1MI2A

Solution structure of murine macrophage inflammatory protein-2, nmr, 20 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE INFLAMMATORY PROTEIN-2
publication title Solution structure of murine macrophage inflammatory protein-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 9
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1mi2A00
2HCIA 5T1GA 1KNEA 1B53A 5E4WC 4OIKA 1MI2A 1F9RA 2B2VC 2JP1A 4HAEA 1BNZA 1J8IA 1JICA 5JJZA 1WTQA 4QUCA 3HP3A 3I8ZA 1IKMA 1EIHA 2H1EA 1RTOA 2MGSA 3TN2A 1QG7A 3I90A 1WTPA 1G6ZA 1U4MA 5COYA 1RJTA 3ONAB 1JE4A 1O7ZA 2L1BA 5CBAE 3LWEA 1WTWA 2FHTA 3MWYW 4ZKCB 2JYOA 1NR2A 1QNKA 1WTXA 2NYZD 1PFNA 4ZAIA 2M2LA 2DY8A 1SDFA 1KNAA 4HEDA 3D6WA 4CJ2C 2B2WA 2EPBA 4X3UA 1QE6A 1EOTA 4NW2A 4XT3B 1X3QA 1J9OA 1U4PA 1NAPA 2KOLA 3I91A 3R93A 1B2TA 2B2TA 1B50A 2R3ZA 1F2LA 1IL8A 1A15A 1ICWA 2K03A 1X32A 3H91A 4RAUC 1DOKA 1BO0A 3KBXA 1MSHA 3P7JA 5D65A 1PFBA 1HUMA 2FMMA 1O80A 2SDFA 2XIWA 2B2YC 2Q8TA 1CA5A 4U68A 1EIGA 4CJ0B 2D9UA 1DONA 2K05A 1PLFA 1MSGA 3SVMA 1NCVA 1ESRA 4MN3A 1HUNA 4R8IA 1DOLA 1Q3LA 4HCSA 4DN4M 2RA4A 2MJ8A 1GUWA 2B2VA 2FFKB 1BBXC 3MTSA 3IFDA 2B2UC 2EOTA 1G2TA 5DNFA 1SAPA 1B3AA 2KUMA 2L11A 1ZXTA 2NWGA 1X3PA 3DM1A 3FDTA 1PFMA 2NZ1D 2RVLA 2KVMA 1EQTA 1HFNA 1F9QA 3QO2A 5EPJA 1F9PA 4XT1B 4UAIA 1AZPA 1EL0A 3GV3A 1U4LA 1XX8A 2K01A 4IUPA 2FJ2A 4IUVA 1HHVA 1HRJA 4ZLTF 3FPUB 2HUGA 2B2UA 4XDXA 1WD1A 2K1BA 3G7LA 1VMCA 3N52A 4RA8A 3TZDA 1ILPA 1DZ1A 1VMPA 5T1IA 1RTNA 2L9HA 1G2SA 3DEPA 4X3TA 4ZKBB 2N55A 4CJ1B 1U4RA 3I3CA 4RWSC 2HDLA 1RHPA 2MPMA 1ML0D 3F2UA 5EPKA 1MGSA 5AFWA 1G91A 5CMDA 1WTOA 4LMQD 1B4OA 1TVXA 4IUUA 2B2YA 1S4ZA 5D14A 2X69A 2X6GA 1IKLA 1PDQA 4IURA 1WTVA 1CA6A 2HCCA 1XYIA 1WVLA 2J7ZA 3GV6A 2X6LA 4IUTA 5CORA 4OIJA 5EPLA 1WTRA 3DEOA 5E4XA 1E0BA 5CBEE 1AZQA 4X3KA 2IL8A 4HSVA 1O7YA 2B2WC 1CM9A 1AP0A 1F9SA 1M8AA 1RODA 2RSNA 2EE1A 4IUQA 1NR4A 2L12A 2RSOA 2DY7A 2MP1A 3IL8A 4O42A 5EKIA 1SSOA 2K28A 1ILQA 2B2TC 4X3SA 4QUFA 1WD0A 1BF4A 2KECA 5EQ0A 3UI2A 2BDNA 2KEEA 2VXWA 4R9WA 2Q8RE 3KUPA 1LV9A 4MHEA 1HA6A 2FINB 2K04A 5EJWA 4ZK9B 2CVRA 2N88A 1DOMA 1HFGA 2L4NA 3Q6SA 1C8CA 2KEDA 2HDMA
chains in the Genus database with same CATH superfamily
1BCPB 3KLWA 3CF5A 3CMEA 1PH7A 1J8IA 1O78A 3I8ZA 2UXCL 1VQ9A 1RTOA 1YHBA 4YCVA 2IPKD 3TZUA 3VR3A 3OYYA 4DV7L 3ONAB 4IJHA 1H9KA 3CC7A 4DR2L 2R92B 1F77A 2G5DA 4FVMA 1O7IA 3RR5A 3UE1A 4PNYA 2RHQB 1I50H 2MNAA 3NEMA 1YHAA 3F2CA 1PZID 4XT3B 3CCSA 2Q8IB 2Q2TA 1TWCB 3R3OA 5A35A 4OGQC 3J80c 4APVA 1SYFA 4RGNA 1O80A 2F4VQ 4A3IG 5BR8Q 3TP8A 3I4NB 3CPWA 3L3OC 1PH6A 4JI4Q 3TMEA 2SNMA 4QQBX 4R8IA 2MJ8A 2ZT9C 1BBXC 3IFDA 4BY1B 3BZCA 2JA8B 4C3IH 2KUMA 4HSPA 4DV6L 2AQ1B 3OMCA 1EEFD 1EY6A 5EPJA 1F9PA 3AYHB 1Q1BA 3HFZB 1TT2A 3NQIA 4IUVA 3UDXA 3BDOA 1LTBD 3BDLA 1ILPA 4BY7G 2JEBI 1DZ1A 1EQVA 4OO1G 1X54A 4DV2L 3U4VA 4X3TA 3PUYA 3WDNA 1I4XA 4GKJQ 3I4MG 1V9PA 2NBFA 1KHIA 3CP0A 4L5RC 5CGKA 3GTOB 1KLUD 1NMFA 1TWGB 3GTMB 2UXDQ 5CYUA 1YJNA 1WVLA 4DR3Q 2OXPA 3JAME 1S40A 1V1PB 3IRBA 1ET9A 4X3KA 5CV9A 4PMCA 2Z8LA 3CCQA 2Q2UA 1HA5A 3CW2C 2H5XA 4IUQA 3E9IA 4IUNA 1YJWA 1OXTA 2K28A 5IP7H 4HR7B 5I6WA 2I46A 5EQ0A 3BVGA 3E5SA 4LFAQ 1C7YA 1D5XC 1LT3D 2JEAI 1A63A 2KQ3A 4OL7A 5FLXE 2K04A 5IIFA 2JA5G 3M3YH 2HDMA 5T1GA 1XTCD 4HJ7A 4N9TA 2ES2A 1SNQA 1Y1VH 2B2VC 1BNZA 3GTLH 3K5OA 2A6ED 1SNDA 3IFTA 5E1FA 3OWEB 2J0TD 4NXMQ 3C46A 2HIVA 3PV0A 3HOVB 1RJTA 4KKTA 5J3BA 3LWEA 4DR6L 2JYOA 2MHVA 2QDLA 3T1HQ 4A3LH 1MBYA 1SNMA 1W6KA 3NP8A 1BBWA 5IYCH 4X3UA 3A74A 4GN3B 1ENCA 3EBEA 4S3SA 4DR7Q 3H0GB 4DK3C 1B50A 3U58A 4KKSA 1TXYA 2R7FA 1K83H 4UP7A 2ZTCA 5CR3A 5I2YA 1JCKB 3D4DA 3J7ZC 3CCRA 3P1HA 1PLFA 1MSGA 1EYCA 3K0XA 1W2BA 2B2VA 2CQOA 3CC2A 2QA4A 3NBHA 4MZ9A 3TBIB 4J8QA 1SEBD 2PQEA 3H94A 4DV0Q 2VQEQ 3UDGA 2K01A 4IN3A 3K5NA 1PXUA 3D6CA 2A73B 5C4ZA 2R92H 1SJED 4JK1C 3MAQA 1MJEA 3OTOL 1N34Q 4Y52H 3DEPA 3HKZE 2XWBB 1U4RA 2G9DA 4FO2A 1TWCH 3WOEA 4FXGC 5EKKA 2X69A 2JQOA 2MO0A 1Y1WH 3PIO3 2ID0A 3NHHA 1V43A 1C9OA 4JBJA 3I4NH 2PYKA 3HKZB 5G3LF 2K32A 3ND8A 2B2WC 1AE2A 2EYFA 3NENA 1B9NA 2Z4IA 2QEJC 2IY5B 2PMZB 4DK1A 3PIOA 1UEBA 1W3SA 2F0PA 4HIOA 1HZ9A 1SYGA 4ZK9B 2Z4HA 4HJ9A 5J39A 1PYWD 2IJ0A 1EIYB 1FGBD 1FJGQ 3FKIG 1X3GA 3HG9A 4LF9Q 4LUVA 2L15A 2JA9A 4IPCA 1HPCA 5KIXA 2AWNA 2PW7A 4HTHA 4DAPA 1QILA 4KJOA 3HRZC 3AFPA 1E1OA 3PMFA 4A3FG 5JAVA 4IFDI 4H02A 1HH2P 3PSIA 1K73C 4AIMA 4IFDG 1L0WA 1PRTC 2NYZD 3CMAA 3KDFB 1EFID 2B2WA 5FJ8H 2LXJA 3F1ZA 4CBVA 1OO9B 1U4PA 2KOLA 1N36Q 3DHQA 1B8AA 1KQSA 1JB3A 4Z9CB 2DUDA 4P72A 1GUSA 1SYCA 3RUZA 3PIP3 4JV5L 2B2YC 1HR0Q 4DA2A 3VR6A 4CJ0B 3MVVA 5IGGA 3CCVA 3KYHC 3RMHA 1PH1A 4OWWB 2NTSA 4DN4M 4YY3Q 4AYBG 4H0LC 4LF7Q 5JEAJ 3PIPA 2RVLA 4DU9A 1GOZA 3Q0AA 1HNXQ 1HFNA 1I4PA 1BUVT 4AH6A 3MHBA 4R8NA 3S2DB 1XPRA 2RKSA 4HIDA 1JJ2A 2B29A 3LX0A 1BCPD 5M5XB 2A68D 1VMPA 4XQJA 1PTOC 5GAEC 4ZKBB 1J5EL 4ZUJA 4CJ1B 1R9TB 1D2BA 4DXFA 3DWPA 4A3KB 5M3MB 1JMCA 2F0EA 4DR1L 2JA6G 3JAMc 2B2YA 1S4ZA 2DJFC 4GN4B 1IXRA 3S15B 3MXNB 5ELCA 3GV6A 1VQNA 1EYGA 4KKUA 3A5ZB 3FVQA 4GLAC 4DNTB 2F4IA 4X6AH 1JOOA 1VQIA 5FLXc 2C5CA 2CH4W 2ASBA 1PH2A 2KCCA 1VQJA 3UI2A 2BDNA 1PYSB 1V1QA 5M5YB 4MHEA 4JI3Q 2N78A 2IX1A 3NPPA 5AJ3L 1ENFA 1AH9A 2Z1CA 3BZDB 4A3MG 2ZM6Q 4A3JG 2QILA 1F9RA 5JEAG 1T5EA 3V96A 3C2PA 1WTQA 3QOLA 4NMZA 4ZRZA 2M00A 3ULJA 5LL6S 1IHZA 4B9WA 1SE8A 1M1KC 1TR5A 2V1CC 1SFOB 2NVYH 2XVSA 1JB7A 2KCTA 3DWAA 1Q7YC 4FF2A 1L1OC 2UU9Q 3ERSX 1EYDA 4WJWA 1D6EC 3HOUH 4TRDA 2K75A 2EY5A 3C3LA 3EIVA 2R3ZA 5E4WC 4A3IB 1QVFA 3P7JA 3KBXA 4IJLA 1L2FA 2E76C 1W6JA 1QVCA 1CA5A 2WB1E 3GTPH 3H3VH 4RKLA 2F3VA 4LF5L 1EZ8A 1CHPD 4NXNL 1FNWA 1WCMG 5FO7B 1CQVA 4DR4L 3IAYA 2K50A 3A8IE 3BZKA 1RF2D 2EXZA 1N32Q 4OONA 3OSOA 1A2UA 2WB1B 4GZYC 3S16B 1I94L 4BBSG 1HUNA 3K80C 3SDZA 1B1ZA 1L1OA 1WD1A 4UP8A 3G7LA 1VMCA 3N52A 2TSSA 3RLFA 2XWJB 3CRLC 3I4MB 3J7A5 3E3XA 5FO9B 4LUZA 2N55A 3I3CA 5DM63 4NB3A 1STBA 1PA6A 4RG1A 2WKDA 2F0VA 1WTVA 2NZOA 5LMNQ 1XNRL 4GKKL 5HURA 4RKBA 2F03A 4QB4A 5CV4A 3ITPA 3QJYA 2KHIA 3IL8A 1SSOA 1SR3A 4WORA 3GTKB 2JA5B 2OTLA 4Q0FA 4CKCA 1IBKQ 1IBML 4HCEA 3URYA 4JI7L 1VQ5A 1K9MC 4A3CG 1U9RA 5M5XH 3OW7A 3HZXA 5JJZA 5A2QL 4QUCA 3VYSA 1R9TH 3L9AX 3FHWA 1OTCA 3TN2A 3I55A 1EOVA 2IHEA 4LF8Q 3MEHA 3S15H 4F87A 4ZKCB 5KRUA 4PV1C 1QNKA 2UUAL 1TS3A 2JN4A 3DXJC 1KNAA 3GTQB 1Q8IA 2F0IA 4PZ7A 5I2XA 4YWLA 5C3XA 1NAPA 4A3GG 5IYBH 1D7QA 4DXGA 5D65A 4KHZA 3E0EA 1L0YB 5TSSA 4GNXC 4KHVA 3B6YA 3CC4A 2CQAA 2YU9B 2A5HA 1XMQQ 1VQGA 3D0FA 2XGTA 1EY0A 3GQBA 2F3WA 1B44D 4C3JB 2RCNA 4YHHQ 4RH6A 4M8AA 3M4QA 3MFGA 4RHSA 1XTDA 3HOZG 4TVAB 3S2HH 1TKWB 2XNAC 4F88A 4A3DG 3NTHA 3NWTA 1VQBA 4R4IA 3TSSA 1U4LA 3M4YA 2R61A 2JA7H 4A3EG 2XRQD 4B3RL 1SMYD 3NSWA 1H9SA 4N8FA 3I73A 1IZ6A 1RHPA 2VY3A 3F2UA 3CCEA 3T53B 1GUNA 5CMDA 4KN4C 1IW7D 2MUYA 4GNXA 4IURA 4JI4L 2BCOA 2WIIB 3HKSA 3AQQA 4WJ4A 4X66Q 4DAMA 2GN5A 2K5WA 1D5MC 3FPPA 4JI8Q 3J7YW 1NBWA 2ATWA 2JXMB 1Z47A 2DY7A 1KRTA 1KDAA 5IOCA 1RKNA 4H7BA 1SE2A 4YWMA 1F2ZA 4GOPB 2E75C 2N88A 3A8KE 2PI2E 3KBGA 4NDXA 3A8JE 1CHQD 3GD7A 1EQRA 2F0UA 3HOYH 1KNEA 4IOAA 1MI2A 4HAEA 4RFBA 3G48A 3TP5A 5IWAL 1JOQA 1KTKA 4C3HG 1QG7A 5C3WA 2B63H 3S1NB 3NELA 4CDEC 2QKIC 1KAAA 1TIID 3S1MB 3P75A 1ICFB 3KF8A 2EJGC 4HEDA 4AYBE 4G7ZC 2Q2HA 3A56A 3Q22A 2VUMG 3STBD 3R93A 1B2TA 2NTTA 4KI0A 1X9NA 3G71A 1XNQQ 3R8BA 3EVQA 5G3LD 3G4SA 2XTIA 2Q8TA 2DNEA 4DK0A 4P2CB 2JSOA 4RGOS 5E3FA 4F7XA 5A2QE 4AYBB 1EY5A 2WP8J 5BN3A 4HJ8A 2HQEA 1K8GA 3TP7A 4P74A 2L11A 4B3MQ 5C3EG 4XIGS 1M90C 2NZ1D 2F0WA 3BYYB 5GAHC 3T1HL 3GV3A 3NBIA 4XXEA 3EN2A 4BS9A 2E2IB 3OIQA 3TS0A 3VDYA 4X62Q 1HJPA 4JI0Q 5JJIA 4A93G 2BE5D 2CFMA 5C4XH 3GTQH 1S5CD 2JA6B 1SJHD 2WV6D 4DAYB 3I7FA 5C6AA 5EAYA 5AFWA 5J22A 4KHPQ 1HR0W 4RCNA 4FXKC 4IALA 4V190 4F8MA 4JI2Q 3KLRA 1K8AC 1XMOQ 1NMGA 4IUTA 3G6EA 2YU9H 3F2BA 2PCFB 3U50C 1CTMA 4K6DA 1MHWC 2I5LX 4GN5A 2EE1A 2D0PA 4C3JH 4DV0L 1A3TA 3K57A 1DD2A 5EKIA 1K0SA 5C0XI 3PO2G 2VQEL 4K2KA 4JI1Q 1G6PA 1LTAD 1BR9A 1L0XB 4A3MB 1E24A 4P73A 4A3JB 3K7AB 1V1PA 3SR1A 1C8CA 4A3BG 4XQQA 1N34L 2IWHA 3I56A 2HCIA 2F0KA 2E74C 1YNND 5FO8B 5ELOA 2UUBL 3NWSA 3UDFA 2F0QA 3J7AV 1JICA 3L7ZC 1QJOA 1NNXA 2KJXA 4ZYSA 1I4QA 1QNUA 3J81L 3K59A 5ELFA 4TKOB 4XQNA 1O7ZA 1YNJD 3MXUA 5HGQA 3NE5B 4R4OA 1RDPD 1PFNA 1VQDA 3S17B 5F2DA 4AQYQ 4OXPA 1TS2A 2C9OA 4LF4Q 4NW2A 2UXBQ 1JOKA 1F2MA 2XN9C 2VS1A 2ZJRA 4BXXG 1LO5D 1EU4A 1IL8A 2BH2A 5IT9L 4DK6C 1VS0A 4NPSA 4DV3L 2C35B 1S5BD 4U68A 1WCMB 1KRSA 2VL6A 4LF9L 2SNSA 1KD1C 3KJPA 1BVSA 1GJXA 1CFMA 4RCOA 4Q5VA 2NN6H 