1MI2A

Solution structure of murine macrophage inflammatory protein-2, nmr, 20 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE INFLAMMATORY PROTEIN-2
publication title Solution structure of murine macrophage inflammatory protein-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 9
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1mi2A00
5CBAE 1WTRA 5EQ0A 1PFBA 1ILQA 2RSOA 3I3CA 1ML0D 2FJ2A 3LWEA 5CORA 5T1IA 1C8CA 2KEEA 1CA5A 1CA6A 4QUCA 1ESRA 1BBXC 1B3AA 3IFDA 4IUPA 1WTWA 2NYZD 2KEDA 2SDFA 4X3KA 4CJ2C 3FPUB 3KUPA 1HFGA 3D6WA 2HDMA 1NCVA 1RTNA 4ZKBB 2VXWA 1ICWA 1TVXA 3DEPA 3TN2A 1B53A 1IKLA 2HUGA 1WTXA 2H1EA 4ZK9B 1DOLA 4HSVA 4O42A 5COYA 1RJTA 1X3QA 1ILPA 1PFNA 1JICA 1QG7A 4RAUC 1A15A 3SVMA 2B2WC 4NW2A 1B4OA 1ZXTA 2EOTA 2L4NA 4X3SA 1U4LA 2BDNA 2N55A 2MGSA 5CBEE 1X32A 2XIWA 1G91A 2B2TC 2DY7A 1HHVA 1Q3LA 2MPMA 2X69A 3KBXA 5EJWA 4HCSA 3H91A 2B2WA 3HP3A 1MGSA 5AFWA 3I8ZA 3P7JA 1EIGA 5CMDA 4IUUA 1IKMA 1NR2A 2HDLA 3I90A 1QE6A 2B2TA 4XT1B 4ZLTF 2B2YC 1WD0A 4X3UA 4CJ1B 1G2SA 1MI2A 4HEDA 1HUNA 1M8AA 2KUMA 1SDFA 2K03A 2X6LA 4ZKCB 1EQTA 4X3TA 2Q8RE 4R9WA 4XT3B 1BNZA 1RODA 2B2UC 2B2VA 1PDQA 2CVRA 2MJ8A 3ONAB 2B2YA 1WTPA 5EPLA 1MSHA 1F2LA 2RA4A 3GV3A 2IL8A 4IURA 5JJZA 1G6ZA 4IUQA 1QNKA 1U4RA 4MN3A 2K05A 1VMPA 4ZAIA 1E0BA 2HCIA 2B2UA 2FINB 2L11A 2RSNA 3DM1A 2KOLA 2JYOA 2L12A 1RHPA 4U68A 2N88A 2K1BA 1NR4A 1WTOA 1EOTA 4OIKA 1DONA 5DNFA 1F9PA 4XDXA 4LMQD 5E4XA 1WTQA 2KVMA 2B2VC 5EPJA 4R8IA 2KECA 3R93A 1DOKA 1HRJA 4RWSC 2M2LA 5EPKA 4MHEA 1WTVA 1SAPA 5T1GA 5E4WC 2EPBA 1MSGA 1AP0A 2D9UA 1WVLA 2K28A 3FDTA 2K01A 1GUWA 2FHTA 5D14A 1KNAA 1SSOA 2Q8TA 2JP1A 2NZ1D 5EKIA 1JE4A 1S4ZA 1F9RA 3DEOA 1AZQA 2HCCA 1G2TA 1XYIA 4UAIA 3GV6A 1NAPA 2RVLA 1U4PA 1HUMA 1WD1A 1F9QA 2EE1A 2X6GA 2R3ZA 2L9HA 1AZPA 2L1BA 3QO2A 3IL8A 1BF4A 1O7YA 2NWGA 3F2UA 3N52A 1DOMA 1LV9A 1X3PA 2FMMA 1O80A 4HAEA 1XX8A 2FFKB 1F9SA 1VMCA 1PLFA 3I91A 2DY8A 5D65A 1CM9A 3TZDA 4CJ0B 2MP1A 1U4MA 1DZ1A 1HA6A 4RA8A 4IUVA 3UI2A 2J7ZA 4OIJA 1PFMA 1HFNA 1J9OA 2K04A 3MTSA 4IUTA 3Q6SA 4QUFA 3G7LA 1RTOA 3MWYW 1B2TA 1B50A 1IL8A 1KNEA 1O7ZA 1J8IA 1EL0A 1BO0A 4DN4M 1EIHA
chains in the Genus database with same CATH superfamily
5DAUA 1XPOA 4XQNA 4A3DB 2O2LD 3LWEA 3PO2G 1KXLA 2EIFA 1ENCA 2DN8A 4CJ2C 4LF8L 2L5TA 2Q2IA 4L5RC 1EY7A 1TWCB 2SNMA 2VXWA 3NQTA 4CKBA 2CQAA 1EYAA 3BS1A 2H1EA 5IYBG 1Y69U 5FLXL 1L0XB 1QVFA 1XXGA 1I94Q 3MFYA 3ITPA 1GUTA 5C44B 4A3LH 5FLXc 1MIUA 3HOXB 4IQZA 3DMUA 1FNVA 5CBEE 2I0QA 1F2ZA 1X32A 5ELOA 2B8GA 3S16H 3J81L 4NB3A 1M4VA 4C3JG 5AJ3Q 2EYHA 5JPNC 3J81c 5JVH3 1NR2A 2HDLA 1AE2A 2AKWB 2SOBA 5EKLA 4IO9A 3GTLH 1X9NA 4OX9Q 2ZJRA 2KUMA 3AMUA 4R9WA 4E6IA 4RGMA 1X56A 2RKSA 1X65A 1TQOA 1SYGA 2CVRA 2MJ8A 2F3VA 1QVCA 1IXRA 2CQOA 1O7IA 5K36G 1AFPA 4LK1C 4JCVE 4UP9A 4BY1G 2GA4B 2LY7A 5GAGC 2Z4IA 3OIQA 2Z9HA 5IGCA 5BN5A 4Q5VA 1L2FA 4GKKL 4P72A 2EY1A 4EQNA 3GQBA 5HGTA 5FK9C 3S1QH 4R8IA 3R3OA 2JEBI 4OO1H 1WOCA 1VQ6A 3KJPA 5M5XB 3IAYA 3JC66 1S5FD 4A3IB 3I4LA 3RZOH 2UXCL 4R4CA 3MEHA 1G2TA 1LTAD 3GV6A 2OWOA 1S5BD 2UXBL 2LMCB 4JV5L 3WDNA 3P75A 2YTXA 1O80A 1XX8A 4PNYA 1V1OA 1PLFA 3PIOA 1VDZA 3CU7A 4XQJA 4GN5A 1RDPD 4JI6Q 1A0IA 2C5CA 3K7AB 3MWYW 1MKHA 4KJOA 1KNEA 1F2YA 4B9XA 1O7ZA 2GN5A 1IL2A 5KRUA 2JA7B 2EY2A 5CBAE 1CQVA 1PFBA 1C8CA 4DAYA 1XMOQ 5C6AA 1LUZA 1ESRA 1UEAB 3K57A 2QA4A 1B9NA 5C3EH 1TS4A 1SE8A 3KUPA 4MTKA 3UE0A 3M4OB 2EYJA 1TVXA 1YIJA 4A3BH 5KEEA 2UUCL 2QDBA 4HIMA 2XGTA 1E2ZA 2EYPA 5JAVA 1VQGA 1RL2A 4K14A 5I2YA 1PH3A 4GKJL 1EU3A 4N9PA 3Q24A 4JYAQ 3I56A 2NVYB 2AQ3B 1ENAA 2EYOA 3RUZA 4YHHQ 2QF7A 4G7HC 1QE6A 1E3PA 2DUDA 3BYYB 3RZDB 4GZYC 4DR3Q 4IPGA 3NTKA 5M5WH 3STBC 1U0LA 1BNZA 2RHSB 3C2PA 2NVQB 4L6TB 5C4HA 3BVGA 1DYQA 1N36L 1IW7C 4IURA 3DWPA 5CV9A 2JA5H 2HQEA 3O13A 4LF6L 3J7ZC 3CCRA 2A6EC 3TRZA 4RKLA 4A3GB 4KD4A 2IX0A 2UU9Q 1CQFA 1Y8OB 2EY5A 4DK6C 1HTLD 1LLRD 3A54A 3KLSA 1IBKL 4WJ3M 1EY5A 4K5WA 3RLFA 4GOPA 1C0AA 2BOSA 1TWFB 1K73C 2HIVA 1TWHB 3SK4A 3T51B 3VR6A 1V9PA 1S72A 3RN5A 4DUZL 1Q8KA 4FF1A 1E2VA 5EKIA 4DAMA 4JI3Q 1NE3A 3IRBA 5AJ3L 2ALYB 3SR1A 1YI2A 2EE1A 4EQPA 4DXFA 3K0XA 4QMGA 3CAMA 3E0EA 1QZGA 4C2MH 1PH5A 4DV0Q 5JOBA 3PO3G 1PZKD 1HFNA 1J9OA 5J1ZA 4C1NK 4C3IH 1QVGA 3M4PA 1SNOA 1UE1A 3FPPA 1GJXA 1N32Q 4X65L 1ONLA 1A63A 4DN4M 5JEAG 3VA5A 1EUJA 4DR1Q 5KNDA 3FP9A 2A6HC 1BBXC 3AFPA 1SNDA 4TKOB 4HTHA 4JI2Q 3M4QA 1IHZA 3KBGA 1LT3D 3TSSA 4K6DA 5A35A 1GKHA 1NBWA 4DR6Q 3M9BA 1ASZA 3TDQA 3VYRA 3VR2A 3CRKC 3SK5A 1DOLA 3R2TA 1PTOC 4HSVA 4B08A 1STGA 2Z0SA 3DUZA 4FVMA 1A15A 1SMYD 4DA2A 1VS0A 5EGTA 2EJMA 4QQBX 3MXGA 2EYMA 1S5DD 1G91A 5DEHA 1Q46A 3ZJYC 4CGYB 4A3LG 2EY6A 1EQRA 3M7GA 1VQ8A 1EWCA 4IUUA 2ZJPA 2B2TA 4A3MB 3T1HQ 3J80i 2B2YC 1VQEA 2RQXA 3PSIA 1E7ZA 2K03A 4RCOA 4DV1Q 4UDUC 2F4VQ 5C5MA 3R8BA 2E5LQ 1KAAA 3C46A 1PDQA 3HOUH 4DU9A 1GHKA 1MSHA 4YWLA 1TWGH 3G48A 3DWAA 4CKEA 4YY3Q 1WCMH 4L8JA 1N8RC 2KOLA 2JYOA 5IT9L 1RHPA 1OXSC 5ELNA 2AHOB 3S1MH 2EQSA 5KYIA 1VQNA 2DJFC 5IT9c 1TWAH 1QWYA 2JN4A 4OWTB 4K5VA 3MHBA 3R93A 1LTGD 3IKJA 5HGQA 5T1GA 4JYAL 2IX3A 1VQDA 1LTRD 4OL7A 5E7NA 3U9OA 4OO1G 5L37A 4FDBA 3NE5B 2JP1A 4X66L 3DLLA 2PMZE 1X6OA 3FRPB 4YHHL 4GOPC 1PTOB 3U50C 1A6XA 1CSPA 1EEFD 4UP7A 4EQOA 3K81C 4I7ZC 4DAYB 5M9OA 4HJ5A 4YIJA 4CJ0B 2DY8A 1CM9A 4B3RQ 4WJ4A 1STHA 1KHIA 1FJGQ 1PH6A 2ZXOA 2E2IB 1W6KA 1KL9A 3SGIA 2CH4A 1J8IA 2UU9L 1QUQA 4HMJA 1MD2D 2PZWA 4LFAL 4QIWE 3S2DB 3LGJA 1EIHA 3J7YW 1PH8A 2RHQB 1CSQA 4KKSA 2FJ2A 2KCTA 1BVSA 4X64L 3IFDA 1ESFA 2ZT9C 4LF9L 1YNNC 3S1NH 2HDMA 1HZ9A 3TN2A 1B53A 2B8FA 2NBFA 4FF2A 5C4XG 4A3FB 2A74C 4A3BG 2B2WC 4A3KH 1PRTC 2QCPX 4L5TA 1UE6A 4A3DG 1XPUA 4B3SQ 3PO2H 3T1YL 2R92B 2PW7A 4KV6A 3L2PA 3H91A 3KJOA 3I8ZA 4A3CG 3K58A 1I4GA 4DV0L 3ULJA 2WAQG 2VQFQ 4LF5L 4HIOA 2ICIA 4GOPB 3HOYB 2ZXRA 1H9JA 2Q8RE 1K28A 2EXDA 1N33L 3K6OA 2B2UC 1LTID 3HOXG 1JT8A 1A8VA 1EEID 5IP7H 4ME5A 3RN2A 2IL8A 2Z8LA 3S14B 1JWUD 1SE4A 4C3JH 2OXPA 4QB4A 4DR1L 4AQYQ 4U68A 4LW1A 4JI2L 3S15B 2NB0A 3OTOQ 1GUNA 3PUZA 4UY8C 5E4XA 2WB1B 4BY7H 2JE6I 1STNA 1FVIA 4MTNA 2JA6B 4AIMA 2ASBA 4QL5A 5FLMH 4BY1H 5M5YB 3N6RA 1VCIA 2F4IA 3NHHA 3ZYYX 2BE5C 2K5QA 3I70A 1L1OA 3D4RA 5FO7B 2NVTH 4HJ7A 1PZID 3GO5A 2EXZA 1NAPA 2RVLA 2A5HA 2R3ZA 1YEZA 4FXDA 3GTJH 1PRTB 1XWEA 2IT1A 2KBNA 3EA6A 4BBRB 3K0YA 4JI5Q 2FFKB 2F4VL 2K5NA 4A3JB 2E5LL 1TS2A 1H9MA 1KLGD 1NNXA 1QILA 3CQZB 3UI2A 4A3IG 1UWVA 2IW3A 3MTSA 1Z9FA 3G7LA 2O5JC 4TVAB 2UXDQ 3T56B 2LXJA 2E76C 1I4RA 4V0BA 2NN6I 1I3QH 3WOEA 3PQIA 2E2JH 2I46A 5M3MB 2IPKD 3BDOA 1JQYD 4POFA 3GTOH 2KEDA 3OW7A 1SR3A 1NJIC 1Y1WB 5GROA 4JPBW 3DEPA 1FNWA 1XMQQ 3CCQA 2CH4W 1BDOA 3V96A 3H3VI 1V8QA 3HRZC 4Q0FA 2WFWA 2L4NA 2Z6KC 3TP8A 1PXUA 5EJWA 2RCFA 4HCSA 2PZTA 2WINB 4RGTA 1EFWA 2ICEC 4B3RL 1Y14B 1HNXL 2R7FA 2KQ3A 4LUVA 1G8ZD 1TY0A 3OHXC 1ET6A 4HJ8A 1LACA 1S40A 5EKKA 2I5MX 4JI1Q 1SNCA 2BH2A 3V05A 2IJ0A 3S24A 5JJZA 1A3TA 1Q82C 3HOUG 1TIID 4BA2I 3BG3A 5IODA 3Q23A 4O0AA 2AMCB 2MHVA 4X62Q 1UNSA 1HXYD 3H6MA 3CMEA 1HR0Q 3EQLC 2KECA 1SJHD 5DM73 1G51A 4POGA 2R7ZH 3QWNA 2BA1A 1Q81C 3AB9A 4A3GG 4B3SL 1SSOA 3TZUA 3R2IA 1AZQA 4DK3C 5CV4A 2E8GA 3FEWX 3BVZA 3OWFA 1F9QA 5C3WA 3QO2A 4H7BA 4NDXA 3OYYA 4DV3Q 2FMMA 1HNZQ 2VNUD 3NENA 3QG1A 3UDGA 2VUMB 4IUNA 1L1OC 1K83B 4RA8A 5I6WA 5ELDA 1Z6HA 4AYBG 1KDCA 2NN6H 4HR7B 3NWTA 4PZ8A 4LF4Q 5EQ0A 1EY8A 5CORA 2OF1A 1F77A 4KHZA 3J80L 3T13A 2A68C 3I72A 3J80c 3TP7A 3PO3H 1T5EA 4KHPL 4KY6A 2JXMB 2VS1A 4APVA 3W1GA 1NMGA 3GP7A 3H3VH 1Z7TA 3A5ZB 1VF7A 5LL6X 4XYOA 2F0SA 1M1KC 3KK7A 4J1MA 2IY5B 4A3KG 3JAME 2GVBA 4JI5L 4AH6A 5CMDA 1K8AC 1H9SB 2A6ED 4RH6A 3D8GA 4M8AA 1JJ2A 3HOZH 1H9RA 1V43A 2RDGA 5EPLA 1HR0W 2IHFA 2UXDL 3GTPB 1VQJA 4GS3A 1U4RA 2DNCA 1VMPA 1MBYA 5IP7G 1L1OB 4JI8Q 4ULLA 2F0QA 2WAQE 4RHRA 5FLXE 4DR7Q 3AYHB 3J81j 2J0TD 2PNRC 4GLVB 4XDXA 3FMCA 3CCJA 1J5EQ 4NXML 3NXWA 1XMQL 2SEBD 3J81E 1G291 5LHY1 2D0OA 3GTKH 4RWSC 4JBJA 4BY7G 2CHBD 4K0KQ 2RDFA 5FLMG 1BQQT 1ICFB 1HJPA 3QR8A 4DNIA 4L5SA 3DEOA 2K4KA 3NP8A 3V2TA 1OXXK 2A69D 2D0PA 2R61A 2CFMA 1LYLA 3SXHA 1QOHA 3I4NB 2DGYA 3CD6A 1Q12A 4BBSB 4HAEA 3UDIA 2JA8B 1Y1VB 1F9SA 1VMCA 1A2TA 4CBVA 3G6JB 3A8IE 3MA2B 4CDCC 1BCPD 1XNQL 4JOIA 2A6HD 3S17B 1HNWQ 1SFOB 2F52A 2XTIA 1IYVA 3NEMA 3D31A 1SNMA 1PH4A 4DNRB 3W3AA 1KLUD 2F0PA 4QUCA 5IWAL 1CKMA 2G5DA 1HR0L 4A93H 2SDFA 1QJOA 4DR5Q 4DV5L 4IFDJ 4DV7L 1GUOA 4JVZA 1NCVA 1RTNA 2YTVA 4DXGA 2D5DA 2L0CA 