1MI0A

Crystal structure of the redesigned protein g variant nug2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
HHHAMDTYKLVIVLNGTTFTYTTEAVDAATAEKVFKQYANDNGVDGEWTYADATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin-binding protein G
publication title Crystal structures and increased stabilization of the protein G variants with switched folding pathways NuG1 and NuG2
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 12
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mi0A00
2N9LA 5BMGA 1HZ5A 2ON8A 1IBXA 4GLSC 1PGAA 2PTLA 2JZPA 2IGDA 5HI1A 1GB1A 1Q10A 1IBXB 2IGHA 4KGSA 2EELA 1HEZE 1FD6A 2ONQA 1XCQL 2JSVX 2I2YA 1GB4A 2I38A 4IKGA 2LHEA 1PGBA 2JWUA 1HZ6A 1YNTE 1K53A 4OZCA 2JU6X 2KWDA 2ZW0A 1FCCC 1C9FA 1EM7A 3GB1A 2KQ4X 1ZXHA 2J52A 2QMTA 5HG2A 4HKZE 3FILA 1YMHE 1MHXA 5JXVA 1XCTL 1XF5L 4IOIE 1FCLA 3UI3A 5HHDG 1KH0A 5HFYA 1P7FA 2LUMA 4OZAA 4KGRA 1QKZA 2KACA 1UWXA 2OEDA 2IGGA 5BMIA 1PGXA 1IGDA 2NMQA 1MVKA 2N9KA 1F2RI 1P7EA 2K0PA 4WH4A 1JMLA 5BMHA 4KGTA 2PW9A 2GI9A 2QSDA 1IGCA 3MP9A 1MPEA 4D2KA 4OZBA 3FILB 2N7JA 4MACA 2RPVA 2ZW1A 3V3XA 1K50A 1MI0A 2RMMA 2KN4A 1K51A 2J53A 1K52A 2PLPA 2LHDA 2LGIA 2JXTA 4HJGE 1D4BA 1F2RC 2KDMA 2GB1A 1MHHE
chains in the Genus database with same CATH superfamily
4LNFA 2NTSA 3APFA 5BO4B 5C3JB 1GG3A 1C77A 4XGAB 4WQMA 3IXSA 1M94A 1EO6A 3IT4B 3ZIMA 1I4HA 1E7UA 1YN3A 1E8YA 2QCZA 5IP4D 1J7BA 1IBXB 1SE3A 2IO0B 1HEZE 2JPHA 1WX9A 3AEGB 2KTRA 4P1CC 4JL9A 5EE3A 3CSFA 2M0AA 1WX8A 2KXJA 3EUB2 1MJDA 3I3TB 2JU6X 2PEAA 2AWTA 4DXGA 4EOYA 1C79A 2BYTA 3WA0A 4XE0A 2OJRA 2CU3A 5TR5A 3UIPB 1E10A 2DNFA 3Q14C 3AEDB 5IOIA 4IDIA 2BQQA 2LD9A 2ZEQA 1ZPSA 3E56A 2L83A 4PS7A 5CX3A 4AWJA 3AU5A 1L2NA 2KT7A 4KDLB 2KMAA 3H7PA 4I6LB 4EZJA 3U30A 2QDFA 4NAWB 1AARA 4YTPB 3V62A 1E9MA 2ZCBA 2MH7A 2ZW1A 4K81A 3DQVA 1UGJA 2MHJA 2FBWB 3GE3C 2K1FA 1OQQA 1GUAB 3AN1A 3RI7C 3DBRB 4WWNA 1QILA 1V81A 4GXBA 2YLMA 3RPFC 1V8CA 2DLBA 2EMTA 5C23A 1SIFA 4IWQA 3BZDB 2AYOB 4DBGA 2O6VD 2IGDA 3A9KA 4W9JA 1PYWD 3U52E 5EE9A 3QCAA 2JY6A 2CS4A 1ZE3D 2JSVX 4N58A 2DAFA 4ZRJA 1JWMD 3BK1A 2I38A 3GOEA 4JGHB 4W9FA 2YEPF 3KUDB 3R7QA 4YTMB 4HDOA 4O1NA 5CTRC 4TSSA 1WMHA 1N63A 2XEWA 3KYCD 1WJUA 3SD5A 1ZUD2 2DAJA 3B1LX 4LJPB 4FJVB 3ZNZB 3RULA 2WXJA 2JX5A 3EHVA 4HCPB 1RFKA 5HG2A 3B0AA 4KSLC 2BKFA 1FCLA 3B2GA 3W5VB 2NTTA 2PJHA 4FADA 4XDCA 1YJIA 1TS5A 2QJLA 3PREA 2BT6A 3BWUD 2N0SB 2NR2A 2X8XX 2KZRA 2KVRA 2IDYA 2CKHB 2DENB 2N1VA 3N1XC 1P7EA 5BMHA 2GI9A 1KTKA 4BOSC 4C7ZA 2KLGA 2QEJC 3V61A 3A1QA 1KFYB 1K8RB 3Q3NC 3QHTA 2L52A 1VZ7A 2W54A 3NUHB 4ZHPA 1EUVB 1SXTA 1JCKB 4A6QA 1WWTA 5AUIA 4XC2A 4JLCA 2AL3A 3BYTB 1D5XC 4C00A 4ZRQA 3A4RA 3HM6X 2M4NA 3TL5A 3D32A 3C19A 1NYRA 2J0JA 3NJTA 2WXPA 3WANA 1SF0A 2A5UA 4RF0A 3M3JA 3M62B 5KHQA 2KTRB 1EU3A 2NVUI 4US8A 2JF5A 1FMAD 1WGYA 1WF9A 2DYOA 2MBQA 1YN5A 1CMXB 2KQSA 3AEFB 1MG4A 1M4VA 2RDHA 5HHDG 3L13A 4HRSA 2L00B 4KGRA 3U7DA 1BXTA 3ONSA 2W55A 4DHJB 4LNIA 1TKGA 2KO3A 4MSQB 3JSVB 4WJQA 3RZWC 1WR6E 1SJHD 3DHIC 1MVKA 1V97A 3HRDD 4LNOA 3I5JC 5MPOA 1GAQB 1N62A 2HJ1A 1SSNA 3RD2A 2CJOA 1WM3A 5FK9C 1P3QU 3UIOB 3A9JB 4MGKE 4RGNA 3V60A 3C0RB 2V3SA 2J53A 4WWOA 1ZGUB 4YXDB 2LHDA 3QQ8B 5DPSA 5J2RA 1GOZA 1H4RA 2O6VA 3RNEC 5D3DA 1TS2A 1N5WA 2WP9B 1LQBA 4JIOU 1KLGD 4GLSC 2R2OA 2I1KA 4I6NB 3I57A 3Q3OC 2R61A 1UUPA 2D07B 3Q8EA 4FHJA 3A9KB 4C4VA 1WE6A 2B3AA 2KNBA 4TV3A 3I9V1 5E6NA 2X38A 1D3ZA 3VAWA 2I2YA 5GMVA 1HZ6A 2XNAC 3WALA 3P42A 3RNFC 5LNK1 2NPTA 4FXCA 2BVCA 4XZ4A 1WXVA 2JUOA 1FFUA 3T3OA 1P9DU 1E8XA 3AU4A 4A9AA 3AI5A 3AMZA 2IJ0A 4LJOB 1ENFA 3L10B 4HXDA 3ML8A 5DPTA 5JXVA 1U4AA 1FXTB 1I4PA 4XDDA 1I4GA 2UYZB 2WDQB 3VH4B 1L7YA 1GNUA 3T8MA 2HTHA 1C4AA 1BUIC 4LTUA 1E90A 3H6NA 1B9RA 3TJPA 1NVID 4W9CA 4BAXA 1UBIA 3PLUA 3KH0A 3GP7A 2JYEA 4DDGD 2RD0A 3CMMB 3SEBA 2D3GA 4BOZB 3PT2B 3P2BA 3WIMA 3VRBB 5G55A 2KWVB 4GGQA 1TJEA 1MI0A 2DZIA 2ZVNA 1K51A 2JZZA 2JVCA 4MJSA 3A1QB 4WWPA 4OVZA 2KDFB 2ZVOA 2SEBD 2BGFA 2PKOA 4GMVA 3W1YA 2Y3AA 1I7HA 1F9JA 1LGRA 1S1QB 3Q3JA 3WCQA 3TEXA 2K9XA 4II3B 1ZDVA 3ZO5B 3QJZA 4IM3A 2MP2A 4BKSD 1ZW7A 3VHTC 3NG0A 3DBSA 3WAMA 2WHIA 3HHMA 2AEHA 3VUXA 3ZJVA 3NZ3A 3Q69A 2JRIB 1F1HA 2KWDA 4IC7B 4HDQA 3I63C 3C8YA 3JVZX 2QMTA 2RDGA 2ZPNA 2VZKD 4GDLB 2D2QA 2NBUA 4MT5A 2FIFA 3TMPB 2JZ3B 1CZPA 3Q8AA 3P4PB 3SU8X 2D3BA 4PS8A 3E9SA 4LDTD 1TTNA 1QKZA 3OLMD 5G5HA 2L8JA 2KX0A 1ZKHA 1CQVA 3N20C 2CHWA 4AUQC 5H92C 3VH3B 1MG8A 2DWQA 5FR6A 4A90A 2AX5A 4MACA 2TSSA 3P4SB 4P6VF 2ZPYA 2L05A 3W1SA 2KANA 1UWMA 2YEPB 2N9PC 3EA6A 2BB6A 1Z2MA 3KYDD 2LXAA 1SE2A 2G4DB 2KWCA 2QIEB 2WXKA 4ZHOA 4EKUA 1L6UA 4HWIB 1FIQA 3PO0A 1KF6B 4R3DA 2C7NB 4MM3B 2PMVA 2WX0A 1HZ5A 3PRZA 1TKEA 1D6EC 5G2NA 3SFDB 4N6EB 1L4DB 5BYRA 1OQRA 4G11A 2WQYB 3BVMA 2JRHA 1JQ4A 3M63B 3W9CB 2MEKA 4YL8A 4XYCA 4JWUC 1XLOA 5CHFA 2H88B 2FUG1 4C4VB 3W5UB 4B6WA 1AW7A 4N59A 3N9YC 1WGKA 1HTQA 4K3CA 3V6CB 3TSSA 1E7VA 2DHZA 2AQ1B 1S3SG 2FCNA 4ICUA 1LO5D 2BS4B 3GB1A 5AEKB 3Q3MC 1QOGA 1ZXHA 3BVZA 2KK8A 1KM7A 2KJ6A 2N9EB 3O13A 1F77A 3TIXA 4A8XC 2KN5A 1I35A 4GN1A 1KH0A 5KHOA 3HM3A 4KV2A 4W9KA 4OZAA 1HXYD 2OEDA 1JRPA 2KQ7A 4HPMB 1LFDA 2MBEA 1VDVA 3JYUA 1PGXA 3R3MA 3HK0A 1TKYA 4ZRIA 1FO4A 4MGIE 2Z0DB 4NY0A 1SE9A 4HVBA 2JQRB 3VUWA 4RH6A 1J7CA 2K3UA 4FJZA 4GSWA 4MSMB 1IGCA 4PT5A 2J7QB 