3A54A 5IP9H 1BBUA 1ZXTA 3H15A 4UY8C 3HOWH 4BBSB 2A19A 2N8NA 2H4OA 3QO2A 4DV7Q 1YBYA 3NK9A 4P71A 2R7ZH 4KN7C 3EQLC 1YJ9A 3S14H 1N36L 4WJ3M 4GLVB 4K8JA 1P8LA 2K5NA 3VR5A 4ZUIA 4DV5Q 3KFUA 2R93G 1HR0L 2NUCA 2ICEC 4LMQD 2A6HC 2RHSB 3H3VC 1H9JA 2IHFA 3JAMi 1CA6A 2BA0A 2Y0SE 1UE5A 4DFAA 1Q82C 3K5MA 2IL8A 4HSVA 4DNIA 3D3RA 4C3IG 5C4JB 4N9PA 1K8MA 4IFDJ 3RZDB 4O42A 3U9OA 1BOSA 1ILQA 1X56A 4DV1Q 1WD0A 1Z7TA 1CKMA 1HQRD 3KUPA 2Y0SB 1ZYRD 3TEHB 1FVIA 2E2IH 3GTGB 3ND9A 5EPKA 2OQKA 2PMZE 4H13C 2A8VA 2JP1A 2M9VA 5IYDG 1S3OA 2K5VA 4L5TA 2MGSA 1V1OA 3S1RB 2YV5A 4PZ8A 1PZJD 2IW3A 1NY4A 5LMNW 2A1AA 4BY1H 2JA8H 5LMUL 1PZKD 4J15A 1GHJA 1TWHB 2ICIA 4QF4A 4HIMA 4ZAIA 5M3FB 4A3GB 1PRTF 3K5LA 4JVZA 4FNFA 5IP7G 1VQAA 1WFQA 1VQKA 5FKAC 1A15A 1JE5A 1BO0A 1LT4D 3AEVA 3AFQA 1Y69U 2EYOA 3UDIA 3KDFA 2KA7A 2ZM6L 2XRSD 1E3PA 4K8IA 3GTOH 5JEAH 2PNRC 1DOLA 1TWGH 1Y1VG 2L5TA 1SYEA 4HCSA 3J81E 3GTMH 2EYPA 1PVOA 5I6YA 4A3DB 5DNFA 2QF7A 2B8FA 3NQTA 3V2TA 2K5HA 2K33A 2LMCB 4A3EB 2UU9L 1RD9D 1UNSA 4DR6Q 5DEHA 4ME3A 2FJ2A 4A3LG 2HUGA 2OWOA 1NE3A 2ALYB 3H09A 5IYCG 4CDCC 4K2LA 5IT9E 3S17H 5FLMH 4DUZL 3SK4A 2RF4A 4IQZA 3VYRA 3CCUA 1STNA 2A69D 4RWSC 1PTOF 1ML0D 2KHSA 1B9MA 3SK5A 4B9XA 1AFPA 2EYJA 4L5SA 2VB2X 5DAUA 3AU7A 4ME5A 3MC0B 2J7ZA 4ZQ3A 1PH3A 4LF6Q 3J80L 1WCMH 2EQSA 3HOVH 1E0BA 1AZQA 4B3SQ 1ET6A 1JJCB 2IX0A 1I3QB 1I6VC 1HZBA 1EWHA 3QWNA 1Q1EA 5C5MA 3CQZB 3MXNA 1E2WA 1HZCA 1BQQT 5ELDA 3H0GH 2CVRA 1G51A 2CW0D 1HTLD 5HGTA 5EKLA 1FL0A 3S1QB 3OTOQ 3PF5A 4R4CA 4C3HB 1KC8C 2B8GA 1LTID 1AE3A 4B08A 1YHQA 2D0OA 5LMNL 3W2DA 5KNBA 1Y1WG 2EJFC 3HGBA 1HNWQ 1JE4A 2O4XA 3DMUA 2MFIA 1EY8A 3PUZA 1JWSD 3CCJA 4OHJA 2AWOA 1KABA 5ELBA 3M4OB 1CKNB 3C1EA 4X64Q 1EOTA 3RN2A 1EIFA 5IGFA 1LUZA 1C0AA 3RZDH 3U4ZA 4FP5D 3M85A 1UEAB 4TQUS 4LFCQ 4HMJA 3C1FA 3GTJB 1YITA 4B3TQ 2K05A 1H95A 4ZCKA 2BA1A 5C3EB 2QW7A 1YNXA 1STGA 4JYAL 1JJGA 5JJKA 1B3AA 4LFBQ 3FDTA 1EY4A 2HHHQ 2A6EC 3TQYA 2WKCA 3S1RH 4C56C 4A93B 1YZ6A 4IUPA 2K4KA 1JR0D 3VYTA 1SBBB 1TWHH 3OPOA 2K1BA 2MQHA 2ZTEA 5FJ8G 3H6MA 4YWKA 5M3FH 3MFYA 1UAPA 3MXGA 2QGQA 2Z0SA 1LTRD 5GADC 1A8VA 5KNDA 4YCUA 1B4OA 1LTGD 4N8X1 4JV5Q 1SE3A 1QUQB 1SMXA 3RZOB 1XMQL 5K36H 4K6LA 4IPHA 2X6LA 1UE1A 5M5WB 1NJIC 1IBLL 3DEOA 1UWVA 1N33L 4BY7B 3PO2B 4DV4L 1HCZA 4JI6L 1LTSD 1NR4A 2MP1A 4A3DH 2PZUA 4EX5A 1I5FA 2E2HB 4EVOA 1SRUA 3Q24A 2AUJD 2E2DC 3TREA 4A3BB 2Q8RE 4M1UB 5NUCA 3HOXG 4A3EH 1N8RC 1HNZL 1GUGA 2JE6I 2Q2IA 2KEDA 1YVCA 3NUCA 4LK1C 1TU2B 4DGZA 1J5EQ 1K28A 3A7LA 4C1NI 1J6QA 2D5DA 4DR1Q 3W5OA 1SE4A 3I90A 4ILWA 3J80E 1WTPA 2BH8A 4QCLA 4KV6A 4R4TA 5CBAE 4JI8L 4OX9Q 1DYQA 2F0TA 3N6RA 1VQMA 1VDZA 4FDBA 1HQMC 1M4VA 3D6WA 4P75A 3S2DH 2BOSA 1LLRD 5JOBA 4LJZC 1I3QH 2IX3A 3J7AF 3I91A 4IPGA 2YTXA 1DM0B 1GUOA 2BDOA 2VQFL 1X32A 4JI5Q 2K52A 4DUYQ 2SDFA 3CQZH 3D8GA 2J4XA 1TQOA 4A3KH 5M3MH 5AJ3Q 2EDGA 4ALPA 1Y14B 1VQ8A 1S5ED 4KD4A 2AHOB 3S1QH 1GUWA 2FFKB 4C3HH 4KY7A 5IE8A 1KDCA 2AUKA 3RNUA 2EIFA 4IPDA 1K0RA 5FK9C 4CGYB 4PMBA 2AMCB 3P20A 4ZLTF 3TDQA 2B2UA 2LXKA 3BVMA 3T1YQ 3HS0C 3KF6B 5M5YH 3HOUG 3HKZG 3M4OH 2R93B 5I9OA 2L9HA 1QCBD 1G2SA 5IY0A 2UUCQ 1MGSA 4R1JA 3H3VI 2EYMA 4IUUA 5GQOA 1Q46A 3GTJH 4LF5Q 4DNRB 3RN5A 3CAMA 4C3IB 1HXYD 3PGZA 1SFOH 1H9RA 4B3ML 2F52A 1CM9A 3L2PA 1AP0A 5C3EH 4KY5A 4EQNA 4DR4Q 2NZHA 2B2TC 4X3SA 1Q8KA 2NVTB 2PQAB 4X62L 4HMIA 1PHJA 1D8LA 1LV9A 4KLKA 5IGBA 1I94Q 2F4VL 5IGEA 5BR8L 1G8ZD 4FF4A 4A3IH 3TP6A 1ENAA 4CDDC 1AW7A 4OIKA 4UDUC 4XYOA 1BCPC 2A68C 3HP3A 4JC0A 1DGSA 1D5ZC 3TS2A 4JI2L 4H44C 2OCEA 2CCZA 4FXDA 1XMOL 1PH5A 5COYA 5I4DA 4QIWB 2EY1A 3RD4A 2RDHA 3RZOH 2NVQB 3MZ5A 4BBRG 5EBCA 1EFWA 1WI5A 1Y8NB 4DKAC 1ASYA 4PG3A 3JAML 3FKIB 5M5WH 3PCOB 4CJ2C 4L5QA 3S16H 2OQ0A 4BY7H 2GA4B 3NXWA 3PO2H 4DR5Q 4JI1L 4I7AA 2CWPA 2CWAA 4XTCS 4OO1H 5JJLA 2B2TA 3M3YB 1KLGD 4RAUC 3W3AA 1EUJA 4GKJL 2E2HH 1DOKA 2PI2A 3WWVA 4A3FB 2RDFA 3I4MH 1SLJA 2Z9HA 4X65Q 4JI7Q 5FLXL 2UXDL 1Y1VB 1T5XD 2E5LQ 3A5UA 2XSCA 3FP9A 4DR3L 4IO9A 1C4QA 1A3UA 1VQCA 1QB5D 2IT1A 2AQ3B 1CSQA 1GXDC 3D4RA 4A76A 2MO1A 2EOTA 3MEFA 2O2LD 3OMGA 3ULLA 2LSSA 4L8JA 4LW1A 3SGIA 5H1SE 4U673 2VNUD 3X3NA 3J81j 4LFAL 4YIJA 3GO5A 3NTKA 3I4OA 1YIJA 4FF3A 4JOIC 4LF4L 3GTKH 2JA5H 2UUAQ 2UXBL 3AMUA 4RA8A 3BU2A 2HIXA 1KDBA 5C0XJ 3W1GA 2QDBA 1DXMA 5GROA 5C44G 2HDLA 5JVG3 4WRDA 1A2TA 1WTOA 4NXML 1VF7A 1QZHA 1PRTD 2ZTDA 2KCNA 4ABNA 3KF8B 2G9HD 2K7VA 1PV4A 1QZGA 5E7NA 1G291 5GAGC 2OF1A 4KMUC 4UP9A 1B7YB 4DAYA 4K0KQ 2K6AA 4DR7L 2EYHA 4KJNA 2OEOA 3BG3A 3M9BA 2JA7G 3D4WA 2R6GA 4KTAA 1DOMA 4JOIA 1JORA 1PFSA 2WINB 1ZEQX 1PYBA 1S72A 2PW5A 2EVBA 4DV5L 3OIPA 3PO3G 4B3RQ 2F0MA 1Q90A 1K3BC 2R93H 3I72A 1Y1WB 1VQ4A 3QOJA 5EGTA 1FYCA 1U4MA 3CCMA 2LS01 3U9SA 3ICEA 1NTGA 1I4RA 1PTOD 3MA2B 1A62A 2DN8A 5C0XG 3GP7A 4C2MB 2WFWA 4DV1L 1GO3E 5D3DA 3KJOA 1ICWA 1VQOA 3JC66 1HTPA 5IGDA 2NVTH 2I0QA 4OO1I 1TY2A 2WAQG 2WB1G 1Q86C 4BWGB 1EIGA 2D9UA 2RCFA 3LNNA 3HOYG 1NCVA 4MN3A 3K58A 3BS1A 1RCVD 1Q3LA 5IYDH 5J1ZA 3KLSX 5LHY1 1G2TA 5IWAQ 4K5WA 2NWGA 4G7HC 3BVZA 2F0OA 4K14A 2B63G 1OXXK 2F0JA 1JC7A 4HN7A 3ULPA 2NVQH 3GDEA 4G4KA 4KY6A 1OXUA 4NKLA 4QMGA 1HZAA 1KAWA 1FJGL 2PZTA 2PO4A 4JBKA 3FKIH 1FNVA 1S5FD 4MNOA 1GVPA 2RDGA 1BXTA 1SNPA 3PUXA 4KK7A 1QVGA 1G91A 4CKBA 1QOHA 2UXCQ 4A3FH 5D14A 2KBNA 3MXPA 3VR2A 2AQ2B 5JPMC 2LKVA 2V4DA 2F0LA 3D31A 1CUKA 4EQ5A 3R2IA 4IFDH 4OIJA 1WJJA 4OWTB 1STAA 5CBEE 3T16A 2HD3A 4DR2Q 5KYIA 3S1NH 3S1MH 2RSOA 4Y7NB 3HOXB 2KEEA 3BDCA 3RLOA 2ZXOA 5CV7A 1HA6A 4QGUA 5IGCA 2L4NA 3Q6SA 2D2CC 2YTVA 2F0SA 5C4XG 3QR8A 3G6JB 4YY3L 5EBDA 1SXTA 4LUOA 4V0BA 2K14A 3DM3A 4MTKA 5HY6A 2L55A 4LF7L 1EIHA 1SMYC 4UHVA 2EZVA 3A55A 2ZJPA 3QB3A 1HNXL 4LF6L 3VR4A 4HIKA 4QL5A 4DV6Q 1WTWA 4FYDA 4B3SL 1IW7C 1DJRD 1V8QA 3I70A 1CQFA 4C3JG 1E2VA 1FGUA 2EY6A 2VB3X 3NBHB 4DV2Q 1KXLA 3Q23A 4EGVA 3A7AB 4TSSA 2JA6H 1KIXA 1EEID 4HJ5A 2I07B 1DONA 2UUBQ 4BA2I 3VA5A 3MTSA 1U5KA 2NVYB 1X65A 1LTLA 1SAPA 2YYZA 3E0JA 1I4GA 1VQFA 3A0JA 3ZYYX 5JVH3 3LWUA 3DM1A 1HNWL 3BYTB 4MTNA 5DM73 2GVAA 4JI3L 1XX8A 3PUWA 3HOUB 4QJFA 2KHJA 4I65A 1K8OA 4X64L 1EY9A 2SEBD 1OXVA 3TZDA 4HJAA 1LM0A 1O7LA 3K8AA 4C2MH 2HT1A 4LWCA 1RTNA 4A3MH 4A3JH 1WOCA 3K7AH 4MIUA 3GTPB 5ELNA 2MPMA 1LABA 5CV6A 4JG2A 4LFCL 3HOZB 1IYJB 3STBC 4DV3Q 4B3TL 2X6GA 1IKLA 1PDQA 1A6XA 1II3A 2HCCA 4RMFA 1XYIA 1JQYD 1XPUA 2NN6I 5KYLA 4LFBL 2VZAA 2F0DA 2NN6G 4QY7A 5IP9G 2HHHL 2L12A 3HOWG 5DLQE 4J6HA 3S9WA 1TWAB 3FRPB 3QIAA 2PNHA 2D62A 2TMPA 2R7ZG 5EJWA 1XPOA 4POGA 1LT5D 3UE0A 4G7OC 1PH9A 1B53A 3CU7A 1EYAA 3DUZA 4CDFC 1EU3A 2BE5C 4K5VA 4FF1A 2CKZB 1MJCA 3I2ZA 1IL2A 1Z9FA 3OHXC 1PH4A 4BBRB 3KLSA 1N32L 1X3EA 2Z6KC 4JPBW 2KCMA 4DF7A 4ODGA 3F8TA 4OELB 4BBSH 1NR2A 3Q8DA 1GUTA 1YEZA 1ESFA 1EQQA 2R92G 3CKIB 4ID6A 2B39A 1FD7D 3T51B 4JW0A 4JBMA 5JPNC 3NTIA 3H91A 3VYUA 2K03A 4CHTB 4Y7NH 4KD3A 3HOXH 1STYA 3SHLA 1U0LA 3J81i 1GHKA 2RQXA 1CKNA 1ESRA 4GLXA 1E22A 1PRTB 1XXGA 2AKWB 1Q12A 3KK7A 2RA4A 4RGMA 4BA1I 3I4NG 4YCWA 2VUMB 1GM5A 1YNNC 1GKHA 4POFA 1NUCA 1STHA 4OX9L 4BY1G 2F0NA 2Z6KA 1SROA 2JA8G 4XT1B 5C4JH 1IBKL 1C48A 5I9PA 5LMUQ 1OXSC 2QEXA 1I4HA 2DGYA 3FPUB 3DWQA 3ER0A 2FMCA 1YNJC 1D1IA 4A3CH 1R4PB 1XWEA 5C44B 2I5HA 1EWCA 3ZJYC 5T1IA 4JI5L 4DUYL 3GTGH 1VQPA 3AB9A 4L63B 2R7DA 4WFN3 2FXQA 1Y8OB 2EYLA 2SOBA 4A4IA 1CK1A 1B3QA 4O0AA 5K5PA 1P16A 4LF8L 5FOBB 2EXDA 1TS5A 3PF4A 1X6OA 2EY2A 1RL2A 1X55A 3V05A 2ENBA 3E9HA 2K5DA 3S2HB 1RIPA 1RODA 1PTOB 2CHBD 2JA7B 1R4QB 5KGUA 1BKBA 1FR3A 1IYUA 4A3GH 1QUQA 2KECA 5KEEA 1EWIA 1XJVA 3CPFA 5M9OA 4IZ8A 5LL6X 3DLLA 2FINB 3T1YL 3PO3B 3PQIA 1IYVA 1EZ6A 4I7ZC 1SNOA 5FLMG 2HQLA 2N3SA 3FEWX 4DUZQ 2DJGC 2UUCL 3O13A 3OWFA 2ZJQA 4YHHL 2EJMA 5BN4A 3EA6A 2WAQE 4C1NK 3HOZH 2P5ZX 2L1BA 2FHTA 3CCLA 3HOVG 1I6HB 1TY0A 1K3RA 2GVBA 2M2LA 2DY8A 1SDFA 4NP5A 2EPBA 2DNCA 3KOJA 1Y8PB 3CD6A 5IODA 1H9MA 3X3MA 1J9OA 2WAQB 1F2LA 2B3GA 3W1BA 1CZGA 3HOYB 3T4AC 2FMMA 1A3VA 3H0GG 1PH8A 1TWAH 1CZWA 2WACA 1LYLA 1LT6D 4X66L 3SK6A 4ULLA 3OW2A 5ELEA 1ZYRC 2E2JB 1L1OB 4G57A 3I4LA 3K7UC 4DPGA 1CKOA 1TWFB 2B63B 5BN5A 2B2UC 3T56B 1NSNS 2NVXB 2LY7A 1X3PA 1LTTD 3K6OA 4CKEA 1PFMA 2KVMA 1EQTA 4OEMB 1KL9A 1T9HA 2YTYA 2I5MX 1EL0A 4BBRH 4LAAA 1BDOA 4DAVA 5ISRA 1HRJA 3BJUA 1VQ7A 3IKJA 4DR5L 1ASZA 3J81c 1QWYA 1TS4A 3E6ZX 2ZXPA 1GD7A 3LGJA 2O5JC 2L0CA 4E6IA 4X65L 1EY7A 1ZKOA 5C5LA 2K5QA 2E5LL 1TVXA 3SEBA 1LACA 2F0GA 2Y0SG 5CV8A 4K5XA 2RBMA 4OWXB 3KF6A 5EPLA 5CORA 1CT1D 1WTRA 1B70B 1I50B 1X3FA 5E4XA 5IT9c 3TRZA 2KENA 1D1KA 1AN8A 2QCPX 4UPAA 1SYDA 1F9SA 2RSNA 4JYAQ 1JT8A 3EROA 1Q81C 3R2TA 2OT2A 2VUMH 2JJQA 2LFNA 1BF4A 3M7GA 4QUFA 3SK8A 4IOCA 3EFXD 4PMWA 4R9WA 2A74C 1XNQL 4O1NA 1A0IA 1E7ZA 5C4HA 1MD2D 1SN8A 5C4XB 1HFGA 3CHBD 4GOPC 5M3FG 3WOFA 5C44H 4NXNQ 1YI2A 3J80i 3OOCA 1STEA 1IKMA 2PQAA 4EQOA 2H1EA 1VCIA 1BCPF 1G6ZA 2A69C 5K36G 1AEXA 3L0OA 1FNUA 3MWYW 1WTXA 3QG1A 3CXCA 1IBLQ 4K0KL 4JI0L 1N33Q 3FMCA 4J1MA 1CSPA 1UE7A 4DV4Q 4A93H 2VW9A 3K0YA 4QIWE 1VF5C 4JI6Q 1QE6A 2ZXRA 1X3QA 2A6HD 5CC4A 1PTOH 1JWUD 2F3IA 2E8GA 3M7NA 4L6TB 3T13A 4KHPL 1MSHA 1PFBA 5CV5A 1HUMA 4PQXA 1WYDA 2XIWA 3SXHA 2O5IC 1HNZQ 2F0FA 3PO3H 4GOPA 3K81C 3SVMA 4GS3A 3RLNA 3ERQA 2PZWA 1XNRQ 4GKKQ 1WTHA 2CW0C 1VQ6A 4XYQA 1H9SB 1MIUA 2NB0A 1S5DD 3SE0A 1F9QA 4R4QA 4UAIA 1AZPA 3HEJA 1SNCA 4GNXB 3VA7A 5C0XH 1HHVA 1Z6HA 1IBMQ 4XDXA 4A3BH 1I6HH 4RGTA 1VQLA 3GTLB 1VQHA 1E1TA 3F2DA 4JBWA 2N49A 5D3IB 2VQFQ 4RHRA 1N9WA 2PPBC 3M4PA 4A3KG 1SYBA 5M3MG 4LNQA 1VQEA 5L37A 4JCVE 1DCZA 1UE6A 3CRKC 4O2DA 2CH4A 3HOWB 2E2JH 1F2YA 1O7YA 4EQPA 4AQYL 1M8AA 1PMRA 1TWFH 4PZ6A 2R7ZB 1K83B 2F0HA 2NVXH 4BXXH 3S14B 1MKHA 5KNCA 1ONLA 2F1MA 2VXWA 1E2ZA 5IYBG 1JWMD 1CI3M 2JK8A 3PUVA 3S24A 2OTJA 3EJIA 4A75A 1UUPA 2Z6BA
