJI C;  2X4J A;  4BDZ A;  3H6Z A;  1VIE A;  3N5B B;  4PLL A;  4BDY A;  4EMK C;  5GAN 2;  2VUB A;  2MMP A;  3G4S A;  4E7K A;  4C8Q B;  5CAI A;  3QXE B;  3JB9 F;  2QA4 T;  2JUF A;  2XD0 A;  3TEE A;  3VJP A;  1D3B B;  1Y7X A;  3CEY A;  4NL3 A;  3DLL A;  2ZGW A;  3JCM f;  5LJ5 j;  3JCM d;  4B9X A;  3X28 B;  4B9W A;  2GFU A;  1M4Z A;  5GMK j;  2RHY A;  2XKO C;  4XTY A;  3TCJ A;  3VV0 A;  5FLX E;  2PUO B;  1KQ2 A;  4ZGJ B;  3JB9 I;  1XTD A;  2EAY A;  5LJ3 f;  3CXC S;  1X6O A;  1K8A U;  5I21 A;  2K2V A;  2ZPH B;  4M75 F;  3I56 A;  1WQ7 A;  2L3R A;  5FU7 B;  3V7C A;  4ZGE B;  4PJO A;  4FT2 A;  2FB7 A;  2KQW A;  4J7F A;  5DLQ E;  4E7L A;  1N9S A;  2ZCF B;  2DKG A;  1M1F A;  3MHX A;  1JBM A;  4MZP A;  3OYM A;  4C92 B;  4JS4 A;  3X25 B;  1H64 1;  3CMA T;  5LL6 S;  3CME T;  3CCR T;  4JJN K;  3OYH A;  1M8V A;  1WJS A;  5GAM h;  2ZZD A;  3L1A A;  2X4X A;  3RMQ A;  4II1 A;  3NTH A;  1KQS A;  4R56 A;  3MEU A;  4BB7 A;  1FX7 A;  3HKS A;  3QYH B;  1KQ1 A;  2QQ9 A;  4XTU A;  1I81 A;  2XIC A;  4F7U A;  4IUQ A;  3ME9 A;  3HFO A;  3OMG A;  5C6S A;  3L2Z A;  3BY7 A;  3L2V A;  5D6W A;  3J81 E;  4E47 A;  2VC8 A;  2QQS A;  2JTM A;  2LTO A;  2V8J A;  2L89 A;  3JCM h;  4ELZ C;  2XHC A;  5GMK l;  2EFI A;  1BKB A;  2JTF A;  3OSS C;  4FSX A;  3JCM b;  3CCE T;  2E12 A;  5L8R E;  2VYT A;  2R57 A;  4C92 D;  3HSB A;  4M78 G;  3LYI A;  1OI1 A;  1RL2 A;  1KQS S;  2QEX T;  3O8V A;  4PJO F;  2M0O A;  3L2Q A;  3OW2 A;  2FYK A;  3A8L B;  2QTX A;  4PKC C;  5LJ5 h;  3OYC A;  3L2U A;  5CKE A;  4N0A A;  3SFM A;  3URG A;  3JCM V;  3JCM P;  3C4S A;  5GMK h;  4C8Q C;  4BE2 A;  4KUL A;  3JCM X;  2P0P A;  2DIQ A;  1KHI A;  2I2L A;  1BI0 A;  5C0M A;  3CC7 A;  2LQ8 A;  1VQN T;  2CZ0 B;  2M1H A;  4HT9 A;  2KMT A;  3UT1 A;  1GXI E;  4FT4 A;  3H8Z A;  5HKC A;  1OYX A;  3LH0 A;  2CS7 A;  1Q82 C;  1VQO A;  2EJF A;  3A8H B;  4FM4 B;  1YJ9 A;  4V2S A;  2GCX A;  4M78 D;  1VQ7 A;  3AHU A;  2JNG A;  2DD5 A;  2RHU A;  4A4K A;  3CC4 A;  5GAN j;  1N27 A;  4LD9 K;  3RMS A;  4C8Q D;  1VIF A;  2RK2 A;  3OYY A;  2LCC A;  5FU6 B;  2VGN A;  2RJC A;  2DD4 A;  3LW5 E;  2RK1 A;  3HFN A;  1N6A A;  3HP9 A;  3WVD B;  4QVC A;  3KUF A;  2D0Q B;  2IG0 A;  4M75 B;  4Q5W A;  2OTJ A;  2X35 A;  5DLO A;  2EQK A;  4X9D A;  4C92 C;  3CBO A;  3PTA A;  4M7A A;  4C5I A;  2DZC A;  5M9O A;  2VXF A;  3E9F A;  1G5V A;  1EIF A;  5CKH A;  2GFA A;  4XTX A;  4WF2 A;  5CKF A;  1I8F A;  4ZN3 A;  2PVD B;  1AHJ B;  4M77 A;  4F7U B;  2CYZ B;  4J6X A;  4CRI A;  3SDZ A;  1U1S A;  4M78 E;  3GP8 A;  4E7I A;  3MET A;  2EIF A;  1XOV A;  2QQR A;  3DB4 A;  4OF1 A;  4EMK B;  2KSS A;  4C0D B;  3V8L A;  3CCL T;  5GAM e;  4C92 E;  3A5Z B;  1KHC A;  4OVA A;  3CCV T;  3MP1 A;  3QDR B;  4IUP A;  3OSV A;  4JUV A;  1QVG A;  4M77 G;  1VQL A;  4C0G A;  2VGM A;  3M53 A;  4C8Q G;  1UGP B;  1Q86 C;  2H3J A;  3G71 A;  3HL8 A;  2CZ6 B;  1YBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...