5J18A 1ROEA 4EFOA 2RPVA 1WX7A 4RGOS 3JW0X 1FXIA 2ZZPB 4F1SA 2BW2A 2HE7A 4ZOHC 2MWSB 4E74A 1UH6A 5DPWA 4RM9A 3VTVA 4CYEA 1FNUA 1ZXIA 2O2VB 2PTLA 3AV8A 4BKSA 2D10A 1PQSA 4KVGB 2V4IB 4F7ZA 1V49A 1QQRA 1UZXB 2KMCA 4GDKB 1JWBD 3U8ZA 2LVPA 4HEA1 4URKA 4NQLB 4HPLB 3IFWB 2JWUA 1ET6A 3BVGA 2WYQA 1YNTE 3DVNU 2KVZA 4LLGM 3ML9A 5LXIB 2G1EA 4M0WB 4ZRPA 2LASA 4DXAB 2FNJB 1Q1OA 1YQ3B 2MCNB 5T8IA 2LFIA 4REZA 4KIKB 4L1BA 1GJZA 2OJWA 2V4LA 1WJ6A 4IG7B 2LRWA 1G6JA 3NHEB 4I6PA 3NVVA 2ZNVB 2H89B 3WAOA 4MH8A 2M56B 1WE7A 4CO7A 4P1BC 1NI3A 3L17A 4NNJB 2CHZA 1V1PA 1C78A 4ANUA 5JHBA 4GB9A 2DYMA 4W9DA 1UF0A 4FJYA 2C9WB 4RCOA 1H8CA 2CHXA 3PZ7A 3WAPA 4G50A 1T6BX 3IG3A 2K8BA 2PW9A 5JHAA 2RR9A 4TMAB 1Z5SB 4P16A 1SGHA 1XXGA 4RGTA 3K9OB 2IY0B 1KLUD 2OOBB 1RWSA 1X1MA 1D5MC 1C3TA 2KJHB 1QF6A 2HTME 2BYVE 1AN8A 1F2RC 2MA9B 2LWPA 2KDMA 1AYFA 1CJEA 2YVCA 2K5PA 2MBOA 3W2DA 3QA8A 2XN9C 3NS8A 4MH0E 3ABVB 1E7PB 1WM2A 4IWPA 3KVFB 1PUTA 3P4QB 3BINA 4NPNA 1D5ZC 2R2QA 2GBNA 3TUOA 4WJPA 1FNWA 2XK5A 1L4ZB 1ISNA 2L3ZA 4XX5A 1WYGA 3AULA 1JW9D 3AE8B 4BKGA 3PZ8A 4BZAA 1WJ4A 3RNGC 1NYQA 1EM7A 2L76A 1R7SA 2BYFA 1YX5B 3FILA 1WXMA 2BWES 2G45B 5IO9A 1GC6A 1Q0WB 4ZDVA 4RNAA 3EGRA 1P7FA 1P98A 3ALBA 3NVYA 4KSKC 2CR5A 1XLNA 2ZCCA 4ZYNA 2PE9A 2ZJDA 4CQNA 2JWZA 5BMIA 1T0QC 2GOWA 5E6JA 4B95A 1J0GA 2N9KA 4A3OA 2BB5A 2K0PA 2MJEA 1WGHA 4KGTA 3DBLB 2W3RA 2C7MB 1IYFA 2KDIA 1BT0A 5JZEB 3NRZA 1E6EB 4M00A 2FCMA 2E6XA 1FXAA 1V80A 1FM0D 1F52A 2BPSA 5C2TB 1XT9B 3K9PB 2ACZB 3MC9A 2PLPA 4W9HA 4GU2A 1Y8RC 2IO3B 1Y56A 1UBQA 2SAKA 1ACCA 3BIID 3U7ZA 2NCNA 1JROA 4K7SA 3H7PB 4YT0B 1WGDA 1PGAA 2KAJA 2ASQA 2N9XA 3MJ5A 2LI5A 3GE8C 2V0GA 3APDA 4W9LA 3NVWA 3HUIA 2AL6A 2LRUA 5EE0A 3V6EB 1FEHA 3B08A 4PYUA 1YJJA 1TYGB 3DWGC 2WXGA 1HQRD 1XLQA 2IY1B 4J6IA 4BBNF 4US9A 2Z59B 2JXXA 3IBEA 2N1WA 1PDXA 2WS3B 4ITKA 1TGZB 4J3OD 3L08A 2BF8B 1YMHE 1MHXA 4HROA 3ZVVA 3VXWA 2K6DB 3DBLI 2V1YA 2WXIA 5DPRA 1YQ4B 2LUMA 2KD0A 2GBKA 1TS4A 1SJED 1TIFA 3A33B 2WDTB 3P4RB 1FRRA 1UNSA 3V05A 1WMHB 4XWWA 2K25A 1YD8U 5BYQA 3AB5A 1WH3A 1WZ0A 4PK1A 4WH4A 2MBHA 2WXOA 1XQQA 3VFKA 2MRPA 4QAYA 1LXDA 4AJWA 1C4CA 3DWMA 4LK0M 3Q8BA 2RMMA 1SEBD 1WFYA 1TZOA 3A4SC 2C5LC 2KC1A 4NQKE 1WIAA 3ZTCA 3KQ4A 4BBNC 1VLBA 4W9IA 1TY0A 2K22A 3T9LA 3TCAA 5FR3A 3OG5A 4K7WA 4KKJA 1R4MB 5HI1A 1GB1A 2LMCA 2MX2A 2FCSA 4B0EA 3J9CA 2W82A 5JH5C 1N61A 5DCNA 3W1SC 4FLHA 2D3CA 2M19A 3PLVA 1QZEA 2LJ5A 4A20A 1NEKB 1T0YA 1QOFA 3Q8FA 1KRHA 1SBBB 3RZFA 3PRMB 4DHJD 2VH1A 3QK0A 3RCZA 1OQYA 1TZ1A 4NAWA 2EKEC 3P1MA 4HKZE 1XD3B 3IVFA 4IOIE 4B0MA 1TY2A 3PTFC 3AM9A 1WGRA 5HKHA 3ZRFA 3ZGZA 3KUZA 3R8BA 2BS3B 2IGGA 4GOCA 4M02A 3QARA 2IO2B 4NJ6A 2KFJA 1QLBB 3OAWA 1YIWA 2WLBA 3ZKJC 3H8HA 4DXFA 1WXSA 1P1AA 1R4MI 1I4RA 2NBWB 3EFCA 2KN4A 4JQWC 3MHSD 2JYTA 1VRAB 1RAXA 2JXTA 5IKCM 4WIPA 1WXQA 3IHPC 2M8SA 3H1UA 4EE2A 4FBJB 2MBBB 4IWOA 2N9LA 4CHKA 1VJKA 1L0YB 3Q2AC 3IAM1 3MTNB 3BK2A 2VH2A 4WJOA 4KGSA 4DQOC 4FHKA 1YN4A 1GB4A 1PFDA 2V3PA 5AZFA 3ZYYX 3H9DA 3DOWA 3RT3B 2Y5PA 4KZ0A 1P0RA 4K1RB 2O6VB 2GBMA 1WR1A 3VDZA 3ZDMC 1HA5A 3ZLZA 3IT6B 3O65B 3QC8B 1XF5L 4B9KA 2K8CA 2WGSA 3LXFA 1FRDA 5L83A 4JX1C 1OGWA 3ZJUA 3VR8B 4XWTA 3EC8A 4ACFA 2WU2B 3MJWA 1WXAA 3U2SC 2DZKA 4YWGG 2NPTB 1QT9A 3SDLC 3UQBA 4TQ0A 1F2RI 1VZ6A 5CHVC 1NENB 3FC4A 4HJKA 3NVZA 1T5XD 2QSDA 3AEAB 1ZP0B 1LM8B 1VCBA 2PPHA 2BWFA 3KLSX 3V3XA 2KMMA 2DYBA 2WDVB 1I4XA 4E71A 2FAZA 2M1MA 5D7GA 1DGJA 2KDEB 4AOFA 2RDBC 1L0XB 2KFKA 2RPQA 3L54A 2JT4B 3SHQA 1FFVA 3DPDA 2FIDA 4BFRA 4KDIC 4WJNA 3MHZA 2LGXA 1MFWA 2KKCA 3MFGA 4DHZE 4F8CB 2C7HA 2MSED 4TKNA 3Q3FA 4MELA 1QOAA 4L23A 2KC2A 4MGZE 3ZRCA 2REXA 2G4SA 4M01A 5I4DA 4NAMA 2K6QA 3GS2A 5G5GA 2LHEA 4MJSB 4YSXB 2LEKA 1RLFA 1R4NB 3AECB 1NI2A 4BKTA 2EKIA 3T3NA 3JSVA 1RM6C 5AUKA 2AQ2B 3AEEB 4DK5A 3L0WB 2ZW0A 3ZXVA 2DZMA 3LYYA 1C9FA 3MC8A 1L5PA 4TQ1A 1DOXA 4ICVA 3NOBA 3A9JA 1TT5B 2QILA 3VR9B 4NJCA 2MP2B 1EF5A 3N32A 2J42A 2V3NA 1KOTA 2D11A 4PS3A 1B1ZA 1UWXA 2J0KA 2Q5WD 3NZSA 3NY5A 4WURA 2INPE 4DWFA 3FKYA 2PIAA 2KOXA 4PYZA 3AE7B 4ZRKA 1E5WA 3Q6BA 4RM8A 1QOBA 1YX6B 4X57B 2MJDA 5EDSA 1TS3A 3VVWB 4KKIA 3MP9A 1MPEA 1RRBA 4D2KA 4ARCA 3NZUA 1SB3C 2KLCA 4RFBA 4ZYSA 4JPSA 5GXGB 1JWUD 4ANVA 5E6OA 3PRPB 1JALA 4H2AA 3DBHB 1NBFC 4RGMA 1K52A 3EECA 2L0FA 3Q8CA 5FKAC 2E3TA 2FUHB 2LGDA 1EWYC 4KX6B 3RMKC 3PSEB 2WXNA 2C60A 1JRUA 2GB1A 4NZLB 3CF6E 5D94A 3AE6B 1WJNA 4ANXA 2LZ6A 2DZJA 1R4NI 2NS5A 5AZGA 4IW0A 4WAAA 3PV1A 1OFFA 4ANWA 5E6PA 3ZDTA 3AE9B 1ET9A 2IGHA 4TUUA 3BYYB 1N5XA 3DVGY 4DHZB 1FD6A 3RNCC 4YTNB 4HLEA 2A4ZA 3OJ4B 3CIRB 1N60A 2L32A 3P63A 2BTEA 3CSTA 1GPXA 5D2MB 4OZCA 4IUMB 3CWIA 3B2FA 2XBBC 1FCCC 4W9EA 3ZNGC 2INDC 2K8HA 1UD7A 1XCTL 3DBRI 5H8YE 4JE3B 1WZ3A 3ZTDA 1RFAA 4HCNB 4AQ7A 4MDKE 3DHGC 2KHWB 3NS1A 4ASWC 4NJ7A 2DX5B 1YJ1A 2KACA 1IP9A 3SFEB 1L6VA 2M17A 1AWDA 1IGDA 3DBHI 3UINB 2NMQA 3UF8A 4E3CA 2KWUB 2GRIA 3PHXB 1J19A 1ZOYB 1T0RC 2Y5CA 3ETRA 3H7SA 2CU1A 4OVUA 5BYSA 4AJYB 3RYTA 3QIJA 1K50A 3UGBB 4G0NB 2LUEA 4A3PA 4HJGE 1HE8A 1WGGA 5D6JB 3IAS1 1L0VB 3L16A 3DHHC 4K7UA 1KLVA 1E8ZA 2KFKB 1T0SC 1T3QA 2D3AA 2J4XA 2J0MA 1RYJA 3AE5B 2ON8A 1JWSD 3KWVA 2JZPA 1V6EA 3VUYA 3ECIA 3QAQA 4GDLA 4OHJA 1C4PA 2INCC 3L4PA 3N1YC 1OEYJ 5C1ZA 4GIVA 2ONQA 3VQIA 3R2TA 1V1OA 1SIJA 2W9NA 4JWSC 1OEYA 2MW5A 4IKGA 2EMSA 