chains in the Genus database with same CATH topology
1BCPB 1J8IA 1O78A 3I8ZA 1RTOA 2IPKD 3TZUA 3VR3A 3ONAB 1H9KA 2R92B 1F77A 4FVMA 4PNYA 1PZID 4XT3B 2Q8IB 1TWCB 3R3OA 5A35A 4OGQC 1SYFA 4RGNA 1O80A 3TP8A 3I4NB 3L3OC 3TMEA 2SNMA 4R8IA 2MJ8A 2ZT9C 1BBXC 3IFDA 4BY1B 2JA8B 2KUMA 4HSPA 2AQ1B 3OMCA 1EEFD 1EY6A 5EPJA 1F9PA 1Q1BA 1TT2A 3NQIA 4IUVA 3BDOA 1LTBD 3BDLA 1ILPA 2JEBI 1DZ1A 1EQVA 4OO1G 4X3TA 3PUYA 3WDNA 1I4XA 2NBFA 3GTOB 5CGKA 1KLUD 1TWGB 3GTMB 5CYUA 1WVLA 2OXPA 3JAME 1V1PB 4X3KA 1ET9A 5CV9A 4PMCA 2Z8LA 1HA5A 4IUQA 4IUNA 1OXTA 2K28A 4HR7B 5I6WA 2I46A 5EQ0A 3BVGA 3E5SA 1D5XC 1LT3D 2JEAI 2KQ3A 4OL7A 5FLXE 2K04A 5IIFA 2HDMA 5T1GA 1XTCD 4N9TA 1SNQA 2B2VC 1BNZA 3K5OA 2A6ED 1SNDA 3IFTA 5E1FA 3OWEB 2J0TD 3C46A 3PV0A 3HOVB 1RJTA 4KKTA 3LWEA 2JYOA 2MHVA 1MBYA 1SNMA 1W6KA 3NP8A 4X3UA 1ENCA 4S3SA 3H0GB 1B50A 4KKSA 5CR3A 5I2YA 1JCKB 3D4DA 3P1HA 1PLFA 1MSGA 1EYCA 2B2VA 3NBHA 3TBIB 4J8QA 1SEBD 2PQEA 3H94A 2K01A 4IN3A 3K5NA 1PXUA 3D6CA 2A73B 5C4ZA 1SJED 4JK1C 3MAQA 3DEPA 2XWBB 1U4RA 2G9DA 4FO2A 3WOEA 4FXGC 5EKKA 2X69A 3PIO3 2ID0A 3NHHA 1V43A 2PYKA 3HKZB 5G3LF 2K32A 3ND8A 2B2WC 2EYFA 1B9NA 2Z4IA 2QEJC 2PMZB 4DK1A 2F0PA 1SYGA 4ZK9B 2Z4HA 5J39A 1PYWD 2IJ0A 1FGBD 3HG9A 1HPCA 5KIXA 2AWNA 2PW7A 4HTHA 4DAPA 1QILA 4KJOA 3HRZC 3PMFA 5JAVA 4IFDI 4IFDG 1PRTC 2NYZD 1EFID 2B2WA 4CBVA 1OO9B 1U4PA 2KOLA 3DHQA 1JB3A 4Z9CB 1GUSA 1SYCA 3RUZA 3PIP3 2B2YC 4DA2A 3VR6A 4CJ0B 3MVVA 5IGGA 3RMHA 2NTSA 4DN4M 4H0LC 5JEAJ 2RVLA 4DU9A 1GOZA 3Q0AA 1HFNA 1I4PA 1BUVT 3MHBA 4R8NA 3S2DB 2RKSA 5M5XB 3LX0A 1BCPD 2A68D 1VMPA 4XQJA 1PTOC 4ZKBB 4ZUJA 4CJ1B 1R9TB 1D2BA 4DXFA 3DWPA 4A3KB 5M3MB 2F0EA 2B2YA 1S4ZA 3S15B 5ELCA 3GV6A 4KKUA 3FVQA 4DNTB 2F4IA 1JOOA 2C5CA 2KCCA 3UI2A 2BDNA 5M5YB 4MHEA 2IX1A 3NPPA 1ENFA 2Z1CA 3BZDB 2QILA 1F9RA 5JEAG 1T5EA 3V96A 3C2PA 1WTQA 3QOLA 4NMZA 4ZRZA 2M00A 5LL6S 1IHZA 4B9WA 1TR5A 1SFOB 2XVSA 3DWAA 4FF2A 1EYDA 4WJWA 1D6EC 4TRDA 2EY5A 3C3LA 2R3ZA 5E4WC 4A3IB 3P7JA 3KBXA 2E76C 1W6JA 1CA5A 4RKLA 2F3VA 1EZ8A 1CHPD 1FNWA 5FO7B 1CQVA 3IAYA 3A8IE 1RF2D 2EXZA 3OSOA 1A2UA 2WB1B 4GZYC 3S16B 1HUNA 3SDZA 1B1ZA 1WD1A 3G7LA 1VMCA 3N52A 2TSSA 3RLFA 2XWJB 3CRLC 3I4MB 5FO9B 2N55A 3I3CA 5DM63 1STBA 2WKDA 2F0VA 1WTVA 5HURA 4RKBA 2F03A 4QB4A 5CV4A 3ITPA 3QJYA 3IL8A 1SSOA 4WORA 3GTKB 2JA5B 4Q0FA 4CKCA 4HCEA 3URYA 1U9RA 3OW7A 3HZXA 5JJZA 5A2QL 4QUCA 3VYSA 3L9AX 3TN2A 3MEHA 4F87A 4ZKCB 5KRUA 4PV1C 1QNKA 1TS3A 3DXJC 1KNAA 3GTQB 1Q8IA 2F0IA 5I2XA 5C3XA 1NAPA 4DXGA 5D65A 4KHZA 1L0YB 5TSSA 4KHVA 2CQAA 2YU9B 2A5HA 3GQBA 1EY0A 2F3WA 1B44D 4C3JB 4RH6A 4M8AA 3MFGA 4RHSA 1TKWB 2XNAC 4F88A 3NTHA 3NWTA 3TSSA 1U4LA 3M4YA 2R61A 2XRQD 1SMYD 3NSWA 1H9SA 3I73A 1RHPA 3F2UA 3T53B 1GUNA 5CMDA 4KN4C 1IW7D 2MUYA 4IURA 2BCOA 2WIIB 2K5WA 1D5MC 3FPPA 3J7YW 2JXMB 1Z47A 2DY7A 1KDAA 5IOCA 1RKNA 4H7BA 1SE2A 1F2ZA 2E75C 2N88A 3A8KE 3KBGA 4NDXA 3A8JE 1CHQD 3GD7A 2F0UA 1KNEA 1MI2A 4HAEA 4RFBA 3TP5A 1JOQA 1KTKA 4C3HG 1QG7A 5C3WA 3S1NB 2QKIC 1KAAA 1TIID 3S1MB 3P75A 3KF8A 2EJGC 4HEDA 4G7ZC 3A56A 3Q22A 3R93A 1B2TA 2NTTA 4KI0A 3R8BA 3EVQA 5G3LD 2Q8TA 2DNEA 4DK0A 4P2CB 2JSOA 4RGOS 5E3FA 4F7XA 5A2QE 4AYBB 1EY5A 2WP8J 5BN3A 2HQEA 3TP7A 2L11A 4XIGS 2NZ1D 2F0WA 3BYYB 3GV3A 3NBIA 4XXEA 4BS9A 2E2IB 3OIQA 2BE5D 1S5CD 2JA6B 1SJHD 2WV6D 5C6AA 5J22A 5AFWA 4RCNA 4FXKC 4IALA 4V190 4F8MA 3KLRA 4IUTA 2PCFB 1CTMA 4K6DA 2EE1A 1A3TA 3K57A 1DD2A 5EKIA 5C0XI 4K2KA 1LTAD 1BR9A 1L0XB 4A3MB 4A3JB 3K7AB 1V1PA 3SR1A 1C8CA 4XQQA 2IWHA 2HCIA 2F0KA 2E74C 1YNND 5FO8B 3NWSA 2F0QA 3J7AV 1JICA 3L7ZC 1QJOA 2KJXA 4ZYSA 1I4QA 1QNUA 3J81L 3K59A 5ELFA 4TKOB 4XQNA 1O7ZA 1YNJD 3MXUA 3NE5B 1RDPD 1PFNA 3S17B 5F2DA 1TS2A 2C9OA 4NW2A 1JOKA 1F2MA 2XN9C 1LO5D 1EU4A 1IL8A 5IT9L 1S5BD 4U68A 1WCMB 2SNSA 1GJXA 1CFMA 4RCOA 4Q5VA 2NN6H 3A54A 1ZXTA 4BBSB 2H4OA 3QO2A 3NK9A 4KN7C 3EQLC 4K8JA 3VR5A 4ZUIA 2NUCA 2ICEC 4LMQD 2A6HC 3H3VC 1H9JA 1CA6A 2BA0A 4DFAA 3K5MA 2IL8A 4HSVA 3D3RA 4C3IG 5C4JB 4N9PA 1K8MA 4IFDJ 3RZDB 4O42A 3U9OA 1BOSA 1ILQA 1WD0A 1Z7TA 1HQRD 3KUPA 2Y0SB 1ZYRD 3GTGB 3ND9A 5EPKA 4H13C 2JP1A 2M9VA 2MGSA 1V1OA 3S1RB 1PZJD 2IW3A 1PZKD 1GHJA 1TWHB 2ICIA 4QF4A 4ZAIA 5M3FB 4A3GB 1PRTF 3K5LA 4FNFA 5FKAC 1A15A 1BO0A 1LT4D 1Y69U 2EYOA 2KA7A 2XRSD 4K8IA 5JEAH 2PNRC 1DOLA 2L5TA 4HCSA 3J81E 1SYEA 2EYPA 5I6YA 4A3DB 5DNFA 2QF7A 2B8FA 3NQTA 3V2TA 2K33A 2LMCB 4A3EB 1RD9D 1UNSA 5DEHA 2FJ2A 2HUGA 3H09A 4K2LA 5IT9E 3SK4A 4IQZA 3VYRA 1STNA 2A69D 4RWSC 1PTOF 1ML0D 2KHSA 1B9MA 3SK5A 4B9XA 1AFPA 2EYJA 2VB2X 5DAUA 3AU7A 4ME5A 3MC0B 2J7ZA 4ZQ3A 3J80L 1E0BA 1AZQA 1ET6A 2IX0A 1I3QB 1I6VC 1EWHA 3QWNA 1Q1EA 5C5MA 3CQZB 3MXNA 1E2WA 1BQQT 5ELDA 2CVRA 2CW0D 1HTLD 5HGTA 5EKLA 3S1QB 4C3HB 2B8GA 1LTID 4B08A 3W2DA 5KNBA 2EJFC 3HGBA 1JE4A 2O4XA 3DMUA 1EY8A 3PUZA 1JWSD 4OHJA 2AWOA 1KABA 5ELBA 3M4OB 3C1EA 1EOTA 5IGFA 4FP5D 3M85A 1UEAB 4TQUS 4HMJA 3C1FA 3GTJB 2K05A 2BA1A 5C3EB 1STGA 1B3AA 3FDTA 1EY4A 2A6EC 2WKCA 4C56C 4A93B 4IUPA 1JR0D 3VYTA 1SBBB 3OPOA 2K1BA 3H6MA 3MFYA 1UAPA 3MXGA 1LTRD 5KNDA 1B4OA 1LTGD 1SE3A 3RZOB 5K36H 4K6LA 2X6LA 5M5WB 3DEOA 4BY7B 3PO2B 1HCZA 1LTSD 1NR4A 2MP1A 2PZUA 2E2HB 4EVOA 3Q24A 2AUJD 2E2DC 4A3BB 2Q8RE 4M1UB 5NUCA 1GUGA 2JE6I 2KEDA 3NUCA 4LK1C 1TU2B 4DGZA 3A7LA 4C1NI 2D5DA 1SE4A 3I90A 4ILWA 3J80E 1WTPA 4QCLA 4KV6A 5CBAE 1DYQA 2F0TA 3N6RA 1VDZA 1HQMC 1M4VA 3D6WA 2BOSA 1LLRD 5JOBA 4LJZC 2IX3A 3J7AF 3I91A 1DM0B 1GUOA 2BDOA 1X32A 2SDFA 3D8GA 2J4XA 1TQOA 2EDGA 1S5ED 4KD4A 1GUWA 2FFKB 4KY7A 1KDCA 2AUKA 5FK9C 4CGYB 4PMBA 3P20A 4ZLTF 3TDQA 2B2UA 3BVMA 3HS0C 2R93B 5I9OA 2L9HA 1QCBD 1G2SA 1MGSA 2EYMA 4IUUA 4DNRB 4C3IB 1HXYD 1H9RA 1CM9A 1AP0A 4KY5A 4EQNA 2B2TC 4X3SA 2NVTB 4HMIA 1LV9A 5IGBA 5IGEA 1G8ZD 4FF4A 3TP6A 1ENAA 1AW7A 4OIKA 4UDUC 4XYOA 1BCPC 2A68C 3HP3A 1D5ZC 4H44C 4FXDA 5COYA 5I4DA 4QIWB 2EY1A 3RD4A 2RDHA 2NVQB 3MZ5A 5EBCA 1Y8NB 3JAML 3FKIB 4CJ2C 2GA4B 3NXWA 4OO1H 4XTCS 2B2TA 3M3YB 1KLGD 4RAUC 3W3AA 1DOKA 4A3FB 2RDFA 5FLXL 1Y1VB 1T5XD 2XSCA 1C4QA 1A3UA 1QB5D 2IT1A 2AQ3B 1GXDC 3D4RA 2EOTA 2O2LD 3OMGA 4L8JA 4U673 2VNUD 3X3NA 4YIJA 3GO5A 3NTKA 4FF3A 3AMUA 4RA8A 1KDBA 5C0XJ 2QDBA 1DXMA 5JVG3 2HDLA 4WRDA 1A2TA 1WTOA 1VF7A 1PRTD 2KCNA 4ABNA 2G9HD 2K7VA 1G291 2OF1A 4KMUC 4DAYA 2K6AA 2EYHA 4KJNA 2OEOA 3BG3A 3D4WA 2R6GA 4KTAA 1DOMA 1JORA 2WINB 1ZEQX 2PW5A 2EVBA 3OIPA 2F0MA 1Q90A 3I72A 1Y1WB 3QOJA 5EGTA 1FYCA 1U4MA 2LS01 3U9SA 1I4RA 1PTOD 3MA2B 2DN8A 5C0XG 3GP7A 4C2MB 5D3DA 1ICWA 1HTPA 5IGDA 4OO1I 1TY2A 4BWGB 1EIGA 2D9UA 3LNNA 1NCVA 4MN3A 3K58A 3BS1A 1RCVD 1Q3LA 5J1ZA 3KLSX 5LHY1 1G2TA 4K5WA 2NWGA 4G7HC 3BVZA 2F0OA 4K14A 1OXXK 2F0JA 1JC7A 4HN7A 4G4KA 4KY6A 1OXUA 4NKLA 4QMGA 2PZTA 2PO4A 1FNVA 1S5FD 2RDGA 1BXTA 1SNPA 3PUXA 4KK7A 1G91A 4CKBA 1QOHA 5D14A 3MXPA 3VR2A 2AQ2B 5JPMC 2LKVA 2V4DA 2F0LA 3D31A 3R2IA 4IFDH 4OIJA 1STAA 5CBEE 3T16A 5KYIA 2RSOA 4Y7NB 3HOXB 2KEEA 3BDCA 2ZXOA 5CV7A 1HA6A 5IGCA 2L4NA 3Q6SA 2D2CC 2F0SA 3G6JB 5EBDA 1SXTA 4V0BA 2L55A 1EIHA 1SMYC 2EZVA 3A55A 3QB3A 3VR4A 1WTWA 4FYDA 1IW7C 1DJRD 1V8QA 3I70A 1CQFA 4C3JG 1E2VA 2EY6A 2VB3X 3Q23A 4EGVA 3A7AB 4TSSA 1EEID 2I07B 1DONA 4BA2I 3VA5A 3MTSA 2NVYB 2YYZA 1SAPA 3E0JA 1I4GA 3ZYYX 5JVH3 3LWUA 3DM1A 3BYTB 5DM73 1XX8A 3PUWA 3HOUB 1K8OA 4I65A 1EY9A 2SEBD 1OXVA 3TZDA 1O7LA 1RTNA 4MIUA 3GTPB 2MPMA 1LABA 5CV6A 3HOZB 2X6GA 1IKLA 1PDQA 1A6XA 1II3A 2HCCA 1XYIA 1JQYD 2NN6I 5KYLA 2F0DA 2NN6G 2L12A 4J6HA 