1MI0A

Crystal structure of the redesigned protein g variant nug2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
b'HHHAMDTYKLVIVLNGTTFTYTTEAVDAATAEKVFKQYANDNGVDGEWTYADATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin-binding protein G
publication title Crystal structures and increased stabilization of the protein G variants with switched folding pathways NuG1 and NuG2
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 12
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mi0A00
5BMHA 1MHXA 1YNTE 3UI3A 2LHDA 3FILB 2J53A 4KGSA 3V3XA 2K0PA 1PGAA 2QMTA 2KWDA 1JMLA 2ONQA 1XCQL 2LUMA 1C9FA 1FCLA 1K53A 2KDMA 1IGDA 2N9LA 3MP9A 2GI9A 2JWUA 2RPVA 1GB1A 4OZBA 1F2RC 4GLSC 1PGXA 4KGTA 4HKZE 2LGIA 2J52A 1QKZA 2JXTA 1D4BA 1PGBA 2ZW1A 2PTLA 1HZ5A 1YMHE 2NMQA 2OEDA 2N9KA 1MI0A 1XF5L 2ZW0A 5BMIA 1ZXHA 2IGHA 1GB4A 1HZ6A 1K50A 1IBXA 1XCTL 3GB1A 2EELA 2I2YA 2QSDA 2LHEA 1K51A 1F2RI 2RMMA 5HG2A 5HHDG 1IBXB 4WH4A 2KQ4X 4HJGE 2IGGA 2KN4A 1HEZE 1IGCA 1EM7A 4IOIE 4KGRA 4IKGA 1P7FA 1UWXA 4OZAA 2KACA 2JU6X 5HI1A 2PW9A 2N7JA 1MVKA 2ON8A 1MHHE 2PLPA 4D2KA 1FD6A 2IGDA 1FCCC 2I38A 1Q10A 1P7EA 5HFYA 1K52A 2GB1A 1MPEA 1KH0A 4OZCA 3FILA 5BMGA 2JSVX 4MACA 5JXVA 2JZPA
chains in the Genus database with same CATH superfamily
3NVVA 3H8HA 4GDLA 3AE1B 3V05A 2JRHA 2B76B 1E7VA 3RNAC 4KIKB 1JMLA 4TSSA 2ZCBA 1XCQL 1TKGA 1WR1A 4K3BA 1WXVA 1WX9A 3AI5A 2N9LA 2WXPA 3L16A 1GAQB 1KF6B 2GI9A 3ENEA 4G0NB 2LRUA 2MBEA 1TGZB 3PZ7A 3DBHI 2NR2A 2VZKB 5AZHA 4NQLB 4TMAB 5DPSA 2JX5A 2IO1B 4KVGB 4YSYB 4C4VA 1FIQA 4P1BC 1B1ZA 2RDGA 4H2AA 4HPPA 4IWOA 1T0RC 2HTHA 3N3KB 2YVCA 4F1SA 3RCZA 1XF5L 1DOIA 2BS2B 4WWOA 5DPRA 3A9KA 1ESFA 3VR8B 2WXHA 2WNMA 2BYTA 3W5VB 1FMAD 1HTOA 4WWMA 1P1AA 2RMMA 3UIPB 2DENB 1K8RB 2IGGA 2O6VA 3ZLZA 3AB5A 3Q3FA 2GRIA 1NYQA 4KSLC 3EGRA 2PW9A 4ARIA 1FFUA 3DBRB 1V1PB 4N6EB 4YTMB 4MSQB 3PTFC 2DZMA 4L1BA 1FRRA 4HEA1 2HD5B 3KYDD 2ZPYA 2V9HA 3NZUA 4MELA 1YN3A 1N62A 3C0RB 3M62B 3AH7A 3ZDTA 5KHOA 2MW5A 2KJHB 1WJ6A 2Y5BB 2JRIB 4XX5A 3AEDB 4LJOB 2N9XA 3PZDA 4ZYNA 3V62A 2KQ7A 1NYRA 4TV3A 3ZKJC 2UWQA 1E5WA 1VLBA 2C60A 3APCA 2JWUA 1WXAA 2WYQA 3ZJUA 2HE7A 4W9CA 4KSKC 1MG4A 2R2OA 2KX0A 3W9CB 3WCQA 2GLSA 4DXAB 1KTKA 3ZNID 1G6JA 1VZ8A 2D3GA 1V86A 4ANVA 2LI5A 5EE0A 4BZAA 5H8YE 4K1RB 3ZXVA 2KWCA 3O65B 1JWAD 5D2MB 3KQ4A 2W55A 2K3UA 1X1MA 2D2QA 3QX1A 1SJED 4K7WA 5J2RA 3SHQA 1JRUA 3DWMA 2CHXA 2LHEA 3A9JA 3RZWC 1FM0D 1JCKB 3V61A 2MQJA 3DHHC 4MJSB 5LXHA 3LYYA 4IOIE 1VZ7A 2KQSA 3RULA 4BKTA 1F1HA 1I4QA 4HK2A 2DWQA 2KACA 3SFDB 2V4IB 4C7ZA 3N30A 4A8XC 5C1ZA 1E8WA 1Q5WB 2ON8A 2I1JA 1WGDA 1S1QB 2RDBC 1Q1OA 5H92C 1STEA 1QOAA 4A6QA 5DPTA 1ISNA 1WX7A 1EU3A 5EE3A 1YQ3B 1E7PB 3VTWA 2K25A 3NZ3A 2W82A 1MPEA 2K22A 1YQBA 3PVLA 1R4NB 3SFEB 3EA6A 4PYZA 2KTFA 3L4PA 3P1MA 4AWJA 2N1WA 3VR9B 4WWNA 3AE2B 3FILB 3A1QA 3ZO5B 3TUOA 2N9EB 1PGAA 4UDUC 1KOTA 2KWDA 2KXJA 3VH3B 4S17A 1K53A 1SXTA 3W1SA 3RD2A 1I4GA 1QILA 1T5XD 1ZOYB 5CX3A 1SJHD 3V6CB 1Q0WB 1RFKA 1NI2A 3ZNHB 2D07B 1ACCA 1WGYA 5G5HA 2R2QA 3Q3NC 3Q8FA 4DXGA 4ICVA 2K1FA 3B2GA 4AOFA 1WXMA 4ARCA 4RFBA 1LQBA 3DHGC 5BO4B 1UGMA 2WX0A 3VDZA 5BMIA 1SF0A 4HDQA 5J18A 2H88B 4P1CC 5LXIB 1WGKA 3LB8C 2PE9A 2KDIA 1QOFA 1FEHA 1EUVB 1J8CA 3UGBB 2WXFA 1ZDXA 4NJ6A 1F0ZA 4HPLB 4QAYA 3Q3MC 3OJ4B 1ENFA 3WAOA 4AP4C 3SR6A 5FKAC 3SEBA 1HA5A 3M95A 1FRDA 4GXBA 1P3QU 1BXTA 2KD0A 2J4XA 1FXTB 4C00A 2KK8A 2GB1A 3CWIA 3GS2A 5D6JB 1XQQA 2Z0EB 3Q2AC 2KZRA 2E6XA 1VZ6A 4LDTB 1SEBD 3DVGX 1L6VA 4PS3A 1TKEA 1M94A 3MFGA 1LGRA 1YJIA 2YLMA 2WDVB 3NVWA 4PS7A 2KFKB 4OHJA 3U2SC 1NENB 3AEFB 1R4MB 2REXA 2MWSB 4KZCA 4HKQA 3WANA 3MP9A 2ZJDA 4GOCA 3ECIA 2KLGA 1JQ4A 4B0EA 4G11A 3TCAA 1PGXA 1SE3A 1ZW7A 2O2VB 4W9FA 2M8SA 4ZRIA 2C7NB 3LDZE 3IBEA 2CJOA 2JZZA 2K5PA 1GG3A 3IFWB 3WAMA 1TS4A 2L52A 2KTRA 1V97A 5GMVA 4A3OA 1L0VB 4F8CB 3H7PB 1MI0A 1H8CA 3GOEA 5C3JB 3NOBA 4JWUC 3ZNGC 4JGHB 2EMSA 2M56B 1HEZE 2ACZB 3KWVA 2CHZA 2IYDB 3EFUA 5IKCM 3APFA 3VUWA 2JU6X 5HI1A 3B1LX 1L2NA 3VHTC 3KUDB 2JXXA 2QIEB 1V8CA 2KVRA 5BYSA 2AL3A 1ZPSA 3SU8X 3BYYB 2UYZB 1ZE3D 1TZ1A 1KLVA 2JUOA 2D3AA 1C4CA 3BWUD 1TS5A 4M01A 2JYTA 1SE9A 2LGYA 4HLEA 1YNTE 4M0WB 4WAFA 2JY6A 2SEBD 4XWTA 4NPNA 3ZRFA 1RWSA 4M8NA 4GGQA 2KJ6A 5IP4D 2G9HD 4BKSA 3ABVB 2BF8B 2LMCA 2RPVA 5T8IA 3MC0B 3QQ8B 2AQ1B 1EU4A 1H4RA 3CSFA 2NCNA 5AZGA 3IVFA 4WAAA 3AEEB 2RGFA 3QK0A 1WI0A 1YX6B 2ZCCA 1C79A 3R7QA 2GBJA 2KMAA 2OEDA 3DWGC 2QHOA 3MJ5A 1ET6A 3Q3JA 2KYWA 3N1YC 1YN5A 3AV8A 2ZVNA 1C77A 1XCTL 3GB1A 2EELA 5E6NA 4CQNA 2QSDA 4C7YA 2XEWA 3DHIC 4LTUA 2K8CA 4II3B 3CF6E 5EE9A 1FXIA 3OLMD 2V0GA 3GZNB 2LXCA 3ZVVA 1E10A 2A4ZA 3BK1A 1UWXA 1B9RA 1J19A 2HJ1A 5AZFA 4TUUA 1C1YB 3VRAB 2PEAA 5KHQA 3EHVA 4PS8A 2Q5WD 3W2DA 3PSEB 1CK1A 3T3OA 3URYA 4YSXB 4GDKB 3AULA 2K39A 1MFWA 2N1VA 5LLIA 4HWIB 2CKHB 3ML8A 2R61A 3VUYA 3JSVB 4FA6A 1C9FA 3T8MA 4FLHA 4IWPA 2VZKD 2MP2A 3I5JC 1SIFA 3V3XA 4X57B 2OJRA 2W9NA 4N58A 1SBBB 1WGHA 1YD8U 2BWFA 3L54A 3AU4A 2KMCA 4IUMB 1FCLA 2YEPB 5C2TB 3BZDB 2WP9B 3FAHA 1BMLC 2KDEB 4MGKE 4BKSD 2JWZA 3AE3B 4A90A 2J0JA 3U7ZA 3P4RB 4KGTA 3RI7C 2LGIA 4P7IA 5G55A 1PGBA 2L7RA 3QWZB 2KDFB 4A3PA 1E8XA 4EEWA 4N59A 1C78A 1QOBA 1WJ4A 3PZ8A 2ZW0A 3JYUA 1KFYB 2IGHA 1GB4A 1HZ6A 4ANUA 2SAKA 2M4NA 2PVOD 4XWWA 3AE4B 5HKHA 4K81A 3ZYYX 3TMPB 1FNUA 