3VYSA 1LABA 1VQAA 2CWPA 3MZ5A 2Q2TA 4R8NA 5ELEA 2GVAA 4B3ML 3T4AC 2F1MA 1I6HB 3I90A 3SDZA 1C48A 2JJQA 1D6EC 4X3UA 3L9AX 5C4XH 4OWWB 1M8AA 2XVSA 3HOVB 2D62A 3M3YB 1HZAA 2EDGA 3OMGA 4A3DH 4K8IA 1PH7A 2B2YA 1C7YA 3GTMB 3PIP3 4OHJA 4GLXA 4DUYQ 1EZ8A 2R92G 1V1PB 1B7YB 1GD7A 1E0BA 4A3CH 4HSPA 2HHHL 1TWCH 3BZKA 4JBMA 2F0KA 1VQ9A 2N88A 2C9OA 2OCEA 2A19A 1YJWA 3TMEA 2BA0A 1ZEQX 5DNFA 2N49A 1EY4A 3HOYG 4P2CB 4F87A 5C44H 3HOXH 2VQEQ 3PUXA 4HJAA 1WTVA 2VZAA 1LTTD 4IOAA 4IFDI 2KCNA 1WVLA 1K3RA 4A4IA 3FKIB 1KNAA 1YHAA 4DAPA 2R7ZG 3MEFA 3S2HB 2NZ1D 2QEXA 4KHVA 1EIFA 1JE4A 5IGBA 1TKWB 2CWAA 3CW2C 2NUCA 5D3IB 4JG2A 5FO8B 1Q1BA 1JOQA 1LV9A 1CZGA 1T5XD 2F0GA 2JA6G 3H0GB 3HEJA 1KABA 2B39A 2K50A 1I94L 1VQOA 1YZ6A 1D5XC 1YNND 1LT4D 4C3HB 3AU7A 2FMCA 2PI2A 2OEOA 1ML0D 5T1IA 5ELBA 2NN6G 3S1RB 1PRTD 1YHQA 4A3JG 2Q2UA 4AYBE 4GN4B 1E1OA 4ID6A 4JOIC 3RNUA 1IYUA 1O78A 3EFXD 3LX0A 3MC0B 5M5XH 4OX9L 4A3IH 4DV6Q 4MNOA 2HUGA 4BS9A 1EYCA 4P75A 4ZRZA 3I4MB 2HQLA 1YHBA 4FP5D 1MJCA 4LUZA 3QB3A 2MGSA 1PYSB 1BCPF 1QCBD 2F0WA 5M3MG 2B3GA 1KD1C 2B2WA 2B63B 5JJIA 1JOOA 1OXUA 1Q86C 1SYBA 1LTLA 3I73A 4N8X1 1FL0A 3K7AH 4LFBQ 1SDFA 2X6LA 4ZKCB 2SNSA 4X3TA 2JA7H 1RODA 2F0OA 3CF5A 1B9MA 1WTPA 4FXGC 2XRSD 4IALA 3HOZG 1LM0A 3L0OA 1JCKB 1GO3E 2K05A 1OTCA 4ZAIA 4DV4Q 2B2UA 1SNPA 5FKAC 3M4OH 2BE5D 1KC8C 1HA5A 1OXTA 1RCVD 2NTTA 1SXTA 1TS5A 3F1ZA 4LMQD 3Q22A 2KA7A 2V4DA 2AWNA 1DGSA 1YVCA 5DM63 4JI0Q 4IFDH 2PPBC 4JI6L 2AQ2B 2NVYH 3PF5A 2UUBQ 1PYWD 3P1HA 4B3TQ 3SHLA 2K6AA 4K2LA 1ASYA 3RZDH 1F9RA 1NY4A 4UAIA 4NMZA 1VQFA 1XMOL 5FJ8H 4N8FA 4F7XA 3IL8A 1E2WA 2NVQH 1IKMA 1DOMA 3NK9A 3SE0A 3TQYA 1SBBB 3RLNA 2E2HB 1AW7A 3EJIA 5IT9E 1HA6A 4IPDA 1R9TB 4A3GH 3WOFA 2K33A 2KCMA 4EX5A 3Q6SA 4GNXC 3K7UC 4KD3A 1LT6D 3K5NA 1HZCA 5LMNQ 3D4DA 2DNEA 1WTRA 1TWFH 1S3OA 1JOKA 3I3CA 3NBHB 1TWHH 3A55A 3I55A 3HOWB 2F0FA 2VUMG 1ENFA 4DR3L 2VQEL 1HFGA 2PMZB 5C0XJ 4ABNA 1VF5C 4UPAA 5GADC 1JB7A 2NZOA 4DGZA 4A93G 3CCSA 4XTCS 4Y7NB 4DR2Q 1PFNA 1QG7A 3OOCA 1NUCA 4NXNQ 2F0EA 5A2QL 1ZXTA 2Y0SG 4BWGB 1VQKA 2KHSA 3PF4A 5C5LA 1BBWA 1Q3LA 4PZ6A 3GTGB 1I50B 1W6JA 1CFMA 1JR0D 2K5VA 3P7JA 1RF2D 2Z6KA 4HJ9A 1G2SA 4YWKA 1B44D 1N34Q 2XWJB 3HKSA 1EQTA 1AH9A 1SN8A 1EZ6A 2F0TA 1STEA 3OSOA 4WJWA 3NELA 1XPRA 5C4JB 4LFCQ 3DWQA 3GV3A 4JI3L 2H5XA 1IBLQ 3CPWA 1GUGA 4RCNA 2P5ZX 3A8KE 1I6VC 2EYLA 4A3EB 4DV6L 4GNXB 1IBMQ 1JE5A 2UUAQ 2J4XA 5DLQE 5J39A 1STAA 3DXJC 4IN3A 1E1TA 5C44G 3HKZB 1UE5A 3FDTA 5C0XI 1XJVA 1N32L 1NMFA 3ERQA 4A3MH 4DPGA 2ZM6Q 3CCMA 4JI7Q 3I7FA 3J7AF 2F0DA 3UE1A 2RCNA 1H9SA 3K8AA 5LMNW 2NVXB 4LFBL 4ZCKA 5D65A 3D4WA 3X3MA 4DR6L 3TZDA 5GAEC 5IGDA 1PZJD 2E2DC 1JJCB 3A5UA 3SEBA 3CPFA 3GTQB 5ELCA 1EY0A 4HCEA 3E5SA 4DV4L 4GN3B 1EL0A 4RMFA 3I4NG 4P73A 1QB5D 4BBSG 2RSOA 2JA8G 1Y1VG 5BR8Q 3M7NA 5KNBA 3T1HL 1PYBA 4HIDA 2PYKA 5IYDG 4C56C 4DV1L 4UP8A 3CMAA 3MXNA 4O1NA 2NZHA 3G71A 1X3QA 3F2CA 1PTOH 2K7VA 1KDAA 4TRDA 3OIPA 4DR4Q 4X3SA 1YNJC 4JK1C 4YY3L 2OT2A 4IPHA 1MGSA 1L0YB 2M00A 3CC2A 2YU9B 3C1FA 5JPMC 1PMRA 2BH8A 3MAQA 4KY7A 4ZLTF 3KYHC 2E2IH 2K5WA 4A76A 4CDDC 1U5KA 2CCZA 3S2DH 2R93B 3AQQA 1CZWA 2RA4A 5LMNL 2F0MA 4EVOA 2JA7G 1D1IA 2MQHA 4ZUJA 4XIGS 1EFID 1EIYB 2G9HD 4KN7C 2EJFC 1Q90A 4OIKA 4OGQC 1X55A 3K59A 3VYTA 1SJED 4KK7A 4A3FH 2E75C 4LF7Q 2DJGC 2PZUA 4CHTB 1FJGL 4KLKA 5I9OA 4X6AH 2WKDA 2R92H 3FVQA 5C0XH 3VR3A 4K2KA 3RMHA 1JJGA 1DCZA 4IFDG 2PQAA 4NP5A 2VB2X 1XYIA 2F03A 1HUMA 3HOYH 4ZYSA 3CC7A 1ZYRC 1AZPA 1S5CD 4S3SA 2TSSA 4K5XA 3MFGA 4GKKQ 1S5ED 3S16B 4JI4Q 5FJ8G 2QW7A 3S14H 1K8OA 3BZCA 5KGUA 3FKIG 2FXQA 3CCLA 2K04A 1UAPA 1V1PA 3KF6A 1IBLL 2F0JA 2CW0C 4KY5A 3GTLB 3S15H 1IL8A 2IHEA 2EVBA 3U4VA 4LWCA 2JA6H 1ILQA 1CA6A 3KF8A 3CRLC 2R6GA 1IBML 2UXBQ 1FD7D 1WI5A 5M5YH 1WTWA 2VQFL 2RDHA 3DHQA 2XSCA 1FGUA 2ATWA 4KKUA 5IGFA 5IOCA 4YCVA 5E3FA 5COYA 2RF4A 3MXPA 4NPSA 1ILPA 2KHIA 3S1QB 2QEJC 3E0JA 3RLOA 3VR4A 2EOTA 4BBRH 3PIO3 3CCEA 3I2ZA 4AQYL 1E24A 4A3JH 2X69A 3KBXA 2ES2A 3CQZH 1EU4A 3OTOL 3A0JA 5IIFA 5TSSA 5G3LD 4XXEA 1VQ4A 1EIGA 1C4QA 3RZOB 2N8NA 5CR3A 1BR9A 4IJHA 2O4XA 3I4MG 4KMUC 1G6PA 3U9SA 2D2CC 2Y0SE 3WWVA 1MJEA 2KJXA 1OO9B 2UUCQ 3J80E 4KJNA 4G4KA 3U58A 1Y8NB 3PCOB 5M3MH 3QOLA 2XNAC 1JMCA 4GKJQ 3NPPA 3U4ZA 1P8LA 1QNKA 1HCZA 4WORA 1PVOA 2B63G 2FINB 2RSNA 5CYUA 5J3BA 1TT2A 3STBD 5FO9B 5BR8L 1Y1WH 3TS2A 4JC0A 5LL6S 1UE7A 4F8MA 2F0IA 4CDFC 4OELB 1VQMA 1IW7D 2N3SA 2G9DA 3E9IA 1WTQA 1VQBA 4DK1A 5IP9H 5KNCA 2Q8IB 3J7AV 1M90C 2I07B 2M2LA 5EPKA 3JAML 1PHJA 4RKBA 4JBKA 4KKTA 5I9PA 2EPBA 5C3EB 2C35B 2A73B 2LS01 1PH2A 4GLAC 4A3BB 4PMWA 3KLSX 2LSSA 4LF6Q 1GHJA 1U4PA 4LJZC 3K80C 4A3MG 1RD9D 2L9HA 3E9HA 4NKLA 3ND9A 1VQPA 1I4PA 1IBKQ 2ENBA 4ZUIA 3PUWA 2EZVA 1DZ1A 1W2BA 1I4QA 2WAQB 4DFAA 3ULLA 2JA9A 2KENA 1R4QB 2E74C 4L63B 3MXNB 4OXPA 5HY6A 5JVG3 1RKNA 1B2TA 3OMCA 4DUZQ 1WFQA 1XTCD 5M5WB 5K5PA 3CXCA 2H4OA 3GDEA 3T53B 2IX1A 1SYFA 3ULPA 2AUJD 2WP8J 2CKZB 2EJGC 1L0WA 2HIXA 4LF7L 4IUPA 2JA5B 2Q2HA 3FPUB 4XQQA 1D5ZC 2RBMA 1ICWA 4ZK9B 1EYGA 4JI1L 4ILWA 1KRTA 1DXMA 1I5FA 2M9VA 3Q0AA 3SVMA 2PW5A 4Y52H 1KIXA 1EWHA 3QOJA 1VQ5A 2XIWA 2JEAI 4U673 5KIXA 3HOWG 1SROA 4ZQ3A 3NBIA 4X65Q 2MPMA 2VUMH 1PTOD 3KDFA 5BN4A 3HP3A 1K83H 5ELFA 4X62L 4KN4C 5AFWA 4QGUA 4JI4L 1SRUA 1D2BA 3D6CA 1AN8A 1BBUA 1CKNB 3F2BA 3M4YA 4C2MB 1B3QA 5HURA 3QIAA 1HPCA 2L11A 3NBHA 3NQIA 1K3BC 2PQAB 4C3IB 4DV3L 1EOTA 1HNZL 3CKIB 4FO2A 4QJFA 3NSWA 1X3FA 1I4XA 3CC4A 5G3LF 3TS0A 1EQVA 3I4OA 4A3FG 1HQRD 4DNTB 1MSGA 1AP0A 2D9UA 3K5OA 2F3WA 3M85A 4QY7A 3TBIB 4A75A 4LF4L 3KF6B 5C0XG 1P16A 2HCCA 1KDBA 2K5HA 2KHJA 2Z1CA 4JW0A 4A3EG 3PUVA 3H94A 3KF8B 1NTGA 5I4DA 5ISRA 1HTPA 3GTPH 1FNUA 2L55A 3L7ZC 1VQ7A 4R4OA 3HKZG 5I6YA 1QZHA 5CGKA 1TU2B 1YBYA 3A8JE 1TY2A 1Q1EA 2OTLA 4LAAA 2A1AA 4R1JA 1BUVT 3B6YA 1A62A 4X66Q 3HOUB 5C3XA 1K9MC 1SEBD 4GNXA 1STBA 1TWGB 2WB1G 5CV8A 4BA1I 1WCMB 1LT5D 4ODGA 4ZKBB 3S1MB 1V1QA 1TWAB 3T16A 3S9WA 1JICA 4N9TA 3I4NH 1CT1D 4BBSH 1U4LA 2LXKA 2JA8H 1Y1VH 4JI8L 1EWIA 4DR7L 3HG9A 2F0UA 4LFAQ 1HHVA 3BU2A 3UDFA 2WKCA 3P20A 4ME3A 1HQMC 4BBRG 3URYA 4WFN3 5IYDH 5J22A 1Y8PB 4CDEC 1J5EL 1DD2A 3S17H 4X64Q 1SFOH 4HEDA 4LF9Q 2K32A 3QJYA 4K0KL 3Q8DA 5FOBB 1NSNS 5EBDA 3NWSA 4AYBB 1IYJB 2I5LX 3A56A 4IUQA 3H15A 4DV2Q 4G57A 1SYCA 4BXXH 3AEVA 3T1YQ 4EQ5A 4FYDA 5BN3A 1U9RA 2K52A 3CP0A 5LMUQ 1Y1WG 4DK0A 2R93G 1C9OA 1K0RA 2L15A 1PTOF 3AFQA 1FYCA 4LF5Q 1DOKA 2BDOA 5NUCA 2A69C 5IP9G 3LWUA 1HNWL 2AQ1B 1N33Q 2F0LA 1PFSA 1I6HH 1GUWA 4J8QA 3S1NB 2F0NA 2YV5A 3C3LA 4DF7A 2ZXPA 2EYFA 3HOVH 3MXUA 2XN9C 4DAVA 4FNFA 1BCPC 5IYCH 4OONA 4HN7A 5M3FB 2F3IA 1PA6A 4A3KB 1WYDA 1CTMA 3M3YH 4DR5L 1X3PA 4PQXA 3GTMH 4HMIA 5JJKA 3PO2B 4PG3A 3X3NA 1CHQD 1X54A 3G4SA 3BDLA 5IGEA 1D5MC 2ZTCA 1D1KA 2PO4A 1K0SA 2B29A 1YJ9A 1I4HA 1TXYA 1BO0A 5CC4A 1X3EA 4MIUA 1PH9A 4QCLA 1LTSD 1CA5A 1K8MA 5KYLA 3PIPA 1WJJA 1YNJD 3KDFB 4C3JB 4FF3A 3TP5A 1GM5A 3FKIH 3S2HH 1DM0B 1BOSA 3EVQA 4YWMA 5H1SE 4H44C 5CV5A 1D7QA 1RJTA 4DUYL 4FXKC 3JAMi 4BY7B 1K8GA 1B4OA 1R4PB 5IGGA 1JWSD 1FGBD 1EYDA 3H0GH 1CI3M 3VA7A 4BY1B 1D8LA 2F0HA 3OW2A 1MHWC 3C1EA 2NVTB 3H09A 4C3HH 1MI2A 4J6HA 5IE8A 2K5DA 4DKAC 4G7ZC 2ZJQA 4XT3B 1BCPB 4O2DA 1ET9A 1AEXA 3GTJB 1A2UA 2LFNA 4CKCA 3VR5A 2K75A 3K5LA 3S1RH 2PNHA 2QDLA 4MZ9A 4H13C 3KFUA 1EQQA 2OQKA 1XNRQ 2L12A 5IY0A 4RHSA 3J81i 2K1BA 1NR4A 3I4MH 3TP6A 5A2QE 3PV0A 1I3QB 5EAYA 4I7AA 4QIWB 1HRJA 1HNXQ 1ZYRD 1UUPA 2E2JB 1N9WA 1PRTF 1X3GA 5E4WC 3GTOB 3UDXA 1HZBA 1OXVA 2B63H 4PMCA 4H0LC 2XRQD 4EGVA 3EROA 2JSOA 3MVVA 5C4ZA 1J6QA 3IFTA 4Z9CB 2A8VA 1STYA 2IWHA 2CW0D 3RD4A 3KOJA 5EBCA 5F2DA 1YNXA 3I91A 3HS0C 5C3EG 4G7OC 1EY6A 2J7ZA 4OIJA 5GAHC 2MO1A 5M3FH 3D0FA 4QUFA 4DV2L 4RFBA 2VW9A 1A3VA 4YCUA 1WTHA 3ERSX 3G6EA 5LMUL 1VQCA 1FR3A 2KCCA 2PCFB 2QILA 3HGBA 3HKZE 4K8JA 4WRDA 5E1FA 4F88A 3PMFA 1JB3A 2NYZD 5IYBH 4LNQA 2BCOA 3F8TA 3D6WA 4LUOA 3H3VC 4P71A 1WTXA 1TR5A 1CKOA 2PI2E 4O42A 3CCVA 2OQ0A 4H02A 5CV6A 1CUKA 2A68D 4NW2A 2V1CC 1H9KA 2BDNA 2WB1E 2B2TC 2DY7A 2R7ZB 2E2HH 2NTSA 2HT1A 1Z47A 2JA5G 4RG1A 1R9TH 3K5MA 1Q7YC 2VY3A 1KAWA 1SMYC 2QGQA 1JC7A 4UHVA 4CJ1B 1HUNA 4OEMB 3SK8A 4JI0L 5K36H 5JEAJ 4KHPQ 2WIIB 2UUBL 2JK8A 4J15A 2I5HA 2B2VA 3ONAB 4B3TL 4ALPA 3EN2A 1F2LA 1E22A 3BJUA 3HOWH 4PMBA 4TSSA 1SE3A 3OPOA 1G6ZA 3W1BA 2QKIC 3BYTB 2AUKA 3FHWA 2HCIA 1YITA 1TS3A 1W3SA 3KLRA 1VQLA 4Y7NH 1DONA 1SYEA 3F2DA 4BXXG 1T9HA 4C1NI 3L3OC 2KVMA 1AE3A 4LF8Q 3E3XA 4RGOS 