3S9WA 1TWAB 3FRPB 3QIAA 2D62A 2TMPA 5EJWA 1LT5D 4G7OC 1B53A 3CU7A 1EYAA 3DUZA 1EU3A 2BE5C 4K5VA 4FF1A 3OHXC 4BBRB 3KLSA 4DF7A 4ODGA 1NR2A 1GUTA 1ESFA 3CKIB 4ID6A 2B39A 1FD7D 3T51B 5JPNC 3NTIA 3H91A 3VYUA 2K03A 4CHTB 4KD3A 1STYA 3SHLA 1GHKA 2RQXA 1ESRA 1PRTB 1XXGA 1Q12A 3KK7A 2RA4A 4RGMA 4BA1I 2VUMB 1YNNC 1NUCA 1STHA 2F0NA 4XT1B 1C48A 5I9PA 1OXSC 1I4HA 3FPUB 3DWQA 2FMCA 1YNJC 1D1IA 1R4PB 1XWEA 5C44B 1EWCA 5T1IA 3AB9A 4L63B 4WFN3 1Y8OB 2EYLA 2SOBA 1CK1A 5K5PA 5FOBB 1TS5A 2EY2A 3V05A 2ENBA 2K5DA 3S2HB 1RODA 1PTOB 2CHBD 2JA7B 1R4QB 5KGUA 1FR3A 1IYUA 2KECA 5KEEA 5M9OA 4IZ8A 5LL6X 2FINB 3PO3B 1IYVA 1EZ6A 4I7ZC 1SNOA 3FEWX 3O13A 3OWFA 2EJMA 5BN4A 3EA6A 4C1NK 2L1BA 2FHTA 1I6HB 1TY0A 2M2LA 2DY8A 1SDFA 4NP5A 2EPBA 2DNCA 1Y8PB 5IODA 1H9MA 3X3MA 1J9OA 2WAQB 1F2LA 1CZGA 3HOYB 3T4AC 2FMMA 1A3VA 1CZWA 2WACA 1LT6D 3SK6A 4ULLA 5ELEA 1ZYRC 2E2JB 4G57A 3I4LA 1TWFB 2B63B 5BN5A 2B2UC 3T56B 1NSNS 2NVXB 2LY7A 1X3PA 1LTTD 3K6OA 4CKEA 1PFMA 2KVMA 1EQTA 1EL0A 4LAAA 1BDOA 4DAVA 5ISRA 1HRJA 3IKJA 1QWYA 1TS4A 3E6ZX 2ZXPA 2O5JC 2L0CA 4E6IA 1EY7A 1ZKOA 5C5LA 2K5QA 1TVXA 3SEBA 1LACA 2F0GA 5CV8A 4K5XA 2RBMA 5EPLA 5CORA 1CT1D 1WTRA 1I50B 5E4XA 1D1KA 1AN8A 2QCPX 1SYDA 1F9SA 2RSNA 3EROA 3R2TA 2OT2A 2LFNA 1BF4A 3M7GA 4QUFA 3SK8A 3EFXD 4PMWA 4R9WA 2A74C 4O1NA 5C4HA 1MD2D 5C4XB 1HFGA 3CHBD 3WOFA 3OOCA 1STEA 1IKMA 4EQOA 2H1EA 1VCIA 1BCPF 1G6ZA 2A69C 5K36G 1AEXA 1FNUA 3MWYW 1WTXA 3QG1A 3FMCA 4J1MA 3K0YA 1VF5C 1QE6A 2ZXRA 1X3QA 2A6HD 5CC4A 1PTOH 1JWUD 3M7NA 4L6TB 3T13A 1MSHA 1PFBA 5CV5A 1HUMA 4PQXA 2XIWA 3SXHA 2O5IC 2F0FA 3SVMA 3ERQA 2PZWA 2CW0C 4XYQA 1H9SB 2NB0A 1S5DD 3SE0A 1F9QA 4UAIA 1AZPA 3HEJA 1SNCA 3VA7A 5C0XH 1HHVA 1Z6HA 4XDXA 4RGTA 3GTLB 4JBWA 5D3IB 4RHRA 2PPBC 1SYBA 1DCZA 3CRKC 3HOWB 1F2YA 1O7YA 4EQPA 1M8AA 1PMRA 2R7ZB 1K83B 2F0HA 3S14B 5KNCA 1ONLA 2F1MA 2VXWA 1E2ZA 1JWMD 1CI3M 3PUVA 3EJIA 1UUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCI A;  5T1G A;  1KNE A;  1B53 A;  5E4W C;  4OIK A;  1MI2 A;  1F9R A;  2B2V C;  2JP1 A;  4HAE A;  1BNZ A;  1J8I A;  1JIC A;  5JJZ A;  1WTQ A;  4QUC A;  3HP3 A;  3I8Z A;  1IKM A;  1EIH A;  2H1E A;  1RTO A;  2MGS A;  3TN2 A;  1QG7 A;  3I90 A;  1WTP A;  1G6Z A;  1U4M A;  5COY A;  1RJT A;  3ONA B;  1JE4 A;  1O7Z A;  2L1B A;  5CBA E;  3LWE A;  1WTW A;  2FHT A;  3MWY W;  4ZKC B;  2JYO A;  1NR2 A;  1QNK A;  1WTX A;  2NYZ D;  1PFN A;  4ZAI A;  2M2L A;  2DY8 A;  1SDF A;  1KNA A;  4HED A;  3D6W A;  4CJ2 C;  2B2W A;  2EPB A;  4X3U A;  1QE6 A;  1EOT A;  4NW2 A;  4XT3 B;  1X3Q A;  1J9O A;  1U4P A;  1NAP A;  2KOL A;  3I91 A;  3R93 A;  1B2T A;  2B2T A;  1B50 A;  2R3Z A;  1F2L A;  1IL8 A;  1A15 A;  1ICW A;  2K03 A;  1X32 A;  3H91 A;  4RAU C;  1DOK A;  1BO0 A;  3KBX A;  1MSH A;  3P7J A;  5D65 A;  1PFB A;  1HUM A;  2FMM A;  1O80 A;  2SDF A;  2XIW A;  2B2Y C;  2Q8T A;  1CA5 A;  4U68 A;  1EIG A;  4CJ0 B;  2D9U A;  1DON A;  2K05 A;  1PLF A;  1MSG A;  3SVM A;  1NCV A;  1ESR A;  4MN3 A;  1HUN A;  4R8I A;  1DOL A;  1Q3L A;  4HCS A;  4DN4 M;  2RA4 A;  2MJ8 A;  1GUW A;  2B2V A;  2FFK B;  1BBX C;  3MTS A;  3IFD A;  2B2U C;  2EOT A;  1G2T A;  5DNF A;  1SAP A;  1B3A A;  2KUM A;  2L11 A;  1ZXT A;  2NWG A;  1X3P A;  3DM1 A;  3FDT A;  1PFM A;  2NZ1 D;  2RVL A;  2KVM A;  1EQT A;  1HFN A;  1F9Q A;  3QO2 A;  5EPJ A;  1F9P A;  4XT1 B;  4UAI A;  1AZP A;  1EL0 A;  3GV3 A;  1U4L A;  1XX8 A;  2K01 A;  4IUP A;  2FJ2 A;  4IUV A;  1HHV A;  1HRJ A;  4ZLT F;  3FPU B;  2HUG A;  2B2U A;  4XDX A;  1WD1 A;  2K1B A;  3G7L A;  1VMC A;  3N52 A;  4RA8 A;  3TZD A;  1ILP A;  1DZ1 A;  1VMP A;  5T1I A;  1RTN A;  2L9H A;  1G2S A;  3DEP A;  4X3T A;  4ZKB B;  2N55 A;  4CJ1 B;  1U4R A;  3I3C A;  4RWS C;  2HDL A;  1RHP A;  2MPM A;  1ML0 D;  3F2U A;  5EPK A;  1MGS A;  5AFW A;  1G91 A;  5CMD A;  1WTO A;  4LMQ D;  1B4O A;  1TVX A;  4IUU A;  2B2Y A;  1S4Z A;  5D14 A;  2X69 A;  2X6G A;  1IKL A;  1PDQ A;  4IUR A;  1WTV A;  1CA6 A;  2HCC A;  1XYI A;  1WVL A;  2J7Z A;  3GV6 A;  2X6L A;  4IUT A;  5COR A;  4OIJ A;  5EPL A;  1WTR A;  3DEO A;  5E4X A;  1E0B A;  5CBE E;  1AZQ A;  4X3K A;  2IL8 A;  4HSV A;  1O7Y A;  2B2W C;  1CM9 A;  1AP0 A;  1F9S A;  1M8A A;  1ROD A;  2RSN A;  2EE1 A;  4IUQ A;  1NR4 A;  2L12 A;  2RSO A;  2DY7 A;  2MP1 A;  3IL8 A;  4O42 A;  5EKI A;  1SSO A;  2K28 A;  1ILQ A;  2B2T C;  4X3S A;  4QUF A;  1WD0 A;  1BF4 A;  2KEC A;  5EQ0 A;  3UI2 A;  2BDN A;  2KEE A;  2VXW A;  4R9W A;  2Q8R E;  3KUP A;  1LV9 A;  4MHE A;  1HA6 A;  2FIN B;  2K04 A;  5EJW A;  4ZK9 B;  2CVR A;  2N88 A;  1DOM A;  1HFG A;  2L4N A;  3Q6S A;  1C8C A;  2KED A;  2HDM A; 
#chains in the Genus database with same CATH topology
 1BCP B;  3KLW A;  3CF5 A;  3CME A;  1PH7 A;  1J8I A;  1O78 A;  3I8Z A;  2UXC L;  1VQ9 A;  1RTO A;  1YHB A;  4YCV A;  2IPK D;  3TZU A;  3VR3 A;  3OYY A;  4DV7 L;  3ONA B;  4IJH A;  1H9K A;  3CC7 A;  4DR2 L;  2R92 B;  1F77 A;  2G5D A;  4FVM A;  1O7I A;  3RR5 A;  3UE1 A;  4PNY A;  2RHQ B;  1I50 H;  2MNA A;  3NEM A;  1YHA A;  3F2C A;  1PZI D;  4XT3 B;  3CCS A;  2Q8I B;  2Q2T A;  1TWC B;  3R3O A;  5A35 A;  4OGQ C;  3J80 c;  4APV A;  1SYF A;  4RGN A;  1O80 A;  2F4V Q;  4A3I G;  5BR8 Q;  3TP8 A;  3I4N B;  3CPW A;  3L3O C;  1PH6 A;  4JI4 Q;  3TME A;  2SNM A;  4QQB X;  4R8I A;  2MJ8 A;  2ZT9 C;  1BBX C;  3IFD A;  4BY1 B;  3BZC A;  2JA8 B;  4C3I H;  2KUM A;  4HSP A;  4DV6 L;  2AQ1 B;  3OMC A;  1EEF D;  1EY6 A;  5EPJ A;  1F9P A;  3AYH B;  1Q1B A;  3HFZ B;  1TT2 A;  3NQI A;  4IUV A;  3UDX A;  3BDO A;  1LTB D;  3BDL A;  1ILP A;  4BY7 G;  2JEB I;  1DZ1 A;  1EQV A;  4OO1 G;  1X54 A;  4DV2 L;  3U4V A;  4X3T A;  3PUY A;  3WDN A;  1I4X A;  4GKJ Q;  3I4M G;  1V9P A;  2NBF A;  1KHI A;  3CP0 A;  4L5R C;  5CGK A;  3GTO B;  1KLU D;  1NMF A;  1TWG B;  3GTM B;  2UXD Q;  5CYU A;  1YJN A;  1WVL A;  4DR3 Q;  2OXP A;  3JAM E;  1S40 A;  1V1P B;  3IRB A;  1ET9 A;  4X3K A;  5CV9 A;  4PMC A;  2Z8L A;  3CCQ A;  2Q2U A;  1HA5 A;  3CW2 C;  2H5X A;  4IUQ A;  3E9I A;  4IUN A;  1YJW A;  1OXT A;  2K28 A;  5IP7 H;  4HR7 B;  5I6W A;  2I46 A;  5EQ0 A;  3BVG A;  3E5S A;  4LFA Q;  1C7Y A;  1D5X C;  1LT3 D;  2JEA I;  1A63 A;  2KQ3 A;  4OL7 A;  5FLX E;  2K04 A;  5IIF A;  2JA5 G;  3M3Y H;  2HDM A;  5T1G A;  1XTC D;  4HJ7 A;  4N9T A;  2ES2 A;  1SNQ A;  1Y1V H;  2B2V C;  1BNZ A;  3GTL H;  3K5O A;  2A6E D;  1SND A;  3IFT A;  5E1F A;  3OWE B;  2J0T D;  4NXM Q;  3C46 A;  2HIV A;  3PV0 A;  3HOV B;  1RJT A;  4KKT A;  5J3B A;  3LWE A;  4DR6 L;  2JYO A;  2MHV A;  2QDL A;  3T1H Q;  4A3L H;  1MBY A;  1SNM A;  1W6K A;  3NP8 A;  1BBW A;  5IYC H;  4X3U A;  3A74 A;  4GN3 B;  1ENC A;  3EBE A;  4S3S A;  4DR7 Q;  3H0G B;  4DK3 C;  1B50 A;  3U58 A;  4KKS A;  1TXY A;  2R7F A;  1K83 H;  4UP7 A;  2ZTC A;  5CR3 A;  5I2Y A;  1JCK B;  3D4D A;  3J7Z C;  3CCR A;  3P1H A;  1PLF A;  1MSG A;  1EYC A;  3K0X A;  1W2B A;  2B2V A;  2CQO A;  3CC2 A;  2QA4 A;  3NBH A;  4MZ9 A;  3TBI B;  4J8Q A;  1SEB D;  2PQE A;  3H94 A;  4DV0 Q;  2VQE Q;  3UDG A;  2K01 A;  4IN3 A;  3K5N A;  1PXU A;  3D6C A;  2A73 B;  5C4Z A;  2R92 H;  1SJE D;  4JK1 C;  3MAQ A;  1MJE A;  3OTO L;  1N34 Q;  4Y52 H;  3DEP A;  3HKZ E;  2XWB B;  1U4R A;  2G9D A;  4FO2 A;  1TWC H;  3WOE A;  4FXG C;  5EKK A;  2X69 A;  2JQO A;  2MO0 A;  1Y1W H;  3PIO 3;  2ID0 A;  3NHH A;  1V43 A;  1C9O A;  4JBJ A;  3I4N H;  2PYK A;  3HKZ B;  5G3L F;  2K32 A;  3ND8 A;  2B2W C;  1AE2 A;  2EYF A;  3NEN A;  1B9N A;  2Z4I A;  2QEJ C;  2IY5 B;  2PMZ B;  4DK1 A;  3PIO A;  1UEB A;  1W3S A;  2F0P A;  4HIO A;  1HZ9 A;  1SYG A;  4ZK9 B;  2Z4H A;  4HJ9 A;  5J39 A;  1PYW D;  2IJ0 A;  1EIY B;  1FGB D;  1FJG Q;  3FKI G;  1X3G A;  3HG9 A;  4LF9 Q;  4LUV A;  2L15 A;  2JA9 A;  4IPC A;  1HPC A;  5KIX A;  2AWN A;  2PW7 A;  4HTH A;  4DAP A;  1QIL A;  4KJO A;  3HRZ C;  3AFP A;  1E1O A;  3PMF A;  4A3F G;  5JAV A;  4IFD I;  4H02 A;  1HH2 P;  3PSI A;  1K73 C;  4AIM A;  4IFD G;  1L0W A;  1PRT C;  2NYZ D;  3CMA A;  3KDF B;  1EFI D;  2B2W A;  5FJ8 H;  2LXJ A;  3F1Z A;  4CBV A;  1OO9 B;  1U4P A;  2KOL A;  1N36 Q;  3DHQ A;  1B8A A;  1KQS A;  1JB3 A;  4Z9C B;  2DUD A;  4P72 A;  1GUS A;  1SYC A;  3RUZ A;  3PIP 3;  4JV5 L;  2B2Y C;  1HR0 Q;  4DA2 A;  3VR6 A;  4CJ0 B;  3MVV A;  5IGG A;  3CCV A;  3KYH C;  3RMH A;  1PH1 A;  4OWW B;  2NTS A;  4DN4 M;  4YY3 Q;  4AYB G;  4H0L C;  4LF7 Q;  5JEA J;  3PIP A;  2RVL A;  4DU9 A;  1GOZ A;  3Q0A A;  1HNX Q;  1HFN A;  1I4P A;  1BUV T;  4AH6 A;  3MHB A;  