2M17A 4WH4A 4HJGE 2XK5A 2LJ5A 2LZ6A 3R8BA 3J9CA 2DBYA 1IP9A 1AWDA 2V4LA 3M63B 1WF9A 1UBQA 1FFVA 3R66C 2FCMA 4YTNB 2DLBA 2AQ2B 4P6VF 2IGDA 1CJEA 4ZDVA 2E3TA 4HXDA 1XLQA 2I38A 4TKNA 3HVZA 2MH7A 2KWUB 1XLPA 3VTVA 2ZNVC 2BYVE 1WM3A 3NVZA 4XYCA 1GUAB 2JSVX 4KV2A 4RF1A 2WXGA 1XLNA 4XZ4A 1QQRA 3D32A 3FC4A 3EFCA 2NPTB 1MHXA 1GC7A 3B2FA 4PT5A 2Y5CA 4Q2JA 2BPSA 1I4HA 1WRIA 2LGXA 2LXAA 4JE3B 1FXAA 3NS8A 2AL6A 2KLCA 1RM6C 1JROA 2MA9B 2Y3AA 1F2RC 4GLSC 2X38A 3PRZA 2WGSA 4M02A 4OW0A 2AYOB 3AE9B 3ZJVA 4C80A 1AYFA 5AUKA 1BT0A 5JHBA 3SD5A 3AMZA 4WIPA 1WJNA 1LM8B 3A4SC 3DBHB 3ZXRA 4MGYE 2WQYB 3C8YA 4WJOA 3T9LA 4FBJB 1GOZA 4MT5A 4LNIA 1P9DU 4S0RA 3AE8B 2OJWA 2FCNA 1IBXB 2DX5B 2WDTB 2LASA 2N7EA 3NUHB 4B6WA 1P7FA 1JWBD 2MRPA 3VH4B 2MX2A 3EECA 1MHHE 4FN2A 4W9HA 1FD6A 3UF8A 5EDSA 1HXYD 2QILA 1TY0A 2L83A 3BVGA 2FCQA 3N1XC 4BFRA 2O2VA 1VD2A 1NEKB 1ET9A 2TSSA 1V80A 4USAA 1UWMA 4NAWB 1V5TA 3OJ3A 4GN1A 1GC6A 4GDLB 2G4DB 4ACFA 2KC1A 4MDKE 4BVUC 1IPGA 1FPYA 2C9WB 1TKYA 5LNK1 2KWVB 3IT4B 3RUIB 1PYWD 4DDID 5D3DA 1TBEA 2FBWB 3UQBA 2GBNA 4C4VB 2D10A 2LJIA 3L17A 1AARA 2PKOA 1F52A 3HVDA 1T0QC 3N20C 2KFJA 4MH0E 2I2YA 4CHKA 1FNWA 1K51A 1L0XB 1VR9A 3HRDD 3A9KB 4EUTA 1DOXA 4K7UA 5IAAC 4FULA 3RPFC 1Y8RC 4FJVB 4M0WA 5AUIA 1OFFA 5MPOA 2WXRA 1HTQA 3TL5A 2O6VB 4EOYA 2WHIA 4XC2A 3H6NA 2EKIA 2HJ8A 4LDTD 4D2KA 1E8YA 1ZKHA 2WXMA 4W9LA 3APDA 3PS6A 3X23A 2GMIC 1XXGA 2M0XA 4FHKA 3RN9C 1VJKA 1GPXA 1N60A 2GBKA 5AEKB 5D7GA 1N61A 4RCOA 2ZZPB 1GNUA 3WA0A 3H1UA 2LGDA 2J53A 3N32A 3B08A 3NG0A 4BOSC 4JQWC 1WMHA 4P16A 1TTNA 4I6PA 1IGDA 2WXOA 2PMVA 5GXGB 2ZPNA 4ZOHC 1QOGA 4C56C 1D5XC 2NBUA 2MBQA 3DVNU 3IAM1 3DOWA 4GMVA 1SE4A 2VH1A 4RH6A 1P0RA 4HVBA 2J52A 2DZJA 1WX8A 1YX5B 5D94A 4YT0B 4IDIA 2BWES 1QLBB 2LEKA 4W9KA 3WALA 3C19A 4EZJA 4RM9A 3GP7A 1PFDA 4AUQC 3RYTA 1J7AA 1OGWA 3TEXA 1SB3C 4IM3A 2K6QA 4GDKA 2G3QB 2OHFA 3KYCD 4EKUA 4LNFA 2WXLA 3R2IA 4GSWA 3ZGZA 4URKA 2L0TA 4EZKA 4DDGD 5HG2A 2L1AA 2BB5A 3P4PB 1WWTA 2NBVB 3SDLC 1WYWB 2IBIB 2V3PA 4B9KA 3ZJTA 1IGCA 3A9JB 4KGRA 1I4PA 2NTTA 3CMMB 1OQQA 1V81A 1C4AA 3HK0A 2JVCA 1WFYA 2VH2A 4LNKA 4YWGG 2MJEA 2KKCA 2D3BA 2PLPA 4XDDA 2CR5A 3DVNV 3BK2A 3BVMA 2BBCA 2ICIA 2KN5A 3PREA 5JZEB 1K52A 2QEJC 1E6EB 5CHVC 4MM3B 2V3NA 1WXQA 4US9A 1KJTA 4KIKA 4EE2A 3UQAA 4NZLB 4K3CA 1N63A 1I4RA 1WR6E 2LVOA 1WZ3A 2FUHB 2WLBA 3A1QB 4FXCA 2XBBC 3IT6B 2AX5A 2FE8A 2QJLA 2K8BA 5JHAA 4RGOS 2Z59B 1L5PA 2NTSA 4HJKA 5TSSA 3KUZA 4IWQA 1IYFA 2KO3A 3DBLI 4BBNF 5IA7A 1NDDA 3PPAA 1QKZA 3Q8BA 4A20A 3KUCB 3BY4B 2PTLA 4IC7B 2FCSA 1WZ0A 5E6OA 3ETRA 2DYBA 2L32A 5J17A 4I6LB 4DHZB 4WWPA 4K7SA 1D6EC 1T0SC 4II2B 1WGGA 1EWCA 1JWSD 2KX3A 5HHDG 2KNBA 2BGFA 3RNBC 1WE6A 2INCC 2WWZA 5JH5C 1XT9B 1V1PA 1JWMD 1V49A 2N0SB 4WQMA 3P4QB 1SIJA 3TBLD 4BAXA 2BB6A 1WH3A 2BKRB 2EMTA 1WJUA 2D3CA 3TJPA 1WXSA 1FCCC 1BUIC 4M00A 2FAZA 3KWLA 4BOZB 1ZP0B 1J0GA 4E74A 3NVYA 5BMGA 1MG8A 2KT7A 3ONSA 4BBNC 2RR9A 4MACA 5JXVA 1F77A 2D11A 5BMHA 1YQ4B 4REZA 4W9EA 3U8ZA 1OQRA 3NHEB 4A55A 4JL9A 1A70A 1ROEA 4NJCA 2K0PA 4JPSA 2CU3A 1XO3A 2LUMA 4KX6B 5IO9A 2WXQA 2KDMA 2KJRA 1KM7A 1CZPA 5FR6A 2XN9C 3DBLB 1WSPA 3T3NA 1ZGUB 1C76A 4DXFA 2M0AA 4ASWC 2FIDA 2J7QB 1V9JA 2JXTA 3RFZB 5C23A 3CSTA 2L00B 3HM6X 2KMMA 4RMAA 3JVZX 3TEZA 2NMQA 3AEAB 4DHJB 2WXIA 3P42A 3QJZA 2WDQB 2RSUA 4RNAA 3UINB 4W9DA 3DBSA 2M19A 4WJPA 4MJSA 2KTRB 2BS3B 4KDLB 4IM2A 3DBRI 2IDYA 3QCAA 1V5OA 1N5WA 1L4DB 2KN4A 2L3ZA 2MJ3A 2BQQA 1EM7A 4G50A 2JF5A 3DDCB 3N1ZC 3U4EG 3ZDMC 3MJWA 4OZAA 3BINA 3QC8B 4HCNB 4NAWA 1RLFA 1D3ZA 1WM2A 4JX1C 2N7DA 2KDBA 1RAXA 4DWFA 2J0KA 4B0MA 2JZ3B 2K6DB 1EF1A 1Q10A 3MC8A 2H89B 4BKGA 1P7EA 3ZIMA 4E3CA 5TR5A 2GOWA 4HROA 5EE1A 2ZNVB 3W5UB 4LNOA 3FILA 3KW5B 2V3SA 3FKYA 3L0WB 3RZFA 3TSSA 3UI3A 1PQSA 3B0AA 4ZRPA 2FNJB 2WXKA 4TQ0A 4KKIA 2INNE 4CYEA 2KHWB 3I3TB 2KANA 4ANWA 2V1YA 3PHXB 5DCNA 5G5GA 1UGJA 3AEBB 4OZBA 2IO3B 2CHWA 2BT6A 2PPHA 3IG3A 1J7CA 3AM9A 2X8XX 3AE7B 4US8A 2Y5PA 1C3TA 4B95A 1D5MC 1YOVB 2J42A 1A5RA 4KZ0A 3Q8EA 4A9AA 1PDXA 4XE0A 2K8HA 2CU1A 3ML9A 4ITKA 4MGIE 4OVUA 1L6UA 2AWTA 1Z5SB 2MBBB 3I57A 4ZRQA 2ZVOA 5BYRA 1VDVA 1JRPA 2XNAC 2L76A 5IN7A 3DCGA 2QC8A 1R4NI 2HTME 4I6NB 3IXSA 1NVID 4ZRKA 4OVZA 1E90A 2WX1A 2DAFA 2MEKA 4N9F4 1KH0A 4OZCA 4DK5A 1KLGD 4LNNA 1UELA 3A4RA 3U52E 2C7HA 5G2NA 4FHJA 2FUG1 2KFKA 5L95C 2WU2B 3AE6B 4JLCA 1S3SG 3VFKA 1RRBA 3WAPA 2DZIA 1WYGA 2MP2B 3P4SB 1P98A 2WXNA 2KAJA 3EUB2 3TIXA 1GB1A 2VRRB 4FJYA 3TEWA 4IG7B 1E7UA 2BW2A 3ZTCA 1I7HA 3QA8A 1LO5D 4RGTA 2I1KA 2MHJA 3H7PA 3MHZA 3NRZA 1D4BA 2K9XA 1V6EA 1L7YA 1JW9D 3RNFC 2Z0DB 1AW7A 5E6PA 4YSZB 3QARA 1YJ1A 3AECB 2O6VD 5E6JA 1U4AA 2UU7A 1UD7A 2RPQA 4W9IA 4MM3A 1UNSA 1XEEA 2G4SA 1E0ZA 4R3DA 3N9YC 1TYGB 1J7BA 2A5UA 3AN1A 3JW0X 2DHZA 2RD0A 3IHPC 4IM0A 3I63C 2XK5B 3PHWB 2BYFA 4LJPB 2DZKA 3MTNB 4DBGA 3PGEA 2DNFA 2NVUI 4HPMB 4GU2A 4NQKE 3VUXA 2RDHA 3DQVA 3VTUA 3U7DA 2PVGC 1VRAB 2N9PC 1SE2A 3E9SA 5HFYA 1LFDA 3RNGC 1R4MI 2IO0B 3P63A 3Q69A 2FIFA 1WY8A 4HDOA 3VVWB 1WRDB 2LVPA 2DYMA 1OEYJ 2JZPA 3U30A 4DQOC 4KGSA 2IO2B 3PV1A 3ZTDA 2ASQA 2QMTA 1UH6A 3UIOB 1TY2A 2GBMA 3R7RA 3WIMA 1T3QA 2KVZA 3RMKC 4NY0A 3PLUA 2W54A 2B3AA 2BTEA 2DAJA 3AU5A 4IW0A 3HUIA 1CMXB 2DYOA 2EKEC 1QF6A 3PRMB 2CS4A 3K9OB 1LXDA 2G45B 1EWYC 4ZYSA 2PIAA 2JQRB 1ZXHA 1D5ZC 4PYUA 4O1NA 