2WX1A 1EU4A 2V9HA 1YOVB 1K53A 1HTOA 2PVGC 3ZXRA 2INNE 2WXFA 2KTFA 2N7EA 3R7RA 2K39A 4II2B 2IPKD 3RNBC 3DVGX 2GBJA 2N7DA 4ARIA 1VR9A 3VRAB 2J52A 3N30A 1V9JA 1WY8A 1CK1A 1WI0A 1DYQA 3U4EG 3MC0B 4WWMA 3TEZA 5HFYA 3OWEB 2G3QB 4EZKA 4K3BA 2LVQA 4M8NA 4HK2A 4AP4C 2DBYA 2RGFA 5TSSA 4N9F4 2WWZA 4S0RA 2BS2B 3GZNB 2KJRA 4MM3A 1XLPA 1F0ZA 2VZKB 2WU5B 3ZNID 4IM2A 2L0TA 3N3KB 3R66C 4WAFA 5LXHA 3PGEA 2ICIA 2OHFA 4HKQA 3DVNV 3ZJTA 2LGYA 4OZBA 4LDTB 2HJ8A 1EF1A 1V5OA 4LNKA 5EE1A 2AQ3B 3TBLD 1V1PB 1GC7A 4DDID 4YSYB 2GLSA 3RFZB 2FCQA 3BY4B 1IPGA 2QHOA 1STEA 3R2IA 4RMAA 3DDCB 2IBIB 5IAAC 5L95C 1IBXA 1I4QA 1WYWB 2Y5BB 4YSZB 1C76A 2BYEA 1KJTA 3AE1B 3QX1A 2FE8A 2GBRA 2LGSA 2EELA 4HPPA 1TBEA 1DOYA 2ZNVC 1I42A 4RF1A 2D5GA 3OJ3A 2Z8LA 2IZVB 5IN7A 4L2YA 2LXCA 3LDZE 2WXQA 4AS1A 3DCGA 3AEBB 1E0ZA 1Q5WB 2KQ4X 3GZNI 3RNAC 3VTWA 2KDBA 3KW5B 4G3XB 3UI3A 3PHWB 2VRRB 2QC8A 1ZDXA 3AXCA 1UGMA 2MJ3A 3PPAA 2CJNA 2IYDB 2WNMA 2WXLA 2N4FA 2BKRB 2Z0EB 2KYWA 4FN2A 2XK5B 3HIZA 3ZQ4A 4BVUC 3TEWA 2O2VA 1IUEA 5J17A 2LVOA 2UU7A 1JMLA 2MLBA 3AE4B 3ZW3A 3N1ZC 3APCA 4LCDE 4KZCA 3FILB 3PZDA 4GDKA 4MGYE 2W3SA 4MEMA 1BMLC 1N6ZA 5AZHA 3AE3B 1V5TA 1XO3A 4M8MA 2LGIA 2PVOD 1D4BA 4USAA 1JWAD 4M0WA 1MHHE 1ESFA 1FPYA 5IA7A 4OW0A 5BMGA 1DOIA 1C1YB 4KIKA 1FNVA 3X0WA 4EZLA 2MQJA 4S17A 3SR6A 3HVDA 2LJIA 1Q10A 1SE4A 3EFUA 3ENEA 4W9GA 2WDRB 4C7YA 3ZNHB 1NDDA 1J8CA 1XCQL 4C56C 3QWZB 1E8WA 3HVZA 1PGBA 2HD5B 2KX3A 2WXRA 3M95A 3KUCB 2WXHA 1A70A 1WRDB 2L1AA 2M0XA 4Q2JA 3AE2B 4C80A 1WRIA 4UDUC 3VTUA 3KWLA 3S2AA 2WXMA 3B9JA 2UWQA 1VD2A 3RN9C 2NBVB 4A55A 1V2YA 3PVLA 1WSPA 2PE6B 1VZ8A 4FULA 3UQAA 4OVVA 1A5RA 2GMIC 4EEWA 2RSUA 5D3IB 4LNNA 4FA6A 2HDEA 1V86A 2B76B 1OTRB 1YQBA 2IO1B 2G9HD 3PS6A 3URYA 3RUIB 4WQOB 3AH7A 2N7JA 5CHWA 1XEEA 2L7RA 1UELA 2BBCA 2I1JA 4EUTA 3ZUNA 3X23A 3TEYA 3LB8C 1EWCA 3LJ3A 5LLIA 3FAHA 4IM0A 1J7AA 4P7IA
chains in the Genus database with same CATH topology
4NZLB 2NTSA 3BIID 5C3JB 3AE6B 2Y3AA 3U7ZA 1I7HA 1JROA 4YT0B 1C77A 1PGAA 2KAJA 4WQMA 3IXSA 3MJ5A 3IT4B 3WCQA 1I4HA 2K9XA 3TEXA 1ZDVA 1YN3A 1OFFA 2V0GA 3AE9B 1J7BA 1ET9A 1SE3A 2IGHA 1IBXB 3BYYB 1N5XA 1HEZE 3NVWA 3HUIA 1FD6A 4YTNB 5EE0A 3AEGB 3CIRB 1N60A 2L32A 1FEHA 5EE3A 1YJJA 1TYGB 2M0AA 3P63A 2BTEA 3EUB2 3DWGC 2WXGA 1HQRD 1XLQA 1GPXA 3ZJVA 3NZ3A 3Q69A 4OZCA 2JU6X 2KWDA 3B2FA 3CWIA 4DXGA 4US9A 1C79A 2BYTA 1FCCC 3C8YA 1PDXA 2WS3B 4ITKA 4XE0A 2QMTA 2RDGA 4J3OD 2VZKD 4GDLB 2CU3A 1E10A 1YMHE 1MHXA 3AEDB 4MT5A 1XCTL 4HROA 5H8YE 4JE3B 4IDIA 1CZPA 3Q8AA 3P4PB 4AQ7A 2WXIA 3E9SA 1ZPSA 3E56A 3NS1A 1YQ4B 2L83A 2LUMA 1TS4A 1QKZA 1SJED 2KACA 3SFEB 5G5HA 1L6VA 3P4RB 1FRRA 1UNSA 1AWDA 3V05A 1IGDA 1CQVA 2NMQA 4XWWA 2GRIA 5BYQA 3AB5A 1ZOYB 4WH4A 2Y5CA 3ETRA 2WXOA 5H92C 5BYSA 4NAWB 2DWQA 4YTPB 4A90A 1E9MA 1C4CA 2AX5A 2MH7A 4MACA 3DWMA 2TSSA 2ZW1A 3P4SB 4P6VF 4LK0M 3Q8BA 1K50A 3W1SA 2RMMA 1SEBD 1UWMA 2YEPB 1UGJA 2FBWB 3EA6A 2BB6A 1OQQA 3AN1A 1TZOA 1SE2A 4HJGE 2WXKA 2QIEB 4ZHOA 1L6UA 3IAS1 1FIQA 1QILA 1L0VB 3KQ4A 3PO0A 1VLBA 1TY0A 3RPFC 2K22A 1KF6B 4R3DA 4MM3B 1T3QA 1V8CA 2PMVA 2DLBA 1HZ5A 2J4XA 1TKEA 1RYJA 3AE5B 2ON8A 1D6EC 1JWSD 3KWVA 4KKJA 5FR3A 2JZPA 3BZDB 2IGDA 4N6EB 5HI1A 3SFDB 1L4DB 1PYWD 5BYRA 4OHJA 1OQRA 1C4PA 2WQYB 3BVMA 3U52E 1GB1A 2LMCA 5EE9A 4B0EA 1JQ4A 3L4PA 3W9CB 2MEKA 3J9CA 2W82A 2ONQA 3VQIA 3R2TA 1V1OA 1ZE3D 2JSVX 1SIJA 4N58A 1N61A 1JWMD 4JWSC 3BK1A 2I38A 4IKGA 4JWUC 1XLOA 2H88B 2FUG1 2M19A 1EU4A 2YEPF 3W5UB 4YTMB 4O1NA 4TSSA 1AW7A 4N59A 1N63A 1K53A 3N9YC 1WGKA 1NEKB 2PVGC 1ZUD2 2INNE 1QOFA 2WXFA 3Q8FA 1KRHA 1SBBB 3TSSA 2IPKD 2WXJA 2AQ1B 1LO5D 2BS4B 2JX5A 3GB1A 4ARIA 1VR9A 1QOGA 1RFKA 3P1MA 1ZXHA 2J52A 5HG2A 3BVZA 3VRAB 4HKZE 1CK1A 4IOIE 3O13A 1F77A 4B0MA 1FCLA 1TY2A 3B2GA 4A8XC 1DYQA 3W5VB 2NTTA 3U4EG 3MC0B 4WWMA 4XDCA 3TEZA 1KH0A 5HFYA 3AM9A 3OWEB 1YJIA 1TS5A 4OZAA 1HXYD 2QJLA 2OEDA 1JRPA 3ZGZA 2DBYA 5TSSA 3R8BA 2BS3B 1VDVA 2IGGA 2BT6A 3BWUD 2N0SB 1PGXA 2BS2B 1TKYA 1XLPA 1FO4A 1F0ZA 2VZKB 2WU5B 2JQRB 2IDYA 1QLBB 1P7EA 4RH6A 1J7CA 2K3UA 4WAFA 5BMHA 2GI9A 1KTKA 1IGCA 2ICIA 2OHFA 2WLBA 4C7ZA 4HKQA 4PT5A 2QEJC 3ZJTA 3H8HA 1ROEA 4OZBA 4DXFA 2RPVA 4RGOS 1FXIA 1KFYB 1I4RA 2KN4A 5EE1A 2AQ3B 2BW2A 2L52A 1VZ7A 2W54A 3NUHB 2JYTA 4ZHPA 1V1PB 1VRAB 4ZOHC 1SXTA 2JXTA 4YSYB 4WIPA 1JCKB 1WXQA 3RFZB 4A6QA 1WWTA 5AUIA 1STEA 3R2IA 3BYTB 4EE2A 2N9LA 1D5XC 1FNUA 1VJKA 1ZXIA 1L0YB 4ZRQA 1IBXA 2PTLA 1I4QA 3AV8A 3IAM1 4YSZB 1C76A 2V4IB 1QQRA 2FE8A 3AE1B 1NYRA 3BK2A 4GDKB 1JWBD 2EELA 4KGSA 4DQOC 1DOYA 2WXPA 4HEA1 1YN4A 1GB4A 1PFDA 2V3PA 1SF0A 2JWUA 3ZYYX 4RF1A 2D5GA 1ET6A 4RF0A 3BVGA 1YNTE 2Y5PA 2Z8LA 4LLGM 4L2YA 2G1EA 1EU3A 4ZRPA 2WXQA 4AS1A 1HA5A 4US8A 3AEBB 1YQ3B 1E0ZA 5T8IA 2LFIA 4REZA 1FMAD 2KQ4X 3IT6B 4L1BA 2DYOA 1YN5A 3NVVA 2H89B 1XF5L 3AEFB 4MH8A 2M56B 3LXFA 1FRDA 3UI3A 1M4VA 2RDHA 4JX1C 3ZJUA 1NI3A 1ZDXA 5HHDG 3VR8B 4XWTA 2MJ3A 1V1PA 1C78A 2CJNA 4HRSA 4KGRA 2WU2B 1BXTA 2WNMA 2WXLA 2DYMA 3U2SC 2W55A 4YWGG 1TKGA 1QT9A 4RCOA 3PZ7A 3ZQ4A 1SJHD 4TQ0A 1MVKA 3TEWA 1F2RI 1V97A 1IUEA 1T6BX 3HRDD 1JMLA 1VZ6A 1NENB 2PW9A 3FC4A 1T5XD 1GAQB 2QSDA 3AE4B 1N62A 3AEAB 3NVZA 1ZP0B 4TMAB 5MPOA 1SSNA 4P16A 3FILB 2CJOA 3KLSX 5FK9C 2W3SA 3V3XA 1XXGA 2KMMA 2WDVB 4RGTA 1KLUD 1BMLC 4RGNA 1I4XA 1RWSA 3AE3B 5D7GA 2J53A 1DGJA 1XO3A 4YXDB 