4R8N A;  3S2D B;  1XPR A;  2RKS A;  4HID A;  1JJ2 A;  2B29 A;  3LX0 A;  1BCP D;  5M5X B;  2A68 D;  1VMP A;  4XQJ A;  1PTO C;  5GAE C;  4ZKB B;  1J5E L;  4ZUJ A;  4CJ1 B;  1R9T B;  1D2B A;  4DXF A;  3DWP A;  4A3K B;  5M3M B;  1JMC A;  2F0E A;  4DR1 L;  2JA6 G;  3JAM c;  2B2Y A;  1S4Z A;  2DJF C;  4GN4 B;  1IXR A;  3S15 B;  3MXN B;  5ELC A;  3GV6 A;  1VQN A;  1EYG A;  4KKU A;  3A5Z B;  3FVQ A;  4GLA C;  4DNT B;  2F4I A;  4X6A H;  1JOO A;  1VQI A;  5FLX c;  2C5C A;  2CH4 W;  2ASB A;  1PH2 A;  2KCC A;  1VQJ A;  3UI2 A;  2BDN A;  1PYS B;  1V1Q A;  5M5Y B;  4MHE A;  4JI3 Q;  2N78 A;  2IX1 A;  3NPP A;  5AJ3 L;  1ENF A;  1AH9 A;  2Z1C A;  3BZD B;  4A3M G;  2ZM6 Q;  4A3J G;  2QIL A;  1F9R A;  5JEA G;  1T5E A;  3V96 A;  3C2P A;  1WTQ A;  3QOL A;  4NMZ A;  4ZRZ A;  2M00 A;  3ULJ A;  5LL6 S;  1IHZ A;  4B9W A;  1SE8 A;  1M1K C;  1TR5 A;  2V1C C;  1SFO B;  2NVY H;  2XVS A;  1JB7 A;  2KCT A;  3DWA A;  1Q7Y C;  4FF2 A;  1L1O C;  2UU9 Q;  3ERS X;  1EYD A;  4WJW A;  1D6E C;  3HOU H;  4TRD A;  2K75 A;  2EY5 A;  3C3L A;  3EIV A;  2R3Z A;  5E4W C;  4A3I B;  1QVF A;  3P7J A;  3KBX A;  4IJL A;  1L2F A;  2E76 C;  1W6J A;  1QVC A;  1CA5 A;  2WB1 E;  3GTP H;  3H3V H;  4RKL A;  2F3V A;  4LF5 L;  1EZ8 A;  1CHP D;  4NXN L;  1FNW A;  1WCM G;  5FO7 B;  1CQV A;  4DR4 L;  3IAY A;  2K50 A;  3A8I E;  3BZK A;  1RF2 D;  2EXZ A;  1N32 Q;  4OON A;  3OSO A;  1A2U A;  2WB1 B;  4GZY C;  3S16 B;  1I94 L;  4BBS G;  1HUN A;  3K80 C;  3SDZ A;  1B1Z A;  1L1O A;  1WD1 A;  4UP8 A;  3G7L A;  1VMC A;  3N52 A;  2TSS A;  3RLF A;  2XWJ B;  3CRL C;  3I4M B;  3J7A 5;  3E3X A;  5FO9 B;  4LUZ A;  2N55 A;  3I3C A;  5DM6 3;  4NB3 A;  1STB A;  1PA6 A;  4RG1 A;  2WKD A;  2F0V A;  1WTV A;  2NZO A;  5LMN Q;  1XNR L;  4GKK L;  5HUR A;  4RKB A;  2F03 A;  4QB4 A;  5CV4 A;  3ITP A;  3QJY A;  2KHI A;  3IL8 A;  1SSO A;  1SR3 A;  4WOR A;  3GTK B;  2JA5 B;  2OTL A;  4Q0F A;  4CKC A;  1IBK Q;  1IBM L;  4HCE A;  3URY A;  4JI7 L;  1VQ5 A;  1K9M C;  4A3C G;  1U9R A;  5M5X H;  3OW7 A;  3HZX A;  5JJZ A;  5A2Q L;  4QUC A;  3VYS A;  1R9T H;  3L9A X;  3FHW A;  1OTC A;  3TN2 A;  3I55 A;  1EOV A;  2IHE A;  4LF8 Q;  3MEH A;  3S15 H;  4F87 A;  4ZKC B;  5KRU A;  4PV1 C;  1QNK A;  2UUA L;  1TS3 A;  2JN4 A;  3DXJ C;  1KNA A;  3GTQ B;  1Q8I A;  2F0I A;  4PZ7 A;  5I2X A;  4YWL A;  5C3X A;  1NAP A;  4A3G G;  5IYB H;  1D7Q A;  4DXG A;  5D65 A;  4KHZ A;  3E0E A;  1L0Y B;  5TSS A;  4GNX C;  4KHV A;  3B6Y A;  3CC4 A;  2CQA A;  2YU9 B;  2A5H A;  1XMQ Q;  1VQG A;  3D0F A;  2XGT A;  1EY0 A;  3GQB A;  2F3W A;  1B44 D;  4C3J B;  2RCN A;  4YHH Q;  4RH6 A;  4M8A A;  3M4Q A;  3MFG A;  4RHS A;  1XTD A;  3HOZ G;  4TVA B;  3S2H H;  1TKW B;  2XNA C;  4F88 A;  4A3D G;  3NTH A;  3NWT A;  1VQB A;  4R4I A;  3TSS A;  1U4L A;  3M4Y A;  2R61 A;  2JA7 H;  4A3E G;  2XRQ D;  4B3R L;  1SMY D;  3NSW A;  1H9S A;  4N8F A;  3I73 A;  1IZ6 A;  1RHP A;  2VY3 A;  3F2U A;  3CCE A;  3T53 B;  1GUN A;  5CMD A;  4KN4 C;  1IW7 D;  2MUY A;  4GNX A;  4IUR A;  4JI4 L;  2BCO A;  2WII B;  3HKS A;  3AQQ A;  4WJ4 A;  4X66 Q;  4DAM A;  2GN5 A;  2K5W A;  1D5M C;  3FPP A;  4JI8 Q;  3J7Y W;  1NBW A;  2ATW A;  2JXM B;  1Z47 A;  2DY7 A;  1KRT A;  1KDA A;  5IOC A;  1RKN A;  4H7B A;  1SE2 A;  4YWM A;  1F2Z A;  4GOP B;  2E75 C;  2N88 A;  3A8K E;  2PI2 E;  3KBG A;  4NDX A;  3A8J E;  1CHQ D;  3GD7 A;  1EQR A;  2F0U A;  3HOY H;  1KNE A;  4IOA A;  1MI2 A;  4HAE A;  4RFB A;  3G48 A;  3TP5 A;  5IWA L;  1JOQ A;  1KTK A;  4C3H G;  1QG7 A;  5C3W A;  2B63 H;  3S1N B;  3NEL A;  4CDE C;  2QKI C;  1KAA A;  1TII D;  3S1M B;  3P75 A;  1ICF B;  3KF8 A;  2EJG C;  4HED A;  4AYB E;  4G7Z C;  2Q2H A;  3A56 A;  3Q22 A;  2VUM G;  3STB D;  3R93 A;  1B2T A;  2NTT A;  4KI0 A;  1X9N A;  3G71 A;  1XNQ Q;  3R8B A;  3EVQ A;  5G3L D;  3G4S A;  2XTI A;  2Q8T A;  2DNE A;  4DK0 A;  4P2C B;  2JSO A;  4RGO S;  5E3F A;  4F7X A;  5A2Q E;  4AYB B;  1EY5 A;  2WP8 J;  5BN3 A;  4HJ8 A;  2HQE A;  1K8G A;  3TP7 A;  4P74 A;  2L11 A;  4B3M Q;  5C3E G;  4XIG S;  1M90 C;  2NZ1 D;  2F0W A;  3BYY B;  5GAH C;  3T1H L;  3GV3 A;  3NBI A;  4XXE A;  3EN2 A;  4BS9 A;  2E2I B;  3OIQ A;  3TS0 A;  3VDY A;  4X62 Q;  1HJP A;  4JI0 Q;  5JJI A;  4A93 G;  2BE5 D;  2CFM A;  5C4X H;  3GTQ H;  1S5C D;  2JA6 B;  1SJH D;  2WV6 D;  4DAY B;  3I7F A;  5C6A A;  5EAY A;  5AFW A;  5J22 A;  4KHP Q;  1HR0 W;  4RCN A;  4FXK C;  4IAL A;  4V19 0;  4F8M A;  4JI2 Q;  3KLR A;  1K8A C;  1XMO Q;  1NMG A;  4IUT A;  3G6E A;  2YU9 H;  3F2B A;  2PCF B;  3U50 C;  1CTM A;  4K6D A;  1MHW C;  2I5L X;  4GN5 A;  2EE1 A;  2D0P A;  4C3J H;  4DV0 L;  1A3T A;  3K57 A;  1DD2 A;  5EKI A;  1K0S A;  5C0X I;  3PO2 G;  2VQE L;  4K2K A;  4JI1 Q;  1G6P A;  1LTA D;  1BR9 A;  1L0X B;  4A3M B;  1E24 A;  4P73 A;  4A3J B;  3K7A B;  1V1P A;  3SR1 A;  1C8C A;  4A3B G;  4XQQ A;  1N34 L;  2IWH A;  3I56 A;  2HCI A;  2F0K A;  2E74 C;  1YNN D;  5FO8 B;  5ELO A;  2UUB L;  3NWS A;  3UDF A;  2F0Q A;  3J7A V;  1JIC A;  3L7Z C;  1QJO A;  1NNX A;  2KJX A;  4ZYS A;  1I4Q A;  1QNU A;  3J81 L;  3K59 A;  5ELF A;  4TKO B;  4XQN A;  1O7Z A;  1YNJ D;  3MXU A;  5HGQ A;  3NE5 B;  4R4O A;  1RDP D;  1PFN A;  1VQD A;  3S17 B;  5F2D A;  4AQY Q;  4OXP A;  1TS2 A;  2C9O A;  4LF4 Q;  4NW2 A;  2UXB Q;  1JOK A;  1F2M A;  2XN9 C;  2VS1 A;  2ZJR A;  4BXX G;  1LO5 D;  1EU4 A;  1IL8 A;  2BH2 A;  5IT9 L;  4DK6 C;  1VS0 A;  4NPS A;  4DV3 L;  2C35 B;  1S5B D;  4U68 A;  1WCM B;  1KRS A;  2VL6 A;  4LF9 L;  2SNS A;  1KD1 C;  3KJP A;  1BVS A;  1GJX A;  1CFM A;  4RCO A;  4Q5V A;  2NN6 H;  3A54 A;  5IP9 H;  1BBU A;  1ZXT A;  3H15 A;  4UY8 C;  3HOW H;  4BBS B;  2A19 A;  2N8N A;  2H4O A;  3QO2 A;  4DV7 Q;  1YBY A;  3NK9 A;  4P71 A;  2R7Z H;  4KN7 C;  3EQL C;  1YJ9 A;  3S14 H;  1N36 L;  4WJ3 M;  4GLV B;  4K8J A;  1P8L A;  2K5N A;  3VR5 A;  4ZUI A;  4DV5 Q;  3KFU A;  2R93 G;  1HR0 L;  2NUC A;  2ICE C;  4LMQ D;  2A6H C;  2RHS B;  3H3V C;  1H9J A;  2IHF A;  3JAM i;  1CA6 A;  2BA0 A;  2Y0S E;  1UE5 A;  4DFA A;  1Q82 C;  3K5M A;  2IL8 A;  4HSV A;  4DNI A;  3D3R A;  4C3I G;  5C4J B;  4N9P A;  1K8M A;  4IFD J;  3RZD B;  4O42 A;  3U9O A;  1BOS A;  1ILQ A;  1X56 A;  4DV1 Q;  1WD0 A;  1Z7T A;  1CKM A;  1HQR D;  3KUP A;  2Y0S B;  1ZYR D;  3TEH B;  1FVI A;  2E2I H;  3GTG B;  3ND9 A;  5EPK A;  2OQK A;  2PMZ E;  4H13 C;  2A8V A;  2JP1 A;  2M9V A;  5IYD G;  1S3O A;  2K5V A;  4L5T A;  2MGS A;  1V1O A;  3S1R B;  2YV5 A;  4PZ8 A;  1PZJ D;  2IW3 A;  1NY4 A;  5LMN W;  2A1A A;  4BY1 H;  2JA8 H;  5LMU L;  1PZK D;  4J15 A;  1GHJ A;  1TWH B;  2ICI A;  4QF4 A;  4HIM A;  4ZAI A;  5M3F B;  4A3G B;  1PRT F;  3K5L A;  4JVZ A;  4FNF A;  5IP7 G;  1VQA A;  1WFQ A;  1VQK A;  5FKA C;  1A15 A;  1JE5 A;  1BO0 A;  1LT4 D;  3AEV A;  3AFQ A;  1Y69 U;  2EYO A;  3UDI A;  3KDF A;  2KA7 A;  2ZM6 L;  2XRS D;  1E3P A;  4K8I A;  3GTO H;  5JEA H;  2PNR C;  1DOL A;  1TWG H;  1Y1V G;  2L5T A;  1SYE A;  4HCS A;  3J81 E;  3GTM H;  2EYP A;  1PVO A;  5I6Y A;  4A3D B;  5DNF A;  2QF7 A;  2B8F A;  3NQT A;  3V2T A;  2K5H A;  2K33 A;  2LMC B;  4A3E B;  2UU9 L;  1RD9 D;  1UNS A;  4DR6 Q;  5DEH A;  4ME3 A;  2FJ2 A;  4A3L G;  2HUG A;  2OWO A;  1NE3 A;  2ALY B;  3H09 A;  5IYC G;  4CDC C;  4K2L A;  5IT9 E;  3S17 H;  5FLM H;  4DUZ L;  3SK4 A;  2RF4 A;  4IQZ A;  3VYR A;  3CCU A;  1STN A;  2A69 D;  4RWS C;  1PTO F;  1ML0 D;  2KHS A;  1B9M A;  3SK5 A;  4B9X A;  1AFP A;  2EYJ A;  4L5S A;  2VB2 X;  5DAU A;  3AU7 A;  4ME5 A;  3MC0 B;  2J7Z A;  4ZQ3 A;  1PH3 A;  4LF6 Q;  3J80 L;  1WCM H;  2EQS A;  3HOV H;  1E0B A;  1AZQ A;  4B3S Q;  1ET6 A;  1JJC B;  2IX0 A;  1I3Q B;  1I6V C;  1HZB A;  1EWH A;  3QWN A;  1Q1E A;  5C5M A;  3CQZ B;  3MXN A;  1E2W A;  1HZC A;  1BQQ T;  5ELD A;  3H0G H;  2CVR A;  1G51 A;  2CW0 D;  1HTL D;  5HGT A;  5EKL A;  1FL0 A;  3S1Q B;  3OTO Q;  3PF5 A;  4R4C A;  4C3H B;  1KC8 C;  2B8G A;  1LTI D;  1AE3 A;  4B08 A;  1YHQ A;  2D0O A;  5LMN L;  3W2D A;  5KNB A;  1Y1W G;  2EJF C;  3HGB A;  1HNW Q;  1JE4 A;  2O4X A;  3DMU A;  2MFI A;  1EY8 A;  3PUZ A;  1JWS D;  3CCJ A;  4OHJ A;  2AWO A;  1KAB A;  5ELB A;  3M4O B;  1CKN B;  3C1E A;  4X64 Q;  1EOT A;  3RN2 A;  1EIF A;  5IGF A;  1LUZ A;  1C0A A;  3RZD H;  3U4Z A;  4FP5 D;  3M85 A;  1UEA B;  4TQU S;  4LFC Q;  4HMJ A;  3C1F A;  3GTJ B;  1YIT A;  4B3T Q;  2K05 A;  1H95 A;  4ZCK A;  2BA1 A;  5C3E B;  2QW7 A;  1YNX A;  1STG A;  4JYA L;  1JJG A;  5JJK A;  1B3A A;  4LFB Q;  