3ZQ4A 4MSMB 4YXDB 1WGRA 3P2BA 3AXCA 3B9JA 4E71A 3BYTB 3OAWA 2IZVB 3VQIA 1KLUD 4LK0M 1T0YA 1DGJA 5BYQA 1YJJA 2IPKD 4IKGA 2L0FA 1WE7A 3BIID 4GIVA 4L2YA 2BKFA 2GBRA 3RT3B 3V60A 4M8MA 2MJDA 3M3JA 2N7JA 3W1YA 4FADA 2L8JA 3I9V1 3L13A 3GE3C 3VAWA 3PO0A 4MGZE 2MCNB 1JALA 4DHZE 1IUEA 3JSVA 1XD3B 4CO7A 1HQRD 2AQ3B 3HIZA 5FK9C 2IY1B 4WJNA 2BYEA 3RNEC 1HE8A 1I4XA 4WURA 2MLBA 5I4DA 2BVCA 2HDEA 2JYEA 2MSED 3HM3A 4YTPB 4RF0A 4W9GA 1YN4A 3R3MA 3O13A 3MHSD 3LJ3A 1Y56A 4AQ7A 2ONQA 3VXWA 1WIAA 4XGAB 1KRHA 5D3IB 2L05A 2QCZA 3TEYA 1UUPA 4MEMA 1FO4A 1TS3A 1MJDA 3KLSX 1N6ZA 1NBFC 1SSNA 2ZEQA 3ALBA 3Q3OC 2LFIA 4J6IA 3L10B 3E56A 1SGHA 1OQYA 4LLGM 2QDFA 3IAS1 1V1OA 1QT9A 2INPE 3GZNI 1QZEA 2OOBB 1AN8A 3Q6BA 3S2AA 2WU5B 4JIOU 1E8ZA 1UBIA 4AS1A 3OG5A 1V2YA 4JWSC 1UZXB 1EF5A 3K9PB 2MBOA 4ICUA 3DVGY 1T6BX 2KQ4X 1TIFA 3Q8CA 4NJ7A 4WJQA 2WDRB 4ZHOA 3LXFA 3QIJA 4OVVA 4WQOB 4FJZA 2PE6B 1XLOA 3RNCC 4RGMA 2LD9A 1MVKA 2LRWA 2KC2A 4RGNA 2W3SA 2NBWB 3NY5A 2IY0B 3ZNZB 4W9JA 3PRPB 3H7SA 1NI3A 3PLVA 5FR3A 3AEGB 2NPTA 4EZLA 3V6EB 5IOIA 3W1SC 1R7SA 1EO6A 3L08A 4HCPB 2IJ0A 2LHDA 4F7ZA 1TT5B 3CIRB 2WXJA 4KKJA 2AEHA 4EFOA 3X0WA 3KVFB 3MC9A 2LUEA 3EC8A 4NAMA 2PJHA 3H9DA 2WS3B 3QAQA 4DHJD 4ZRJA 1WMHB 2INDC 1TZOA 3NJTA 3OWEB 4ZHPA 1VCBA 1TS2A 1M4VA 3AE5B 2MBHA 2N4FA 2D5GA 2LGSA 4LCDE 2G1EA 4HKZE 1RFAA 4J3OD 3ZUNA 1ZXIA 2ZW1A 2J0MA 1HZ5A 5CHWA 1CQVA 4YL8A 5CTRC 5CHFA 5L83A 1YMHE 1L0YB 2N9KA 5DPWA 2BS4B 3Q14C 3Q8AA 2JPHA 1FNVA 3BVZA 1K50A 3QHTA 1IBXA 4HRSA 2YEPF 1E9MA 1DOYA 3HHMA 1PUTA 2LVQA 1I42A 4ANXA 3R2TA 1F2RI 1Z2MA 3ZW3A 3GE8C 1JWUD 1ZDVA 3PT2B 1I35A 2JT4B 4L23A 4GB9A 2CJNA 4XDCA 4G3XB 3VRBB 3KH0A 1OEYA 1YIWA 2KOXA 4NNJB 3NZSA 1DYQA 1RYJA 2Z8LA 4PK1A 1OTRB 2C5LC 4MH8A 1F9JA 3NS1A 2M1MA 2LWPA 4KDIC 2W3RA 3A33B 3ZRCA 2NS5A 1UF0A 1L4ZB 4AJWA 1GJZA 1TJEA 1C4PA 4TQ1A 1N5XA 3DPDA 1ZUD2 4AJYB 2C7MB 4RM8A
chains in the Genus database with same CATH topology
1N61A 4RCOA 2WU2B 3AE6B 1YNTE 3NVVA 3H8HA 4WAFA 2SEBD 2J53A 4XWTA 3AE1B 3V05A 1RWSA 2B76B 1WYGA 1JMLA 4TSSA 2G9HD 1XCQL 1TKGA 4P16A 3P4SB 2WXNA 1IGDA 2N9LA 2WXOA 2PMVA 2WXPA 3ABVB 2KAJA 1GAQB 1KF6B 2GI9A 5GXGB 2LMCA 2RPVA 3EUB2 4ZOHC 5T8IA 1QOGA 4C56C 1D5XC 3MC0B 1GB1A 2AQ1B 3PZ7A 1EU4A 3IAM1 2VZKB 3TEWA 4TMAB 1SE4A 2BW2A 1I7HA 2JX5A 4RH6A 4YSYB 1LO5D 4RGTA 2J52A 3MHZA 1FIQA 3NRZA 1B1ZA 2RDGA 4YT0B 2K9XA 3AEEB 1D4BA 4H2AA 1JW9D 1AW7A 4IDIA 1QLBB 2LEKA 4YSZB 1C79A 2OEDA 3DWGC 3GP7A 1PFDA 1XF5L 3MJ5A 3AECB 1DOIA 2BS2B 1J7AA 5E6JA 1ET6A 1YN5A 1ESFA 1SB3C 3AV8A 3TEXA 3VR8B 2WXHA 2WNMA 1C77A 1XCTL 2OHFA 2BYTA 3GB1A 2EELA 4CQNA 3W5VB 2WXLA 3R2IA 3ZGZA 1FMAD 2QSDA 4WWMA 4C7YA 4LTUA 2RMMA 2L1AA 5HG2A 2BB5A 1UNSA 1FXIA 1WWTA 3P4PB 5EE9A 1XEEA 2IGGA 2V0GA 1E0ZA 3AB5A 2V3PA 3N9YC 1TYGB 1J7BA 1IGCA 4R3DA 3ZJTA 2GRIA 3AN1A 4KGRA 1I4PA 1NYQA 1E10A 2NTTA 3BK1A 1UWXA 1OQQA 1B9RA 1C4AA 3EGRA 2PW9A 4ARIA 1FFUA 1V1PB 4YWGG 4N6EB 4YTMB 2MJEA 3VRAB 4L1BA 2PLPA 1FRRA 2RDHA 4HEA1 4XDDA 2Q5WD 3W2DA 2PVGC 3BK2A 3BVMA 2BBCA 1VRAB 2ICIA 1CK1A 1YN3A 1N62A 3URYA 3T3OA 4YSXB 1SE2A 3E9SA 4GDKB 5HFYA 1K52A 2QEJC 3AH7A 1E6EB 3P63A 4MM3B 2V3NA 2R61A 3Q69A 3AEDB 1WXQA 2DYMA 4US9A 2JZPA 1C9FA 4DQOC 4EE2A 2VZKD 4NZLB 4KGSA 3V3XA 1N63A 1I4RA 1NYRA 1SBBB 4N58A 2QMTA 1TY2A 2WLBA 1T3QA 4FXCA 1FCLA 1VLBA 2YEPB 5C2TB 2JWUA 3BZDB 2WP9B 5H92C 3FAHA 1BMLC 2W54A 3IT6B 3ZJUA 2AX5A 2FE8A 2QJLA 2BTEA 4RGOS 1L5PA 2NTSA 5TSSA 3W9CB 3AE3B 3HUIA 3WCQA 4A90A 1KTKA 2DYOA 3U7ZA 3P4RB 4KGTA 1VZ8A 1QF6A 2LGIA 1QKZA 3Q8BA 1PGBA 2PTLA 5EE0A 5H8YE 4N59A 1C78A 3ETRA 1QOBA 2L32A 1EWYC 1JWAD 3PZ8A 2ZW0A 4ZYSA 2PIAA 2JQRB 1KFYB 1D6EC 1ZXHA 1D5ZC 2IGHA 2W55A 3KQ4A 4O1NA 1HZ6A 1GB4A 3ZQ4A 2K3UA 2SAKA 4YXDB 2PVOD 1SJED 4XWWA 3AE4B 1EWCA 3B9JA 3DWMA 2LHEA 3BYTB 1JWSD 3ZYYX 1FM0D 1FNUA 5HHDG 3VQIA 4WH4A 1KLUD 1JCKB 4LK0M 4HJGE 1DGJA 3LYYA 5BYQA 4IOIE 1V1PA 1JWMD 1YJJA 2N0SB 2IPKD 4WQMA 4IKGA 3R8BA 1VZ7A 3P4QB 3BIID 1SIJA 1I4QA 4L2YA 2DWQA 2DBYA 3J9CA 2KACA 2MJDA 2V4IB 3SFDB 2BB6A 4C7ZA 4A8XC 1AWDA 2N7JA 2ON8A 3I9V1 1FFVA 3PO0A 1JALA 4YTNB 1IUEA 2DLBA 2AQ2B 4P6VF 2IGDA 1CJEA 1BUIC 1FCCC 1QOAA 1STEA 2E3TA 1XLQA 2I38A 4A6QA 3KWLA 1EU3A 3HVZA 5EE3A 1YQ3B 1E7PB 1ZP0B 2MH7A 1HQRD 2AQ3B 3NZ3A 2W82A 1XLPA 1MPEA 3NVZA 2K22A 3NVYA 5FK9C 5BMGA 2JSVX 3SFEB 3EA6A 3P1MA 1I4XA 3L4PA 4WURA 4MACA 5JXVA 4RF1A 2WXGA 3VR9B 1XLNA 1F77A 5I4DA 5BMHA 1YQ4B 1QQRA 3AE2B 3FC4A 4REZA 2HDEA 2JYEA 1MHXA 4PT5A 3B2FA 4Q2JA 2Y5CA 1OQRA 4YTPB 3FILB 4A55A 4RF0A 1A70A 1I4HA 1ROEA 4NJCA 2K0PA 3TUOA 1YN4A 4JPSA 3O13A 1PGAA 4UDUC 1Y56A 2KWDA 1WRIA 2CU3A 4AQ7A 2ONQA 1XO3A 4JE3B 1FXAA 2LUMA 4KX6B 1K53A 1SXTA 2KDMA 2WXQA 3W1SA 1RM6C 1I4GA 1KRHA 1QILA 1T5XD 5D3IB 1JROA 1CZPA 3TEYA 1UUPA 1FO4A 1ZOYB 1TS3A 2XN9C 2Y3AA 1WSPA 1SJHD 3T3NA 1F2RC 4GLSC 2X38A 3KLSX 1C76A 1RFKA 4DXFA 4OW0A 3AE9B 3ZJVA 4C80A 1ACCA 1SSNA 2M0AA 1AYFA 5AUKA 5G5HA 2LFIA 2JXTA 3Q8FA 3E56A 3RFZB 4DXGA 4LLGM 3IAS1 3B2GA 2KMMA 1V1OA 1QT9A 2INPE 3AMZA 4WIPA 3TEZA 2NMQA 4ARCA 4RFBA 3AEAB 1AN8A 2WXIA 3P42A 1SF0A 5BMIA 2WDQB 2WU5B 2WQYB 4RNAA 3C8YA 2H88B 1GOZA 2M19A 1WGKA 4MT5A 4AS1A 2BS3B 3LB8C 4JWSC 2IDYA 3AE8B 1QOFA 1FEHA 1IBXB 2WXFA 1T6BX 2KQ4X 1N5WA 1L4DB 2KN4A 1ZDXA 3Q8CA 2MJ3A 1EM7A 2WDRB 1F0ZA 4ZHOA 3NUHB 3LXFA 3U4EG 1P7FA 1JWBD 4OZAA 