1SNQA 4MHEA 1DJRD 1PH1A 1PV4A 2F0VA 4OWXB 3NTIA 3GTGH 1I50H 5GQOA 2K01A 3PO3B 5D14A 3VDYA 4I65A 3PGZA 2Q8TA 3J7A5 1HH2P 2K14A 4C3IG 4KI0A 1S4ZA 3A74A 4HIKA 5CV7A 3ER0A 3KLWA 1WD1A 1XTDA 2L1BA 1O7YA 5C4JH 3F2UA 1JORA 4QF4A 3HOVG 1VQHA 5IYCG 2AWOA 1II3A 2ZTEA 1JWMD 4NXMQ 4R4QA 4DR2L 1GVPA 1O7LA 2VB3X 1CKNA 2WACA 1PFMA 4NXNL 4IJLA 1RTOA 1B50A 4PZ7A 4A3EH 2Z6BA 5JJLA 1XNRL 3HOZB 1SE2A 2JQOA 3TEHB 3DM3A 3HFZB 1SLJA 1YJNA 1B1ZA 2KEEA 2O5IC 2R7DA 1B3AA 4X3KA 3D3RA 4IOCA 3E6ZX 4YCWA 1N34L 1SYDA 3OWEB 3TREA 4PV1C 1BXTA 1IKLA 4K6LA 3RR5A 5D3DA 4LFCL 1XNQQ 1Q8IA 4RAUC 1H95A 2WV6D 4FF4A 2NVXH 2N55A 4M1UB 1LO5D 3CCUA 3GTKB 3PUYA 2UXCQ 2N78A 2XWBB 3A7LA 3BZDB 4B9WA 2Z4HA 1B70B 1F2MA 1WCMG 3EBEA 3H0GG 1B8AA 5IWAQ 4XT1B 2UUAL 4JV5Q 4JBWA 1GXDC 2ZTDA 1WD0A 4RGNA 3GTQH 4DV5Q 1CHPD 4DV7Q 4TQUS 3W2DA 3ICEA 4C3HG 2VL6A 1RIPA 3EIVA 2ZM6L 4JI7L 4MN3A 2LKVA 3A7AB 3DM1A 1QUQB 3ND8A 2MNAA 1ZKOA 1QNUA 2YYZA 1KRSA 2MFIA 4B3MQ 2OTJA 4KTAA 1F9PA 2YTYA 5I2XA 4V190 3GD7A 1GOZA 2B2VC 2TMPA 5EPJA 4OO1I 1SAPA 1KQSA 4A93B 1UEBA 1EY9A 2K28A 2YU9H 2FHTA 2HD3A 2MO0A 3VYUA 1GUSA 3LNNA 1IZ6A 2Y0SB 3CHBD 3SK6A 1VQIA 2HHHQ 1EOVA 1SMXA 4IZ8A 2X6GA 3NTHA 1KTKA 4R4IA 2R93H 1BF4A 2NWGA 3N52A 1WTOA 3NUCA 2ID0A 4XYQA 1LTBD 2MUYA 2MP1A 1U4MA 2PQEA 3BDCA 3HZXA 4IUVA 3W5OA 1BKBA 4IUTA 4L5QA 5JEAH 4DR4L 4P74A 1A3UA 4IPCA 3JAMc 5C4XB 1CK1A 4R4TA 3BVMA 1N36Q 5M3FG
chains in the Genus database with same CATH topology
5DAUA 4XQNA 4A3DB 2O2LD 3LWEA 1ENCA 2DN8A 4CJ2C 2L5TA 1EY7A 1TWCB 2SNMA 2VXWA 3NQTA 4CKBA 2CQAA 1EYAA 3BS1A 2H1EA 1Y69U 5FLXL 1L0XB 1XXGA 3MFYA 3ITPA 1GUTA 5C44B 3HOXB 4IQZA 3DMUA 1FNVA 5CBEE 1F2ZA 1X32A 2B8GA 3J81L 1M4VA 4C3JG 2EYHA 5JPNC 5JVH3 1NR2A 2HDLA 2SOBA 5EKLA 2KUMA 3AMUA 4R9WA 4E6IA 4RGMA 2RKSA 1TQOA 1SYGA 2CVRA 2MJ8A 2F3VA 5K36G 1AFPA 4LK1C 2GA4B 2LY7A 2Z4IA 3OIQA 5IGCA 5BN5A 4Q5VA 2EY1A 4EQNA 3GQBA 5HGTA 5FK9C 4R8IA 3R3OA 2JEBI 4OO1H 5M5XB 3IAYA 1S5FD 4A3IB 3I4LA 3MEHA 1G2TA 1LTAD 3GV6A 1S5BD 2LMCB 3WDNA 3P75A 1O80A 1XX8A 4PNYA 1V1OA 1PLFA 1VDZA 3CU7A 4XQJA 1RDPD 2C5CA 3K7AB 3MWYW 4KJOA 1KNEA 1F2YA 4B9XA 1O7ZA 5KRUA 2JA7B 2EY2A 5CBAE 1CQVA 1PFBA 1C8CA 4DAYA 5C6AA 1ESRA 1UEAB 3K57A 1B9NA 1TS4A 3KUPA 3M4OB 2EYJA 1TVXA 5KEEA 2QDBA 1E2ZA 2EYPA 5JAVA 4K14A 5I2YA 1EU3A 4N9PA 3Q24A 2NVYB 2AQ3B 1ENAA 2EYOA 3RUZA 2QF7A 4G7HC 1QE6A 3BYYB 3RZDB 4GZYC 3NTKA 1BNZA 3C2PA 2NVQB 4L6TB 5C4HA 3BVGA 1DYQA 1IW7C 4IURA 3DWPA 5CV9A 2HQEA 3O13A 2A6EC 4RKLA 4A3GB 4KD4A 2IX0A 1CQFA 1Y8OB 2EY5A 1HTLD 1LLRD 3A54A 3KLSA 1EY5A 4K5WA 3RLFA 2BOSA 1TWFB 1TWHB 3SK4A 3T51B 3VR6A 4FF1A 1E2VA 5EKIA 3SR1A 2EE1A 4EQPA 4DXFA 4QMGA 5JOBA 1PZKD 1HFNA 1J9OA 5J1ZA 4C1NK 1SNOA 3FPPA 1GJXA 1ONLA 4DN4M 5JEAG 3VA5A 5KNDA 2A6HC 1BBXC 1SNDA 4TKOB 4HTHA 1IHZA 3KBGA 1LT3D 3TSSA 4K6DA 5A35A 3TDQA 3VYRA 3VR2A 3CRKC 3SK5A 1DOLA 3R2TA 1PTOC 4HSVA 4B08A 1STGA 3DUZA 4FVMA 1A15A 1SMYD 4DA2A 5EGTA 2EJMA 3MXGA 2EYMA 1S5DD 1G91A 5DEHA 4CGYB 2EY6A 3M7GA 1EWCA 4IUUA 4A3MB 2B2TA 2B2YC 2RQXA 2K03A 4RCOA 4UDUC 5C5MA 3R8BA 1KAAA 3C46A 1PDQA 4DU9A 1GHKA 1MSHA 3DWAA 4CKEA 4L8JA 2KOLA 2JYOA 5IT9L 1RHPA 1OXSC 5KYIA 1QWYA 4K5VA 3MHBA 3R93A 1LTGD 3IKJA 5T1GA 2IX3A 1LTRD 4OL7A 3U9OA 4OO1G 3NE5B 2JP1A 3FRPB 1PTOB 1A6XA 1EEFD 4EQOA 4I7ZC 5M9OA 4YIJA 4CJ0B 2DY8A 1CM9A 1STHA 2ZXOA 2E2IB 1W6KA 1J8IA 4HMJA 1MD2D 2PZWA 3S2DB 1EIHA 3J7YW 4KKSA 2FJ2A 3IFDA 1ESFA 2ZT9C 1YNNC 2HDMA 3TN2A 1B53A 2B8FA 2NBFA 4FF2A 4A3FB 2A74C 2B2WC 1PRTC 2QCPX 2R92B 2PW7A 4KV6A 3H91A 3I8ZA 3K58A 1I4GA 2ICIA 3HOYB 2ZXRA 1H9JA 2Q8RE 3K6OA 2B2UC 1LTID 1EEID 4ME5A 2IL8A 2Z8LA 3S14B 1JWUD 1SE4A 2OXPA 4QB4A 4U68A 3S15B 2NB0A 1GUNA 3PUZA 5E4XA 2WB1B 2JE6I 1STNA 2JA6B 5M5YB 3N6RA 1VCIA 2F4IA 3NHHA 3ZYYX 2BE5C 2K5QA 3I70A 3D4RA 5FO7B 1PZID 3GO5A 2EXZA 1NAPA 2RVLA 2A5HA 2R3ZA 4FXDA 1PRTB 1XWEA 4BBRB 2IT1A 3EA6A 3K0YA 2FFKB 4A3JB 1TS2A 1H9MA 1KLGD 1QILA 3CQZB 3UI2A 2IW3A 3MTSA 3G7LA 2O5JC 3T56B 4V0BA 2E76C 1I4RA 2NN6I 3WOEA 2I46A 5M3MB 2IPKD 3BDOA 1JQYD 2KEDA 3OW7A 1Y1WB 3DEPA 1FNWA 1BDOA 3V96A 1V8QA 3HRZC 4Q0FA 2L4NA 3TP8A 1PXUA 5EJWA 4HCSA 2PZTA 2WINB 4RGTA 2ICEC 2KQ3A 1G8ZD 1TY0A 3OHXC 1ET6A 1LACA 5EKKA 1SNCA 3V05A 2IJ0A 5JJZA 1A3TA 1TIID 4BA2I 3BG3A 5IODA 3Q23A 2MHVA 1UNSA 1HXYD 3H6MA 3EQLC 2KECA 1SJHD 5DM73 3QWNA 2BA1A 3AB9A 1SSOA 3TZUA 3R2IA 1AZQA 5CV4A 3FEWX 3BVZA 3OWFA 1F9QA 5C3WA 3QO2A 4H7BA 4NDXA 2FMMA 2VNUD 3QG1A 2VUMB 4IUNA 1K83B 4RA8A 5I6WA 5ELDA 1Z6HA 1KDCA 2NN6H 4HR7B 3NWTA 5EQ0A 1EY8A 5CORA 2OF1A 1F77A 4KHZA 3J80L 3T13A 2A68C 3I72A 3TP7A 1T5EA 4KY6A 2JXMB 3GP7A 1Z7TA 1VF7A 5LL6X 4XYOA 2F0SA 3KK7A 4J1MA 3JAME 5CMDA 1H9SB 2A6ED 4RH6A 3D8GA 4M8AA 1H9RA 1V43A 2RDGA 5EPLA 3GTPB 1U4RA 2DNCA 1VMPA 1MBYA 4ULLA 2F0QA 4RHRA 5FLXE 2J0TD 2PNRC 4XDXA 3FMCA 3NXWA 2SEBD 3J81E 1G291 5LHY1 4RWSC 2CHBD 2RDFA 1BQQT 3DEOA 3NP8A 3V2TA 1OXXK 2A69D 2R61A 3SXHA 1QOHA 3I4NB 1Q12A 4BBSB 4HAEA 2JA8B 1Y1VB 1F9SA 1VMCA 1A2TA 4CBVA 3G6JB 3A8IE 3MA2B 1BCPD 2A6HD 3S17B 1SFOB 1IYVA 3D31A 1SNMA 4DNRB 1KLUD 2F0PA 3W3AA 4QUCA 2SDFA 1QJOA 4IFDJ 1GUOA 1NCVA 1RTNA 4DXGA 2D5DA 2L0CA 3VYSA 1LABA 3MZ5A 4R8NA 5ELEA 3T4AC 2F1MA 1I6HB 3I90A 3SDZA 1C48A 1D6EC 4X3UA 3L9AX 3HOVB 1M8AA 2XVSA 2D62A 3M3YB 2EDGA 3OMGA 4K8IA 2B2YA 3GTMB 3PIP3 4OHJA 1EZ8A 1V1PB 1E0BA 4HSPA 2F0KA 2N88A 2C9OA 3TMEA 2BA0A 1ZEQX 5DNFA 1EY4A 4P2CB 4F87A 3PUXA 1WTVA 1LTTD 4IFDI 2KCNA 1WVLA 3FKIB 1KNAA 4DAPA 3S2HB 2NZ1D 4KHVA 1JE4A 5IGBA 1TKWB 2NUCA 5D3IB 5FO8B 1Q1BA 1JOQA 1LV9A 1CZGA 1T5XD 2F0GA 3H0GB 3HEJA 1KABA 2B39A 1D5XC 1YNND 1LT4D 4C3HB 3AU7A 2FMCA 2OEOA 1ML0D 5T1IA 5ELBA 2NN6G 3S1RB 1PRTD 4ID6A 1IYUA 1O78A 3EFXD 3LX0A 3MC0B 2HUGA 4BS9A 1EYCA 4ZRZA 3I4MB 4FP5D 3QB3A 2MGSA 1BCPF 1QCBD 2F0WA 2B2WA 2B63B 1JOOA 1OXUA 1SYBA 3I73A 1SDFA 2X6LA 4ZKCB 2SNSA 4X3TA 1RODA 2F0OA 1B9MA 1WTPA 4FXGC 2XRSD 4IALA 1JCKB 2K05A 4ZAIA 2B2UA 1SNPA 5FKAC 2BE5D 1HA5A 1OXTA 1RCVD 2NTTA 1SXTA 1TS5A 4LMQD 3Q22A 2KA7A 2V4DA 2AWNA 5DM63 4IFDH 2PPBC 2AQ2B 1PYWD 3P1HA 3SHLA 2K6AA 4K2LA 1F9RA 4UAIA 4NMZA 4F7XA 3IL8A 1E2WA 1IKMA 1DOMA 3NK9A 3SE0A 1SBBB 2E2HB 1AW7A 3EJIA 5IT9E 1HA6A 1R9TB 3WOFA 2K33A 3Q6SA 4KD3A 3K5NA 1LT6D 3D4DA 2DNEA 1WTRA 1JOKA 3I3CA 3A55A 3HOWB 2F0FA 1ENFA 1HFGA 2PMZB 5C0XJ 4ABNA 1VF5C 4DGZA 4XTCS 4Y7NB 1PFNA 1QG7A 3OOCA 1NUCA 2F0EA 5A2QL 1ZXTA 4BWGB 2KHSA 5C5LA 1Q3LA 3GTGB 1I50B 1W6JA 1CFMA 1JR0D 3P7JA 1RF2D 1G2SA 1B44D 2XWJB 1EQTA 1EZ6A 2F0TA 1STEA 3OSOA 4WJWA 5C4JB 3DWQA 3GV3A 1GUGA 4RCNA 3A8KE 1I6VC 2EYLA 4A3EB 2J4XA 5J39A 1STAA 3DXJC 4IN3A 3HKZB 3FDTA 5C0XI 3ERQA 3J7AF 2F0DA 1H9SA 2NVXB 5D65A 3D4WA 3X3MA 3TZDA 5IGDA 1PZJD 2E2DC 3SEBA 3GTQB 5ELCA 1EY0A 4HCEA 3E5SA 1EL0A 1QB5D 2RSOA 3M7NA 5KNBA 2PYKA 4C56C 3MXNA 4O1NA 1X3QA 1PTOH 2K7VA 1KDAA 4TRDA 3OIPA 4X3SA 1YNJC 4JK1C 2OT2A 1MGSA 1L0YB 2M00A 2YU9B 3C1FA 5JPMC 1PMRA 3MAQA 4KY7A 4ZLTF 2K5WA 2R93B 1CZWA 2RA4A 2F0MA 4EVOA 1D1IA 4ZUJA 4XIGS 1EFID 2G9HD 4KN7C 2EJFC 1Q90A 4OIKA 4OGQC 3K59A 3VYTA 1SJED 4KK7A 2E75C 2PZUA 4CHTB 5I9OA 2WKDA 3FVQA 5C0XH 3VR3A 4K2KA 3RMHA 1DCZA 4IFDG 4NP5A 2VB2X 1XYIA 2F03A 1HUMA 4ZYSA 1ZYRC 1AZPA 1S5CD 4S3SA 2TSSA 4K5XA 3MFGA 1S5ED 3S16B 1K8OA 5KGUA 2K04A 1UAPA 1V1PA 3GTLB 2F0JA 2CW0C 4KY5A 1IL8A 2EVBA 1ILQA 1CA6A 3KF8A 3CRLC 2R6GA 1FD7D 1WTWA 2RDHA 3DHQA 2XSCA 4KKUA 5IGFA 5IOCA 5E3FA 5COYA 3MXPA 1ILPA 3S1QB 2QEJC 3E0JA 3VR4A 2EOTA 3PIO3 2X69A 3KBXA 1EU4A 5IIFA 5TSSA 5G3LD 4XXEA 1EIGA 1C4QA 3RZOB 5CR3A 1BR9A 2O4XA 4KMUC 3U9SA 2D2CC 2KJXA 1OO9B 3J80E 4KJNA 4G4KA 1Y8NB 3QOLA 2XNAC 3NPPA 1QNKA 1HCZA 4WORA 2FINB 2RSNA 5CYUA 1DD2A 1TT2A 5FO9B 5LL6S 4F8MA 2F0IA 1IW7D 2G9DA 1WTQA 4DK1A 5KNCA 2Q8IB 3J7AV 2I07B 2M2LA 5EPKA 3JAML 4RKBA 4KKTA 5I9PA 2EPBA 5C3EB 2A73B 2LS01 4A3BB 4PMWA 3KLSX 1GHJA 1U4PA 4LJZC 1RD9D 2L9HA 4NKLA 3ND9A 1I4PA 2ENBA 4ZUIA 3PUWA 2EZVA 1DZ1A 1I4QA 2WAQB 4DFAA 1R4QB 2E74C 4L63B 5JVG3 1B2TA 1RKNA 3OMCA 1XTCD 5M5WB 5K5PA 2H4OA 3T53B 2IX1A 1SYFA 2AUJD 2WP8J 2EJGC 4IUPA 2JA5B 3FPUB 4XQQA 1D5ZC 2RBMA 1ICWA 4ZK9B 4ILWA 1DXMA 2M9VA 3Q0AA 3SVMA 2PW5A 1EWHA 3QOJA 2XIWA 2JEAI 4U673 5KIXA 4ZQ3A 3NBIA 2MPMA 1PTOD 5BN4A 3HP3A 5ELFA 4KN4C 5AFWA 1D2BA 3D6CA 1AN8A 3M4YA 4C2MB 5HURA 3QIAA 1HPCA 2L11A 3NBHA 3NQIA 4C3IB 1EOTA 3CKIB 4FO2A 3NSWA 1I4XA 5G3LF 1EQVA 1HQRD 4DNTB 1MSGA 1AP0A 2D9UA 3K5OA 2F3WA 3M85A 3TBIB 5C0XG 2HCCA 1KDBA 2Z1CA 3PUVA 3H94A 5I4DA 5ISRA 1HTPA 1FNUA 