3FDT A;  1EY4 A;  2HHH Q;  2A6E C;  3TQY A;  2WKC A;  3S1R H;  4C56 C;  4A93 B;  1YZ6 A;  4IUP A;  2K4K A;  1JR0 D;  3VYT A;  1SBB B;  1TWH H;  3OPO A;  2K1B A;  2MQH A;  2ZTE A;  5FJ8 G;  3H6M A;  4YWK A;  5M3F H;  3MFY A;  1UAP A;  3MXG A;  2QGQ A;  2Z0S A;  1LTR D;  5GAD C;  1A8V A;  5KND A;  4YCU A;  1B4O A;  1LTG D;  4N8X 1;  4JV5 Q;  1SE3 A;  1QUQ B;  1SMX A;  3RZO B;  1XMQ L;  5K36 H;  4K6L A;  4IPH A;  2X6L A;  1UE1 A;  5M5W B;  1NJI C;  1IBL L;  3DEO A;  1UWV A;  1N33 L;  4BY7 B;  3PO2 B;  4DV4 L;  1HCZ A;  4JI6 L;  1LTS D;  1NR4 A;  2MP1 A;  4A3D H;  2PZU A;  4EX5 A;  1I5F A;  2E2H B;  4EVO A;  1SRU A;  3Q24 A;  2AUJ D;  2E2D C;  3TRE A;  4A3B B;  2Q8R E;  4M1U B;  5NUC A;  3HOX G;  4A3E H;  1N8R C;  1HNZ L;  1GUG A;  2JE6 I;  2Q2I A;  2KED A;  1YVC A;  3NUC A;  4LK1 C;  1TU2 B;  4DGZ A;  1J5E Q;  1K28 A;  3A7L A;  4C1N I;  1J6Q A;  2D5D A;  4DR1 Q;  3W5O A;  1SE4 A;  3I90 A;  4ILW A;  3J80 E;  1WTP A;  2BH8 A;  4QCL A;  4KV6 A;  4R4T A;  5CBA E;  4JI8 L;  4OX9 Q;  1DYQ A;  2F0T A;  3N6R A;  1VQM A;  1VDZ A;  4FDB A;  1HQM C;  1M4V A;  3D6W A;  4P75 A;  3S2D H;  2BOS A;  1LLR D;  5JOB A;  4LJZ C;  1I3Q H;  2IX3 A;  3J7A F;  3I91 A;  4IPG A;  2YTX A;  1DM0 B;  1GUO A;  2BDO A;  2VQF L;  1X32 A;  4JI5 Q;  2K52 A;  4DUY Q;  2SDF A;  3CQZ H;  3D8G A;  2J4X A;  1TQO A;  4A3K H;  5M3M H;  5AJ3 Q;  2EDG A;  4ALP A;  1Y14 B;  1VQ8 A;  1S5E D;  4KD4 A;  2AHO B;  3S1Q H;  1GUW A;  2FFK B;  4C3H H;  4KY7 A;  5IE8 A;  1KDC A;  2AUK A;  3RNU A;  2EIF A;  4IPD A;  1K0R A;  5FK9 C;  4CGY B;  4PMB A;  2AMC B;  3P20 A;  4ZLT F;  3TDQ A;  2B2U A;  2LXK A;  3BVM A;  3T1Y Q;  3HS0 C;  3KF6 B;  5M5Y H;  3HOU G;  3HKZ G;  3M4O H;  2R93 B;  5I9O A;  2L9H A;  1QCB D;  1G2S A;  5IY0 A;  2UUC Q;  1MGS A;  4R1J A;  3H3V I;  2EYM A;  4IUU A;  5GQO A;  1Q46 A;  3GTJ H;  4LF5 Q;  4DNR B;  3RN5 A;  3CAM A;  4C3I B;  1HXY D;  3PGZ A;  1SFO H;  1H9R A;  4B3M L;  2F52 A;  1CM9 A;  3L2P A;  1AP0 A;  5C3E H;  4KY5 A;  4EQN A;  4DR4 Q;  2NZH A;  2B2T C;  4X3S A;  1Q8K A;  2NVT B;  2PQA B;  4X62 L;  4HMI A;  1PHJ A;  1D8L A;  1LV9 A;  4KLK A;  5IGB A;  1I94 Q;  2F4V L;  5IGE A;  5BR8 L;  1G8Z D;  4FF4 A;  4A3I H;  3TP6 A;  1ENA A;  4CDD C;  1AW7 A;  4OIK A;  4UDU C;  4XYO A;  1BCP C;  2A68 C;  3HP3 A;  4JC0 A;  1DGS A;  1D5Z C;  3TS2 A;  4JI2 L;  4H44 C;  2OCE A;  2CCZ A;  4FXD A;  1XMO L;  1PH5 A;  5COY A;  5I4D A;  4QIW B;  2EY1 A;  3RD4 A;  2RDH A;  3RZO H;  2NVQ B;  3MZ5 A;  4BBR G;  5EBC A;  1EFW A;  1WI5 A;  1Y8N B;  4DKA C;  1ASY A;  4PG3 A;  3JAM L;  3FKI B;  5M5W H;  3PCO B;  4CJ2 C;  4L5Q A;  3S16 H;  2OQ0 A;  4BY7 H;  2GA4 B;  3NXW A;  3PO2 H;  4DR5 Q;  4JI1 L;  4I7A A;  2CWP A;  2CWA A;  4XTC S;  4OO1 H;  5JJL A;  2B2T A;  3M3Y B;  1KLG D;  4RAU C;  3W3A A;  1EUJ A;  4GKJ L;  2E2H H;  1DOK A;  2PI2 A;  3WWV A;  4A3F B;  2RDF A;  3I4M H;  1SLJ A;  2Z9H A;  4X65 Q;  4JI7 Q;  5FLX L;  2UXD L;  1Y1V B;  1T5X D;  2E5L Q;  3A5U A;  2XSC A;  3FP9 A;  4DR3 L;  4IO9 A;  1C4Q A;  1A3U A;  1VQC A;  1QB5 D;  2IT1 A;  2AQ3 B;  1CSQ A;  1GXD C;  3D4R A;  4A76 A;  2MO1 A;  2EOT A;  3MEF A;  2O2L D;  3OMG A;  3ULL A;  2LSS A;  4L8J A;  4LW1 A;  3SGI A;  5H1S E;  4U67 3;  2VNU D;  3X3N A;  3J81 j;  4LFA L;  4YIJ A;  3GO5 A;  3NTK A;  3I4O A;  1YIJ A;  4FF3 A;  4JOI C;  4LF4 L;  3GTK H;  2JA5 H;  2UUA Q;  2UXB L;  3AMU A;  4RA8 A;  3BU2 A;  2HIX A;  1KDB A;  5C0X J;  3W1G A;  2QDB A;  1DXM A;  5GRO A;  5C44 G;  2HDL A;  5JVG 3;  4WRD A;  1A2T A;  1WTO A;  4NXM L;  1VF7 A;  1QZH A;  1PRT D;  2ZTD A;  2KCN A;  4ABN A;  3KF8 B;  2G9H D;  2K7V A;  1PV4 A;  1QZG A;  5E7N A;  1G29 1;  5GAG C;  2OF1 A;  4KMU C;  4UP9 A;  1B7Y B;  4DAY A;  4K0K Q;  2K6A A;  4DR7 L;  2EYH A;  4KJN A;  2OEO A;  3BG3 A;  3M9B A;  2JA7 G;  3D4W A;  2R6G A;  4KTA A;  1DOM A;  4JOI A;  1JOR A;  1PFS A;  2WIN B;  1ZEQ X;  1PYB A;  1S72 A;  2PW5 A;  2EVB A;  4DV5 L;  3OIP A;  3PO3 G;  4B3R Q;  2F0M A;  1Q90 A;  1K3B C;  2R93 H;  3I72 A;  1Y1W B;  1VQ4 A;  3QOJ A;  5EGT A;  1FYC A;  1U4M A;  3CCM A;  2LS0 1;  3U9S A;  3ICE A;  1NTG A;  1I4R A;  1PTO D;  3MA2 B;  1A62 A;  2DN8 A;  5C0X G;  3GP7 A;  4C2M B;  2WFW A;  4DV1 L;  1GO3 E;  5D3D A;  3KJO A;  1ICW A;  1VQO A;  3JC6 6;  1HTP A;  5IGD A;  2NVT H;  2I0Q A;  4OO1 I;  1TY2 A;  2WAQ G;  2WB1 G;  1Q86 C;  4BWG B;  1EIG A;  2D9U A;  2RCF A;  3LNN A;  3HOY G;  1NCV A;  4MN3 A;  3K58 A;  3BS1 A;  1RCV D;  1Q3L A;  5IYD H;  5J1Z A;  3KLS X;  5LHY 1;  1G2T A;  5IWA Q;  4K5W A;  2NWG A;  4G7H C;  3BVZ A;  2F0O A;  4K14 A;  2B63 G;  1OXX K;  2F0J A;  1JC7 A;  4HN7 A;  3ULP A;  2NVQ H;  3GDE A;  4G4K A;  4KY6 A;  1OXU A;  4NKL A;  4QMG A;  1HZA A;  1KAW A;  1FJG L;  2PZT A;  2PO4 A;  4JBK A;  3FKI H;  1FNV A;  1S5F D;  4MNO A;  1GVP A;  2RDG A;  1BXT A;  1SNP A;  3PUX A;  4KK7 A;  1QVG A;  1G91 A;  4CKB A;  1QOH A;  2UXC Q;  4A3F H;  5D14 A;  2KBN A;  3MXP A;  3VR2 A;  2AQ2 B;  5JPM C;  2LKV A;  2V4D A;  2F0L A;  3D31 A;  1CUK A;  4EQ5 A;  3R2I A;  4IFD H;  4OIJ A;  1WJJ A;  4OWT B;  1STA A;  5CBE E;  3T16 A;  2HD3 A;  4DR2 Q;  5KYI A;  3S1N H;  3S1M H;  2RSO A;  4Y7N B;  3HOX B;  2KEE A;  3BDC A;  3RLO A;  2ZXO A;  5CV7 A;  1HA6 A;  4QGU A;  5IGC A;  2L4N A;  3Q6S A;  2D2C C;  2YTV A;  2F0S A;  5C4X G;  3QR8 A;  3G6J B;  4YY3 L;  5EBD A;  1SXT A;  4LUO A;  4V0B A;  2K14 A;  3DM3 A;  4MTK A;  5HY6 A;  2L55 A;  4LF7 L;  1EIH A;  1SMY C;  4UHV A;  2EZV A;  3A55 A;  2ZJP A;  3QB3 A;  1HNX L;  4LF6 L;  3VR4 A;  4HIK A;  4QL5 A;  4DV6 Q;  1WTW A;  4FYD A;  4B3S L;  1IW7 C;  1DJR D;  1V8Q A;  3I70 A;  1CQF A;  4C3J G;  1E2V A;  1FGU A;  2EY6 A;  2VB3 X;  3NBH B;  4DV2 Q;  1KXL A;  3Q23 A;  4EGV A;  3A7A B;  4TSS A;  2JA6 H;  1KIX A;  1EEI D;  4HJ5 A;  2I07 B;  1DON A;  2UUB Q;  4BA2 I;  3VA5 A;  3MTS A;  1U5K A;  2NVY B;  1X65 A;  1LTL A;  1SAP A;  2YYZ A;  3E0J A;  1I4G A;  1VQF A;  3A0J A;  3ZYY X;  5JVH 3;  3LWU A;  3DM1 A;  1HNW L;  3BYT B;  4MTN A;  5DM7 3;  2GVA A;  4JI3 L;  1XX8 A;  3PUW A;  3HOU B;  4QJF A;  2KHJ A;  4I65 A;  1K8O A;  4X64 L;  1EY9 A;  2SEB D;  1OXV A;  3TZD A;  4HJA A;  1LM0 A;  1O7L A;  3K8A A;  4C2M H;  2HT1 A;  4LWC A;  1RTN A;  4A3M H;  4A3J H;  1WOC A;  3K7A H;  4MIU A;  3GTP B;  5ELN A;  2MPM A;  1LAB A;  5CV6 A;  4JG2 A;  4LFC L;  3HOZ B;  1IYJ B;  3STB C;  4DV3 Q;  4B3T L;  2X6G A;  1IKL A;  1PDQ A;  1A6X A;  1II3 A;  2HCC A;  4RMF A;  1XYI A;  1JQY D;  1XPU A;  2NN6 I;  5KYL A;  4LFB L;  2VZA A;  2F0D A;  2NN6 G;  4QY7 A;  5IP9 G;  2HHH L;  2L12 A;  3HOW G;  5DLQ E;  4J6H A;  3S9W A;  1TWA B;  3FRP B;  3QIA A;  2PNH A;  2D62 A;  2TMP A;  2R7Z G;  5EJW A;  1XPO A;  4POG A;  1LT5 D;  3UE0 A;  4G7O C;  1PH9 A;  1B53 A;  3CU7 A;  1EYA A;  3DUZ A;  4CDF C;  1EU3 A;  2BE5 C;  4K5V A;  4FF1 A;  2CKZ B;  1MJC A;  3I2Z A;  1IL2 A;  1Z9F A;  3OHX C;  1PH4 A;  4BBR B;  3KLS A;  1N32 L;  1X3E A;  2Z6K C;  4JPB W;  2KCM A;  4DF7 A;  4ODG A;  3F8T A;  4OEL B;  4BBS H;  1NR2 A;  3Q8D A;  1GUT A;  1YEZ A;  1ESF A;  1EQQ A;  2R92 G;  3CKI B;  4ID6 A;  2B39 A;  1FD7 D;  3T51 B;  4JW0 A;  4JBM A;  5JPN C;  3NTI A;  3H91 A;  3VYU A;  2K03 A;  4CHT B;  4Y7N H;  4KD3 A;  3HOX H;  1STY A;  3SHL A;  1U0L A;  3J81 i;  1GHK A;  2RQX A;  1CKN A;  1ESR A;  4GLX A;  1E22 A;  1PRT B;  1XXG A;  2AKW B;  1Q12 A;  3KK7 A;  2RA4 A;  4RGM A;  4BA1 I;  3I4N G;  4YCW A;  2VUM B;  1GM5 A;  1YNN C;  1GKH A;  4POF A;  1NUC A;  1STH A;  4OX9 L;  4BY1 G;  2F0N A;  2Z6K A;  1SRO A;  2JA8 G;  4XT1 B;  5C4J H;  1IBK L;  1C48 A;  5I9P A;  5LMU Q;  1OXS C;  2QEX A;  1I4H A;  2DGY A;  3FPU B;  3DWQ A;  3ER0 A;  2FMC A;  1YNJ C;  1D1I A;  4A3C H;  1R4P B;  1XWE A;  5C44 B;  2I5H A;  1EWC A;  3ZJY C;  5T1I A;  4JI5 L;  4DUY L;  3GTG H;  1VQP A;  3AB9 A;  4L63 B;  2R7D A;  4WFN 3;  2FXQ A;  1Y8O B;  2EYL A;  2SOB A;  4A4I A;  1CK1 A;  1B3Q A;  4O0A A;  5K5P A;  1P16 A;  4LF8 L;  5FOB B;  2EXD A;  1TS5 A;  3PF4 A;  1X6O A;  2EY2 A;  1RL2 A;  1X55 A;  3V05 A;  2ENB A;  3E9H A;  2K5D A;  3S2H B;  1RIP A;  1ROD A;  1PTO B;  2CHB D;  2JA7 B;  1R4Q B;  5KGU A;  1BKB A;  1FR3 A;  1IYU A;  4A3G H;  1QUQ A;  2KEC A;  5KEE A;  1EWI A;  1XJV A;  3CPF A;  5M9O A;  4IZ8 A;  5LL6 X;  3DLL A;  2FIN B;  3T1Y L;  3PO3 B;  3PQI A;  1IYV A;  1EZ6 A;  4I7Z C;  1SNO A;  5FLM G;  2HQL A;  2N3S A;  3FEW X;  4DUZ Q;  2DJG C;  2UUC