1ENFA 1XLOA 4RGMA 1MVKA 4JX1C 3SR6A 5FKAC 1MHHE 4RGNA 2W3SA 4B0MA 1FD6A 1HXYD 2QILA 1HA5A 3SEBA 1FRDA 1Q10A 1BXTA 2H89B 1P7EA 1TY0A 2L83A 2J4XA 3BVGA 1NI3A 4HROA 5FR3A 3AEGB 2GB1A 3CWIA 5EE1A 3W5UB 1NEKB 3GS2A 3FILA 1R7SA 1ET9A 2TSSA 3TSSA 3UI3A 2E6XA 1VZ6A 2IJ0A 2LHDA 1SEBD 4ZRPA 1L6VA 2WXKA 1TKEA 3MFGA 1YJIA 3NVWA 2WDVB 1UWMA 2WXJA 3CIRB 4KKIA 4USAA 4TQ0A 2INNE 3U2SC 4KKJA 4OHJA 1NENB 4NAWB 3AEFB 4GDLB 4HKQA 3MP9A 4NAMA 2WS3B 1JQ4A 4B0EA 5G5GA 1UGJA 1TZOA 3AEBB 3OWEB 4OZBA 4ZHPA 1TS2A 1M4VA 1PGXA 3AE5B 1SE3A 2BT6A 2D5GA 1TKYA 2G1EA 4HKZE 4J3OD 1J7CA 5LNK1 1ZXIA 3AM9A 3IT4B 2CJOA 3AE7B 2ZW1A 1PYWD 2K5PA 1HZ5A 4US8A 2Y5PA 5D3DA 1CQVA 1D5MC 1TS4A 2FBWB 2L52A 1V97A 1YMHE 2LJIA 1L0YB 1L0VB 2N9KA 1MI0A 2BS4B 3Q8AA 2J42A 1FNVA 2PKOA 3BVZA 1K50A 3Q8EA 1IBXA 3HVDA 5C3JB 4HRSA 2YEPF 4A9AA 1E9MA 1DOYA 1PDXA 4JWUC 1PUTA 4XE0A 2I2YA 1FNWA 1K51A 1L0XB 1VR9A 1F2RI 3HRDD 3R2TA 4ITKA 1L6UA 1JWUD 3I57A 4ZRQA 1ZDVA 2M56B 4L23A 1HEZE 1DOXA 2ACZB 2CJNA 3KWVA 4XDCA 5BYRA 1VDVA 3RPFC 3VRBB 4M0WA 1JRPA 5AUIA 1OFFA 5MPOA 2XNAC 2WXRA 2JU6X 5HI1A 1DYQA 1RYJA 2Z8LA 2QIEB 1V8CA 2HTME 3IXSA 4MH8A 5BYSA 2EKIA 3NS1A 1NVID 4D2KA 1ZPSA 2W3RA 4OVZA 2WXMA 3BYYB 1ZE3D 2MEKA 1XXGA 1L4ZB 1C4CA 3BWUD 1KH0A 1TS5A 2JYTA 4OZCA 1TJEA 1C4PA 4TQ1A 1N5XA 1KLGD 1VJKA 1ZUD2 3U52E 1GPXA 1N60A 5D7GA 2FUG1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMH A;  1MHX A;  1YNT E;  3UI3 A;  2LHD A;  3FIL B;  2J53 A;  4KGS A;  3V3X A;  2K0P A;  1PGA A;  2QMT A;  2KWD A;  1JML A;  2ONQ A;  1XCQ L;  2LUM A;  1C9F A;  1FCL A;  1K53 A;  2KDM A;  1IGD A;  2N9L A;  3MP9 A;  2GI9 A;  2JWU A;  2RPV A;  1GB1 A;  4OZB A;  1F2R C;  4GLS C;  1PGX A;  4KGT A;  4HKZ E;  2LGI A;  2J52 A;  1QKZ A;  2JXT A;  1D4B A;  1PGB A;  2ZW1 A;  2PTL A;  1HZ5 A;  1YMH E;  2NMQ A;  2OED A;  2N9K A;  1MI0 A;  1XF5 L;  2ZW0 A;  5BMI A;  1ZXH A;  2IGH A;  1GB4 A;  1HZ6 A;  1K50 A;  1IBX A;  1XCT L;  3GB1 A;  2EEL A;  2I2Y A;  2QSD A;  2LHE A;  1K51 A;  1F2R I;  2RMM A;  5HG2 A;  5HHD G;  1IBX B;  4WH4 A;  2KQ4 X;  4HJG E;  2IGG A;  2KN4 A;  1HEZ E;  1IGC A;  1EM7 A;  4IOI E;  4KGR A;  4IKG A;  1P7F A;  1UWX A;  4OZA A;  2KAC A;  2JU6 X;  5HI1 A;  2PW9 A;  2N7J A;  1MVK A;  2ON8 A;  1MHH E;  2PLP A;  4D2K A;  1FD6 A;  2IGD A;  1FCC C;  2I38 A;  1Q10 A;  1P7E A;  5HFY A;  1K52 A;  2GB1 A;  1MPE A;  1KH0 A;  4OZC A;  3FIL A;  5BMG A;  2JSV X;  4MAC A;  5JXV A;  2JZP A; 
#chains in the Genus database with same CATH topology
 3NVV A;  3H8H A;  4GDL A;  3AE1 B;  3V05 A;  2JRH A;  2B76 B;  1E7V A;  3RNA C;  4KIK B;  1JML A;  4TSS A;  2ZCB A;  1XCQ L;  1TKG A;  1WR1 A;  4K3B A;  1WXV A;  1WX9 A;  3AI5 A;  2N9L A;  2WXP A;  3L16 A;  1GAQ B;  1KF6 B;  2GI9 A;  3ENE A;  4G0N B;  2LRU A;  2MBE A;  1TGZ B;  3PZ7 A;  3DBH I;  2NR2 A;  2VZK B;  5AZH A;  4NQL B;  4TMA B;  5DPS A;  2JX5 A;  2IO1 B;  4KVG B;  4YSY B;  4C4V A;  1FIQ A;  4P1B C;  1B1Z A;  2RDG A;  4H2A A;  4HPP A;  4IWO A;  1T0R C;  2HTH A;  3N3K B;  2YVC A;  4F1S A;  3RCZ A;  1XF5 L;  1DOI A;  2BS2 B;  4WWO A;  5DPR A;  3A9K A;  1ESF A;  3VR8 B;  2WXH A;  2WNM A;  2BYT A;  3W5V B;  1FMA D;  1HTO A;  4WWM A;  1P1A A;  2RMM A;  3UIP B;  2DEN B;  1K8R B;  2IGG A;  2O6V A;  3ZLZ A;  3AB5 A;  3Q3F A;  2GRI A;  1NYQ A;  4KSL C;  3EGR A;  2PW9 A;  4ARI A;  1FFU A;  3DBR B;  1V1P B;  4N6E B;  4YTM B;  4MSQ B;  3PTF C;  2DZM A;  4L1B A;  1FRR A;  4HEA 1;  2HD5 B;  3KYD D;  2ZPY A;  2V9H A;  3NZU A;  4MEL A;  1YN3 A;  1N62 A;  3C0R B;  3M62 B;  3AH7 A;  3ZDT A;  5KHO A;  2MW5 A;  2KJH B;  1WJ6 A;  2Y5B B;  2JRI B;  4XX5 A;  3AED B;  4LJO B;  2N9X A;  3PZD A;  4ZYN A;  3V62 A;  2KQ7 A;  1NYR A;  4TV3 A;  3ZKJ C;  2UWQ A;  1E5W A;  1VLB A;  2C60 A;  3APC A;  2JWU A;  1WXA A;  2WYQ A;  3ZJU A;  2HE7 A;  4W9C A;  4KSK C;  1MG4 A;  2R2O A;  2KX0 A;  3W9C B;  3WCQ A;  2GLS A;  4DXA B;  1KTK A;  3ZNI D;  1G6J A;  1VZ8 A;  2D3G A;  1V86 A;  4ANV A;  2LI5 A;  5EE0 A;  4BZA A;  5H8Y E;  4K1R B;  3ZXV A;  2KWC A;  3O65 B;  1JWA D;  5D2M B;  3KQ4 A;  2W55 A;  2K3U A;  1X1M A;  2D2Q A;  3QX1 A;  1SJE D;  4K7W A;  5J2R A;  3SHQ A;  1JRU A;  3DWM A;  2CHX A;  2LHE A;  3A9J A;  3RZW C;  1FM0 D;  1JCK B;  3V61 A;  2MQJ A;  3DHH C;  4MJS B;  5LXH A;  3LYY A;  4IOI E;  1VZ7 A;  2KQS A;  3RUL A;  4BKT A;  1F1H A;  1I4Q A;  4HK2 A;  2DWQ A;  2KAC A;  3SFD B;  2V4I B;  4C7Z A;  3N30 A;  4A8X C;  5C1Z A;  1E8W A;  1Q5W B;  2ON8 A;  2I1J A;  1WGD A;  1S1Q B;  2RDB C;  1Q1O A;  5H92 C;  1STE A;  1QOA A;  4A6Q A;  5DPT A;  1ISN A;  1WX7 A;  1EU3 A;  5EE3 A;  1YQ3 B;  1E7P B;  3VTW A;  2K25 A;  3NZ3 A;  2W82 A;  1MPE A;  2K22 A;  1YQB A;  3PVL A;  1R4N B;  3SFE B;  3EA6 A;  4PYZ A;  2KTF A;  3L4P A;  3P1M A;  4AWJ A;  2N1W A;  3VR9 B;  4WWN A;  3AE2 B;  3FIL B;  3A1Q A;  3ZO5 B;  3TUO A;  2N9E B;  1PGA A;  4UDU C;  1KOT A;  2KWD A;  2KXJ A;  3VH3 B;  4S17 A;  1K53 A;  1SXT A;  3W1S A;  3RD2 A;  1I4G A;  1QIL A;  1T5X D;  1ZOY B;  5CX3 A;  1SJH D;  3V6C B;  1Q0W B;  1RFK A;  1NI2 A;  3ZNH B;  2D07 B;  1ACC A;  1WGY A;  5G5H A;  2R2Q A;  3Q3N C;  3Q8F A;  4DXG A;  4ICV A;  2K1F A;  3B2G A;  4AOF A;  1WXM A;  4ARC A;  4RFB A;  1LQB A;  3DHG C;  5BO4 B;  1UGM A;  