1D5MC 1L0XB 2LHDA 2LGIA 2PVOD 1D4BA 1QF6A 2HTME 1AN8A 1F2RC 4USAA 1FFVA 1GOZA 2KDMA 1AYFA 1CJEA 1JWAD 4M0WA 3MHZA 1MHHE 1ESFA 5D3DA 1TS2A 4OW0A 2K5PA 1N5WA 2WP9B 3W2DA 3MFGA 5BMGA 2XN9C 1KLGD 1DOIA 4GLSC 3ABVB 1E7PB 1FNVA 3SR6A 4L23A 1QOAA 3HVDA 2LJIA 1PUTA 1Q10A 1SE4A 3I57A 2WDRB 2R61A 4C7YA 3P4QB 1UUPA 3Q8EA 1XCQL 5I4DA 3I9V1 4C56C 4NAMA 2X38A 2I2YA 3GS2A 5G5GA 1D5ZC 2LHEA 3HVZA 1PGBA 4YSXB 2WXRA 1HZ6A 2XNAC 3P42A 5LNK1 2LEKA 3AECB 4FXCA 3TUOA 2EKIA 2WXHA 3T3NA 1FNWA 1L4ZB 1RM6C 1A70A 1FFUA 2L1AA 1WYGA 5AUKA 2AQ2B 3T3OA 1JW9D 3AE8B 3AEEB 4Q2JA 3AE2B 4C80A 3PZ8A 1WRIA 2ZW0A 4UDUC 3KWLA 1NYQA 4A9AA 2WXMA 3AMZA 1EM7A 3B9JA 2IJ0A 3LYYA 1C9FA 1ENFA 1R7SA 3FILA 1L5PA 4A55A 4TQ1A 1DOXA 5JXVA 1I4PA 4XDDA 1I4GA 1WSPA 1VZ8A 2WDQB 2QILA 3VR9B 4NJCA 4RNAA 3EGRA 1P7FA 2J42A 2V3NA 1C4AA 1B1ZA 3NVYA 1UWXA 1XLNA 2Q5WD 1BUIC 4LTUA 5D3IB 4WURA 2INPE 4CQNA 5BMIA 2PIAA 2HDEA 3AE7B 5E6JA 2B76B 1B9RA 1QOBA 1NVID 2N9KA 2G9HD 2BB5A 2K0PA 3GP7A 2MJEA 2JYEA 4KGTA 2MJDA 2W3RA 3URYA 3SEBA 1TS3A 3VRBB 4KKIA 3MP9A 1MPEA 4D2KA 4ARCA 3NRZA 1E6EB 1SB3C 2N7JA 3AH7A 1TJEA 4RFBA 4JPSA 2E6XA 1JWUD 5GXGB 4ZYSA 1FXAA 1XEEA 1FM0D 1JALA 2BBCA 4H2AA 5C2TB 1MI0A 4RGMA 1K51A 2ACZB 1K52A 3Q8CA 2PLPA 2E3TA 5FKAC 3TEYA 4OVZA 3LB8C 1EWCA 1EWYC 4KX6B 1Y56A 3FAHA 2SEBD 2WXNA 2SAKA 1ACCA 1J7AA 2GB1A 2PKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9L A;  5BMG A;  1HZ5 A;  2ON8 A;  1IBX A;  4GLS C;  1PGA A;  2PTL A;  2JZP A;  2IGD A;  5HI1 A;  1GB1 A;  1Q10 A;  1IBX B;  2IGH A;  4KGS A;  2EEL A;  1HEZ E;  1FD6 A;  2ONQ A;  1XCQ L;  2JSV X;  2I2Y A;  1GB4 A;  2I38 A;  4IKG A;  2LHE A;  1PGB A;  2JWU A;  1HZ6 A;  1YNT E;  1K53 A;  4OZC A;  2JU6 X;  2KWD A;  2ZW0 A;  1FCC C;  1C9F A;  1EM7 A;  3GB1 A;  2KQ4 X;  1ZXH A;  2J52 A;  2QMT A;  5HG2 A;  4HKZ E;  3FIL A;  1YMH E;  1MHX A;  5JXV A;  1XCT L;  1XF5 L;  4IOI E;  1FCL A;  3UI3 A;  5HHD G;  1KH0 A;  5HFY A;  1P7F A;  2LUM A;  4OZA A;  4KGR A;  1QKZ A;  2KAC A;  1UWX A;  2OED A;  2IGG A;  5BMI A;  1PGX A;  1IGD A;  2NMQ A;  1MVK A;  2N9K A;  1F2R I;  1P7E A;  2K0P A;  4WH4 A;  1JML A;  5BMH A;  4KGT A;  2PW9 A;  2GI9 A;  2QSD A;  1IGC A;  3MP9 A;  1MPE A;  4D2K A;  4OZB A;  3FIL B;  2N7J A;  4MAC A;  2RPV A;  2ZW1 A;  3V3X A;  1K50 A;  1MI0 A;  2RMM A;  2KN4 A;  1K51 A;  2J53 A;  1K52 A;  2PLP A;  2LHD A;  2LGI A;  2JXT A;  4HJG E;  1D4B A;  1F2R C;  2KDM A;  2GB1 A;  1MHH E; 
#chains in the Genus database with same CATH topology
 4LNF A;  2NTS A;  3APF A;  5BO4 B;  5C3J B;  1GG3 A;  1C77 A;  4XGA B;  4WQM A;  3IXS A;  1M94 A;  1EO6 A;  3IT4 B;  3ZIM A;  1I4H A;  1E7U A;  1YN3 A;  1E8Y A;  2QCZ A;  5IP4 D;  1J7B A;  1IBX B;  1SE3 A;  2IO0 B;  1HEZ E;  2JPH A;  1WX9 A;  3AEG B;  2KTR A;  4P1C C;  4JL9 A;  5EE3 A;  3CSF A;  2M0A A;  1WX8 A;  2KXJ A;  3EUB 2;  1MJD A;  3I3T B;  2JU6 X;  2PEA A;  2AWT A;  4DXG A;  4EOY A;  1C79 A;  2BYT A;  3WA0 A;  4XE0 A;  2OJR A;  2CU3 A;  5TR5 A;  3UIP B;  1E10 A;  2DNF A;  3Q14 C;  3AED B;  5IOI A;  4IDI A;  2BQQ A;  2LD9 A;  2ZEQ A;  1ZPS A;  3E56 A;  2L83 A;  4PS7 A;  5CX3 A;  4AWJ A;  3AU5 A;  1L2N A;  2KT7 A;  4KDL B;  2KMA A;  3H7P A;  4I6L B;  4EZJ A;  3U30 A;  2QDF A;  4NAW B;  1AAR A;  4YTP B;  3V62 A;  1E9M A;  2ZCB A;  2MH7 A;  2ZW1 A;  4K81 A;  3DQV A;  1UGJ A;  2MHJ A;  2FBW B;  3GE3 C;  2K1F A;  1OQQ A;  1GUA B;  3AN1 A;  3RI7 C;  3DBR B;  4WWN A;  1QIL A;  1V81 A;  4GXB A;  2YLM A;  3RPF C;  1V8C A;  2DLB A;  2EMT A;  5C23 A;  1SIF A;  4IWQ A;  3BZD B;  2AYO B;  4DBG A;  2O6V D;  2IGD A;  3A9K A;  4W9J A;  1PYW D;  3U52 E;  5EE9 A;  3QCA A;  2JY6 A;  2CS4 A;  1ZE3 D;  2JSV X;  4N58 A;  2DAF A;  4ZRJ A;  1JWM D;  3BK1 A;  2I38 A;  3GOE A;  4JGH B;  4W9F A;  2YEP F;  3KUD B;  3R7Q A;  4YTM B;  4HDO A;  4O1N A;  5CTR C;  4TSS A;  1WMH A;  1N63 A;  2XEW A;  3KYC D;  1WJU A;  3SD5 A;  1ZUD 2;  2DAJ A;  3B1L X;  4LJP B;  4FJV B;  3ZNZ B;  3RUL A;  2WXJ A;  2JX5 A;  3EHV A;  4HCP B;  1RFK A;  5HG2 A;  3B0A A;  4KSL C;  2BKF A;  1FCL A;  3B2G A;  3W5V B;  2NTT A;  2PJH A;  4FAD A;  4XDC A;  1YJI A;  1TS5 A;  2QJL A;  3PRE A;  2BT6 A;  3BWU D;  2N0S B;  2NR2 A;  2X8X X;  2KZR A;  2KVR A;  2IDY A;  2CKH B;  2DEN B;  2N1V A;  3N1X C;  1P7E A;  5BMH A;  2GI9 A;  1KTK A;  4BOS C;  4C7Z A;  2KLG A;  2QEJ C;  3V61 A;  3A1Q A;  1KFY B;  1K8R B;  3Q3N C;  3QHT A;  2L52 A;  1VZ7 A;  2W54 A;  3NUH B;  4ZHP A;  1EUV B;  1SXT A;  1JCK B;  4A6Q A;  1WWT A;  5AUI A;  4XC2 A;  4JLC A;  2AL3 A;  3BYT B;  1D5X C;  4C00 A;  4ZRQ A;  3A4R A;  3HM6 X;  2M4N A;  3TL5 A;  3D32 A;  3C19 A;  1NYR A;  2J0J A;  3NJT A;  2WXP A;  3WAN A;  1SF0 A;  2A5U A;  4RF0 A;  3M3J A;  3M62 B;  5KHQ A;  2KTR B;  1EU3 A;  2NVU I;  4US8 A;  2JF5 A;  1FMA D;  1WGY A;  1WF9 A;  2DYO A;  2MBQ A;  1YN5 A;  1CMX B;  2KQS A;  3AEF B;  1MG4 A;  1M4V A;  2RDH A;  5HHD G;  3L13 A;  4HRS A;  2L00 B;  4KGR A;  3U7D A;  1BXT A;  3ONS A;  2W55 A;  4DHJ B;  4LNI A;  1TKG A;  2KO3 A;  4MSQ B;  3JSV B;  4WJQ A;  3RZW C;  1WR6 E;  1SJH D;  3DHI C;  1MVK A;  1V97 A;  3HRD D;  4LNO A;  3I5J C;  5MPO A;  1GAQ B;  1N62 A;  2HJ1 A;  1SSN A;  3RD2 A;  2CJO A;  1WM3 A;  5FK9 C;  1P3Q U;  3UIO B;  3A9J B;  