L;  3O13 A;  3OWF A;  2ZJQ A;  4YHH L;  2EJM A;  5BN4 A;  3EA6 A;  2WAQ E;  4C1N K;  3HOZ H;  2P5Z X;  2L1B A;  2FHT A;  3CCL A;  3HOV G;  1I6H B;  1TY0 A;  1K3R A;  2GVB A;  2M2L A;  2DY8 A;  1SDF A;  4NP5 A;  2EPB A;  2DNC A;  3KOJ A;  1Y8P B;  3CD6 A;  5IOD A;  1H9M A;  3X3M A;  1J9O A;  2WAQ B;  1F2L A;  2B3G A;  3W1B A;  1CZG A;  3HOY B;  3T4A C;  2FMM A;  1A3V A;  3H0G G;  1PH8 A;  1TWA H;  1CZW A;  2WAC A;  1LYL A;  1LT6 D;  4X66 L;  3SK6 A;  4ULL A;  3OW2 A;  5ELE A;  1ZYR C;  2E2J B;  1L1O B;  4G57 A;  3I4L A;  3K7U C;  4DPG A;  1CKO A;  1TWF B;  2B63 B;  5BN5 A;  2B2U C;  3T56 B;  1NSN S;  2NVX B;  2LY7 A;  1X3P A;  1LTT D;  3K6O A;  4CKE A;  1PFM A;  2KVM A;  1EQT A;  4OEM B;  1KL9 A;  1T9H A;  2YTY A;  2I5M X;  1EL0 A;  4BBR H;  4LAA A;  1BDO A;  4DAV A;  5ISR A;  1HRJ A;  3BJU A;  1VQ7 A;  3IKJ A;  4DR5 L;  1ASZ A;  3J81 c;  1QWY A;  1TS4 A;  3E6Z X;  2ZXP A;  1GD7 A;  3LGJ A;  2O5J C;  2L0C A;  4E6I A;  4X65 L;  1EY7 A;  1ZKO A;  5C5L A;  2K5Q A;  2E5L L;  1TVX A;  3SEB A;  1LAC A;  2F0G A;  2Y0S G;  5CV8 A;  4K5X A;  2RBM A;  4OWX B;  3KF6 A;  5EPL A;  5COR A;  1CT1 D;  1WTR A;  1B70 B;  1I50 B;  1X3F A;  5E4X A;  5IT9 c;  3TRZ A;  2KEN A;  1D1K A;  1AN8 A;  2QCP X;  4UPA A;  1SYD A;  1F9S A;  2RSN A;  4JYA Q;  1JT8 A;  3ERO A;  1Q81 C;  3R2T A;  2OT2 A;  2VUM H;  2JJQ A;  2LFN A;  1BF4 A;  3M7G A;  4QUF A;  3SK8 A;  4IOC A;  3EFX D;  4PMW A;  4R9W A;  2A74 C;  1XNQ L;  4O1N A;  1A0I A;  1E7Z A;  5C4H A;  1MD2 D;  1SN8 A;  5C4X B;  1HFG A;  3CHB D;  4GOP C;  5M3F G;  3WOF A;  5C44 H;  4NXN Q;  1YI2 A;  3J80 i;  3OOC A;  1STE A;  1IKM A;  2PQA A;  4EQO A;  2H1E A;  1VCI A;  1BCP F;  1G6Z A;  2A69 C;  5K36 G;  1AEX A;  3L0O A;  1FNU A;  3MWY W;  1WTX A;  3QG1 A;  3CXC A;  1IBL Q;  4K0K L;  4JI0 L;  1N33 Q;  3FMC A;  4J1M A;  1CSP A;  1UE7 A;  4DV4 Q;  4A93 H;  2VW9 A;  3K0Y A;  4QIW E;  1VF5 C;  4JI6 Q;  1QE6 A;  2ZXR A;  1X3Q A;  2A6H D;  5CC4 A;  1PTO H;  1JWU D;  2F3I A;  2E8G A;  3M7N A;  4L6T B;  3T13 A;  4KHP L;  1MSH A;  1PFB A;  5CV5 A;  1HUM A;  4PQX A;  1WYD A;  2XIW A;  3SXH A;  2O5I C;  1HNZ Q;  2F0F A;  3PO3 H;  4GOP A;  3K81 C;  3SVM A;  4GS3 A;  3RLN A;  3ERQ A;  2PZW A;  1XNR Q;  4GKK Q;  1WTH A;  2CW0 C;  1VQ6 A;  4XYQ A;  1H9S B;  1MIU A;  2NB0 A;  1S5D D;  3SE0 A;  1F9Q A;  4R4Q A;  4UAI A;  1AZP A;  3HEJ A;  1SNC A;  4GNX B;  3VA7 A;  5C0X H;  1HHV A;  1Z6H A;  1IBM Q;  4XDX A;  4A3B H;  1I6H H;  4RGT A;  1VQL A;  3GTL B;  1VQH A;  1E1T A;  3F2D A;  4JBW A;  2N49 A;  5D3I B;  2VQF Q;  4RHR A;  1N9W A;  2PPB C;  3M4P A;  4A3K G;  1SYB A;  5M3M G;  4LNQ A;  1VQE A;  5L37 A;  4JCV E;  1DCZ A;  1UE6 A;  3CRK C;  4O2D A;  2CH4 A;  3HOW B;  2E2J H;  1F2Y A;  1O7Y A;  4EQP A;  4AQY L;  1M8A A;  1PMR A;  1TWF H;  4PZ6 A;  2R7Z B;  1K83 B;  2F0H A;  2NVX H;  4BXX H;  3S14 B;  1MKH A;  5KNC A;  1ONL A;  2F1M A;  2VXW A;  1E2Z A;  5IYB G;  1JWM D;  1CI3 M;  2JK8 A;  3PUV A;  3S24 A;  2OTJ A;  3EJI A;  4A75 A;  1UUP A;  2Z6B A; 
#chains in the Genus database with same CATH homology
 1BCP B;  1J8I A;  1O78 A;  3I8Z A;  1RTO A;  2IPK D;  3TZU A;  3VR3 A;  3ONA B;  1H9K A;  2R92 B;  1F77 A;  4FVM A;  4PNY A;  1PZI D;  4XT3 B;  2Q8I B;  1TWC B;  3R3O A;  5A35 A;  4OGQ C;  1SYF A;  4RGN A;  1O80 A;  3TP8 A;  3I4N B;  3L3O C;  3TME A;  2SNM A;  4R8I A;  2MJ8 A;  2ZT9 C;  1BBX C;  3IFD A;  4BY1 B;  2JA8 B;  2KUM A;  4HSP A;  2AQ1 B;  3OMC A;  1EEF D;  1EY6 A;  5EPJ A;  1F9P A;  1Q1B A;  1TT2 A;  3NQI A;  4IUV A;  3BDO A;  1LTB D;  3BDL A;  1ILP A;  2JEB I;  1DZ1 A;  1EQV A;  4OO1 G;  4X3T A;  3PUY A;  3WDN A;  1I4X A;  2NBF A;  3GTO B;  5CGK A;  1KLU D;  1TWG B;  3GTM B;  5CYU A;  1WVL A;  2OXP A;  3JAM E;  1V1P B;  4X3K A;  1ET9 A;  5CV9 A;  4PMC A;  2Z8L A;  1HA5 A;  4IUQ A;  4IUN A;  1OXT A;  2K28 A;  4HR7 B;  5I6W A;  2I46 A;  5EQ0 A;  3BVG A;  3E5S A;  1D5X C;  1LT3 D;  2JEA I;  2KQ3 A;  4OL7 A;  5FLX E;  2K04 A;  5IIF A;  2HDM A;  5T1G A;  1XTC D;  4N9T A;  1SNQ A;  2B2V C;  1BNZ A;  3K5O A;  2A6E D;  1SND A;  3IFT A;  5E1F A;  3OWE B;  2J0T D;  3C46 A;  3PV0 A;  3HOV B;  1RJT A;  4KKT A;  3LWE A;  2JYO A;  2MHV A;  1MBY A;  1SNM A;  1W6K A;  3NP8 A;  4X3U A;  1ENC A;  4S3S A;  3H0G B;  1B50 A;  4KKS A;  5CR3 A;  5I2Y A;  1JCK B;  3D4D A;  3P1H A;  1PLF A;  1MSG A;  1EYC A;  2B2V A;  3NBH A;  3TBI B;  4J8Q A;  1SEB D;  2PQE A;  3H94 A;  2K01 A;  4IN3 A;  3K5N A;  1PXU A;  3D6C A;  2A73 B;  5C4Z A;  1SJE D;  4JK1 C;  3MAQ A;  3DEP A;  2XWB B;  1U4R A;  2G9D A;  4FO2 A;  3WOE A;  4FXG C;  5EKK A;  2X69 A;  3PIO 3;  2ID0 A;  3NHH A;  1V43 A;  2PYK A;  3HKZ B;  5G3L F;  2K32 A;  3ND8 A;  2B2W C;  2EYF A;  1B9N A;  2Z4I A;  2QEJ C;  2PMZ B;  4DK1 A;  2F0P A;  1SYG A;  4ZK9 B;  2Z4H A;  5J39 A;  1PYW D;  2IJ0 A;  1FGB D;  3HG9 A;  1HPC A;  5KIX A;  2AWN A;  2PW7 A;  4HTH A;  4DAP A;  1QIL A;  4KJO A;  3HRZ C;  3PMF A;  5JAV A;  4IFD I;  4IFD G;  1PRT C;  2NYZ D;  1EFI D;  2B2W A;  4CBV A;  1OO9 B;  1U4P A;  2KOL A;  3DHQ A;  1JB3 A;  4Z9C B;  1GUS A;  1SYC A;  3RUZ A;  3PIP 3;  2B2Y C;  4DA2 A;  3VR6 A;  4CJ0 B;  3MVV A;  5IGG A;  3RMH A;  2NTS A;  4DN4 M;  4H0L C;  5JEA J;  2RVL A;  4DU9 A;  1GOZ A;  3Q0A A;  1HFN A;  1I4P A;  1BUV T;  3MHB A;  4R8N A;  3S2D B;  2RKS A;  5M5X B;  3LX0 A;  1BCP D;  2A68 D;  1VMP A;  4XQJ A;  1PTO C;  4ZKB B;  4ZUJ A;  4CJ1 B;  1R9T B;  1D2B A;  4DXF A;  3DWP A;  4A3K B;  5M3M B;  2F0E A;  2B2Y A;  1S4Z A;  3S15 B;  5ELC A;  3GV6 A;  4KKU A;  3FVQ A;  4DNT B;  2F4I A;  1JOO A;  2C5C A;  2KCC A;  3UI2 A;  2BDN A;  5M5Y B;  4MHE A;  2IX1 A;  3NPP A;  1ENF A;  2Z1C A;  3BZD B;  2QIL A;  1F9R A;  5JEA G;  1T5E A;  3V96 A;  3C2P A;  1WTQ A;  3QOL A;  4NMZ A;  4ZRZ A;  2M00 A;  5LL6 S;  1IHZ A;  4B9W A;  1TR5 A;  1SFO B;  2XVS A;  3DWA A;  4FF2 A;  1EYD A;  4WJW A;  1D6E C;  4TRD A;  2EY5 A;  3C3L A;  2R3Z A;  5E4W C;  4A3I B;  3P7J A;  3KBX A;  2E76 C;  1W6J A;  1CA5 A;  4RKL A;  2F3V A;  1EZ8 A;  1CHP D;  1FNW A;  5FO7 B;  1CQV A;  3IAY A;  3A8I E;  1RF2 D;  2EXZ A;  3OSO A;  1A2U A;  2WB1 B;  4GZY C;  3S16 B;  1HUN A;  3SDZ A;  1B1Z A;  1WD1 A;  3G7L A;  1VMC A;  3N52 A;  2TSS A;  3RLF A;  2XWJ B;  3CRL C;  3I4M B;  5FO9 B;  2N55 A;  3I3C A;  5DM6 3;  1STB A;  2WKD A;  2F0V A;  1WTV A;  5HUR A;  4RKB A;  2F03 A;  4QB4 A;  5CV4 A;  3ITP A;  3QJY A;  3IL8 A;  1SSO A;  4WOR A;  3GTK B;  2JA5 B;  4Q0F A;  4CKC A;  4HCE A;  3URY A;  1U9R A;  3OW7 A;  3HZX A;  5JJZ A;  5A2Q L;  4QUC A;  3VYS A;  3L9A X;  3TN2 A;  3MEH A;  4F87 A;  4ZKC B;  5KRU A;  4PV1 C;  1QNK A;  1TS3 A;  3DXJ C;  1KNA A;  3GTQ B;  1Q8I A;  2F0I A;  5I2X A;  5C3X A;  1NAP A;  4DXG A;  5D65 A;  4KHZ A;  1L0Y B;  5TSS A;  4KHV A;  2CQA A;  2YU9 B;  2A5H A;  3GQB A;  1EY0 A;  2F3W A;  1B44 D;  4C3J B;  4RH6 A;  4M8A A;  3MFG A;  4RHS A;  1TKW B;  2XNA C;  4F88 A;  3NTH A;  3NWT A;  3TSS A;  1U4L A;  3M4Y A;  2R61 A;  2XRQ D;  1SMY D;  3NSW A;  1H9S A;  3I73 A;  1RHP A;  3F2U A;  3T53 B;  1GUN A;  5CMD A;  4KN4 C;  1IW7 D;  2MUY A;  4IUR A;  2BCO A;  2WII B;  2K5W A;  1D5M C;  3FPP A;  3J7Y W;  2JXM B;  1Z47 A;  2DY7 A;  1KDA A;  5IOC A;  1RKN A;  4H7B A;  1SE2 A;  1F2Z A;  2E75 C;  2N88 A;  3A8K E;  3KBG A;  4NDX A;  3A8J E;  1CHQ D;  3GD7 A;  2F0U A;  1KNE A;  1MI2 A;  4HAE A;  4RFB A;  3TP5 A;  1JOQ A;  1KTK A;  4C3H G;  1QG7 A;  5C3W A;  3S1N B;  2QKI C;  1KAA A;  1TII D;  3S1M B;  3P75 A;  3KF8 A;  2EJG C;  4HED A;  4G7Z C;  3A56 A;  3Q22 A;  3R93 A;  1B2T A;  2NTT A;  4KI0 A;  3R8B A;  3EVQ A;  5G3L D;  2Q8T A;  2DNE A;  4DK0 A;  4P2C B;  2JSO A;  4RGO S;  5E3F A;  4F7X A;  5A2Q E;  4AYB B;  1EY5 A;  2WP8 J;  5BN3 A;  2HQE A;  3TP7 A;  2L11 A;  4XIG S;  2NZ1 D;  2F0W A;  3BYY B;  3GV3 A;  3NBI A;  4XXE A;  4BS9 A;  2E2I B;  3OIQ A;  2BE5 D;  1S5C D;  2JA6 B;  1SJH D;  2WV6 D;  5C6A A;  5J22 A;  5AFW A;  4RCN A;  4FXK C;  4IAL A;  4V19 0;  4F8M A;  3KLR A;  4IUT A;  2PCF B;  1CTM A;  4K6D A;  2EE1 A;  1A3T A;  3K57 A;  1DD2 A;  5EKI A;  5C0X I;  4K2K A;  1LTA D;  1BR9 A;  1L0X B;  4A3M B;  4A3J B;  3K7A B;  1V1P A;  3SR1 A;  1C8C A;  4XQQ A;  2IWH A;  2HCI A;  2F0K A;  2E74 C;  1YNN D;  5FO8 B;  3NWS A;  2F0Q A;  3J7A V;  1JIC A;  3L7Z C;  1QJO A;  2KJX A;  4ZYS A;  1I4Q A;  1QNU A;  3J81 L;  3K59 A;  5ELF A;  4TKO B;  4XQN A;  1O7Z A;  1YNJ D;  3MXU