2WX0 A;  3VDZ A;  5BMI A;  1SF0 A;  4HDQ A;  5J18 A;  2H88 B;  4P1C C;  5LXI B;  1WGK A;  3LB8 C;  2PE9 A;  2KDI A;  1QOF A;  1FEH A;  1EUV B;  1J8C A;  3UGB B;  2WXF A;  1ZDX A;  4NJ6 A;  1F0Z A;  4HPL B;  4QAY A;  3Q3M C;  3OJ4 B;  1ENF A;  3WAO A;  4AP4 C;  3SR6 A;  5FKA C;  3SEB A;  1HA5 A;  3M95 A;  1FRD A;  4GXB A;  1P3Q U;  1BXT A;  2KD0 A;  2J4X A;  1FXT B;  4C00 A;  2KK8 A;  2GB1 A;  3CWI A;  3GS2 A;  5D6J B;  1XQQ A;  2Z0E B;  3Q2A C;  2KZR A;  2E6X A;  1VZ6 A;  4LDT B;  1SEB D;  3DVG X;  1L6V A;  4PS3 A;  1TKE A;  1M94 A;  3MFG A;  1LGR A;  1YJI A;  2YLM A;  2WDV B;  3NVW A;  4PS7 A;  2KFK B;  4OHJ A;  3U2S C;  1NEN B;  3AEF B;  1R4M B;  2REX A;  2MWS B;  4KZC A;  4HKQ A;  3WAN A;  3MP9 A;  2ZJD A;  4GOC A;  3ECI A;  2KLG A;  1JQ4 A;  4B0E A;  4G11 A;  3TCA A;  1PGX A;  1SE3 A;  1ZW7 A;  2O2V B;  4W9F A;  2M8S A;  4ZRI A;  2C7N B;  3LDZ E;  3IBE A;  2CJO A;  2JZZ A;  2K5P A;  1GG3 A;  3IFW B;  3WAM A;  1TS4 A;  2L52 A;  2KTR A;  1V97 A;  5GMV A;  4A3O A;  1L0V B;  4F8C B;  3H7P B;  1MI0 A;  1H8C A;  3GOE A;  5C3J B;  3NOB A;  4JWU C;  3ZNG C;  4JGH B;  2EMS A;  2M56 B;  1HEZ E;  2ACZ B;  3KWV A;  2CHZ A;  2IYD B;  3EFU A;  5IKC M;  3APF A;  3VUW A;  2JU6 X;  5HI1 A;  3B1L X;  1L2N A;  3VHT C;  3KUD B;  2JXX A;  2QIE B;  1V8C A;  2KVR A;  5BYS A;  2AL3 A;  1ZPS A;  3SU8 X;  3BYY B;  2UYZ B;  1ZE3 D;  1TZ1 A;  1KLV A;  2JUO A;  2D3A A;  1C4C A;  3BWU D;  1TS5 A;  4M01 A;  2JYT A;  1SE9 A;  2LGY A;  4HLE A;  1YNT E;  4M0W B;  4WAF A;  2JY6 A;  2SEB D;  4XWT A;  4NPN A;  3ZRF A;  1RWS A;  4M8N A;  4GGQ A;  2KJ6 A;  5IP4 D;  2G9H D;  4BKS A;  3ABV B;  2BF8 B;  2LMC A;  2RPV A;  5T8I A;  3MC0 B;  3QQ8 B;  2AQ1 B;  1EU4 A;  1H4R A;  3CSF A;  2NCN A;  5AZG A;  3IVF A;  4WAA A;  3AEE B;  2RGF A;  3QK0 A;  1WI0 A;  1YX6 B;  2ZCC A;  1C79 A;  3R7Q A;  2GBJ A;  2KMA A;  2OED A;  3DWG C;  2QHO A;  3MJ5 A;  1ET6 A;  3Q3J A;  2KYW A;  3N1Y C;  1YN5 A;  3AV8 A;  2ZVN A;  1C77 A;  1XCT L;  3GB1 A;  2EEL A;  5E6N A;  4CQN A;  2QSD A;  4C7Y A;  2XEW A;  3DHI C;  4LTU A;  2K8C A;  4II3 B;  3CF6 E;  5EE9 A;  1FXI A;  3OLM D;  2V0G A;  3GZN B;  2LXC A;  3ZVV A;  1E10 A;  2A4Z A;  3BK1 A;  1UWX A;  1B9R A;  1J19 A;  2HJ1 A;  5AZF A;  4TUU A;  1C1Y B;  3VRA B;  2PEA A;  5KHQ A;  3EHV A;  4PS8 A;  2Q5W D;  3W2D A;  3PSE B;  1CK1 A;  3T3O A;  3URY A;  4YSX B;  4GDK B;  3AUL A;  2K39 A;  1MFW A;  2N1V A;  5LLI A;  4HWI B;  2CKH B;  3ML8 A;  2R61 A;  3VUY A;  3JSV B;  4FA6 A;  1C9F A;  3T8M A;  4FLH A;  4IWP A;  2VZK D;  2MP2 A;  3I5J C;  1SIF A;  3V3X A;  4X57 B;  2OJR A;  2W9N A;  4N58 A;  1SBB B;  1WGH A;  1YD8 U;  2BWF A;  3L54 A;  3AU4 A;  2KMC A;  4IUM B;  1FCL A;  2YEP B;  5C2T B;  3BZD B;  2WP9 B;  3FAH A;  1BML C;  2KDE B;  4MGK E;  4BKS D;  2JWZ A;  3AE3 B;  4A90 A;  2J0J A;  3U7Z A;  3P4R B;  4KGT A;  3RI7 C;  2LGI A;  4P7I A;  5G55 A;  1PGB A;  2L7R A;  3QWZ B;  2KDF B;  4A3P A;  1E8X A;  4EEW A;  4N59 A;  1C78 A;  1QOB A;  1WJ4 A;  3PZ8 A;  2ZW0 A;  3JYU A;  1KFY B;  2IGH A;  1GB4 A;  1HZ6 A;  4ANU A;  2SAK A;  2M4N A;  2PVO D;  4XWW A;  3AE4 B;  5HKH A;  4K81 A;  3ZYY X;  3TMP B;  1FNU A;  2M17 A;  4WH4 A;  4HJG E;  2XK5 A;  2LJ5 A;  2LZ6 A;  3R8B A;  3J9C A;  2DBY A;  1IP9 A;  1AWD A;  2V4L A;  3M63 B;  1WF9 A;  1UBQ A;  1FFV A;  3R66 C;  2FCM A;  4YTN B;  2DLB A;  2AQ2 B;  4P6V F;  2IGD A;  1CJE A;  4ZDV A;  2E3T A;  4HXD A;  1XLQ A;  2I38 A;  4TKN A;  3HVZ A;  2MH7 A;  2KWU B;  1XLP A;  3VTV A;  2ZNV C;  2BYV E;  1WM3 A;  3NVZ A;  4XYC A;  1GUA B;  2JSV X;  4KV2 A;  4RF1 A;  2WXG A;  1XLN A;  4XZ4 A;  1QQR A;  3D32 A;  3FC4 A;  3EFC A;  2NPT B;  1MHX A;  1GC7 A;  3B2F A;  4PT5 A;  2Y5C A;  4Q2J A;  2BPS A;  1I4H A;  1WRI A;  2LGX A;  2LXA A;  4JE3 B;  1FXA A;  3NS8 A;  2AL6 A;  2KLC A;  1RM6 C;  1JRO A;  2MA9 B;  2Y3A A;  1F2R C;  4GLS C;  2X38 A;  3PRZ A;  2WGS A;  4M02 A;  4OW0 A;  2AYO B;  3AE9 B;  3ZJV A;  4C80 A;  1AYF A;  5AUK A;  1BT0 A;  5JHB A;  3SD5 A;  3AMZ A;  4WIP A;  1WJN A;  1LM8 B;  3A4S C;  3DBH B;  3ZXR A;  4MGY E;  2WQY B;  3C8Y A;  4WJO A;  3T9L A;  4FBJ B;  1GOZ A;  4MT5 A;  4LNI A;  1P9D U;  4S0R A;  3AE8 B;  2OJW A;  2FCN A;  1IBX B;  2DX5 B;  2WDT B;  2LAS A;  2N7E A;  3NUH B;  4B6W A;  1P7F A;  1JWB D;  2MRP A;  3VH4 B;  2MX2 A;  3EEC A;  1MHH E;  4FN2 A;  4W9H A;  1FD6 A;  3UF8 A;  5EDS A;  1HXY D;  2QIL A;  1TY0 A;  2L83 A;  3BVG A;  2FCQ A;  3N1X C;  4BFR A;  2O2V A;  1VD2 A;  1NEK B;  1ET9 A;  2TSS A;  1V80 A;  4USA A;  1UWM A;  4NAW B;  1V5T A;  3OJ3 A;  4GN1 A;  1GC6 A;  4GDL B;  2G4D B;  4ACF A;  2KC1 A;  4MDK E;  4BVU C;  1IPG A;  1FPY A;  2C9W B;  1TKY A;  5LNK 1;  2KWV B;  3IT4 B;  3RUI B;  1PYW D;  4DDI D;  5D3D A;  1TBE A;  2FBW B;  3UQB A;  2GBN A;  4C4V B;  2D10 A;  2LJI A;  3L17 A;  1AAR A;  2PKO A;  1F52 A;  3HVD A;  1T0Q C;  3N20 C;  2KFJ A;  4MH0 E;  2I2Y A;  4CHK A;  1FNW A;  1K51 A;  1L0X B;  1VR9 A;  3HRD D;  3A9K B;  4EUT A;  1DOX A;  4K7U A;  5IAA C;  4FUL A;  3RPF C;  1Y8R C;  4FJV B;  4M0W A;  5AUI A;  1OFF A;  5MPO A;  2WXR A;  1HTQ A;  3TL5 A;  2O6V B;  4EOY A;  2WHI A;  4XC2 A;  3H6N A;  2EKI A;  2HJ8 A;  4LDT D;  4D2K A;  1E8Y A;  1ZKH