2L55A 3L7ZC 5I6YA 5CGKA 1TU2B 3A8JE 1TY2A 1Q1EA 4LAAA 1BUVT 3HOUB 5C3XA 1SEBD 1STBA 1TWGB 5CV8A 4BA1I 1WCMB 1LT5D 4ODGA 4ZKBB 3S1MB 1TWAB 3T16A 3S9WA 1JICA 4N9TA 1CT1D 1U4LA 3HG9A 2F0UA 1HHVA 2WKCA 3P20A 1HQMC 3URYA 4WFN3 5J22A 1Y8PB 4HEDA 2K32A 3QJYA 5FOBB 1NSNS 5EBDA 3NWSA 4AYBB 3A56A 4IUQA 4G57A 1SYCA 4FYDA 5BN3A 1U9RA 4DK0A 1PTOF 1FYCA 1DOKA 2BDOA 5NUCA 2A69C 3LWUA 2AQ1B 2F0LA 1GUWA 4J8QA 3S1NB 2F0NA 3C3LA 4DF7A 2ZXPA 2EYFA 3MXUA 2XN9C 4DAVA 4FNFA 1BCPC 4HN7A 5M3FB 4A3KB 1CTMA 1X3PA 4PQXA 4HMIA 3PO2B 3X3NA 1CHQD 3BDLA 5IGEA 1D5MC 1D1KA 2PO4A 1I4HA 1BO0A 5CC4A 4MIUA 4QCLA 1LTSD 1CA5A 1K8MA 5KYLA 1YNJD 4C3JB 4FF3A 3TP5A 1DM0B 1BOSA 3EVQA 4H44C 5CV5A 1RJTA 4FXKC 4BY7B 1B4OA 1R4PB 5IGGA 1JWSD 1FGBD 1EYDA 3VA7A 1CI3M 4BY1B 2F0HA 3C1EA 2NVTB 3H09A 1MI2A 4J6HA 2K5DA 4G7ZC 4XT3B 1BCPB 1ET9A 1AEXA 3GTJB 1A2UA 2LFNA 4CKCA 3VR5A 3K5LA 4H13C 2L12A 4RHSA 2K1BA 1NR4A 3TP6A 5A2QE 3PV0A 1I3QB 4QIWB 1HRJA 1ZYRD 1UUPA 2E2JB 1PRTF 5E4WC 3GTOB 1OXVA 4PMCA 4H0LC 2XRQD 4EGVA 3EROA 2JSOA 3MVVA 5C4ZA 3IFTA 4Z9CB 1STYA 2IWHA 2CW0D 3RD4A 5EBCA 5F2DA 3I91A 3HS0C 4G7OC 1EY6A 2J7ZA 4OIJA 4QUFA 4RFBA 1A3VA 1FR3A 2KCCA 2PCFB 2QILA 3HGBA 4K8JA 4WRDA 5E1FA 4F88A 3PMFA 1JB3A 2NYZD 2BCOA 3D6WA 3H3VC 1WTXA 1TR5A 4O42A 5CV6A 2A68D 4NW2A 1H9KA 2BDNA 2B2TC 2DY7A 2R7ZB 2NTSA 1Z47A 3K5MA 1SMYC 1JC7A 4CJ1B 1HUNA 3SK8A 5K36H 5JEAJ 2WIIB 2B2VA 3ONAB 1F2LA 4PMBA 4TSSA 1SE3A 3OPOA 1G6ZA 2QKIC 3BYTB 2AUKA 2HCIA 1TS3A 3KLRA 1DONA 1SYEA 4C1NI 3L3OC 2KVMA 4RGOS 1SNQA 4MHEA 1DJRD 2F0VA 3NTIA 2K01A 3PO3B 5D14A 4I65A 2Q8TA 4C3IG 4KI0A 1S4ZA 5CV7A 1WD1A 2L1BA 1O7YA 3F2UA 1JORA 4QF4A 2AWOA 1II3A 1JWMD 1O7LA 2VB3X 2WACA 1PFMA 1RTOA 1B50A 3HOZB 1SE2A 1B1ZA 2KEEA 2O5IC 1B3AA 4X3KA 3D3RA 3E6ZX 1SYDA 3OWEB 4PV1C 1BXTA 1IKLA 4K6LA 5D3DA 1Q8IA 4RAUC 2WV6D 4FF4A 2N55A 4M1UB 1LO5D 3GTKB 3PUYA 3BZDB 2XWBB 3A7LA 4B9WA 2Z4HA 1F2MA 4XT1B 4JBWA 1GXDC 1WD0A 4RGNA 1CHPD 4TQUS 3W2DA 4C3HG 4MN3A 2LKVA 3A7AB 3DM1A 3ND8A 1ZKOA 1QNUA 2YYZA 4KTAA 1F9PA 5I2XA 4V190 3GD7A 1GOZA 2B2VC 2TMPA 5EPJA 4OO1I 1SAPA 4A93B 1EY9A 2K28A 2FHTA 3VYUA 1GUSA 3LNNA 2Y0SB 3CHBD 3SK6A 4IZ8A 2X6GA 3NTHA 1KTKA 1BF4A 2NWGA 3N52A 1WTOA 3NUCA 2ID0A 4XYQA 1LTBD 2MUYA 2MP1A 1U4MA 2PQEA 3BDCA 3HZXA 4IUVA 4IUTA 5JEAH 1A3UA 5C4XB 1CK1A 3BVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBA E;  1WTR A;  5EQ0 A;  1PFB A;  1ILQ A;  2RSO A;  3I3C A;  1ML0 D;  2FJ2 A;  3LWE A;  5COR A;  5T1I A;  1C8C A;  2KEE A;  1CA5 A;  1CA6 A;  4QUC A;  1ESR A;  1BBX C;  1B3A A;  3IFD A;  4IUP A;  1WTW A;  2NYZ D;  2KED A;  2SDF A;  4X3K A;  4CJ2 C;  3FPU B;  3KUP A;  1HFG A;  3D6W A;  2HDM A;  1NCV A;  1RTN A;  4ZKB B;  2VXW A;  1ICW A;  1TVX A;  3DEP A;  3TN2 A;  1B53 A;  1IKL A;  2HUG A;  1WTX A;  2H1E A;  4ZK9 B;  1DOL A;  4HSV A;  4O42 A;  5COY A;  1RJT A;  1X3Q A;  1ILP A;  1PFN A;  1JIC A;  1QG7 A;  4RAU C;  1A15 A;  3SVM A;  2B2W C;  4NW2 A;  1B4O A;  1ZXT A;  2EOT A;  2L4N A;  4X3S A;  1U4L A;  2BDN A;  2N55 A;  2MGS A;  5CBE E;  1X32 A;  2XIW A;  1G91 A;  2B2T C;  2DY7 A;  1HHV A;  1Q3L A;  2MPM A;  2X69 A;  3KBX A;  5EJW A;  4HCS A;  3H91 A;  2B2W A;  3HP3 A;  1MGS A;  5AFW A;  3I8Z A;  3P7J A;  1EIG A;  5CMD A;  4IUU A;  1IKM A;  1NR2 A;  2HDL A;  3I90 A;  1QE6 A;  2B2T A;  4XT1 B;  4ZLT F;  2B2Y C;  1WD0 A;  4X3U A;  4CJ1 B;  1G2S A;  1MI2 A;  4HED A;  1HUN A;  1M8A A;  2KUM A;  1SDF A;  2K03 A;  2X6L A;  4ZKC B;  1EQT A;  4X3T A;  2Q8R E;  4R9W A;  4XT3 B;  1BNZ A;  1ROD A;  2B2U C;  2B2V A;  1PDQ A;  2CVR A;  2MJ8 A;  3ONA B;  2B2Y A;  1WTP A;  5EPL A;  1MSH A;  1F2L A;  2RA4 A;  3GV3 A;  2IL8 A;  4IUR A;  5JJZ A;  1G6Z A;  4IUQ A;  1QNK A;  1U4R A;  4MN3 A;  2K05 A;  1VMP A;  4ZAI A;  1E0B A;  2HCI A;  2B2U A;  2FIN B;  2L11 A;  2RSN A;  3DM1 A;  2KOL A;  2JYO A;  2L12 A;  1RHP A;  4U68 A;  2N88 A;  2K1B A;  1NR4 A;  1WTO A;  1EOT A;  4OIK A;  1DON A;  5DNF A;  1F9P A;  4XDX A;  4LMQ D;  5E4X A;  1WTQ A;  2KVM A;  2B2V C;  5EPJ A;  4R8I A;  2KEC A;  3R93 A;  1DOK A;  1HRJ A;  4RWS C;  2M2L A;  5EPK A;  4MHE A;  1WTV A;  1SAP A;  5T1G A;  5E4W C;  2EPB A;  1MSG A;  1AP0 A;  2D9U A;  1WVL A;  2K28 A;  3FDT A;  2K01 A;  1GUW A;  2FHT A;  5D14 A;  1KNA A;  1SSO A;  2Q8T A;  2JP1 A;  2NZ1 D;  5EKI A;  1JE4 A;  1S4Z A;  1F9R A;  3DEO A;  1AZQ A;  2HCC A;  1G2T A;  1XYI A;  4UAI A;  3GV6 A;  1NAP A;  2RVL A;  1U4P A;  1HUM A;  1WD1 A;  1F9Q A;  2EE1 A;  2X6G A;  2R3Z A;  2L9H A;  1AZP A;  2L1B A;  3QO2 A;  3IL8 A;  1BF4 A;  1O7Y A;  2NWG A;  3F2U A;  3N52 A;  1DOM A;  1LV9 A;  1X3P A;  2FMM A;  1O80 A;  4HAE A;  1XX8 A;  2FFK B;  1F9S A;  1VMC A;  1PLF A;  3I91 A;  2DY8 A;  5D65 A;  1CM9 A;  3TZD A;  4CJ0 B;  2MP1 A;  1U4M A;  1DZ1 A;  1HA6 A;  4RA8 A;  4IUV A;  3UI2 A;  2J7Z A;  4OIJ A;  1PFM A;  1HFN A;  1J9O A;  2K04 A;  3MTS A;  4IUT A;  3Q6S A;  4QUF A;  3G7L A;  1RTO A;  3MWY W;  1B2T A;  1B50 A;  1IL8 A;  1KNE A;  1O7Z A;  1J8I A;  1EL0 A;  1BO0 A;  4DN4 M;  1EIH A; 
#chains in the Genus database with same CATH topology
 5DAU A;  1XPO A;  4XQN A;  4A3D B;  2O2L D;  3LWE A;  3PO2 G;  1KXL A;  2EIF A;  1ENC A;  2DN8 A;  4CJ2 C;  4LF8 L;  2L5T A;  2Q2I A;  4L5R C;  1EY7 A;  1TWC B;  2SNM A;  2VXW A;  3NQT A;  4CKB A;  2CQA A;  1EYA A;  3BS1 A;  2H1E A;  5IYB G;  1Y69 U;  5FLX L;  1L0X B;  1QVF A;  1XXG A;  1I94 Q;  3MFY A;  3ITP A;  1GUT A;  5C44 B;  4A3L H;  5FLX c;  1MIU A;  3HOX B;  4IQZ A;  3DMU A;  1FNV A;  5CBE E;  2I0Q A;  1F2Z A;  1X32 A;  5ELO A;  2B8G A;  3S16 H;  3J81 L;  4NB3 A;  1M4V A;  4C3J G;  5AJ3 Q;  2EYH A;  5JPN C;  3J81 c;  5JVH 3;  1NR2 A;  2HDL A;  1AE2 A;  2AKW B;  2SOB A;  5EKL A;  4IO9 A;  3GTL H;  1X9N A;  4OX9 Q;  2ZJR A;  2KUM A;  3AMU A;  4R9W A;  4E6I A;  4RGM A;  1X56 A;  2RKS A;  1X65 A;  1TQO A;  1SYG A;  2CVR A;  2MJ8 A;  2F3V A;  1QVC A;  1IXR A;  2CQO A;  1O7I A;  5K36 G;  1AFP A;  4LK1 C;  4JCV E;  4UP9 A;  4BY1 G;  2GA4 B;  2LY7 A;  5GAG C;  2Z4I A;  3OIQ A;  2Z9H A;  5IGC A;  5BN5 A;  4Q5V A;  1L2F A;  4GKK L;  4P72 A;  2EY1 A;  4EQN A;  3GQB A;  5HGT A;  5FK9 C;  3S1Q H;  4R8I A;  3R3O A;  2JEB I;  4OO1 H;  1WOC A;  1VQ6 A;  3KJP A;  5M5X B;  3IAY A;  3JC6 6;  1S5F D;  4A3I B;  3I4L A;  3RZO H;  2UXC L;  4R4C A;  3MEH A;  1G2T A;  1LTA D;  3GV6 A;  2OWO A;  1S5B D;  2UXB L;  2LMC B;  4JV5 L;  3WDN A;  3P75 A;  2YTX A;  1O80 A;  1XX8 A;  4PNY A;  1V1O A;  1PLF A;  3PIO A;  1VDZ A;  3CU7 A;  4XQJ A;  4GN5 A;  1RDP D;  4JI6 Q;  1A0I A;  2C5C A;  3K7A B;  3MWY W;  1MKH A;  4KJO A;  1KNE A;  1F2Y A;  4B9X A;  1O7Z A;  2GN5 A;  1IL2 A;  5KRU A;  2JA7 B;  2EY2 A;  5CBA E;  1CQV A;  1PFB A;  1C8C A;  4DAY A;  1XMO Q;  5C6A A;  1LUZ A;  1ESR A;  1UEA B;  3K57 A;  2QA4 A;  1B9N A;  5C3E H;  1TS4 A;  1SE8 A;  3KUP A;  4MTK A;  3UE0 A;  3M4O B;  2EYJ A;  1TVX A;  1YIJ A;  4A3B H;  5KEE A;  2UUC L;  2QDB A;  4HIM A;  2XGT A;  1E2Z A;  2EYP A;  5JAV A;  1VQG A;  1RL2 A;  4K14 A;  5I2Y A;  1PH3 A;  4GKJ L;  1EU3 A;  4N9P A;  3Q24 A;  4JYA Q;  3I56 A;  2NVY B;  2AQ3 B;  1ENA A;  2EYO A;  3RUZ A;  4YHH Q;  2QF7 A;  4G7H C;  1QE6 A;  1E3P A;  2DUD A;  3BYY B;  3RZD B;  4GZY C;  4DR3 Q;  4IPG A;  3NTK A;  5M5W H;  3STB C;  1U0L A;  1BNZ A;  2RHS B;  3C2P A;  2NVQ B;  4L6T B;  5C4H A;  3BVG A;  1DYQ A;  1N36 L;  1IW7 C;  4IUR A;  3DWP A;  5CV9 A;  2JA5 H;  2HQE A;  3O13 A;  4LF6 L;  3J7Z C;  3CCR A;  2A6E C;  3TRZ A;  4RKL A;  4A3G B;  4KD4 A;  2IX0 A;  2UU9 Q;  1CQF A;  1Y8O B;  2EY5 A;  4DK6 C;  1HTL D;  1LLR D;  3A54 A;  3KLS A;  1IBK L;  4WJ3 M;  1EY5 A;  4K5W A;  3RLF A;  4GOP A;  1C0A A;  2BOS A;  1TWF B;  1K73 C;  2HIV A;  1TWH B;  3SK4 A;  3T51 B;  3VR6 A;  1V9P A;  1S72 A;  3RN5 A;  4DUZ L;  1Q8K A;  4FF1 A;  1E2V A;  5EKI A;  4DAM A;  4JI3 Q;  1NE3 A;  3IRB A;  5AJ3 L;  2ALY B;  3SR1 A;  1YI2 A;  2EE1 A;  4EQP A;  4DXF A;  3K0X A;  4QMG A;  3CAM A;  3E0E A;  1QZG A;  4C2M H;  1PH5 A;  4DV0 Q;  5JOB A;  3PO3 G;  1PZK D;  1HFN A;  1J9O A;  5J1Z A;  4C1N K;  4C3I H;  1QVG A;  3M4P A;  1SNO A;  1UE1 A;  3FPP A;  1GJX A;  1N32 Q;  4X65 L;  1ONL A;  1A63 A;  4DN4 M;  5JEA G;  3VA5 A;  1EUJ A;  4DR1 Q;  5KND A;  3FP9 A;  2A6H C;  1BBX C;  3AFP A;  1SND A;  4TKO B;  4HTH A;  4JI2 Q;  3M4Q A;  1IHZ A;  3KBG A;  1LT3 