4MGK E;  4RGN A;  3V60 A;  3C0R B;  2V3S A;  2J53 A;  4WWO A;  1ZGU B;  4YXD B;  2LHD A;  3QQ8 B;  5DPS A;  5J2R A;  1GOZ A;  1H4R A;  2O6V A;  3RNE C;  5D3D A;  1TS2 A;  1N5W A;  2WP9 B;  1LQB A;  4JIO U;  1KLG D;  4GLS C;  2R2O A;  2I1K A;  4I6N B;  3I57 A;  3Q3O C;  2R61 A;  1UUP A;  2D07 B;  3Q8E A;  4FHJ A;  3A9K B;  4C4V A;  1WE6 A;  2B3A A;  2KNB A;  4TV3 A;  3I9V 1;  5E6N A;  2X38 A;  1D3Z A;  3VAW A;  2I2Y A;  5GMV A;  1HZ6 A;  2XNA C;  3WAL A;  3P42 A;  3RNF C;  5LNK 1;  2NPT A;  4FXC A;  2BVC A;  4XZ4 A;  1WXV A;  2JUO A;  1FFU A;  3T3O A;  1P9D U;  1E8X A;  3AU4 A;  4A9A A;  3AI5 A;  3AMZ A;  2IJ0 A;  4LJO B;  1ENF A;  3L10 B;  4HXD A;  3ML8 A;  5DPT A;  5JXV A;  1U4A A;  1FXT B;  1I4P A;  4XDD A;  1I4G A;  2UYZ B;  2WDQ B;  3VH4 B;  1L7Y A;  1GNU A;  3T8M A;  2HTH A;  1C4A A;  1BUI C;  4LTU A;  1E90 A;  3H6N A;  1B9R A;  3TJP A;  1NVI D;  4W9C A;  4BAX A;  1UBI A;  3PLU A;  3KH0 A;  3GP7 A;  2JYE A;  4DDG D;  2RD0 A;  3CMM B;  3SEB A;  2D3G A;  4BOZ B;  3PT2 B;  3P2B A;  3WIM A;  3VRB B;  5G55 A;  2KWV B;  4GGQ A;  1TJE A;  1MI0 A;  2DZI A;  2ZVN A;  1K51 A;  2JZZ A;  2JVC A;  4MJS A;  3A1Q B;  4WWP A;  4OVZ A;  2KDF B;  2ZVO A;  2SEB D;  2BGF A;  2PKO A;  4GMV A;  3W1Y A;  2Y3A A;  1I7H A;  1F9J A;  1LGR A;  1S1Q B;  3Q3J A;  3WCQ A;  3TEX A;  2K9X A;  4II3 B;  1ZDV A;  3ZO5 B;  3QJZ A;  4IM3 A;  2MP2 A;  4BKS D;  1ZW7 A;  3VHT C;  3NG0 A;  3DBS A;  3WAM A;  2WHI A;  3HHM A;  2AEH A;  3VUX A;  3ZJV A;  3NZ3 A;  3Q69 A;  2JRI B;  1F1H A;  2KWD A;  4IC7 B;  4HDQ A;  3I63 C;  3C8Y A;  3JVZ X;  2QMT A;  2RDG A;  2ZPN A;  2VZK D;  4GDL B;  2D2Q A;  2NBU A;  4MT5 A;  2FIF A;  3TMP B;  2JZ3 B;  1CZP A;  3Q8A A;  3P4P B;  3SU8 X;  2D3B A;  4PS8 A;  3E9S A;  4LDT D;  1TTN A;  1QKZ A;  3OLM D;  5G5H A;  2L8J A;  2KX0 A;  1ZKH A;  1CQV A;  3N20 C;  2CHW A;  4AUQ C;  5H92 C;  3VH3 B;  1MG8 A;  2DWQ A;  5FR6 A;  4A90 A;  2AX5 A;  4MAC A;  2TSS A;  3P4S B;  4P6V F;  2ZPY A;  2L05 A;  3W1S A;  2KAN A;  1UWM A;  2YEP B;  2N9P C;  3EA6 A;  2BB6 A;  1Z2M A;  3KYD D;  2LXA A;  1SE2 A;  2G4D B;  2KWC A;  2QIE B;  2WXK A;  4ZHO A;  4EKU A;  1L6U A;  4HWI B;  1FIQ A;  3PO0 A;  1KF6 B;  4R3D A;  2C7N B;  4MM3 B;  2PMV A;  2WX0 A;  1HZ5 A;  3PRZ A;  1TKE A;  1D6E C;  5G2N A;  3SFD B;  4N6E B;  1L4D B;  5BYR A;  1OQR A;  4G11 A;  2WQY B;  3BVM A;  2JRH A;  1JQ4 A;  3M63 B;  3W9C B;  2MEK A;  4YL8 A;  4XYC A;  4JWU C;  1XLO A;  5CHF A;  2H88 B;  2FUG 1;  4C4V B;  3W5U B;  4B6W A;  1AW7 A;  4N59 A;  3N9Y C;  1WGK A;  1HTQ A;  4K3C A;  3V6C B;  3TSS A;  1E7V A;  2DHZ A;  2AQ1 B;  1S3S G;  2FCN A;  4ICU A;  1LO5 D;  2BS4 B;  3GB1 A;  5AEK B;  3Q3M C;  1QOG A;  1ZXH A;  3BVZ A;  2KK8 A;  1KM7 A;  2KJ6 A;  2N9E B;  3O13 A;  1F77 A;  3TIX A;  4A8X C;  2KN5 A;  1I35 A;  4GN1 A;  1KH0 A;  5KHO A;  3HM3 A;  4KV2 A;  4W9K A;  4OZA A;  1HXY D;  2OED A;  1JRP A;  2KQ7 A;  4HPM B;  1LFD A;  2MBE A;  1VDV A;  3JYU A;  1PGX A;  3R3M A;  3HK0 A;  1TKY A;  4ZRI A;  1FO4 A;  4MGI E;  2Z0D B;  4NY0 A;  1SE9 A;  4HVB A;  2JQR B;  3VUW A;  4RH6 A;  1J7C A;  2K3U A;  4FJZ A;  4GSW A;  4MSM B;  1IGC A;  4PT5 A;  2J7Q B;  5J18 A;  1ROE A;  4EFO A;  2RPV A;  1WX7 A;  4RGO S;  3JW0 X;  1FXI A;  2ZZP B;  4F1S A;  2BW2 A;  2HE7 A;  4ZOH C;  2MWS B;  4E74 A;  1UH6 A;  5DPW A;  4RM9 A;  3VTV A;  4CYE A;  1FNU A;  1ZXI A;  2O2V B;  2PTL A;  3AV8 A;  4BKS A;  2D10 A;  1PQS A;  4KVG B;  2V4I B;  4F7Z A;  1V49 A;  1QQR A;  1UZX B;  2KMC A;  4GDK B;  1JWB D;  3U8Z A;  2LVP A;  4HEA 1;  4URK A;  4NQL B;  4HPL B;  3IFW B;  2JWU A;  1ET6 A;  3BVG A;  2WYQ A;  1YNT E;  3DVN U;  2KVZ A;  4LLG M;  3ML9 A;  5LXI B;  2G1E A;  4M0W B;  4ZRP A;  2LAS A;  4DXA B;  2FNJ B;  1Q1O A;  1YQ3 B;  2MCN B;  5T8I A;  2LFI A;  4REZ A;  4KIK B;  4L1B A;  1GJZ A;  2OJW A;  2V4L A;  1WJ6 A;  4IG7 B;  2LRW A;  1G6J A;  3NHE B;  4I6P A;  3NVV A;  2ZNV B;  2H89 B;  3WAO A;  4MH8 A;  2M56 B;  1WE7 A;  4CO7 A;  4P1B C;  1NI3 A;  3L17 A;  4NNJ B;  2CHZ A;  1V1P A;  1C78 A;  4ANU A;  5JHB A;  4GB9 A;  2DYM A;  4W9D A;  1UF0 A;  4FJY A;  2C9W B;  4RCO A;  1H8C A;  2CHX A;  3PZ7 A;  3WAP A;  4G50 A;  1T6B X;  3IG3 A;  2K8B A;  2PW9 A;  5JHA A;  2RR9 A;  4TMA B;  1Z5S B;  4P16 A;  1SGH A;  1XXG A;  4RGT A;  3K9O B;  2IY0 B;  1KLU D;  2OOB B;  1RWS A;  1X1M A;  1D5M C;  1C3T A;  2KJH B;  1QF6 A;  2HTM E;  2BYV E;  1AN8 A;  1F2R C;  2MA9 B;  2LWP A;  2KDM A;  1AYF A;  1CJE A;  2YVC A;  2K5P A;  2MBO A;  3W2D A;  3QA8 A;  2XN9 C;  3NS8 A;  4MH0 E;  3ABV B;  1E7P B;  1WM2 A;  4IWP A;  3KVF B;  1PUT A;  3P4Q B;  3BIN A;  4NPN A;  1D5Z C;  2R2Q A;  2GBN A;  3TUO A;  4WJP A;  1FNW A;  2XK5 A;  1L4Z B;  1ISN A;  2L3Z A;  4XX5 A;  1WYG A;  3AUL A;  1JW9 D;  3AE8 B;  4BKG A;  3PZ8 A;  4BZA A;  1WJ4 A;  3RNG C;  1NYQ A;  1EM7 A;  2L76 A;  1R7S A;  2BYF A;  1YX5 B;  3FIL A;  1WXM A;  2BWE S;  2G45 B;  5IO9 A;  1GC6 A;  1Q0W B;  4ZDV A;  4RNA A;  3EGR A;  1P7F A;  1P98 A;  3ALB A;  3NVY A;  4KSK C;  2CR5 A;  1XLN A;  2ZCC A;  4ZYN A;  2PE9 A;  2ZJD A;  4CQN A;  2JWZ A;  5BMI A;  1T0Q C;  2GOW A;  5E6J A;  4B95 A;  1J0G A;  2N9K A;  4A3O A;  2BB5 A;  2K0P A;  2MJE A;  1WGH A;  4KGT