A;  2WXM A;  4W9L A;  3APD A;  3PS6 A;  3X23 A;  2GMI C;  1XXG A;  2M0X A;  4FHK A;  3RN9 C;  1VJK A;  1GPX A;  1N60 A;  2GBK A;  5AEK B;  5D7G A;  1N61 A;  4RCO A;  2ZZP B;  1GNU A;  3WA0 A;  3H1U A;  2LGD A;  2J53 A;  3N32 A;  3B08 A;  3NG0 A;  4BOS C;  4JQW C;  1WMH A;  4P16 A;  1TTN A;  4I6P A;  1IGD A;  2WXO A;  2PMV A;  5GXG B;  2ZPN A;  4ZOH C;  1QOG A;  4C56 C;  1D5X C;  2NBU A;  2MBQ A;  3DVN U;  3IAM 1;  3DOW A;  4GMV A;  1SE4 A;  2VH1 A;  4RH6 A;  1P0R A;  4HVB A;  2J52 A;  2DZJ A;  1WX8 A;  1YX5 B;  5D94 A;  4YT0 B;  4IDI A;  2BWE S;  1QLB B;  2LEK A;  4W9K A;  3WAL A;  3C19 A;  4EZJ A;  4RM9 A;  3GP7 A;  1PFD A;  4AUQ C;  3RYT A;  1J7A A;  1OGW A;  3TEX A;  1SB3 C;  4IM3 A;  2K6Q A;  4GDK A;  2G3Q B;  2OHF A;  3KYC D;  4EKU A;  4LNF A;  2WXL A;  3R2I A;  4GSW A;  3ZGZ A;  4URK A;  2L0T A;  4EZK A;  4DDG D;  5HG2 A;  2L1A A;  2BB5 A;  3P4P B;  1WWT A;  2NBV B;  3SDL C;  1WYW B;  2IBI B;  2V3P A;  4B9K A;  3ZJT A;  1IGC A;  3A9J B;  4KGR A;  1I4P A;  2NTT A;  3CMM B;  1OQQ A;  1V81 A;  1C4A A;  3HK0 A;  2JVC A;  1WFY A;  2VH2 A;  4LNK A;  4YWG G;  2MJE A;  2KKC A;  2D3B A;  2PLP A;  4XDD A;  2CR5 A;  3DVN V;  3BK2 A;  3BVM A;  2BBC A;  2ICI A;  2KN5 A;  3PRE A;  5JZE B;  1K52 A;  2QEJ C;  1E6E B;  5CHV C;  4MM3 B;  2V3N A;  1WXQ A;  4US9 A;  1KJT A;  4KIK A;  4EE2 A;  3UQA A;  4NZL B;  4K3C A;  1N63 A;  1I4R A;  1WR6 E;  2LVO A;  1WZ3 A;  2FUH B;  2WLB A;  3A1Q B;  4FXC A;  2XBB C;  3IT6 B;  2AX5 A;  2FE8 A;  2QJL A;  2K8B A;  5JHA A;  4RGO S;  2Z59 B;  1L5P A;  2NTS A;  4HJK A;  5TSS A;  3KUZ A;  4IWQ A;  1IYF A;  2KO3 A;  3DBL I;  4BBN F;  5IA7 A;  1NDD A;  3PPA A;  1QKZ A;  3Q8B A;  4A20 A;  3KUC B;  3BY4 B;  2PTL A;  4IC7 B;  2FCS A;  1WZ0 A;  5E6O A;  3ETR A;  2DYB A;  2L32 A;  5J17 A;  4I6L B;  4DHZ B;  4WWP A;  4K7S A;  1D6E C;  1T0S C;  4II2 B;  1WGG A;  1EWC A;  1JWS D;  2KX3 A;  5HHD G;  2KNB A;  2BGF A;  3RNB C;  1WE6 A;  2INC C;  2WWZ A;  5JH5 C;  1XT9 B;  1V1P A;  1JWM D;  1V49 A;  2N0S B;  4WQM A;  3P4Q B;  1SIJ A;  3TBL D;  4BAX A;  2BB6 A;  1WH3 A;  2BKR B;  2EMT A;  1WJU A;  2D3C A;  3TJP A;  1WXS A;  1FCC C;  1BUI C;  4M00 A;  2FAZ A;  3KWL A;  4BOZ B;  1ZP0 B;  1J0G A;  4E74 A;  3NVY A;  5BMG A;  1MG8 A;  2KT7 A;  3ONS A;  4BBN C;  2RR9 A;  4MAC A;  5JXV A;  1F77 A;  2D11 A;  5BMH A;  1YQ4 B;  4REZ A;  4W9E A;  3U8Z A;  1OQR A;  3NHE B;  4A55 A;  4JL9 A;  1A70 A;  1ROE A;  4NJC A;  2K0P A;  4JPS A;  2CU3 A;  1XO3 A;  2LUM A;  4KX6 B;  5IO9 A;  2WXQ A;  2KDM A;  2KJR A;  1KM7 A;  1CZP A;  5FR6 A;  2XN9 C;  3DBL B;  1WSP A;  3T3N A;  1ZGU B;  1C76 A;  4DXF A;  2M0A A;  4ASW C;  2FID A;  2J7Q B;  1V9J A;  2JXT A;  3RFZ B;  5C23 A;  3CST A;  2L00 B;  3HM6 X;  2KMM A;  4RMA A;  3JVZ X;  3TEZ A;  2NMQ A;  3AEA B;  4DHJ B;  2WXI A;  3P42 A;  3QJZ A;  2WDQ B;  2RSU A;  4RNA A;  3UIN B;  4W9D A;  3DBS A;  2M19 A;  4WJP A;  4MJS A;  2KTR B;  2BS3 B;  4KDL B;  4IM2 A;  3DBR I;  2IDY A;  3QCA A;  1V5O A;  1N5W A;  1L4D B;  2KN4 A;  2L3Z A;  2MJ3 A;  2BQQ A;  1EM7 A;  4G50 A;  2JF5 A;  3DDC B;  3N1Z C;  3U4E G;  3ZDM C;  3MJW A;  4OZA A;  3BIN A;  3QC8 B;  4HCN B;  4NAW A;  1RLF A;  1D3Z A;  1WM2 A;  4JX1 C;  2N7D A;  2KDB A;  1RAX A;  4DWF A;  2J0K A;  4B0M A;  2JZ3 B;  2K6D B;  1EF1 A;  1Q10 A;  3MC8 A;  2H89 B;  4BKG A;  1P7E A;  3ZIM A;  4E3C A;  5TR5 A;  2GOW A;  4HRO A;  5EE1 A;  2ZNV B;  3W5U B;  4LNO A;  3FIL A;  3KW5 B;  2V3S A;  3FKY A;  3L0W B;  3RZF A;  3TSS A;  3UI3 A;  1PQS A;  3B0A A;  4ZRP A;  2FNJ B;  2WXK A;  4TQ0 A;  4KKI A;  2INN E;  4CYE A;  2KHW B;  3I3T B;  2KAN A;  4ANW A;  2V1Y A;  3PHX B;  5DCN A;  5G5G A;  1UGJ A;  3AEB B;  4OZB A;  2IO3 B;  2CHW A;  2BT6 A;  2PPH A;  3IG3 A;  1J7C A;  3AM9 A;  2X8X X;  3AE7 B;  4US8 A;  2Y5P A;  1C3T A;  4B95 A;  1D5M C;  1YOV B;  2J42 A;  1A5R A;  4KZ0 A;  3Q8E A;  4A9A A;  1PDX A;  4XE0 A;  2K8H A;  2CU1 A;  3ML9 A;  4ITK A;  4MGI E;  4OVU A;  1L6U A;  2AWT A;  1Z5S B;  2MBB B;  3I57 A;  4ZRQ A;  2ZVO A;  5BYR A;  1VDV A;  1JRP A;  2XNA C;  2L76 A;  5IN7 A;  3DCG A;  2QC8 A;  1R4N I;  2HTM E;  4I6N B;  3IXS A;  1NVI D;  4ZRK A;  4OVZ A;  1E90 A;  2WX1 A;  2DAF A;  2MEK A;  4N9F 4;  1KH0 A;  4OZC A;  4DK5 A;  1KLG D;  4LNN A;  1UEL A;  3A4R A;  3U52 E;  2C7H A;  5G2N A;  4FHJ A;  2FUG 1;  2KFK A;  5L95 C;  2WU2 B;  3AE6 B;  4JLC A;  1S3S G;  3VFK A;  1RRB A;  3WAP A;  2DZI A;  1WYG A;  2MP2 B;  3P4S B;  1P98 A;  2WXN A;  2KAJ A;  3EUB 2;  3TIX A;  1GB1 A;  2VRR B;  4FJY A;  3TEW A;  4IG7 B;  1E7U A;  2BW2 A;  3ZTC A;  1I7H A;  3QA8 A;  1LO5 D;  4RGT A;  2I1K A;  2MHJ A;  3H7P A;  3MHZ A;  3NRZ A;  1D4B A;  2K9X A;  1V6E A;  1L7Y A;  1JW9 D;  3RNF C;  2Z0D B;  1AW7 A;  5E6P A;  4YSZ B;  3QAR A;  1YJ1 A;  3AEC B;  2O6V D;  5E6J A;  1U4A A;  2UU7 A;  1UD7 A;  2RPQ A;  4W9I A;  4MM3 A;  1UNS A;  1XEE A;  2G4S A;  1E0Z A;  4R3D A;  3N9Y C;  1TYG B;  1J7B A;  2A5U A;  3AN1 A;  3JW0 X;  2DHZ A;  2RD0 A;  3IHP C;  4IM0 A;  3I63 C;  2XK5 B;  3PHW B;  2BYF A;  4LJP B;  2DZK A;  3MTN B;  4DBG A;  3PGE A;  2DNF A;  2NVU I;  4HPM B;  4GU2 A;  4NQK E;  3VUX A;  2RDH A;  3DQV A;  3VTU A;  3U7D A;  2PVG C;  1VRA B;  2N9P C;  1SE2 