D;  3TSS A;  4K6D A;  5A35 A;  1GKH A;  1NBW A;  4DR6 Q;  3M9B A;  1ASZ A;  3TDQ A;  3VYR A;  3VR2 A;  3CRK C;  3SK5 A;  1DOL A;  3R2T A;  1PTO C;  4HSV A;  4B08 A;  1STG A;  2Z0S A;  3DUZ A;  4FVM A;  1A15 A;  1SMY D;  4DA2 A;  1VS0 A;  5EGT A;  2EJM A;  4QQB X;  3MXG A;  2EYM A;  1S5D D;  1G91 A;  5DEH A;  1Q46 A;  3ZJY C;  4CGY B;  4A3L G;  2EY6 A;  1EQR A;  3M7G A;  1VQ8 A;  1EWC A;  4IUU A;  2ZJP A;  2B2T A;  4A3M B;  3T1H Q;  3J80 i;  2B2Y C;  1VQE A;  2RQX A;  3PSI A;  1E7Z A;  2K03 A;  4RCO A;  4DV1 Q;  4UDU C;  2F4V Q;  5C5M A;  3R8B A;  2E5L Q;  1KAA A;  3C46 A;  1PDQ A;  3HOU H;  4DU9 A;  1GHK A;  1MSH A;  4YWL A;  1TWG H;  3G48 A;  3DWA A;  4CKE A;  4YY3 Q;  1WCM H;  4L8J A;  1N8R C;  2KOL A;  2JYO A;  5IT9 L;  1RHP A;  1OXS C;  5ELN A;  2AHO B;  3S1M H;  2EQS A;  5KYI A;  1VQN A;  2DJF C;  5IT9 c;  1TWA H;  1QWY A;  2JN4 A;  4OWT B;  4K5V A;  3MHB A;  3R93 A;  1LTG D;  3IKJ A;  5HGQ A;  5T1G A;  4JYA L;  2IX3 A;  1VQD A;  1LTR D;  4OL7 A;  5E7N A;  3U9O A;  4OO1 G;  5L37 A;  4FDB A;  3NE5 B;  2JP1 A;  4X66 L;  3DLL A;  2PMZ E;  1X6O A;  3FRP B;  4YHH L;  4GOP C;  1PTO B;  3U50 C;  1A6X A;  1CSP A;  1EEF D;  4UP7 A;  4EQO A;  3K81 C;  4I7Z C;  4DAY B;  5M9O A;  4HJ5 A;  4YIJ A;  4CJ0 B;  2DY8 A;  1CM9 A;  4B3R Q;  4WJ4 A;  1STH A;  1KHI A;  1FJG Q;  1PH6 A;  2ZXO A;  2E2I B;  1W6K A;  1KL9 A;  3SGI A;  2CH4 A;  1J8I A;  2UU9 L;  1QUQ A;  4HMJ A;  1MD2 D;  2PZW A;  4LFA L;  4QIW E;  3S2D B;  3LGJ A;  1EIH A;  3J7Y W;  1PH8 A;  2RHQ B;  1CSQ A;  4KKS A;  2FJ2 A;  2KCT A;  1BVS A;  4X64 L;  3IFD A;  1ESF A;  2ZT9 C;  4LF9 L;  1YNN C;  3S1N H;  2HDM A;  1HZ9 A;  3TN2 A;  1B53 A;  2B8F A;  2NBF A;  4FF2 A;  5C4X G;  4A3F B;  2A74 C;  4A3B G;  2B2W C;  4A3K H;  1PRT C;  2QCP X;  4L5T A;  1UE6 A;  4A3D G;  1XPU A;  4B3S Q;  3PO2 H;  3T1Y L;  2R92 B;  2PW7 A;  4KV6 A;  3L2P A;  3H91 A;  3KJO A;  3I8Z A;  4A3C G;  3K58 A;  1I4G A;  4DV0 L;  3ULJ A;  2WAQ G;  2VQF Q;  4LF5 L;  4HIO A;  2ICI A;  4GOP B;  3HOY B;  2ZXR A;  1H9J A;  2Q8R E;  1K28 A;  2EXD A;  1N33 L;  3K6O A;  2B2U C;  1LTI D;  3HOX G;  1JT8 A;  1A8V A;  1EEI D;  5IP7 H;  4ME5 A;  3RN2 A;  2IL8 A;  2Z8L A;  3S14 B;  1JWU D;  1SE4 A;  4C3J H;  2OXP A;  4QB4 A;  4DR1 L;  4AQY Q;  4U68 A;  4LW1 A;  4JI2 L;  3S15 B;  2NB0 A;  3OTO Q;  1GUN A;  3PUZ A;  4UY8 C;  5E4X A;  2WB1 B;  4BY7 H;  2JE6 I;  1STN A;  1FVI A;  4MTN A;  2JA6 B;  4AIM A;  2ASB A;  4QL5 A;  5FLM H;  4BY1 H;  5M5Y B;  3N6R A;  1VCI A;  2F4I A;  3NHH A;  3ZYY X;  2BE5 C;  2K5Q A;  3I70 A;  1L1O A;  3D4R A;  5FO7 B;  2NVT H;  4HJ7 A;  1PZI D;  3GO5 A;  2EXZ A;  1NAP A;  2RVL A;  2A5H A;  2R3Z A;  1YEZ A;  4FXD A;  3GTJ H;  1PRT B;  1XWE A;  2IT1 A;  2KBN A;  3EA6 A;  4BBR B;  3K0Y A;  4JI5 Q;  2FFK B;  2F4V L;  2K5N A;  4A3J B;  2E5L L;  1TS2 A;  1H9M A;  1KLG D;  1NNX A;  1QIL A;  3CQZ B;  3UI2 A;  4A3I G;  1UWV A;  2IW3 A;  3MTS A;  1Z9F A;  3G7L A;  2O5J C;  4TVA B;  2UXD Q;  3T56 B;  2LXJ A;  2E76 C;  1I4R A;  4V0B A;  2NN6 I;  1I3Q H;  3WOE A;  3PQI A;  2E2J H;  2I46 A;  5M3M B;  2IPK D;  3BDO A;  1JQY D;  4POF A;  3GTO H;  2KED A;  3OW7 A;  1SR3 A;  1NJI C;  1Y1W B;  5GRO A;  4JPB W;  3DEP A;  1FNW A;  1XMQ Q;  3CCQ A;  2CH4 W;  1BDO A;  3V96 A;  3H3V I;  1V8Q A;  3HRZ C;  4Q0F A;  2WFW A;  2L4N A;  2Z6K C;  3TP8 A;  1PXU A;  5EJW A;  2RCF A;  4HCS A;  2PZT A;  2WIN B;  4RGT A;  1EFW A;  2ICE C;  4B3R L;  1Y14 B;  1HNX L;  2R7F A;  2KQ3 A;  4LUV A;  1G8Z D;  1TY0 A;  3OHX C;  1ET6 A;  4HJ8 A;  1LAC A;  1S40 A;  5EKK A;  2I5M X;  4JI1 Q;  1SNC A;  2BH2 A;  3V05 A;  2IJ0 A;  3S24 A;  5JJZ A;  1A3T A;  1Q82 C;  3HOU G;  1TII D;  4BA2 I;  3BG3 A;  5IOD A;  3Q23 A;  4O0A A;  2AMC B;  2MHV A;  4X62 Q;  1UNS A;  1HXY D;  3H6M A;  3CME A;  1HR0 Q;  3EQL C;  2KEC A;  1SJH D;  5DM7 3;  1G51 A;  4POG A;  2R7Z H;  3QWN A;  2BA1 A;  1Q81 C;  3AB9 A;  4A3G G;  4B3S L;  1SSO A;  3TZU A;  3R2I A;  1AZQ A;  4DK3 C;  5CV4 A;  2E8G A;  3FEW X;  3BVZ A;  3OWF A;  1F9Q A;  5C3W A;  3QO2 A;  4H7B A;  4NDX A;  3OYY A;  4DV3 Q;  2FMM A;  1HNZ Q;  2VNU D;  3NEN A;  3QG1 A;  3UDG A;  2VUM B;  4IUN A;  1L1O C;  1K83 B;  4RA8 A;  5I6W A;  5ELD A;  1Z6H A;  4AYB G;  1KDC A;  2NN6 H;  4HR7 B;  3NWT A;  4PZ8 A;  4LF4 Q;  5EQ0 A;  1EY8 A;  5COR A;  2OF1 A;  1F77 A;  4KHZ A;  3J80 L;  3T13 A;  2A68 C;  3I72 A;  3J80 c;  3TP7 A;  3PO3 H;  1T5E A;  4KHP L;  4KY6 A;  2JXM B;  2VS1 A;  4APV A;  3W1G A;  1NMG A;  3GP7 A;  3H3V H;  1Z7T A;  3A5Z B;  1VF7 A;  5LL6 X;  4XYO A;  2F0S A;  1M1K C;  3KK7 A;  4J1M A;  2IY5 B;  4A3K G;  3JAM E;  2GVB A;  4JI5 L;  4AH6 A;  5CMD A;  1K8A C;  1H9S B;  2A6E D;  4RH6 A;  3D8G A;  4M8A A;  1JJ2 A;  3HOZ H;  1H9R A;  1V43 A;  2RDG A;  5EPL A;  1HR0 W;  2IHF A;  2UXD L;  3GTP B;  1VQJ A;  4GS3 A;  1U4R A;  2DNC A;  1VMP A;  1MBY A;  5IP7 G;  1L1O B;  4JI8 Q;  4ULL A;  2F0Q A;  2WAQ E;  4RHR A;  5FLX E;  4DR7 Q;  3AYH B;  3J81 j;  2J0T D;  2PNR C;  4GLV B;  4XDX A;  3FMC A;  3CCJ A;  1J5E Q;  4NXM L;  3NXW A;  1XMQ L;  2SEB D;  3J81 E;  1G29 1;  5LHY 1;  2D0O A;  3GTK H;  4RWS C;  4JBJ A;  4BY7 G;  2CHB D;  4K0K Q;  2RDF A;  5FLM G;  1BQQ T;  1ICF B;  1HJP A;  3QR8 A;  4DNI A;  4L5S A;  3DEO A;  2K4K A;  3NP8 A;  3V2T A;  1OXX K;  2A69 D;  2D0P A;  2R61 A;  2CFM A;  1LYL A;  3SXH A;  1QOH A;  3I4N B;  2DGY A;  3CD6 A;  1Q12 A;  4BBS B;  4HAE A;  3UDI A;  2JA8 B;  1Y1V B;  1F9S A;  1VMC A;  1A2T A;  4CBV A;  3G6J B;  3A8I E;  3MA2 B;  4CDC C;  1BCP D;  1XNQ L;  4JOI A;  2A6H D;  3S17 B;  1HNW Q;  1SFO B;  2F52 A;  2XTI A;  1IYV A;  3NEM A;  3D31 A;  1SNM A;  1PH4 A;  4DNR B;  3W3A A;  1KLU D;  2F0P A;  4QUC A;  5IWA L;  1CKM A;  2G5D A;  1HR0 L;  4A93 H;  2SDF A;  1QJO A;  4DR5 Q;  4DV5 L;  4IFD J;  4DV7 L;  1GUO A;  4JVZ A;  1NCV A;  1RTN A;  2YTV A;  4DXG A;  2D5D A;  2L0C A;  3VYS A;  1LAB A;  1VQA A;  2CWP A;  3MZ5 A;  2Q2T A;  4R8N A;  5ELE A;  2GVA A;  4B3M L;  3T4A C;  2F1M A;  1I6H B;  3I90 A;  3SDZ A;  1C48 A;  2JJQ A;  1D6E C;  4X3U A;  3L9A X;  5C4X H;  4OWW B;  1M8A A;  2XVS A;  3HOV B;  2D62 A;  3M3Y B;  1HZA A;  2EDG A;  3OMG A;  4A3D H;  4K8I A;  1PH7 A;  2B2Y A;  1C7Y A;  3GTM B;  3PIP 3;  4OHJ A;  4GLX A;  4DUY Q;  1EZ8 A;  2R92 G;  1V1P B;  1B7Y B;  1GD7 A;  1E0B A;  4A3C H;  4HSP A;  2HHH L;  1TWC H;  3BZK A;  4JBM A;  2F0K A;  1VQ9 A;  2N88 A;  2C9O A;  2OCE A;  2A19 A;  1YJW A;  3TME A;  2BA0 A;  1ZEQ X;  5DNF A;  2N49 A;  1EY4 A;  3HOY G;  4P2C B;  4F87 A;  5C44 H;  3HOX H;  2VQE Q;  3PUX A;  4HJA A;  1WTV A;  2VZA A;  1LTT D;  4IOA A;  4IFD I;  2KCN A;  1WVL A;  1K3R A;  4A4I A;  3FKI B;  1KNA A;  1YHA A;  4DAP A;  2R7Z G;  3MEF A;  3S2H B;  2NZ1 D;  2QEX A;  4KHV A;  1EIF A;  1JE4 A;  5IGB A;  1TKW B;  2CWA A;  3CW2 C;  2NUC A;  5D3I B;  4JG2 A;  5FO8 B;  1Q1B A;  1JOQ A;  1LV9 A;  1CZG A;  1T5X D;  2F0G A;  2JA6 G;  3H0G B;  3HEJ A;  1KAB A;  2B39 A;  2K50 A;  1I94 L;  1VQO A;  1YZ6 A;  1D5X C;  1YNN D;  1LT4 D;  4C3H B;  3AU7 A;  2FMC A;  2PI2 A;  2OEO A;  1ML0 D;  5T1I A;  5ELB A;  2NN6 G;  3S1R B;  1PRT D;  1YHQ A;  4A3J G;  2Q2U A;  4AYB E;  4GN4 B;  1E1O A;  4ID6 A;  4JOI C;  3RNU A;  1IYU A;  1O78 A;  3EFX D;  3LX0 A;  3MC0 B;  5M5X H;  4OX9 L;  4A3I H;  4DV6 Q;  4MNO A;  2HUG A;  4BS9 A;  1EYC A;  4P75 A;  4ZRZ A;  3I4M B;  2HQL A;  1YHB A;  4FP5 D;  1MJC A;  4LUZ A;  3QB3 A;  2MGS A;  1PYS B;  1BCP F;  1QCB D;  2F0W A;  5M3M G;  2B3G A;  1KD1 C;  2B2W A;  2B63 B;  5JJI A;  1JOO A;  1OXU A;  1Q86 C;  1SYB A;  1LTL A;  3I73 A;  4N8X 1;  1FL0 A;  3K7A H;  4LFB Q;  1SDF A;  2X6L A;  4ZKC B;  2SNS A;  4X3T A;  2JA7 H;  1ROD A;  2F0O A;  3CF5 A;  1B9M A;  1WTP A;  4FXG C;  2XRS D;  4IAL A;  3HOZ G;  1LM0 A;  3L0O A;  1JCK B;  1GO3 E;  2K05 A;  1OTC A;  4ZAI A;  4DV4 Q;  2B2U A;  1SNP A;  5FKA C;  3M4O H;  2BE5 D;  1KC8 C;  1HA5 A;  1OXT A;  1RCV D;  2NTT A;  1SXT A;  1TS5 A;  3F1Z A;  4LMQ D;  3Q22 A;  2KA7 A;  2V4D A;  2AWN A;  1DGS A;  1YVC A;  5DM6 3;  4JI0 Q;  4IFD H;  2PPB C;  4JI6 L;  2AQ2 B;  2NVY H;  3PF5 A;  2UUB Q;  1PYW D;  3P1H A;  4B3T Q;  3SHL A;  2K6A A;  4K2L A;  1ASY A;  3RZD H;  1F9R A;  1NY4 A;  4UAI A;  4NMZ A;  1VQF A;  1XMO L;  5FJ8 H;  4N8F A;  4F7X A;  3IL8 