A;  3NE5 B;  1RDP D;  1PFN A;  3S17 B;  5F2D A;  1TS2 A;  2C9O A;  4NW2 A;  1JOK A;  1F2M A;  2XN9 C;  1LO5 D;  1EU4 A;  1IL8 A;  5IT9 L;  1S5B D;  4U68 A;  1WCM B;  2SNS A;  1GJX A;  1CFM A;  4RCO A;  4Q5V A;  2NN6 H;  3A54 A;  1ZXT A;  4BBS B;  2H4O A;  3QO2 A;  3NK9 A;  4KN7 C;  3EQL C;  4K8J A;  3VR5 A;  4ZUI A;  2NUC A;  2ICE C;  4LMQ D;  2A6H C;  3H3V C;  1H9J A;  1CA6 A;  2BA0 A;  4DFA A;  3K5M A;  2IL8 A;  4HSV A;  3D3R A;  4C3I G;  5C4J B;  4N9P A;  1K8M A;  4IFD J;  3RZD B;  4O42 A;  3U9O A;  1BOS A;  1ILQ A;  1WD0 A;  1Z7T A;  1HQR D;  3KUP A;  2Y0S B;  1ZYR D;  3GTG B;  3ND9 A;  5EPK A;  4H13 C;  2JP1 A;  2M9V A;  2MGS A;  1V1O A;  3S1R B;  1PZJ D;  2IW3 A;  1PZK D;  1GHJ A;  1TWH B;  2ICI A;  4QF4 A;  4ZAI A;  5M3F B;  4A3G B;  1PRT F;  3K5L A;  4FNF A;  5FKA C;  1A15 A;  1BO0 A;  1LT4 D;  1Y69 U;  2EYO A;  2KA7 A;  2XRS D;  4K8I A;  5JEA H;  2PNR C;  1DOL A;  2L5T A;  4HCS A;  3J81 E;  1SYE A;  2EYP A;  5I6Y A;  4A3D B;  5DNF A;  2QF7 A;  2B8F A;  3NQT A;  3V2T A;  2K33 A;  2LMC B;  4A3E B;  1RD9 D;  1UNS A;  5DEH A;  2FJ2 A;  2HUG A;  3H09 A;  4K2L A;  5IT9 E;  3SK4 A;  4IQZ A;  3VYR A;  1STN A;  2A69 D;  4RWS C;  1PTO F;  1ML0 D;  2KHS A;  1B9M A;  3SK5 A;  4B9X A;  1AFP A;  2EYJ A;  2VB2 X;  5DAU A;  3AU7 A;  4ME5 A;  3MC0 B;  2J7Z A;  4ZQ3 A;  3J80 L;  1E0B A;  1AZQ A;  1ET6 A;  2IX0 A;  1I3Q B;  1I6V C;  1EWH A;  3QWN A;  1Q1E A;  5C5M A;  3CQZ B;  3MXN A;  1E2W A;  1BQQ T;  5ELD A;  2CVR A;  2CW0 D;  1HTL D;  5HGT A;  5EKL A;  3S1Q B;  4C3H B;  2B8G A;  1LTI D;  4B08 A;  3W2D A;  5KNB A;  2EJF C;  3HGB A;  1JE4 A;  2O4X A;  3DMU A;  1EY8 A;  3PUZ A;  1JWS D;  4OHJ A;  2AWO A;  1KAB A;  5ELB A;  3M4O B;  3C1E A;  1EOT A;  5IGF A;  4FP5 D;  3M85 A;  1UEA B;  4TQU S;  4HMJ A;  3C1F A;  3GTJ B;  2K05 A;  2BA1 A;  5C3E B;  1STG A;  1B3A A;  3FDT A;  1EY4 A;  2A6E C;  2WKC A;  4C56 C;  4A93 B;  4IUP A;  1JR0 D;  3VYT A;  1SBB B;  3OPO A;  2K1B A;  3H6M A;  3MFY A;  1UAP A;  3MXG A;  1LTR D;  5KND A;  1B4O A;  1LTG D;  1SE3 A;  3RZO B;  5K36 H;  4K6L A;  2X6L A;  5M5W B;  3DEO A;  4BY7 B;  3PO2 B;  1HCZ A;  1LTS D;  1NR4 A;  2MP1 A;  2PZU A;  2E2H B;  4EVO A;  3Q24 A;  2AUJ D;  2E2D C;  4A3B B;  2Q8R E;  4M1U B;  5NUC A;  1GUG A;  2JE6 I;  2KED A;  3NUC A;  4LK1 C;  1TU2 B;  4DGZ A;  3A7L A;  4C1N I;  2D5D A;  1SE4 A;  3I90 A;  4ILW A;  3J80 E;  1WTP A;  4QCL A;  4KV6 A;  5CBA E;  1DYQ A;  2F0T A;  3N6R A;  1VDZ A;  1HQM C;  1M4V A;  3D6W A;  2BOS A;  1LLR D;  5JOB A;  4LJZ C;  2IX3 A;  3J7A F;  3I91 A;  1DM0 B;  1GUO A;  2BDO A;  1X32 A;  2SDF A;  3D8G A;  2J4X A;  1TQO A;  2EDG A;  1S5E D;  4KD4 A;  1GUW A;  2FFK B;  4KY7 A;  1KDC A;  2AUK A;  5FK9 C;  4CGY B;  4PMB A;  3P20 A;  4ZLT F;  3TDQ A;  2B2U A;  3BVM A;  3HS0 C;  2R93 B;  5I9O A;  2L9H A;  1QCB D;  1G2S A;  1MGS A;  2EYM A;  4IUU A;  4DNR B;  4C3I B;  1HXY D;  1H9R A;  1CM9 A;  1AP0 A;  4KY5 A;  4EQN A;  2B2T C;  4X3S A;  2NVT B;  4HMI A;  1LV9 A;  5IGB A;  5IGE A;  1G8Z D;  4FF4 A;  3TP6 A;  1ENA A;  1AW7 A;  4OIK A;  4UDU C;  4XYO A;  1BCP C;  2A68 C;  3HP3 A;  1D5Z C;  4H44 C;  4FXD A;  5COY A;  5I4D A;  4QIW B;  2EY1 A;  3RD4 A;  2RDH A;  2NVQ B;  3MZ5 A;  5EBC A;  1Y8N B;  3JAM L;  3FKI B;  4CJ2 C;  2GA4 B;  3NXW A;  4OO1 H;  4XTC S;  2B2T A;  3M3Y B;  1KLG D;  4RAU C;  3W3A A;  1DOK A;  4A3F B;  2RDF A;  5FLX L;  1Y1V B;  1T5X D;  2XSC A;  1C4Q A;  1A3U A;  1QB5 D;  2IT1 A;  2AQ3 B;  1GXD C;  3D4R A;  2EOT A;  2O2L D;  3OMG A;  4L8J A;  4U67 3;  2VNU D;  3X3N A;  4YIJ A;  3GO5 A;  3NTK A;  4FF3 A;  3AMU A;  4RA8 A;  1KDB A;  5C0X J;  2QDB A;  1DXM A;  5JVG 3;  2HDL A;  4WRD A;  1A2T A;  1WTO A;  1VF7 A;  1PRT D;  2KCN A;  4ABN A;  2G9H D;  2K7V A;  1G29 1;  2OF1 A;  4KMU C;  4DAY A;  2K6A A;  2EYH A;  4KJN A;  2OEO A;  3BG3 A;  3D4W A;  2R6G A;  4KTA A;  1DOM A;  1JOR A;  2WIN B;  1ZEQ X;  2PW5 A;  2EVB A;  3OIP A;  2F0M A;  1Q90 A;  3I72 A;  1Y1W B;  3QOJ A;  5EGT A;  1FYC A;  1U4M A;  2LS0 1;  3U9S A;  1I4R A;  1PTO D;  3MA2 B;  2DN8 A;  5C0X G;  3GP7 A;  4C2M B;  5D3D A;  1ICW A;  1HTP A;  5IGD A;  4OO1 I;  1TY2 A;  4BWG B;  1EIG A;  2D9U A;  3LNN A;  1NCV A;  4MN3 A;  3K58 A;  3BS1 A;  1RCV D;  1Q3L A;  5J1Z A;  3KLS X;  5LHY 1;  1G2T A;  4K5W A;  2NWG A;  4G7H C;  3BVZ A;  2F0O A;  4K14 A;  1OXX K;  2F0J A;  1JC7 A;  4HN7 A;  4G4K A;  4KY6 A;  1OXU A;  4NKL A;  4QMG A;  2PZT A;  2PO4 A;  1FNV A;  1S5F D;  2RDG A;  1BXT A;  1SNP A;  3PUX A;  4KK7 A;  1G91 A;  4CKB A;  1QOH A;  5D14 A;  3MXP A;  3VR2 A;  2AQ2 B;  5JPM C;  2LKV A;  2V4D A;  2F0L A;  3D31 A;  3R2I A;  4IFD H;  4OIJ A;  1STA A;  5CBE E;  3T16 A;  5KYI A;  2RSO A;  4Y7N B;  3HOX B;  2KEE A;  3BDC A;  2ZXO A;  5CV7 A;  1HA6 A;  5IGC A;  2L4N A;  3Q6S A;  2D2C C;  2F0S A;  3G6J B;  5EBD A;  1SXT A;  4V0B A;  2L55 A;  1EIH A;  1SMY C;  2EZV A;  3A55 A;  3QB3 A;  3VR4 A;  1WTW A;  4FYD A;  1IW7 C;  1DJR D;  1V8Q A;  3I70 A;  1CQF A;  4C3J G;  1E2V A;  2EY6 A;  2VB3 X;  3Q23 A;  4EGV A;  3A7A B;  4TSS A;  1EEI D;  2I07 B;  1DON A;  4BA2 I;  3VA5 A;  3MTS A;  2NVY B;  2YYZ A;  1SAP A;  3E0J A;  1I4G A;  3ZYY X;  5JVH 3;  3LWU A;  3DM1 A;  3BYT B;  5DM7 3;  1XX8 A;  3PUW A;  3HOU B;  1K8O A;  4I65 A;  1EY9 A;  2SEB D;  1OXV A;  3TZD A;  1O7L A;  1RTN A;  4MIU A;  3GTP B;  2MPM A;  1LAB A;  5CV6 A;  3HOZ B;  2X6G A;  1IKL A;  1PDQ A;  1A6X A;  1II3 A;  2HCC A;  1XYI A;  1JQY D;  2NN6 I;  5KYL A;  2F0D A;  2NN6 G;  2L12 A;  4J6H A;  3S9W A;  1TWA B;  3FRP B;  3QIA A;  2D62 A;  2TMP A;  5EJW A;  1LT5 D;  4G7O C;  1B53 A;  3CU7 A;  1EYA A;  3DUZ A;  1EU3 A;  2BE5 C;  4K5V A;  4FF1 A;  3OHX C;  4BBR B;  3KLS A;  4DF7 A;  4ODG A;  1NR2 A;  1GUT A;  1ESF A;  3CKI B;  4ID6 A;  2B39 A;  1FD7 D;  3T51 B;  5JPN C;  3NTI A;  3H91 A;  3VYU A;  2K03 A;  4CHT B;  4KD3 A;  1STY A;  3SHL A;  1GHK A;  2RQX A;  1ESR A;  1PRT B;  1XXG A;  1Q12 A;  3KK7 A;  2RA4 A;  4RGM A;  4BA1 I;  2VUM B;  1YNN C;  1NUC A;  1STH A;  2F0N A;  4XT1 B;  1C48 A;  5I9P A;  1OXS C;  1I4H A;  3FPU B;  3DWQ A;  2FMC A;  1YNJ C;  1D1I A;  1R4P B;  1XWE A;  5C44 B;  1EWC A;  5T1I A;  3AB9 A;  4L63 B;  4WFN 3;  1Y8O B;  2EYL A;  2SOB A;  1CK1 A;  5K5P A;  5FOB B;  1TS5 A;  2EY2 A;  3V05 A;  2ENB A;  2K5D A;  3S2H B;  1ROD A;  1PTO B;  2CHB D;  2JA7 B;  1R4Q B;  5KGU A;  1FR3 A;  1IYU A;  2KEC A;  5KEE A;  5M9O A;  4IZ8 A;  5LL6 X;  2FIN B;  3PO3 B;  1IYV A;  1EZ6 A;  4I7Z C;  1SNO A;  3FEW X;  3O13 A;  3OWF A;  2EJM A;  5BN4 A;  3EA6 A;  4C1N K;  2L1B A;  2FHT A;  1I6H B;  1TY0 A;  2M2L A;  2DY8 A;  1SDF A;  4NP5 A;  2EPB A;  2DNC A;  1Y8P B;  5IOD A;  1H9M A;  3X3M A;  1J9O A;  2WAQ B;  1F2L A;  1CZG A;  3HOY B;  3T4A C;  2FMM A;  1A3V A;  1CZW A;  2WAC A;  1LT6 D;  3SK6 A;  4ULL A;  5ELE A;  1ZYR C;  2E2J B;  4G57 A;  3I4L A;  1TWF B;  2B63 B;  5BN5 A;  2B2U C;  3T56 B;  1NSN S;  2NVX B;  2LY7 A;  1X3P A;  1LTT D;  3K6O A;  4CKE A;  1PFM A;  2KVM A;  1EQT A;  1EL0 A;  4LAA A;  1BDO A;  4DAV A;  5ISR A;  1HRJ A;  3IKJ A;  1QWY A;  1TS4 A;  3E6Z X;  2ZXP A;  2O5J C;  2L0C A;  4E6I A;  1EY7 A;  1ZKO A;  5C5L A;  2K5Q A;  1TVX A;  3SEB A;  1LAC A;  2F0G A;  5CV8 A;  4K5X A;  2RBM A;  5EPL A;  5COR A;  1CT1 D;  1WTR A;  1I50 B;  5E4X A;  1D1K A;  1AN8 A;  2QCP X;  1SYD A;  1F9S A;  2RSN A;  3ERO A;  3R2T A;  2OT2 A;  2LFN A;  1BF4 A;  3M7G A;  4QUF A;  3SK8 A;  3EFX D;  4PMW A;  4R9W A;  2A74 C;  4O1N A;  5C4H A;  1MD2 D;  5C4X B;  1HFG A;  3CHB D;  3WOF A;  3OOC A;  1STE A;  1IKM A;  4EQO A;  2H1E A;  1VCI A;  1BCP F;  1G6Z A;  2A69 C;  5K36 G;  1AEX A;  1FNU A;  3MWY W;  1WTX A;  3QG1 A;  3FMC A;  4J1M A;  3K0Y A;  1VF5 C;  1QE6 A;  2ZXR A;  1X3Q A;  2A6H D;  5CC4 A;  1PTO H;  1JWU D;  3M7N A;  4L6T B;  3T13 A;  1MSH A;  1PFB A;  5CV5 A;  1HUM A;  4PQX A;  2XIW A;  3SXH A;  2O5I C;  2F0F A;  3SVM A;  3ERQ A;  2PZW A;  2CW0 C;  4XYQ A;  1H9S B;  2NB0 A;  1S5D D;  3SE0 A;  1F9Q A;  4UAI A;  1AZP A;  3HEJ A;  1SNC A;  3VA7 A;  5C0X H;  1HHV A;  1Z6H A;  4XDX A;  4RGT A;  3GTL B;  4JBW A;  5D3I B;  4RHR A;  2PPB C;  1SYB A;  1DCZ A;  3CRK C;  3HOW B;  1F2Y A;  1O7Y A;  4EQP A;  1M8A A;  1PMR A;  2R7Z B;  1K83 B;  2F0H A;  3S14 B;  5KNC A;  1ONL A;  2F1M A;  2VXW A;  1E2Z A;  1JWM D;  1CI3 M;  3PUV A;  3EJI A;  1UUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...