A;  3E9S A;  5HFY A;  1LFD A;  3RNG C;  1R4M I;  2IO0 B;  3P63 A;  3Q69 A;  2FIF A;  1WY8 A;  4HDO A;  3VVW B;  1WRD B;  2LVP A;  2DYM A;  1OEY J;  2JZP A;  3U30 A;  4DQO C;  4KGS A;  2IO2 B;  3PV1 A;  3ZTD A;  2ASQ A;  2QMT A;  1UH6 A;  3UIO B;  1TY2 A;  2GBM A;  3R7R A;  3WIM A;  1T3Q A;  2KVZ A;  3RMK C;  4NY0 A;  3PLU A;  2W54 A;  2B3A A;  2BTE A;  2DAJ A;  3AU5 A;  4IW0 A;  3HUI A;  1CMX B;  2DYO A;  2EKE C;  1QF6 A;  3PRM B;  2CS4 A;  3K9O B;  1LXD A;  2G45 B;  1EWY C;  4ZYS A;  2PIA A;  2JQR B;  1ZXH A;  1D5Z C;  4PYU A;  4O1N A;  3ZQ4 A;  4MSM B;  4YXD B;  1WGR A;  3P2B A;  3AXC A;  3B9J A;  4E71 A;  3BYT B;  3OAW A;  2IZV B;  3VQI A;  1KLU D;  4LK0 M;  1T0Y A;  1DGJ A;  5BYQ A;  1YJJ A;  2IPK D;  4IKG A;  2L0F A;  1WE7 A;  3BII D;  4GIV A;  4L2Y A;  2BKF A;  2GBR A;  3RT3 B;  3V60 A;  4M8M A;  2MJD A;  3M3J A;  2N7J A;  3W1Y A;  4FAD A;  2L8J A;  3I9V 1;  3L13 A;  3GE3 C;  3VAW A;  3PO0 A;  4MGZ E;  2MCN B;  1JAL A;  4DHZ E;  1IUE A;  3JSV A;  1XD3 B;  4CO7 A;  1HQR D;  2AQ3 B;  3HIZ A;  5FK9 C;  2IY1 B;  4WJN A;  2BYE A;  3RNE C;  1HE8 A;  1I4X A;  4WUR A;  2MLB A;  5I4D A;  2BVC A;  2HDE A;  2JYE A;  2MSE D;  3HM3 A;  4YTP B;  4RF0 A;  4W9G A;  1YN4 A;  3R3M A;  3O13 A;  3MHS D;  3LJ3 A;  1Y56 A;  4AQ7 A;  2ONQ A;  3VXW A;  1WIA A;  4XGA B;  1KRH A;  5D3I B;  2L05 A;  2QCZ A;  3TEY A;  1UUP A;  4MEM A;  1FO4 A;  1TS3 A;  1MJD A;  3KLS X;  1N6Z A;  1NBF C;  1SSN A;  2ZEQ A;  3ALB A;  3Q3O C;  2LFI A;  4J6I A;  3L10 B;  3E56 A;  1SGH A;  1OQY A;  4LLG M;  2QDF A;  3IAS 1;  1V1O A;  1QT9 A;  2INP E;  3GZN I;  1QZE A;  2OOB B;  1AN8 A;  3Q6B A;  3S2A A;  2WU5 B;  4JIO U;  1E8Z A;  1UBI A;  4AS1 A;  3OG5 A;  1V2Y A;  4JWS C;  1UZX B;  1EF5 A;  3K9P B;  2MBO A;  4ICU A;  3DVG Y;  1T6B X;  2KQ4 X;  1TIF A;  3Q8C A;  4NJ7 A;  4WJQ A;  2WDR B;  4ZHO A;  3LXF A;  3QIJ A;  4OVV A;  4WQO B;  4FJZ A;  2PE6 B;  1XLO A;  3RNC C;  4RGM A;  2LD9 A;  1MVK A;  2LRW A;  2KC2 A;  4RGN A;  2W3S A;  2NBW B;  3NY5 A;  2IY0 B;  3ZNZ B;  4W9J A;  3PRP B;  3H7S A;  1NI3 A;  3PLV A;  5FR3 A;  3AEG B;  2NPT A;  4EZL A;  3V6E B;  5IOI A;  3W1S C;  1R7S A;  1EO6 A;  3L08 A;  4HCP B;  2IJ0 A;  2LHD A;  4F7Z A;  1TT5 B;  3CIR B;  2WXJ A;  4KKJ A;  2AEH A;  4EFO A;  3X0W A;  3KVF B;  3MC9 A;  2LUE A;  3EC8 A;  4NAM A;  2PJH A;  3H9D A;  2WS3 B;  3QAQ A;  4DHJ D;  4ZRJ A;  1WMH B;  2IND C;  1TZO A;  3NJT A;  3OWE B;  4ZHP A;  1VCB A;  1TS2 A;  1M4V A;  3AE5 B;  2MBH A;  2N4F A;  2D5G A;  2LGS A;  4LCD E;  2G1E A;  4HKZ E;  1RFA A;  4J3O D;  3ZUN A;  1ZXI A;  2ZW1 A;  2J0M A;  1HZ5 A;  5CHW A;  1CQV A;  4YL8 A;  5CTR C;  5CHF A;  5L83 A;  1YMH E;  1L0Y B;  2N9K A;  5DPW A;  2BS4 B;  3Q14 C;  3Q8A A;  2JPH A;  1FNV A;  3BVZ A;  1K50 A;  3QHT A;  1IBX A;  4HRS A;  2YEP F;  1E9M A;  1DOY A;  3HHM A;  1PUT A;  2LVQ A;  1I42 A;  4ANX A;  3R2T A;  1F2R I;  1Z2M A;  3ZW3 A;  3GE8 C;  1JWU D;  1ZDV A;  3PT2 B;  1I35 A;  2JT4 B;  4L23 A;  4GB9 A;  2CJN A;  4XDC A;  4G3X B;  3VRB B;  3KH0 A;  1OEY A;  1YIW A;  2KOX A;  4NNJ B;  3NZS A;  1DYQ A;  1RYJ A;  2Z8L A;  4PK1 A;  1OTR B;  2C5L C;  4MH8 A;  1F9J A;  3NS1 A;  2M1M A;  2LWP A;  4KDI C;  2W3R A;  3A33 B;  3ZRC A;  2NS5 A;  1UF0 A;  1L4Z B;  4AJW A;  1GJZ A;  1TJE A;  1C4P A;  4TQ1 A;  1N5X A;  3DPD A;  1ZUD 2;  4AJY B;  2C7M B;  4RM8 A; 
#chains in the Genus database with same CATH homology
 1N61 A;  4RCO A;  2WU2 B;  3AE6 B;  1YNT E;  3NVV A;  3H8H A;  4WAF A;  2SEB D;  2J53 A;  4XWT A;  3AE1 B;  3V05 A;  1RWS A;  2B76 B;  1WYG A;  1JML A;  4TSS A;  2G9H D;  1XCQ L;  1TKG A;  4P16 A;  3P4S B;  2WXN A;  1IGD A;  2N9L A;  2WXO A;  2PMV A;  2WXP A;  3ABV B;  2KAJ A;  1GAQ B;  1KF6 B;  2GI9 A;  5GXG B;  2LMC A;  2RPV A;  3EUB 2;  4ZOH C;  5T8I A;  1QOG A;  4C56 C;  1D5X C;  3MC0 B;  1GB1 A;  2AQ1 B;  3PZ7 A;  1EU4 A;  3IAM 1;  2VZK B;  3TEW A;  4TMA B;  1SE4 A;  2BW2 A;  1I7H A;  2JX5 A;  4RH6 A;  4YSY B;  1LO5 D;  4RGT A;  2J52 A;  3MHZ A;  1FIQ A;  3NRZ A;  1B1Z A;  2RDG A;  4YT0 B;  2K9X A;  3AEE B;  1D4B A;  4H2A A;  1JW9 D;  1AW7 A;  4IDI A;  1QLB B;  2LEK A;  4YSZ B;  1C79 A;  2OED A;  3DWG C;  3GP7 A;  1PFD A;  1XF5 L;  3MJ5 A;  3AEC B;  1DOI A;  2BS2 B;  1J7A A;  5E6J A;  1ET6 A;  1YN5 A;  1ESF A;  1SB3 C;  3AV8 A;  3TEX A;  3VR8 B;  2WXH A;  2WNM A;  1C77 A;  1XCT L;  2OHF A;  2BYT A;  3GB1 A;  2EEL A;  4CQN A;  3W5V B;  2WXL A;  3R2I A;  3ZGZ A;  1FMA D;  2QSD A;  4WWM A;  4C7Y A;  4LTU A;  2RMM A;  2L1A A;  5HG2 A;  2BB5 A;  1UNS A;  1FXI A;  1WWT A;  3P4P B;  5EE9 A;  1XEE A;  2IGG A;  2V0G A;  1E0Z A;  3AB5 A;  2V3P A;  3N9Y C;  1TYG B;  1J7B A;  1IGC A;  4R3D A;  3ZJT A;  2GRI A;  3AN1 A;  4KGR A;  1I4P A;  1NYQ A;  1E10 A;  2NTT A;  3BK1 A;  1UWX A;  1OQQ A;  1B9R A;  1C4A A;  3EGR A;  2PW9 A;  4ARI A;  1FFU A;  1V1P B;  4YWG G;  4N6E B;  4YTM B;  2MJE A;  3VRA B;  4L1B A;  2PLP A;  1FRR A;  2RDH A;  4HEA 1;  4XDD A;  2Q5W D;  3W2D A;  2PVG C;  3BK2 A;  3BVM A;  2BBC A;  1VRA B;  2ICI A;  1CK1 A;  1YN3 A;  1N62 A;  3URY A;  3T3O A;  4YSX B;  1SE2 A;  3E9S A;  4GDK B;  5HFY A;  1K52 A;  2QEJ C;  3AH7 A;  1E6E B;  3P63 A;  4MM3 B;  2V3N A;  2R61 A;  3Q69 A;  