A;  1E2W A;  2NVQ H;  1IKM A;  1DOM A;  3NK9 A;  3SE0 A;  3TQY A;  1SBB B;  3RLN A;  2E2H B;  1AW7 A;  3EJI A;  5IT9 E;  1HA6 A;  4IPD A;  1R9T B;  4A3G H;  3WOF A;  2K33 A;  2KCM A;  4EX5 A;  3Q6S A;  4GNX C;  3K7U C;  4KD3 A;  1LT6 D;  3K5N A;  1HZC A;  5LMN Q;  3D4D A;  2DNE A;  1WTR A;  1TWF H;  1S3O A;  1JOK A;  3I3C A;  3NBH B;  1TWH H;  3A55 A;  3I55 A;  3HOW B;  2F0F A;  2VUM G;  1ENF A;  4DR3 L;  2VQE L;  1HFG A;  2PMZ B;  5C0X J;  4ABN A;  1VF5 C;  4UPA A;  5GAD C;  1JB7 A;  2NZO A;  4DGZ A;  4A93 G;  3CCS A;  4XTC S;  4Y7N B;  4DR2 Q;  1PFN A;  1QG7 A;  3OOC A;  1NUC A;  4NXN Q;  2F0E A;  5A2Q L;  1ZXT A;  2Y0S G;  4BWG B;  1VQK A;  2KHS A;  3PF4 A;  5C5L A;  1BBW A;  1Q3L A;  4PZ6 A;  3GTG B;  1I50 B;  1W6J A;  1CFM A;  1JR0 D;  2K5V A;  3P7J A;  1RF2 D;  2Z6K A;  4HJ9 A;  1G2S A;  4YWK A;  1B44 D;  1N34 Q;  2XWJ B;  3HKS A;  1EQT A;  1AH9 A;  1SN8 A;  1EZ6 A;  2F0T A;  1STE A;  3OSO A;  4WJW A;  3NEL A;  1XPR A;  5C4J B;  4LFC Q;  3DWQ A;  3GV3 A;  4JI3 L;  2H5X A;  1IBL Q;  3CPW A;  1GUG A;  4RCN A;  2P5Z X;  3A8K E;  1I6V C;  2EYL A;  4A3E B;  4DV6 L;  4GNX B;  1IBM Q;  1JE5 A;  2UUA Q;  2J4X A;  5DLQ E;  5J39 A;  1STA A;  3DXJ C;  4IN3 A;  1E1T A;  5C44 G;  3HKZ B;  1UE5 A;  3FDT A;  5C0X I;  1XJV A;  1N32 L;  1NMF A;  3ERQ A;  4A3M H;  4DPG A;  2ZM6 Q;  3CCM A;  4JI7 Q;  3I7F A;  3J7A F;  2F0D A;  3UE1 A;  2RCN A;  1H9S A;  3K8A A;  5LMN W;  2NVX B;  4LFB L;  4ZCK A;  5D65 A;  3D4W A;  3X3M A;  4DR6 L;  3TZD A;  5GAE C;  5IGD A;  1PZJ D;  2E2D C;  1JJC B;  3A5U A;  3SEB A;  3CPF A;  3GTQ B;  5ELC A;  1EY0 A;  4HCE A;  3E5S A;  4DV4 L;  4GN3 B;  1EL0 A;  4RMF A;  3I4N G;  4P73 A;  1QB5 D;  4BBS G;  2RSO A;  2JA8 G;  1Y1V G;  5BR8 Q;  3M7N A;  5KNB A;  3T1H L;  1PYB A;  4HID A;  2PYK A;  5IYD G;  4C56 C;  4DV1 L;  4UP8 A;  3CMA A;  3MXN A;  4O1N A;  2NZH A;  3G71 A;  1X3Q A;  3F2C A;  1PTO H;  2K7V A;  1KDA A;  4TRD A;  3OIP A;  4DR4 Q;  4X3S A;  1YNJ C;  4JK1 C;  4YY3 L;  2OT2 A;  4IPH A;  1MGS A;  1L0Y B;  2M00 A;  3CC2 A;  2YU9 B;  3C1F A;  5JPM C;  1PMR A;  2BH8 A;  3MAQ A;  4KY7 A;  4ZLT F;  3KYH C;  2E2I H;  2K5W A;  4A76 A;  4CDD C;  1U5K A;  2CCZ A;  3S2D H;  2R93 B;  3AQQ A;  1CZW A;  2RA4 A;  5LMN L;  2F0M A;  4EVO A;  2JA7 G;  1D1I A;  2MQH A;  4ZUJ A;  4XIG S;  1EFI D;  1EIY B;  2G9H D;  4KN7 C;  2EJF C;  1Q90 A;  4OIK A;  4OGQ C;  1X55 A;  3K59 A;  3VYT A;  1SJE D;  4KK7 A;  4A3F H;  2E75 C;  4LF7 Q;  2DJG C;  2PZU A;  4CHT B;  1FJG L;  4KLK A;  5I9O A;  4X6A H;  2WKD A;  2R92 H;  3FVQ A;  5C0X H;  3VR3 A;  4K2K A;  3RMH A;  1JJG A;  1DCZ A;  4IFD G;  2PQA A;  4NP5 A;  2VB2 X;  1XYI A;  2F03 A;  1HUM A;  3HOY H;  4ZYS A;  3CC7 A;  1ZYR C;  1AZP A;  1S5C D;  4S3S A;  2TSS A;  4K5X A;  3MFG A;  4GKK Q;  1S5E D;  3S16 B;  4JI4 Q;  5FJ8 G;  2QW7 A;  3S14 H;  1K8O A;  3BZC A;  5KGU A;  3FKI G;  2FXQ A;  3CCL A;  2K04 A;  1UAP A;  1V1P A;  3KF6 A;  1IBL L;  2F0J A;  2CW0 C;  4KY5 A;  3GTL B;  3S15 H;  1IL8 A;  2IHE A;  2EVB A;  3U4V A;  4LWC A;  2JA6 H;  1ILQ A;  1CA6 A;  3KF8 A;  3CRL C;  2R6G A;  1IBM L;  2UXB Q;  1FD7 D;  1WI5 A;  5M5Y H;  1WTW A;  2VQF L;  2RDH A;  3DHQ A;  2XSC A;  1FGU A;  2ATW A;  4KKU A;  5IGF A;  5IOC A;  4YCV A;  5E3F A;  5COY A;  2RF4 A;  3MXP A;  4NPS A;  1ILP A;  2KHI A;  3S1Q B;  2QEJ C;  3E0J A;  3RLO A;  3VR4 A;  2EOT A;  4BBR H;  3PIO 3;  3CCE A;  3I2Z A;  4AQY L;  1E24 A;  4A3J H;  2X69 A;  3KBX A;  2ES2 A;  3CQZ H;  1EU4 A;  3OTO L;  3A0J A;  5IIF A;  5TSS A;  5G3L D;  4XXE A;  1VQ4 A;  1EIG A;  1C4Q A;  3RZO B;  2N8N A;  5CR3 A;  1BR9 A;  4IJH A;  2O4X A;  3I4M G;  4KMU C;  1G6P A;  3U9S A;  2D2C C;  2Y0S E;  3WWV A;  1MJE A;  2KJX A;  1OO9 B;  2UUC Q;  3J80 E;  4KJN A;  4G4K A;  3U58 A;  1Y8N B;  3PCO B;  5M3M H;  3QOL A;  2XNA C;  1JMC A;  4GKJ Q;  3NPP A;  3U4Z A;  1P8L A;  1QNK A;  1HCZ A;  4WOR A;  1PVO A;  2B63 G;  2FIN B;  2RSN A;  5CYU A;  5J3B A;  1TT2 A;  3STB D;  5FO9 B;  5BR8 L;  1Y1W H;  3TS2 A;  4JC0 A;  5LL6 S;  1UE7 A;  4F8M A;  2F0I A;  4CDF C;  4OEL B;  1VQM A;  1IW7 D;  2N3S A;  2G9D A;  3E9I A;  1WTQ A;  1VQB A;  4DK1 A;  5IP9 H;  5KNC A;  2Q8I B;  3J7A V;  1M90 C;  2I07 B;  2M2L A;  5EPK A;  3JAM L;  1PHJ A;  4RKB A;  4JBK A;  4KKT A;  5I9P A;  2EPB A;  5C3E B;  2C35 B;  2A73 B;  2LS0 1;  1PH2 A;  4GLA C;  4A3B B;  4PMW A;  3KLS X;  2LSS A;  4LF6 Q;  1GHJ A;  1U4P A;  4LJZ C;  3K80 C;  4A3M G;  1RD9 D;  2L9H A;  3E9H A;  4NKL A;  3ND9 A;  1VQP A;  1I4P A;  1IBK Q;  2ENB A;  4ZUI A;  3PUW A;  2EZV A;  1DZ1 A;  1W2B A;  1I4Q A;  2WAQ B;  4DFA A;  3ULL A;  2JA9 A;  2KEN A;  1R4Q B;  2E74 C;  4L63 B;  3MXN B;  4OXP A;  5HY6 A;  5JVG 3;  1RKN A;  1B2T A;  3OMC A;  4DUZ Q;  1WFQ A;  1XTC D;  5M5W B;  5K5P A;  3CXC A;  2H4O A;  3GDE A;  3T53 B;  2IX1 A;  1SYF A;  3ULP A;  2AUJ D;  2WP8 J;  2CKZ B;  2EJG C;  1L0W A;  2HIX A;  4LF7 L;  4IUP A;  2JA5 B;  2Q2H A;  3FPU B;  4XQQ A;  1D5Z C;  2RBM A;  1ICW A;  4ZK9 B;  1EYG A;  4JI1 L;  4ILW A;  1KRT A;  1DXM A;  1I5F A;  2M9V A;  3Q0A A;  3SVM A;  2PW5 A;  4Y52 H;  1KIX A;  1EWH A;  3QOJ A;  1VQ5 A;  2XIW A;  2JEA I;  4U67 3;  5KIX A;  3HOW G;  1SRO A;  4ZQ3 A;  3NBI A;  4X65 Q;  2MPM A;  2VUM H;  1PTO D;  3KDF A;  5BN4 A;  3HP3 A;  1K83 H;  5ELF A;  4X62 L;  4KN4 C;  5AFW A;  4QGU A;  4JI4 L;  1SRU A;  1D2B A;  3D6C A;  1AN8 A;  1BBU A;  1CKN B;  3F2B A;  3M4Y A;  4C2M B;  1B3Q A;  5HUR A;  3QIA A;  1HPC A;  2L11 A;  3NBH A;  3NQI A;  1K3B C;  2PQA B;  4C3I B;  4DV3 L;  1EOT A;  1HNZ L;  3CKI B;  4FO2 A;  4QJF A;  3NSW A;  1X3F A;  1I4X A;  3CC4 A;  5G3L F;  3TS0 A;  1EQV A;  3I4O A;  4A3F G;  1HQR D;  4DNT B;  1MSG A;  1AP0 A;  2D9U A;  3K5O A;  2F3W A;  3M85 A;  4QY7 A;  3TBI B;  4A75 A;  4LF4 L;  3KF6 B;  5C0X G;  1P16 A;  2HCC A;  1KDB A;  2K5H A;  2KHJ A;  2Z1C A;  4JW0 A;  4A3E G;  3PUV A;  3H94 A;  3KF8 B;  1NTG A;  5I4D A;  5ISR A;  1HTP A;  3GTP H;  1FNU A;  2L55 A;  3L7Z C;  1VQ7 A;  4R4O A;  3HKZ G;  5I6Y A;  1QZH A;  5CGK A;  1TU2 B;  1YBY A;  3A8J E;  1TY2 A;  1Q1E A;  2OTL A;  4LAA A;  2A1A A;  4R1J A;  1BUV T;  3B6Y A;  1A62 A;  4X66 Q;  3HOU B;  5C3X A;  1K9M C;  1SEB D;  4GNX A;  1STB A;  1TWG B;  2WB1 G;  5CV8 A;  4BA1 I;  1WCM B;  1LT5 D;  4ODG A;  4ZKB B;  3S1M B;  1V1Q A;  1TWA B;  3T16 A;  3S9W A;  1JIC A;  4N9T A;  3I4N H;  1CT1 D;  4BBS H;  1U4L A;  2LXK A;  2JA8 H;  1Y1V H;  4JI8 L;  1EWI A;  4DR7 L;  3HG9 A;  2F0U A;  4LFA Q;  1HHV A;  3BU2 A;  3UDF A;  2WKC A;  3P20 A;  4ME3 A;  1HQM C;  4BBR G;  3URY A;  4WFN 3;  5IYD H;  5J22 A;  1Y8P B;  4CDE C;  1J5E L;  1DD2 A;  3S17 H;  4X64 Q;  1SFO H;  4HED A;  4LF9 Q;  2K32 A;  3QJY A;  4K0K L;  3Q8D A;  5FOB B;  1NSN S;  5EBD A;  3NWS A;  4AYB B;  1IYJ B;  2I5L X;  3A56 A;  4IUQ A;  3H15 A;  4DV2 Q;  4G57 A;  1SYC A;  4BXX H;  3AEV A;  3T1Y Q;  4EQ5 A;  4FYD A;  5BN3 A;  1U9R A;  2K52 A;  3CP0 A;  5LMU Q;  1Y1W G;  4DK0 A;  2R93 G;  1C9O A;  1K0R A;  2L15 A;  1PTO F;  3AFQ A;  1FYC A;  4LF5 Q;  1DOK A;  2BDO A;  5NUC A;  2A69 C;  5IP9 G;  3LWU A;  1HNW L;  2AQ1 B;  1N33 Q;  2F0L A;  1PFS A;  1I6H H;  1GUW A;  4J8Q A;  3S1N B;  2F0N A;  2YV5 A;  3C3L A;  4DF7 A;  2ZXP A;  2EYF A;  3HOV H;  3MXU A;  2XN9 C;  4DAV A;  4FNF A;  1BCP C;  5IYC H;  4OON A;  4HN7 A;  5M3F B;  2F3I A;  1PA6 A;  4A3K B;  1WYD A;  1CTM A;  3M3Y H;  4DR5 L;  1X3P A;  4PQX A;  3GTM H;  4HMI A;  5JJK A;  3PO2 B;  4PG3 A;  3X3N A;  1CHQ D;  1X54 A;  3G4S A;  3BDL A;  5IGE A;  1D5M C;  2ZTC A;  1D1K A;  2PO4 A;  1K0S A;  2B29 A;  1YJ9 A;  1I4H A;  1TXY A;  1BO0 A;  5CC4 A;  1X3E A;  4MIU A;  1PH9 A;  4QCL A;  1LTS D;  1CA5 A;  1K8M A;  5KYL A;  3PIP A;  1WJJ A;  1YNJ D;  3KDF B;  4C3J B;  4FF3 A;  3TP5 A;  1GM5 A;  3FKI H;  3S2H H;  1DM0 B;  1BOS A;  3EVQ A;  4YWM A;  5H1S E;  4H44 C;  5CV5 A;  1D7Q A;  1RJT A;  4DUY L;  4FXK C;  3JAM i;  4BY7 B;  1K8G A;  1B4O A;  1R4P B;  5IGG A;  1JWS D;  1FGB D;  1EYD A;  3H0G H;  1CI3 M;  3VA7 A;  4BY1 B;  1D8L A;  2F0H A;  3OW2 A;  1MHW C;  3C1E A;  2NVT B;  3H09 A;  4C3H H;  1MI2 A;  4J6H A;  5IE8 A;  2K5D A;  4DKA C;  4G7Z C;  2ZJQ A;  4XT3 B;  1BCP B;  4O2D A;  1ET9 A;  1AEX A;  3GTJ B;  1A2U A;  2LFN A;  4CKC A;  3VR5 A;  2K75 A;  3K5L