A;  3DBL B;  2W3R A;  2C7M B;  1IYF A;  2KDI A;  1BT0 A;  5JZE B;  3NRZ A;  1E6E B;  4M00 A;  2FCM A;  2E6X A;  1FXA A;  1V80 A;  1FM0 D;  1F52 A;  2BPS A;  5C2T B;  1XT9 B;  3K9P B;  2ACZ B;  3MC9 A;  2PLP A;  4W9H A;  4GU2 A;  1Y8R C;  2IO3 B;  1Y56 A;  1UBQ A;  2SAK A;  1ACC A;  3BII D;  3U7Z A;  2NCN A;  1JRO A;  4K7S A;  3H7P B;  4YT0 B;  1WGD A;  1PGA A;  2KAJ A;  2ASQ A;  2N9X A;  3MJ5 A;  2LI5 A;  3GE8 C;  2V0G A;  3APD A;  4W9L A;  3NVW A;  3HUI A;  2AL6 A;  2LRU A;  5EE0 A;  3V6E B;  1FEH A;  3B08 A;  4PYU A;  1YJJ A;  1TYG B;  3DWG C;  2WXG A;  1HQR D;  1XLQ A;  2IY1 B;  4J6I A;  4BBN F;  4US9 A;  2Z59 B;  2JXX A;  3IBE A;  2N1W A;  1PDX A;  2WS3 B;  4ITK A;  1TGZ B;  4J3O D;  3L08 A;  2BF8 B;  1YMH E;  1MHX A;  4HRO A;  3ZVV A;  3VXW A;  2K6D B;  3DBL I;  2V1Y A;  2WXI A;  5DPR A;  1YQ4 B;  2LUM A;  2KD0 A;  2GBK A;  1TS4 A;  1SJE D;  1TIF A;  3A33 B;  2WDT B;  3P4R B;  1FRR A;  1UNS A;  3V05 A;  1WMH B;  4XWW A;  2K25 A;  1YD8 U;  5BYQ A;  3AB5 A;  1WH3 A;  1WZ0 A;  4PK1 A;  4WH4 A;  2MBH A;  2WXO A;  1XQQ A;  3VFK A;  2MRP A;  4QAY A;  1LXD A;  4AJW A;  1C4C A;  3DWM A;  4LK0 M;  3Q8B A;  2RMM A;  1SEB D;  1WFY A;  1TZO A;  3A4S C;  2C5L C;  2KC1 A;  4NQK E;  1WIA A;  3ZTC A;  3KQ4 A;  4BBN C;  1VLB A;  4W9I A;  1TY0 A;  2K22 A;  3T9L A;  3TCA A;  5FR3 A;  3OG5 A;  4K7W A;  4KKJ A;  1R4M B;  5HI1 A;  1GB1 A;  2LMC A;  2MX2 A;  2FCS A;  4B0E A;  3J9C A;  2W82 A;  5JH5 C;  1N61 A;  5DCN A;  3W1S C;  4FLH A;  2D3C A;  2M19 A;  3PLV A;  1QZE A;  2LJ5 A;  4A20 A;  1NEK B;  1T0Y A;  1QOF A;  3Q8F A;  1KRH A;  1SBB B;  3RZF A;  3PRM B;  4DHJ D;  2VH1 A;  3QK0 A;  3RCZ A;  1OQY A;  1TZ1 A;  4NAW A;  2EKE C;  3P1M A;  4HKZ E;  1XD3 B;  3IVF A;  4IOI E;  4B0M A;  1TY2 A;  3PTF C;  3AM9 A;  1WGR A;  5HKH A;  3ZRF A;  3ZGZ A;  3KUZ A;  3R8B A;  2BS3 B;  2IGG A;  4GOC A;  4M02 A;  3QAR A;  2IO2 B;  4NJ6 A;  2KFJ A;  1QLB B;  3OAW A;  1YIW A;  2WLB A;  3ZKJ C;  3H8H A;  4DXF A;  1WXS A;  1P1A A;  1R4M I;  1I4R A;  2NBW B;  3EFC A;  2KN4 A;  4JQW C;  3MHS D;  2JYT A;  1VRA B;  1RAX A;  2JXT A;  5IKC M;  4WIP A;  1WXQ A;  3IHP C;  2M8S A;  3H1U A;  4EE2 A;  4FBJ B;  2MBB B;  4IWO A;  2N9L A;  4CHK A;  1VJK A;  1L0Y B;  3Q2A C;  3IAM 1;  3MTN B;  3BK2 A;  2VH2 A;  4WJO A;  4KGS A;  4DQO C;  4FHK A;  1YN4 A;  1GB4 A;  1PFD A;  2V3P A;  5AZF A;  3ZYY X;  3H9D A;  3DOW A;  3RT3 B;  2Y5P A;  4KZ0 A;  1P0R A;  4K1R B;  2O6V B;  2GBM A;  1WR1 A;  3VDZ A;  3ZDM C;  1HA5 A;  3ZLZ A;  3IT6 B;  3O65 B;  3QC8 B;  1XF5 L;  4B9K A;  2K8C A;  2WGS A;  3LXF A;  1FRD A;  5L83 A;  4JX1 C;  1OGW A;  3ZJU A;  3VR8 B;  4XWT A;  3EC8 A;  4ACF A;  2WU2 B;  3MJW A;  1WXA A;  3U2S C;  2DZK A;  4YWG G;  2NPT B;  1QT9 A;  3SDL C;  3UQB A;  4TQ0 A;  1F2R I;  1VZ6 A;  5CHV C;  1NEN B;  3FC4 A;  4HJK A;  3NVZ A;  1T5X D;  2QSD A;  3AEA B;  1ZP0 B;  1LM8 B;  1VCB A;  2PPH A;  2BWF A;  3KLS X;  3V3X A;  2KMM A;  2DYB A;  2WDV B;  1I4X A;  4E71 A;  2FAZ A;  2M1M A;  5D7G A;  1DGJ A;  2KDE B;  4AOF A;  2RDB C;  1L0X B;  2KFK A;  2RPQ A;  3L54 A;  2JT4 B;  3SHQ A;  1FFV A;  3DPD A;  2FID A;  4BFR A;  4KDI C;  4WJN A;  3MHZ A;  2LGX A;  1MFW A;  2KKC A;  3MFG A;  4DHZ E;  4F8C B;  2C7H A;  2MSE D;  4TKN A;  3Q3F A;  4MEL A;  1QOA A;  4L23 A;  2KC2 A;  4MGZ E;  3ZRC A;  2REX A;  2G4S A;  4M01 A;  5I4D A;  4NAM A;  2K6Q A;  3GS2 A;  5G5G A;  2LHE A;  4MJS B;  4YSX B;  2LEK A;  1RLF A;  1R4N B;  3AEC B;  1NI2 A;  4BKT A;  2EKI A;  3T3N A;  3JSV A;  1RM6 C;  5AUK A;  2AQ2 B;  3AEE B;  4DK5 A;  3L0W B;  2ZW0 A;  3ZXV A;  2DZM A;  3LYY A;  1C9F A;  3MC8 A;  1L5P A;  4TQ1 A;  1DOX A;  4ICV A;  3NOB A;  3A9J A;  1TT5 B;  2QIL A;  3VR9 B;  4NJC A;  2MP2 B;  1EF5 A;  3N32 A;  2J42 A;  2V3N A;  1KOT A;  2D11 A;  4PS3 A;  1B1Z A;  1UWX A;  2J0K A;  2Q5W D;  3NZS A;  3NY5 A;  4WUR A;  2INP E;  4DWF A;  3FKY A;  2PIA A;  2KOX A;  4PYZ A;  3AE7 B;  4ZRK A;  1E5W A;  3Q6B A;  4RM8 A;  1QOB A;  1YX6 B;  4X57 B;  2MJD A;  5EDS A;  1TS3 A;  3VVW B;  4KKI A;  3MP9 A;  1MPE A;  1RRB A;  4D2K A;  4ARC A;  3NZU A;  1SB3 C;  2KLC A;  4RFB A;  4ZYS A;  4JPS A;  5GXG B;  1JWU D;  4ANV A;  5E6O A;  3PRP B;  1JAL A;  4H2A A;  3DBH B;  1NBF C;  4RGM A;  1K52 A;  3EEC A;  2L0F A;  3Q8C A;  5FKA C;  2E3T A;  2FUH B;  2LGD A;  1EWY C;  4KX6 B;  3RMK C;  3PSE B;  2WXN A;  2C60 A;  1JRU A;  2GB1 A;  4NZL B;  3CF6 E;  5D94 A;  3AE6 B;  1WJN A;  4ANX A;  2LZ6 A;  2DZJ A;  1R4N I;  2NS5 A;  5AZG A;  4IW0 A;  4WAA A;  3PV1 A;  1OFF A;  4ANW A;  5E6P A;  3ZDT A;  3AE9 B;  1ET9 A;  2IGH A;  4TUU A;  3BYY B;  1N5X A;  3DVG Y;  4DHZ B;  1FD6 A;  3RNC C;  4YTN B;  4HLE A;  2A4Z A;  3OJ4 B;  3CIR B;  1N60 A;  2L32 A;  3P63 A;  2BTE A;  3CST A;  1GPX A;  5D2M B;  4OZC A;  4IUM B;  3CWI A;  3B2F A;  2XBB C;  1FCC C;  4W9E A;  3ZNG C;  2IND C;  2K8H A;  1UD7 A;  1XCT L;  3DBR I;  5H8Y E;  4JE3 B;  1WZ3 A;  3ZTD A;  1RFA A;  4HCN B;  4AQ7 A;  4MDK E;  3DHG C;  2KHW B;  3NS1 A;  4ASW C;  4NJ7 A;  2DX5 B;  1YJ1 A;  2KAC A;  1IP9 A;  3SFE B;  1L6V A;  2M17 A;  1AWD A;  1IGD A;  3DBH I;  3UIN B;  2NMQ A;  3UF8 A;  4E3C A;  2KWU B;  2GRI A;  3PHX B;  1J19 A;  1ZOY B;  1T0R C;  2Y5C