3AED B;  1WXQ A;  2DYM A;  4US9 A;  2JZP A;  1C9F A;  4DQO C;  4EE2 A;  2VZK D;  4NZL B;  4KGS A;  3V3X A;  1N63 A;  1I4R A;  1NYR A;  1SBB B;  4N58 A;  2QMT A;  1TY2 A;  2WLB A;  1T3Q A;  4FXC A;  1FCL A;  1VLB A;  2YEP B;  5C2T B;  2JWU A;  3BZD B;  2WP9 B;  5H92 C;  3FAH A;  1BML C;  2W54 A;  3IT6 B;  3ZJU A;  2AX5 A;  2FE8 A;  2QJL A;  2BTE A;  4RGO S;  1L5P A;  2NTS A;  5TSS A;  3W9C B;  3AE3 B;  3HUI A;  3WCQ A;  4A90 A;  1KTK A;  2DYO A;  3U7Z A;  3P4R B;  4KGT A;  1VZ8 A;  1QF6 A;  2LGI A;  1QKZ A;  3Q8B A;  1PGB A;  2PTL A;  5EE0 A;  5H8Y E;  4N59 A;  1C78 A;  3ETR A;  1QOB A;  2L32 A;  1EWY C;  1JWA D;  3PZ8 A;  2ZW0 A;  4ZYS A;  2PIA A;  2JQR B;  1KFY B;  1D6E C;  1ZXH A;  1D5Z C;  2IGH A;  2W55 A;  3KQ4 A;  4O1N A;  1HZ6 A;  1GB4 A;  3ZQ4 A;  2K3U A;  2SAK A;  4YXD B;  2PVO D;  1SJE D;  4XWW A;  3AE4 B;  1EWC A;  3B9J A;  3DWM A;  2LHE A;  3BYT B;  1JWS D;  3ZYY X;  1FM0 D;  1FNU A;  5HHD G;  3VQI A;  4WH4 A;  1KLU D;  1JCK B;  4LK0 M;  4HJG E;  1DGJ A;  3LYY A;  5BYQ A;  4IOI E;  1V1P A;  1JWM D;  1YJJ A;  2N0S B;  2IPK D;  4WQM A;  4IKG A;  3R8B A;  1VZ7 A;  3P4Q B;  3BII D;  1SIJ A;  1I4Q A;  4L2Y A;  2DWQ A;  2DBY A;  3J9C A;  2KAC A;  2MJD A;  2V4I B;  3SFD B;  2BB6 A;  4C7Z A;  4A8X C;  1AWD A;  2N7J A;  2ON8 A;  3I9V 1;  1FFV A;  3PO0 A;  1JAL A;  4YTN B;  1IUE A;  2DLB A;  2AQ2 B;  4P6V F;  2IGD A;  1CJE A;  1BUI C;  1FCC C;  1QOA A;  1STE A;  2E3T A;  1XLQ A;  2I38 A;  4A6Q A;  3KWL A;  1EU3 A;  3HVZ A;  5EE3 A;  1YQ3 B;  1E7P B;  1ZP0 B;  2MH7 A;  1HQR D;  2AQ3 B;  3NZ3 A;  2W82 A;  1XLP A;  1MPE A;  3NVZ A;  2K22 A;  3NVY A;  5FK9 C;  5BMG A;  2JSV X;  3SFE B;  3EA6 A;  3P1M A;  1I4X A;  3L4P A;  4WUR A;  4MAC A;  5JXV A;  4RF1 A;  2WXG A;  3VR9 B;  1XLN A;  1F77 A;  5I4D A;  5BMH A;  1YQ4 B;  1QQR A;  3AE2 B;  3FC4 A;  4REZ A;  2HDE A;  2JYE A;  1MHX A;  4PT5 A;  3B2F A;  4Q2J A;  2Y5C A;  1OQR A;  4YTP B;  3FIL B;  4A55 A;  4RF0 A;  1A70 A;  1I4H A;  1ROE A;  4NJC A;  2K0P A;  3TUO A;  1YN4 A;  4JPS A;  3O13 A;  1PGA A;  4UDU C;  1Y56 A;  2KWD A;  1WRI A;  2CU3 A;  4AQ7 A;  2ONQ A;  1XO3 A;  4JE3 B;  1FXA A;  2LUM A;  4KX6 B;  1K53 A;  1SXT A;  2KDM A;  2WXQ A;  3W1S A;  1RM6 C;  1I4G A;  1KRH A;  1QIL A;  1T5X D;  5D3I B;  1JRO A;  1CZP A;  3TEY A;  1UUP A;  1FO4 A;  1ZOY B;  1TS3 A;  2XN9 C;  2Y3A A;  1WSP A;  1SJH D;  3T3N A;  1F2R C;  4GLS C;  2X38 A;  3KLS X;  1C76 A;  1RFK A;  4DXF A;  4OW0 A;  3AE9 B;  3ZJV A;  4C80 A;  1ACC A;  1SSN A;  2M0A A;  1AYF A;  5AUK A;  5G5H A;  2LFI A;  2JXT A;  3Q8F A;  3E56 A;  3RFZ B;  4DXG A;  4LLG M;  3IAS 1;  3B2G A;  2KMM A;  1V1O A;  1QT9 A;  2INP E;  3AMZ A;  4WIP A;  3TEZ A;  2NMQ A;  4ARC A;  4RFB A;  3AEA B;  1AN8 A;  2WXI A;  3P42 A;  1SF0 A;  5BMI A;  2WDQ B;  2WU5 B;  2WQY B;  4RNA A;  3C8Y A;  2H88 B;  1GOZ A;  2M19 A;  1WGK A;  4MT5 A;  4AS1 A;  2BS3 B;  3LB8 C;  4JWS C;  2IDY A;  3AE8 B;  1QOF A;  1FEH A;  1IBX B;  2WXF A;  1T6B X;  2KQ4 X;  1N5W A;  1L4D B;  2KN4 A;  1ZDX A;  3Q8C A;  2MJ3 A;  1EM7 A;  2WDR B;  1F0Z A;  4ZHO A;  3NUH B;  3LXF A;  3U4E G;  1P7F A;  1JWB D;  4OZA A;  1ENF A;  1XLO A;  4RGM A;  1MVK A;  4JX1 C;  3SR6 A;  5FKA C;  1MHH E;  4RGN A;  2W3S A;  4B0M A;  1FD6 A;  1HXY D;  2QIL A;  1HA5 A;  3SEB A;  1FRD A;  1Q10 A;  1BXT A;  2H89 B;  1P7E A;  1TY0 A;  2L83 A;  2J4X A;  3BVG A;  1NI3 A;  4HRO A;  5FR3 A;  3AEG B;  2GB1 A;  3CWI A;  5EE1 A;  3W5U B;  1NEK B;  3GS2 A;  3FIL A;  1R7S A;  1ET9 A;  2TSS A;  3TSS A;  3UI3 A;  2E6X A;  1VZ6 A;  2IJ0 A;  2LHD A;  1SEB D;  4ZRP A;  1L6V A;  2WXK A;  1TKE A;  3MFG A;  1YJI A;  3NVW A;  2WDV B;  1UWM A;  2WXJ A;  3CIR B;  4KKI A;  4USA A;  4TQ0 A;  2INN E;  3U2S C;  4KKJ A;  4OHJ A;  1NEN B;  4NAW B;  3AEF B;  4GDL B;  4HKQ A;  3MP9 A;  4NAM A;  2WS3 B;  1JQ4 A;  4B0E A;  5G5G A;  1UGJ A;  1TZO A;  3AEB B;  3OWE B;  4OZB A;  4ZHP A;  1TS2 A;  1M4V A;  1PGX A;  3AE5 B;  1SE3 A;  2BT6 A;  2D5G A;  1TKY A;  2G1E A;  4HKZ E;  4J3O D;  1J7C A;  5LNK 1;  1ZXI A;  3AM9 A;  3IT4 B;  2CJO A;  3AE7 B;  2ZW1 A;  1PYW D;  2K5P A;  1HZ5 A;  4US8 A;  2Y5P A;  5D3D A;  1CQV A;  1D5M C;  1TS4 A;  2FBW B;  2L52 A;  1V97 A;  1YMH E;  2LJI A;  1L0Y B;  1L0V B;  2N9K A;  1MI0 A;  2BS4 B;  3Q8A A;  2J42 A;  1FNV A;  2PKO A;  3BVZ A;  1K50 A;  3Q8E A;  1IBX A;  3HVD A;  5C3J B;  4HRS A;  2YEP F;  4A9A A;  1E9M A;  1DOY A;  1PDX A;  4JWU C;  1PUT A;  4XE0 A;  2I2Y A;  1FNW A;  1K51 A;  1L0X B;  1VR9 A;  1F2R I;  3HRD D;  3R2T A;  4ITK A;  1L6U A;  1JWU D;  3I57 A;  4ZRQ A;  1ZDV A;  2M56 B;  4L23 A;  1HEZ E;  1DOX A;  2ACZ B;  2CJN A;  3KWV A;  4XDC A;  5BYR A;  1VDV A;  3RPF C;  3VRB B;  4M0W A;  1JRP A;  5AUI A;  1OFF A;  5MPO A;  2XNA C;  2WXR A;  2JU6 X;  5HI1 A;  1DYQ A;  1RYJ A;  2Z8L A;  2QIE B;  1V8C A;  2HTM E;  3IXS A;  4MH8 A;  5BYS A;  2EKI A;  3NS1 A;  1NVI D;  4D2K A;  1ZPS A;  2W3R A;  4OVZ A;  2WXM A;  3BYY B;  1ZE3 D;  2MEK A;  1XXG A;  1L4Z B;  1C4C A;  3BWU D;  1KH0 A;  1TS5 A;  2JYT A;  4OZC A;  1TJE A;  1C4P A;  4TQ1 A;  1N5X A;  1KLG D;  1VJK A;  1ZUD 2;  3U52 E;  1GPX A;  1N60 A;  5D7G A;  2FUG 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...