A;  3S1R H;  2PNH A;  2QDL A;  4MZ9 A;  4H13 C;  3KFU A;  1EQQ A;  2OQK A;  1XNR Q;  2L12 A;  5IY0 A;  4RHS A;  3J81 i;  2K1B A;  1NR4 A;  3I4M H;  3TP6 A;  5A2Q E;  3PV0 A;  1I3Q B;  5EAY A;  4I7A A;  4QIW B;  1HRJ A;  1HNX Q;  1ZYR D;  1UUP A;  2E2J B;  1N9W A;  1PRT F;  1X3G A;  5E4W C;  3GTO B;  3UDX A;  1HZB A;  1OXV A;  2B63 H;  4PMC A;  4H0L C;  2XRQ D;  4EGV A;  3ERO A;  2JSO A;  3MVV A;  5C4Z A;  1J6Q A;  3IFT A;  4Z9C B;  2A8V A;  1STY A;  2IWH A;  2CW0 D;  3RD4 A;  3KOJ A;  5EBC A;  5F2D A;  1YNX A;  3I91 A;  3HS0 C;  5C3E G;  4G7O C;  1EY6 A;  2J7Z A;  4OIJ A;  5GAH C;  2MO1 A;  5M3F H;  3D0F A;  4QUF A;  4DV2 L;  4RFB A;  2VW9 A;  1A3V A;  4YCU A;  1WTH A;  3ERS X;  3G6E A;  5LMU L;  1VQC A;  1FR3 A;  2KCC A;  2PCF B;  2QIL A;  3HGB A;  3HKZ E;  4K8J A;  4WRD A;  5E1F A;  4F88 A;  3PMF A;  1JB3 A;  2NYZ D;  5IYB H;  4LNQ A;  2BCO A;  3F8T A;  3D6W A;  4LUO A;  3H3V C;  4P71 A;  1WTX A;  1TR5 A;  1CKO A;  2PI2 E;  4O42 A;  3CCV A;  2OQ0 A;  4H02 A;  5CV6 A;  1CUK A;  2A68 D;  4NW2 A;  2V1C C;  1H9K A;  2BDN A;  2WB1 E;  2B2T C;  2DY7 A;  2R7Z B;  2E2H H;  2NTS A;  2HT1 A;  1Z47 A;  2JA5 G;  4RG1 A;  1R9T H;  3K5M A;  1Q7Y C;  2VY3 A;  1KAW A;  1SMY C;  2QGQ A;  1JC7 A;  4UHV A;  4CJ1 B;  1HUN A;  4OEM B;  3SK8 A;  4JI0 L;  5K36 H;  5JEA J;  4KHP Q;  2WII B;  2UUB L;  2JK8 A;  4J15 A;  2I5H A;  2B2V A;  3ONA B;  4B3T L;  4ALP A;  3EN2 A;  1F2L A;  1E22 A;  3BJU A;  3HOW H;  4PMB A;  4TSS A;  1SE3 A;  3OPO A;  1G6Z A;  3W1B A;  2QKI C;  3BYT B;  2AUK A;  3FHW A;  2HCI A;  1YIT A;  1TS3 A;  1W3S A;  3KLR A;  1VQL A;  4Y7N H;  1DON A;  1SYE A;  3F2D A;  4BXX G;  1T9H A;  4C1N I;  3L3O C;  2KVM A;  1AE3 A;  4LF8 Q;  3E3X A;  4RGO S;  1SNQ A;  4MHE A;  1DJR D;  1PH1 A;  1PV4 A;  2F0V A;  4OWX B;  3NTI A;  3GTG H;  1I50 H;  5GQO A;  2K01 A;  3PO3 B;  5D14 A;  3VDY A;  4I65 A;  3PGZ A;  2Q8T A;  3J7A 5;  1HH2 P;  2K14 A;  4C3I G;  4KI0 A;  1S4Z A;  3A74 A;  4HIK A;  5CV7 A;  3ER0 A;  3KLW A;  1WD1 A;  1XTD A;  2L1B A;  1O7Y A;  5C4J H;  3F2U A;  1JOR A;  4QF4 A;  3HOV G;  1VQH A;  5IYC G;  2AWO A;  1II3 A;  2ZTE A;  1JWM D;  4NXM Q;  4R4Q A;  4DR2 L;  1GVP A;  1O7L A;  2VB3 X;  1CKN A;  2WAC A;  1PFM A;  4NXN L;  4IJL A;  1RTO A;  1B50 A;  4PZ7 A;  4A3E H;  2Z6B A;  5JJL A;  1XNR L;  3HOZ B;  1SE2 A;  2JQO A;  3TEH B;  3DM3 A;  3HFZ B;  1SLJ A;  1YJN A;  1B1Z A;  2KEE A;  2O5I C;  2R7D A;  1B3A A;  4X3K A;  3D3R A;  4IOC A;  3E6Z X;  4YCW A;  1N34 L;  1SYD A;  3OWE B;  3TRE A;  4PV1 C;  1BXT A;  1IKL A;  4K6L A;  3RR5 A;  5D3D A;  4LFC L;  1XNQ Q;  1Q8I A;  4RAU C;  1H95 A;  2WV6 D;  4FF4 A;  2NVX H;  2N55 A;  4M1U B;  1LO5 D;  3CCU A;  3GTK B;  3PUY A;  2UXC Q;  2N78 A;  2XWB B;  3A7L A;  3BZD B;  4B9W A;  2Z4H A;  1B70 B;  1F2M A;  1WCM G;  3EBE A;  3H0G G;  1B8A A;  5IWA Q;  4XT1 B;  2UUA L;  4JV5 Q;  4JBW A;  1GXD C;  2ZTD A;  1WD0 A;  4RGN A;  3GTQ H;  4DV5 Q;  1CHP D;  4DV7 Q;  4TQU S;  3W2D A;  3ICE A;  4C3H G;  2VL6 A;  1RIP A;  3EIV A;  2ZM6 L;  4JI7 L;  4MN3 A;  2LKV A;  3A7A B;  3DM1 A;  1QUQ B;  3ND8 A;  2MNA A;  1ZKO A;  1QNU A;  2YYZ A;  1KRS A;  2MFI A;  4B3M Q;  2OTJ A;  4KTA A;  1F9P A;  2YTY A;  5I2X A;  4V19 0;  3GD7 A;  1GOZ A;  2B2V C;  2TMP A;  5EPJ A;  4OO1 I;  1SAP A;  1KQS A;  4A93 B;  1UEB A;  1EY9 A;  2K28 A;  2YU9 H;  2FHT A;  2HD3 A;  2MO0 A;  3VYU A;  1GUS A;  3LNN A;  1IZ6 A;  2Y0S B;  3CHB D;  3SK6 A;  1VQI A;  2HHH Q;  1EOV A;  1SMX A;  4IZ8 A;  2X6G A;  3NTH A;  1KTK A;  4R4I A;  2R93 H;  1BF4 A;  2NWG A;  3N52 A;  1WTO A;  3NUC A;  2ID0 A;  4XYQ A;  1LTB D;  2MUY A;  2MP1 A;  1U4M A;  2PQE A;  3BDC A;  3HZX A;  4IUV A;  3W5O A;  1BKB A;  4IUT A;  4L5Q A;  5JEA H;  4DR4 L;  4P74 A;  1A3U A;  4IPC A;  3JAM c;  5C4X B;  1CK1 A;  4R4T A;  3BVM A;  1N36 Q;  5M3F G; 
#chains in the Genus database with same CATH homology
 5DAU A;  4XQN A;  4A3D B;  2O2L D;  3LWE A;  1ENC A;  2DN8 A;  4CJ2 C;  2L5T A;  1EY7 A;  1TWC B;  2SNM A;  2VXW A;  3NQT A;  4CKB A;  2CQA A;  1EYA A;  3BS1 A;  2H1E A;  1Y69 U;  5FLX L;  1L0X B;  1XXG A;  3MFY A;  3ITP A;  1GUT A;  5C44 B;  3HOX B;  4IQZ A;  3DMU A;  1FNV A;  5CBE E;  1F2Z A;  1X32 A;  2B8G A;  3J81 L;  1M4V A;  4C3J G;  2EYH A;  5JPN C;  5JVH 3;  1NR2 A;  2HDL A;  2SOB A;  5EKL A;  2KUM A;  3AMU A;  4R9W A;  4E6I A;  4RGM A;  2RKS A;  1TQO A;  1SYG A;  2CVR A;  2MJ8 A;  2F3V A;  5K36 G;  1AFP A;  4LK1 C;  2GA4 B;  2LY7 A;  2Z4I A;  3OIQ A;  5IGC A;  5BN5 A;  4Q5V A;  2EY1 A;  4EQN A;  3GQB A;  5HGT A;  5FK9 C;  4R8I A;  3R3O A;  2JEB I;  4OO1 H;  5M5X B;  3IAY A;  1S5F D;  4A3I B;  3I4L A;  3MEH A;  1G2T A;  1LTA D;  3GV6 A;  1S5B D;  2LMC B;  3WDN A;  3P75 A;  1O80 A;  1XX8 A;  4PNY A;  1V1O A;  1PLF A;  1VDZ A;  3CU7 A;  4XQJ A;  1RDP D;  2C5C A;  3K7A B;  3MWY W;  4KJO A;  1KNE A;  1F2Y A;  4B9X A;  1O7Z A;  5KRU A;  2JA7 B;  2EY2 A;  5CBA E;  1CQV A;  1PFB A;  1C8C A;  4DAY A;  5C6A A;  1ESR A;  1UEA B;  3K57 A;  1B9N A;  1TS4 A;  3KUP A;  3M4O B;  2EYJ A;  1TVX A;  5KEE A;  2QDB A;  1E2Z A;  2EYP A;  5JAV A;  4K14 A;  5I2Y A;  1EU3 A;  4N9P A;  3Q24 A;  2NVY B;  2AQ3 B;  1ENA A;  2EYO A;  3RUZ A;  2QF7 A;  4G7H C;  1QE6 A;  3BYY B;  3RZD B;  4GZY C;  3NTK A;  1BNZ A;  3C2P A;  2NVQ B;  4L6T B;  5C4H A;  3BVG A;  1DYQ A;  1IW7 C;  4IUR A;  3DWP A;  5CV9 A;  2HQE A;  3O13 A;  2A6E C;  4RKL A;  4A3G B;  4KD4 A;  2IX0 A;  1CQF A;  1Y8O B;  2EY5 A;  1HTL D;  1LLR D;  3A54 A;  3KLS A;  1EY5 A;  4K5W A;  3RLF A;  2BOS A;  1TWF B;  1TWH B;  3SK4 A;  3T51 B;  3VR6 A;  4FF1 A;  1E2V A;  5EKI A;  3SR1 A;  2EE1 A;  4EQP A;  4DXF A;  4QMG A;  5JOB A;  1PZK D;  1HFN A;  1J9O A;  5J1Z A;  4C1N K;  1SNO A;  3FPP A;  1GJX A;  1ONL A;  4DN4 M;  5JEA G;  3VA5 A;  5KND A;  2A6H C;  1BBX C;  1SND A;  4TKO B;  4HTH A;  1IHZ A;  3KBG A;  1LT3 D;  3TSS A;  4K6D A;  5A35 A;  3TDQ A;  3VYR A;  3VR2 A;  3CRK C;  3SK5 A;  1DOL A;  3R2T A;  1PTO C;  4HSV A;  4B08 A;  1STG A;  3DUZ A;  4FVM A;  1A15 A;  1SMY D;  4DA2 A;  5EGT A;  2EJM A;  3MXG A;  2EYM A;  1S5D D;  1G91 A;  5DEH A;  4CGY B;  2EY6 A;  3M7G A;  1EWC A;  4IUU A;  4A3M B;  2B2T A;  2B2Y C;  2RQX A;  2K03 A;  4RCO A;  4UDU C;  5C5M A;  3R8B A;  1KAA A;  3C46 A;  1PDQ A;  4DU9 A;  1GHK A;  1MSH A;  3DWA A;  4CKE A;  4L8J A;  2KOL A;  2JYO A;  5IT9 L;  1RHP A;  1OXS C;  5KYI A;  1QWY A;  4K5V A;  3MHB A;  3R93 A;  1LTG D;  3IKJ A;  5T1G A;  2IX3 A;  1LTR D;  4OL7 A;  3U9O A;  4OO1 G;  3NE5 B;  2JP1 A;  3FRP B;  1PTO B;  1A6X A;  1EEF D;  4EQO A;  4I7Z C;  5M9O A;  4YIJ A;  4CJ0 B;  2DY8 A;  1CM9 A;  1STH A;  2ZXO A;  2E2I B;  1W6K A;  1J8I A;  4HMJ A;  1MD2 D;  2PZW A;  3S2D B;  1EIH A;  3J7Y W;  4KKS A;  2FJ2 A;  3IFD A;  1ESF A;  2ZT9 C;  1YNN C;  2HDM A;  3TN2 A;  1B53 A;  2B8F A;  2NBF A;  4FF2 A;  4A3F B;  2A74 C;  2B2W C;  1PRT C;  2QCP X;  2R92 B;  2PW7 A;  4KV6 A;  3H91 A;  3I8Z A;  3K58 A;  1I4G A;  2ICI A;  3HOY B;  2ZXR A;  1H9J A;  2Q8R E;  3K6O A;  2B2U C;  1LTI D;  1EEI D;  4ME5 A;  2IL8 A;  2Z8L A;  3S14 B;  1JWU D;  1SE4 A;  2OXP A;  4QB4 A;  4U68 A;  3S15 B;  2NB0 A;  1GUN A;  3PUZ A;  5E4X A;  2WB1 B;  2JE6 I;  1STN A;  2JA6 B;  5M5Y B;  3N6R A;  1VCI A;  2F4I A;  3NHH A;  3ZYY X;  2BE5 C;  2K5Q A;  3I70 A;  3D4R A;  5FO7 B;  1PZI D;  3GO5 A;  2EXZ A;  1NAP A;  2RVL A;  2A5H A;  2R3Z A;  4FXD A;  1PRT B;  1XWE A;  4BBR B;  2IT1 A;  3EA6 A;  3K0Y A;  2FFK B;  4A3J B;  1TS2 A;  1H9M A;  1KLG D;  1QIL A;  3CQZ B;  3UI2 A;  2IW3 A;  3MTS A;  3G7L A;  2O5J C;  3T56 B;  4V0B A;  2E76 C;  1I4R A;  2NN6 I;  3WOE A;  2I46 A;  5M3M B;  2IPK D;  3BDO A;  1JQY D;  2KED A;  3OW7 A;  1Y1W B;  3DEP A;  1FNW A;  1BDO A;  3V96 A;  1V8Q A;  3HRZ C;  4Q0F A;  2L4N A;  3TP8 A;  1PXU A;  5EJW A;  4HCS A;  2PZT A;  2WIN B;  4RGT A;  2ICE C;  2KQ3 A;  1G8Z D;  1TY0 A;  3OHX C;  1ET6 A;  1LAC A;  5EKK A;  1SNC A;  3V05 A;  2IJ0 A;  5JJZ A;  1A3T A;  1TII D;  4BA2 I;  3BG3 A;  5IOD A;  3Q23 A;  2MHV A;  1UNS A;  1HXY D;  3H6M A;  3EQL C;  2KEC A;  1SJH D;  5DM7 3;  3QWN A;  2BA1 A;  3AB9 A;  1SSO A;  3TZU A;  3R2I A;  1AZQ A;  5CV4 A;  3FEW X;  3BVZ A;  3OWF A;  1F9Q A;  5C3W A;  3QO2 A;  4H7B A;  4NDX A;  2FMM A;  2VNU D;  3QG1 A;  2VUM