A;  3ETR A;  3H7S A;  2CU1 A;  4OVU A;  5BYS A;  4AJY B;  3RYT A;  3QIJ A;  1K50 A;  3UGB B;  4G0N B;  2LUE A;  4A3P A;  4HJG E;  1HE8 A;  1WGG A;  5D6J B;  3IAS 1;  1L0V B;  3L16 A;  3DHH C;  4K7U A;  1KLV A;  1E8Z A;  2KFK B;  1T0S C;  1T3Q A;  2D3A A;  2J4X A;  2J0M A;  1RYJ A;  3AE5 B;  2ON8 A;  1JWS D;  3KWV A;  2JZP A;  1V6E A;  3VUY A;  3ECI A;  3QAQ A;  4GDL A;  4OHJ A;  1C4P A;  2INC C;  3L4P A;  3N1Y C;  1OEY J;  5C1Z A;  4GIV A;  2ONQ A;  3VQI A;  3R2T A;  1V1O A;  1SIJ A;  2W9N A;  4JWS C;  1OEY A;  2MW5 A;  4IKG A;  2EMS A;  2WX1 A;  1EU4 A;  2V9H A;  1YOV B;  1K53 A;  1HTO A;  2PVG C;  3ZXR A;  2INN E;  2WXF A;  2KTF A;  2N7E A;  3R7R A;  2K39 A;  4II2 B;  2IPK D;  3RNB C;  3DVG X;  2GBJ A;  2N7D A;  4ARI A;  1VR9 A;  3VRA B;  2J52 A;  3N30 A;  1V9J A;  1WY8 A;  1CK1 A;  1WI0 A;  1DYQ A;  3U4E G;  3MC0 B;  4WWM A;  3TEZ A;  5HFY A;  3OWE B;  2G3Q B;  4EZK A;  4K3B A;  2LVQ A;  4M8N A;  4HK2 A;  4AP4 C;  2DBY A;  2RGF A;  5TSS A;  4N9F 4;  2WWZ A;  4S0R A;  2BS2 B;  3GZN B;  2KJR A;  4MM3 A;  1XLP A;  1F0Z A;  2VZK B;  2WU5 B;  3ZNI D;  4IM2 A;  2L0T A;  3N3K B;  3R66 C;  4WAF A;  5LXH A;  3PGE A;  2ICI A;  2OHF A;  4HKQ A;  3DVN V;  3ZJT A;  2LGY A;  4OZB A;  4LDT B;  2HJ8 A;  1EF1 A;  1V5O A;  4LNK A;  5EE1 A;  2AQ3 B;  3TBL D;  1V1P B;  1GC7 A;  4DDI D;  4YSY B;  2GLS A;  3RFZ B;  2FCQ A;  3BY4 B;  1IPG A;  2QHO A;  1STE A;  3R2I A;  4RMA A;  3DDC B;  2IBI B;  5IAA C;  5L95 C;  1IBX A;  1I4Q A;  1WYW B;  2Y5B B;  4YSZ B;  1C76 A;  2BYE A;  1KJT A;  3AE1 B;  3QX1 A;  2FE8 A;  2GBR A;  2LGS A;  2EEL A;  4HPP A;  1TBE A;  1DOY A;  2ZNV C;  1I42 A;  4RF1 A;  2D5G A;  3OJ3 A;  2Z8L A;  2IZV B;  5IN7 A;  4L2Y A;  2LXC A;  3LDZ E;  2WXQ A;  4AS1 A;  3DCG A;  3AEB B;  1E0Z A;  1Q5W B;  2KQ4 X;  3GZN I;  3RNA C;  3VTW A;  2KDB A;  3KW5 B;  4G3X B;  3UI3 A;  3PHW B;  2VRR B;  2QC8 A;  1ZDX A;  3AXC A;  1UGM A;  2MJ3 A;  3PPA A;  2CJN A;  2IYD B;  2WNM A;  2WXL A;  2N4F A;  2BKR B;  2Z0E B;  2KYW A;  4FN2 A;  2XK5 B;  3HIZ A;  3ZQ4 A;  4BVU C;  3TEW A;  2O2V A;  1IUE A;  5J17 A;  2LVO A;  2UU7 A;  1JML A;  2MLB A;  3AE4 B;  3ZW3 A;  3N1Z C;  3APC A;  4LCD E;  4KZC A;  3FIL B;  3PZD A;  4GDK A;  4MGY E;  2W3S A;  4MEM A;  1BML C;  1N6Z A;  5AZH A;  3AE3 B;  1V5T A;  1XO3 A;  4M8M A;  2LGI A;  2PVO D;  1D4B A;  4USA A;  1JWA D;  4M0W A;  1MHH E;  1ESF A;  1FPY A;  5IA7 A;  4OW0 A;  5BMG A;  1DOI A;  1C1Y B;  4KIK A;  1FNV A;  3X0W A;  4EZL A;  2MQJ A;  4S17 A;  3SR6 A;  3HVD A;  2LJI A;  1Q10 A;  1SE4 A;  3EFU A;  3ENE A;  4W9G A;  2WDR B;  4C7Y A;  3ZNH B;  1NDD A;  1J8C A;  1XCQ L;  4C56 C;  3QWZ B;  1E8W A;  3HVZ A;  1PGB A;  2HD5 B;  2KX3 A;  2WXR A;  3M95 A;  3KUC B;  2WXH A;  1A70 A;  1WRD B;  2L1A A;  2M0X A;  4Q2J A;  3AE2 B;  4C80 A;  1WRI A;  4UDU C;  3VTU A;  3KWL A;  3S2A A;  2WXM A;  3B9J A;  2UWQ A;  1VD2 A;  3RN9 C;  2NBV B;  4A55 A;  1V2Y A;  3PVL A;  1WSP A;  2PE6 B;  1VZ8 A;  4FUL A;  3UQA A;  4OVV A;  1A5R A;  2GMI C;  4EEW A;  2RSU A;  5D3I B;  4LNN A;  4FA6 A;  2HDE A;  1V86 A;  2B76 B;  1OTR B;  1YQB A;  2IO1 B;  2G9H D;  3PS6 A;  3URY A;  3RUI B;  4WQO B;  3AH7 A;  2N7J A;  5CHW A;  1XEE A;  2L7R A;  1UEL A;  2BBC A;  2I1J A;  4EUT A;  3ZUN A;  3X23 A;  3TEY A;  3LB8 C;  1EWC A;  3LJ3 A;  5LLI A;  3FAH A;  4IM0 A;  1J7A A;  4P7I A; 
#chains in the Genus database with same CATH homology
 4NZL B;  2NTS A;  3BII D;  5C3J B;  3AE6 B;  2Y3A A;  3U7Z A;  1I7H A;  1JRO A;  4YT0 B;  1C77 A;  1PGA A;  2KAJ A;  4WQM A;  3IXS A;  3MJ5 A;  3IT4 B;  3WCQ A;  1I4H A;  2K9X A;  3TEX A;  1ZDV A;  1YN3 A;  1OFF A;  2V0G A;  3AE9 B;  1J7B A;  1ET9 A;  1SE3 A;  2IGH A;  1IBX B;  3BYY B;  1N5X A;  1HEZ E;  3NVW A;  3HUI A;  1FD6 A;  4YTN B;  5EE0 A;  3AEG B;  3CIR B;  1N60 A;  2L32 A;  1FEH A;  5EE3 A;  1YJJ A;  1TYG B;  2M0A A;  3P63 A;  2BTE A;  3EUB 2;  3DWG C;  2WXG A;  1HQR D;  1XLQ A;  1GPX A;  3ZJV A;  3NZ3 A;  3Q69 A;  4OZC A;  2JU6 X;  2KWD A;  3B2F A;  3CWI A;  4DXG A;  4US9 A;  1C79 A;  2BYT A;  1FCC C;  3C8Y A;  1PDX A;  2WS3 B;  4ITK A;  4XE0 A;  2QMT A;  2RDG A;  4J3O D;  2VZK D;  4GDL B;  2CU3 A;  1E10 A;  1YMH E;  1MHX A;  3AED B;  4MT5 A;  1XCT L;  4HRO A;  5H8Y E;  4JE3 B;  4IDI A;  1CZP A;  3Q8A A;  3P4P B;  4AQ7 A;  2WXI A;  3E9S A;  1ZPS A;  3E56 A;  3NS1 A;  1YQ4 B;  2L83 A;  2LUM A;  1TS4 A;  1QKZ A;  1SJE D;  2KAC A;  3SFE B;  5G5H A;  1L6V A;  3P4R B;  1FRR A;  1UNS A;  1AWD A;  3V05 A;  1IGD A;  1CQV A;  2NMQ A;  4XWW A;  2GRI A;  5BYQ A;  3AB5 A;  1ZOY B;  4WH4 A;  2Y5C A;  3ETR A;  2WXO A;  5H92 C;  5BYS A;  4NAW B;  2DWQ A;  4YTP B;  4A90 A;  1E9M A;  1C4C A;  2AX5 A;  2MH7 A;  4MAC A;  3DWM A;  2TSS A;  2ZW1 A;  3P4S B;  4P6V F;  4LK0 M;  3Q8B A;  1K50 A;  3W1S A;  2RMM A;  1SEB D;  1UWM A;  2YEP B;  1UGJ A;  2FBW B;  3EA6 A;  2BB6 A;  1OQQ A;  3AN1 A;  1TZO A;  1SE2 A;  4HJG E;  2WXK A;  2QIE B;  4ZHO A;  1L6U A;  3IAS 1;  1FIQ A;  1QIL A;  1L0V B;  3KQ4 A;  3PO0 A;  1VLB A;  1TY0 A;  3RPF C;  2K22 A;  1KF6 B;  4R3D A;  4MM3 B;  1T3Q A;  1V8C A;  2PMV A;  2DLB A;  1HZ5 A;  2J4X A;  1TKE A;  1RYJ A;  3AE5 B;  2ON8 A;  1D6E C;  1JWS D;  3KWV A;  4KKJ A;  5FR3 A;  2JZP A;  3BZD B;  2IGD A;  4N6E B;  5HI1 A;  3SFD B;  1L4D B;  1PYW D;  5BYR A;  4OHJ A;  1OQR A;  1C4P A;  2WQY B;  3BVM A;  3U52 E;  1GB1 A;  2LMC A;  5EE9 A;  4B0E A;  1JQ4 A;  3L4P A;  3W9C B;  2MEK A;  3J9C A;  2W82 A;  2ONQ A;  3VQI A;  3R2T A;  1V1O A;  1ZE3 D;  2JSV X;  1SIJ A;  4N58 A;  1N61 A;  1JWM D;  4JWS C;  3BK1 A;  2I38 A;  4IKG A;  4JWU C;  1XLO A;  2H88 B;  2FUG 1;  2M19 A;  1EU4 A;  2YEP F;  3W5U B;  4YTM B;  4O1N A;  4TSS A;  1AW7 A;  4N59 A;  1N63 A;  1K53 A;  3N9Y C;  1WGK A;  1NEK B;  2PVG C;  1ZUD 2;  2INN E;  1QOF A;  2WXF A;  3Q8F A;  1KRH A;  1SBB B;  3TSS A;  2IPK D;  2WXJ A;  2AQ1 B;  1LO5 D;  2BS4 B;  2JX5 A;  3GB1 A;  4ARI A;  1VR9 A;  1QOG A;  1RFK A;  3P1M A;  1ZXH A;  2J52 A;  5HG2 A;  3BVZ A;  3VRA B;  4HKZ E;  1CK1 A;  4IOI E;  3O13 A;  1F77 A;  4B0M A;  1FCL A;  1TY2 A;  3B2G A;  4A8X C;  1DYQ A;  3W5V B;  2NTT A;  3U4E G;  3MC0 B;  4WWM A;  4XDC A;  3TEZ A;  1KH0 A;  5HFY A;  3AM9 A;  3OWE B;  1YJI A;  1TS5 A;  4OZA A;  1HXY D;  2QJL A;  2OED A;  1JRP A;  3ZGZ A;  2DBY A;  5TSS A;  3R8B A;  2BS3 B;  1VDV A;  2IGG A;  2BT6 A;  3BWU D;  2N0S B;  1PGX A;  2BS2 B;  1TKY A;  1XLP A;  1FO4 A;  1F0Z A;  2VZK B;  2WU5 B;  2JQR B;  2IDY A;  1QLB B;  1P7E A;  4RH6 A;  1J7C A;  2K3U A;  4WAF A;  5BMH A;  2GI9 A;  1KTK A;  1IGC A;  2ICI A;  2OHF A;  2WLB A;  4C7Z A;  4HKQ A;  4PT5 A;  2QEJ C;  3ZJT A;  3H8H A;  1ROE A;  4OZB A;  4DXF A;  2RPV A;  4RGO S;  1FXI A;  1KFY B;  1I4R A;  2KN4 A;  5EE1 A;  2AQ3 B;  2BW2 A;  2L52 A;  1VZ7 A;  2W54 A;  3NUH B;  2JYT A;  4ZHP A;  1V1P B;  1VRA B;  4ZOH C;  1SXT A;  2JXT A;  4YSY B;  4WIP A;  1JCK B;  1WXQ A;  3RFZ B;  4A6Q A;  1WWT A;  5AUI A;  1STE A;  3R2I A;  3BYT B;  4EE2 A;  2N9L A;  1D5X C;  1FNU A;  1VJK A;  1ZXI A;  1L0Y B;  4ZRQ A;  1IBX A;  2PTL A;  1I4Q A;  3AV8 A;  3IAM 1;  4YSZ B;  1C76 A;  2V4I B;  1QQR A;  2FE8 A;  3AE1 B;  1NYR A;  3BK2 A;  4GDK B;  1JWB D;  2EEL A;  4KGS A;  4DQO C;  1DOY A;  2WXP A;  4HEA 1;  1YN4 A;  1GB4 A;  1PFD A;  2V3P A;  1SF0 A;  2JWU A;  3ZYY X;  4RF1 A;  2D5G A;  1ET6 A;  4RF0 A;  3BVG A;  1YNT E;  2Y5P A;  2Z8L A;  4LLG M;  4L2Y A;  2G1E A;  1EU3 A;  4ZRP A;  2WXQ A;  4AS1 A;  1HA5 A;  4US8 A;  3AEB B;  1YQ3 B;  1E0Z A;  5T8I A;  2LFI A;  4REZ A;  1FMA D;  2KQ4 X;  3IT6 B;  4L1B A;  2DYO A;  1YN5 A;  3NVV A;  2H89 B;  1XF5 L;  3AEF B;  4MH8 A;  2M56 B;  3LXF A;  1FRD A;  3UI3 A;  1M4V A;  2RDH A;  4JX1 C;  3ZJU A;  1NI3 A;  1ZDX A;  5HHD G;  3VR8 B;  4XWT A;  2MJ3 A;  1V1P A;  1C78 A;  2CJN A;  4HRS A;  4KGR A;  2WU2 B;  1BXT A;  2WNM A;  2WXL A;  2DYM A;  3U2S C;  2W55 A;  4YWG G;  1TKG A;  1QT9 A;  4RCO A;  3PZ7 A;  3ZQ4 A;  1SJH D;  4TQ0 A;  1MVK A;  3TEW A;  1F2R I;  1V97 A;  1IUE A;  1T6B X;  3HRD D;  1JML A;  1VZ6 A;  1NEN B;  2PW9 A;  3FC4 A;  1T5X D;  1GAQ B;  2QSD A;  3AE4 B;  1N62 A;  3AEA B;  3NVZ A;  1ZP0 B;  4TMA B;  5MPO A;  1SSN A;  4P16 A;  3FIL B;  2CJO A;  3KLS X;  5FK9 C;  2W3S A;  3V3X A;  1XXG A;  2KMM A;  2WDV B;  4RGT A;  1KLU D;  1BML C;  4RGN A;  1I4X A;  1RWS A;  3AE3 B;  5D7G A;  2J53 A;  1DGJ A;  1XO3 A;  4YXD B;  1D5M C;  1L0X B;  2LHD A;  2LGI A;  2PVO D;  1D4B A;  1QF6 A;  2HTM E;  1AN8 A;  1F2R C;  4USA A;  1FFV A;  1GOZ A;  2KDM A;  1AYF A;  1CJE A;  1JWA D;  4M0W A;  3MHZ A;  1MHH E;  1ESF A;  5D3D A;  1TS2 A;  4OW0 A;  2K5P A;  1N5W A;  2WP9 B;  3W2D A;  3MFG A;  5BMG A;  2XN9 C;  1KLG D;  1DOI A;  4GLS C;  3ABV B;  1E7P B;  1FNV A;  3SR6 A;  4L23 A;  1QOA A;  3HVD A;  2LJI A;  1PUT A;  1Q10 A;  1SE4 A;  3I57 A;  2WDR B;  2R61 A;  4C7Y A;  3P4Q B;  1UUP A;  3Q8E A;  1XCQ L;  5I4D A;  3I9V 1;  4C56 C;  4NAM A;  2X38 A;  2I2Y A;  3GS2 A;  5G5G A;  1D5Z C;  2LHE A;  3HVZ A;  1PGB A;  4YSX B;  2WXR A;  1HZ6 A;  2XNA C;  3P42 A;  5LNK 1;  2LEK A;  3AEC B;  4FXC A;  3TUO A;  2EKI A;  2WXH A;  3T3N A;  1FNW A;  1L4Z B;  1RM6 C;  1A70 A;  1FFU A;  2L1A A;  1WYG A;  5AUK A;  2AQ2 B;  3T3O A;  1JW9 D;  3AE8 B;  3AEE B;  4Q2J A;  3AE2 B;  4C80 A;  3PZ8 A;  1WRI A;  2ZW0 A;  4UDU C;  3KWL A;  1NYQ A;  4A9A A;  2WXM A;  3AMZ A;  1EM7 A;  3B9J A;  2IJ0 A;  3LYY A;  1C9F A;  1ENF A;  1R7S A;  3FIL A;  1L5P A;  4A55 A;  4TQ1 A;  1DOX A;  5JXV A;  1I4P A;  4XDD A;  1I4G A;  1WSP A;  1VZ8 A;  2WDQ B;  2QIL A;  3VR9 B;  4NJC A;  4RNA A;  3EGR A;  1P7F A;  2J42 A;  2V3N A;  1C4A A;  1B1Z A;  3NVY A;  1UWX A;  1XLN A;  2Q5W D;  1BUI C;  4LTU A;  5D3I B;  4WUR A;  2INP E;  4CQN A;  5BMI A;  2PIA A;  2HDE A;  3AE7 B;  5E6J A;  2B76 B;  1B9R A;  1QOB A;  1NVI D;  2N9K A;  2G9H D;  2BB5 A;  2K0P A;  3GP7 A;  2MJE A;  2JYE A;  4KGT A;  2MJD A;  2W3R A;  3URY A;  3SEB A;  1TS3 A;  3VRB B;  4KKI A;  3MP9 A;  1MPE A;  4D2K A;  4ARC A;  3NRZ A;  1E6E B;  1SB3 C;  2N7J A;  3AH7 A;  1TJE A;  4RFB A;  4JPS A;  2E6X A;  1JWU D;  5GXG B;  4ZYS A;  1FXA A;  1XEE A;  1FM0 D;  1JAL A;  2BBC A;  4H2A A;  5C2T B;  1MI0 A;  4RGM A;  1K51 A;  2ACZ B;  1K52 A;  3Q8C A;  2PLP A;  2E3T A;  5FKA C;  3TEY A;  4OVZ A;  3LB8 C;  1EWC A;  1EWY C;  4KX6 B;  1Y56 A;  3FAH A;  2SEB D;  2WXN A;  2SAK A;  1ACC A;  1J7A A;  2GB1 A;  2PKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...