B;  4IUN A;  1K83 B;  4RA8 A;  5I6W A;  5ELD A;  1Z6H A;  1KDC A;  2NN6 H;  4HR7 B;  3NWT A;  5EQ0 A;  1EY8 A;  5COR A;  2OF1 A;  1F77 A;  4KHZ A;  3J80 L;  3T13 A;  2A68 C;  3I72 A;  3TP7 A;  1T5E A;  4KY6 A;  2JXM B;  3GP7 A;  1Z7T A;  1VF7 A;  5LL6 X;  4XYO A;  2F0S A;  3KK7 A;  4J1M A;  3JAM E;  5CMD A;  1H9S B;  2A6E D;  4RH6 A;  3D8G A;  4M8A A;  1H9R A;  1V43 A;  2RDG A;  5EPL A;  3GTP B;  1U4R A;  2DNC A;  1VMP A;  1MBY A;  4ULL A;  2F0Q A;  4RHR A;  5FLX E;  2J0T D;  2PNR C;  4XDX A;  3FMC A;  3NXW A;  2SEB D;  3J81 E;  1G29 1;  5LHY 1;  4RWS C;  2CHB D;  2RDF A;  1BQQ T;  3DEO A;  3NP8 A;  3V2T A;  1OXX K;  2A69 D;  2R61 A;  3SXH A;  1QOH A;  3I4N B;  1Q12 A;  4BBS B;  4HAE A;  2JA8 B;  1Y1V B;  1F9S A;  1VMC A;  1A2T A;  4CBV A;  3G6J B;  3A8I E;  3MA2 B;  1BCP D;  2A6H D;  3S17 B;  1SFO B;  1IYV A;  3D31 A;  1SNM A;  4DNR B;  1KLU D;  2F0P A;  3W3A A;  4QUC A;  2SDF A;  1QJO A;  4IFD J;  1GUO A;  1NCV A;  1RTN A;  4DXG A;  2D5D A;  2L0C A;  3VYS A;  1LAB A;  3MZ5 A;  4R8N A;  5ELE A;  3T4A C;  2F1M A;  1I6H B;  3I90 A;  3SDZ A;  1C48 A;  1D6E C;  4X3U A;  3L9A X;  3HOV B;  1M8A A;  2XVS A;  2D62 A;  3M3Y B;  2EDG A;  3OMG A;  4K8I A;  2B2Y A;  3GTM B;  3PIP 3;  4OHJ A;  1EZ8 A;  1V1P B;  1E0B A;  4HSP A;  2F0K A;  2N88 A;  2C9O A;  3TME A;  2BA0 A;  1ZEQ X;  5DNF A;  1EY4 A;  4P2C B;  4F87 A;  3PUX A;  1WTV A;  1LTT D;  4IFD I;  2KCN A;  1WVL A;  3FKI B;  1KNA A;  4DAP A;  3S2H B;  2NZ1 D;  4KHV A;  1JE4 A;  5IGB A;  1TKW B;  2NUC A;  5D3I B;  5FO8 B;  1Q1B A;  1JOQ A;  1LV9 A;  1CZG A;  1T5X D;  2F0G A;  3H0G B;  3HEJ A;  1KAB A;  2B39 A;  1D5X C;  1YNN D;  1LT4 D;  4C3H B;  3AU7 A;  2FMC A;  2OEO A;  1ML0 D;  5T1I A;  5ELB A;  2NN6 G;  3S1R B;  1PRT D;  4ID6 A;  1IYU A;  1O78 A;  3EFX D;  3LX0 A;  3MC0 B;  2HUG A;  4BS9 A;  1EYC A;  4ZRZ A;  3I4M B;  4FP5 D;  3QB3 A;  2MGS A;  1BCP F;  1QCB D;  2F0W A;  2B2W A;  2B63 B;  1JOO A;  1OXU A;  1SYB A;  3I73 A;  1SDF A;  2X6L A;  4ZKC B;  2SNS A;  4X3T A;  1ROD A;  2F0O A;  1B9M A;  1WTP A;  4FXG C;  2XRS D;  4IAL A;  1JCK B;  2K05 A;  4ZAI A;  2B2U A;  1SNP A;  5FKA C;  2BE5 D;  1HA5 A;  1OXT A;  1RCV D;  2NTT A;  1SXT A;  1TS5 A;  4LMQ D;  3Q22 A;  2KA7 A;  2V4D A;  2AWN A;  5DM6 3;  4IFD H;  2PPB C;  2AQ2 B;  1PYW D;  3P1H A;  3SHL A;  2K6A A;  4K2L A;  1F9R A;  4UAI A;  4NMZ A;  4F7X A;  3IL8 A;  1E2W A;  1IKM A;  1DOM A;  3NK9 A;  3SE0 A;  1SBB B;  2E2H B;  1AW7 A;  3EJI A;  5IT9 E;  1HA6 A;  1R9T B;  3WOF A;  2K33 A;  3Q6S A;  4KD3 A;  3K5N A;  1LT6 D;  3D4D A;  2DNE A;  1WTR A;  1JOK A;  3I3C A;  3A55 A;  3HOW B;  2F0F A;  1ENF A;  1HFG A;  2PMZ B;  5C0X J;  4ABN A;  1VF5 C;  4DGZ A;  4XTC S;  4Y7N B;  1PFN A;  1QG7 A;  3OOC A;  1NUC A;  2F0E A;  5A2Q L;  1ZXT A;  4BWG B;  2KHS A;  5C5L A;  1Q3L A;  3GTG B;  1I50 B;  1W6J A;  1CFM A;  1JR0 D;  3P7J A;  1RF2 D;  1G2S A;  1B44 D;  2XWJ B;  1EQT A;  1EZ6 A;  2F0T A;  1STE A;  3OSO A;  4WJW A;  5C4J B;  3DWQ A;  3GV3 A;  1GUG A;  4RCN A;  3A8K E;  1I6V C;  2EYL A;  4A3E B;  2J4X A;  5J39 A;  1STA A;  3DXJ C;  4IN3 A;  3HKZ B;  3FDT A;  5C0X I;  3ERQ A;  3J7A F;  2F0D A;  1H9S A;  2NVX B;  5D65 A;  3D4W A;  3X3M A;  3TZD A;  5IGD A;  1PZJ D;  2E2D C;  3SEB A;  3GTQ B;  5ELC A;  1EY0 A;  4HCE A;  3E5S A;  1EL0 A;  1QB5 D;  2RSO A;  3M7N A;  5KNB A;  2PYK A;  4C56 C;  3MXN A;  4O1N A;  1X3Q A;  1PTO H;  2K7V A;  1KDA A;  4TRD A;  3OIP A;  4X3S A;  1YNJ C;  4JK1 C;  2OT2 A;  1MGS A;  1L0Y B;  2M00 A;  2YU9 B;  3C1F A;  5JPM C;  1PMR A;  3MAQ A;  4KY7 A;  4ZLT F;  2K5W A;  2R93 B;  1CZW A;  2RA4 A;  2F0M A;  4EVO A;  1D1I A;  4ZUJ A;  4XIG S;  1EFI D;  2G9H D;  4KN7 C;  2EJF C;  1Q90 A;  4OIK A;  4OGQ C;  3K59 A;  3VYT A;  1SJE D;  4KK7 A;  2E75 C;  2PZU A;  4CHT B;  5I9O A;  2WKD A;  3FVQ A;  5C0X H;  3VR3 A;  4K2K A;  3RMH A;  1DCZ A;  4IFD G;  4NP5 A;  2VB2 X;  1XYI A;  2F03 A;  1HUM A;  4ZYS A;  1ZYR C;  1AZP A;  1S5C D;  4S3S A;  2TSS A;  4K5X A;  3MFG A;  1S5E D;  3S16 B;  1K8O A;  5KGU A;  2K04 A;  1UAP A;  1V1P A;  3GTL B;  2F0J A;  2CW0 C;  4KY5 A;  1IL8 A;  2EVB A;  1ILQ A;  1CA6 A;  3KF8 A;  3CRL C;  2R6G A;  1FD7 D;  1WTW A;  2RDH A;  3DHQ A;  2XSC A;  4KKU A;  5IGF A;  5IOC A;  5E3F A;  5COY A;  3MXP A;  1ILP A;  3S1Q B;  2QEJ C;  3E0J A;  3VR4 A;  2EOT A;  3PIO 3;  2X69 A;  3KBX A;  1EU4 A;  5IIF A;  5TSS A;  5G3L D;  4XXE A;  1EIG A;  1C4Q A;  3RZO B;  5CR3 A;  1BR9 A;  2O4X A;  4KMU C;  3U9S A;  2D2C C;  2KJX A;  1OO9 B;  3J80 E;  4KJN A;  4G4K A;  1Y8N B;  3QOL A;  2XNA C;  3NPP A;  1QNK A;  1HCZ A;  4WOR A;  2FIN B;  2RSN A;  5CYU A;  1DD2 A;  1TT2 A;  5FO9 B;  5LL6 S;  4F8M A;  2F0I A;  1IW7 D;  2G9D A;  1WTQ A;  4DK1 A;  5KNC A;  2Q8I B;  3J7A V;  2I07 B;  2M2L A;  5EPK A;  3JAM L;  4RKB A;  4KKT A;  5I9P A;  2EPB A;  5C3E B;  2A73 B;  2LS0 1;  4A3B B;  4PMW A;  3KLS X;  1GHJ A;  1U4P A;  4LJZ C;  1RD9 D;  2L9H A;  4NKL A;  3ND9 A;  1I4P A;  2ENB A;  4ZUI A;  3PUW A;  2EZV A;  1DZ1 A;  1I4Q A;  2WAQ B;  4DFA A;  1R4Q B;  2E74 C;  4L63 B;  5JVG 3;  1B2T A;  1RKN A;  3OMC A;  1XTC D;  5M5W B;  5K5P A;  2H4O A;  3T53 B;  2IX1 A;  1SYF A;  2AUJ D;  2WP8 J;  2EJG C;  4IUP A;  2JA5 B;  3FPU B;  4XQQ A;  1D5Z C;  2RBM A;  1ICW A;  4ZK9 B;  4ILW A;  1DXM A;  2M9V A;  3Q0A A;  3SVM A;  2PW5 A;  1EWH A;  3QOJ A;  2XIW A;  2JEA I;  4U67 3;  5KIX A;  4ZQ3 A;  3NBI A;  2MPM A;  1PTO D;  5BN4 A;  3HP3 A;  5ELF A;  4KN4 C;  5AFW A;  1D2B A;  3D6C A;  1AN8 A;  3M4Y A;  4C2M B;  5HUR A;  3QIA A;  1HPC A;  2L11 A;  3NBH A;  3NQI A;  4C3I B;  1EOT A;  3CKI B;  4FO2 A;  3NSW A;  1I4X A;  5G3L F;  1EQV A;  1HQR D;  4DNT B;  1MSG A;  1AP0 A;  2D9U A;  3K5O A;  2F3W A;  3M85 A;  3TBI B;  5C0X G;  2HCC A;  1KDB A;  2Z1C A;  3PUV A;  3H94 A;  5I4D A;  5ISR A;  1HTP A;  1FNU A;  2L55 A;  3L7Z C;  5I6Y A;  5CGK A;  1TU2 B;  3A8J E;  1TY2 A;  1Q1E A;  4LAA A;  1BUV T;  3HOU B;  5C3X A;  1SEB D;  1STB A;  1TWG B;  5CV8 A;  4BA1 I;  1WCM B;  1LT5 D;  4ODG A;  4ZKB B;  3S1M B;  1TWA B;  3T16 A;  3S9W A;  1JIC A;  4N9T A;  1CT1 D;  1U4L A;  3HG9 A;  2F0U A;  1HHV A;  2WKC A;  3P20 A;  1HQM C;  3URY A;  4WFN 3;  5J22 A;  1Y8P B;  4HED A;  2K32 A;  3QJY A;  5FOB B;  1NSN S;  5EBD A;  3NWS A;  4AYB B;  3A56 A;  4IUQ A;  4G57 A;  1SYC A;  4FYD A;  5BN3 A;  1U9R A;  4DK0 A;  1PTO F;  1FYC A;  1DOK A;  2BDO A;  5NUC A;  2A69 C;  3LWU A;  2AQ1 B;  2F0L A;  1GUW A;  4J8Q A;  3S1N B;  2F0N A;  3C3L A;  4DF7 A;  2ZXP A;  2EYF A;  3MXU A;  2XN9 C;  4DAV A;  4FNF A;  1BCP C;  4HN7 A;  5M3F B;  4A3K B;  1CTM A;  1X3P A;  4PQX A;  4HMI A;  3PO2 B;  3X3N A;  1CHQ D;  3BDL A;  5IGE A;  1D5M C;  1D1K A;  2PO4 A;  1I4H A;  1BO0 A;  5CC4 A;  4MIU A;  4QCL A;  1LTS D;  1CA5 A;  1K8M A;  5KYL A;  1YNJ D;  4C3J B;  4FF3 A;  3TP5 A;  1DM0 B;  1BOS A;  3EVQ A;  4H44 C;  5CV5 A;  1RJT A;  4FXK C;  4BY7 B;  1B4O A;  1R4P B;  5IGG A;  1JWS D;  1FGB D;  1EYD A;  3VA7 A;  1CI3 M;  4BY1 B;  2F0H A;  3C1E A;  2NVT B;  3H09 A;  1MI2 A;  4J6H A;  2K5D A;  4G7Z C;  4XT3 B;  1BCP B;  1ET9 A;  1AEX A;  3GTJ B;  1A2U A;  2LFN A;  4CKC A;  3VR5 A;  3K5L A;  4H13 C;  2L12 A;  4RHS A;  2K1B A;  1NR4 A;  3TP6 A;  5A2Q E;  3PV0 A;  1I3Q B;  4QIW B;  1HRJ A;  1ZYR D;  1UUP A;  2E2J B;  1PRT F;  5E4W C;  3GTO B;  1OXV A;  4PMC A;  4H0L C;  2XRQ D;  4EGV A;  3ERO A;  2JSO A;  3MVV A;  5C4Z A;  3IFT A;  4Z9C B;  1STY A;  2IWH A;  2CW0 D;  3RD4 A;  5EBC A;  5F2D A;  3I91 A;  3HS0 C;  4G7O C;  1EY6 A;  2J7Z A;  4OIJ A;  4QUF A;  4RFB A;  1A3V A;  1FR3 A;  2KCC A;  2PCF B;  2QIL A;  3HGB A;  4K8J A;  4WRD A;  5E1F A;  4F88 A;  3PMF A;  1JB3 A;  2NYZ D;  2BCO A;  3D6W A;  3H3V C;  1WTX A;  1TR5 A;  4O42 A;  5CV6 A;  2A68 D;  4NW2 A;  1H9K A;  2BDN A;  2B2T C;  2DY7 A;  2R7Z B;  2NTS A;  1Z47 A;  3K5M A;  1SMY C;  1JC7 A;  4CJ1 B;  1HUN A;  3SK8 A;  5K36 H;  5JEA J;  2WII B;  2B2V A;  3ONA B;  1F2L A;  4PMB A;  4TSS A;  1SE3 A;  3OPO A;  1G6Z A;  2QKI C;  3BYT B;  2AUK A;  2HCI A;  1TS3 A;  3KLR A;  1DON A;  1SYE A;  4C1N I;  3L3O C;  2KVM A;  4RGO S;  1SNQ A;  4MHE A;  1DJR D;  2F0V A;  3NTI A;  2K01 A;  3PO3 B;  5D14 A;  4I65 A;  2Q8T A;  4C3I G;  4KI0 A;  1S4Z A;  5CV7 A;  1WD1 A;  2L1B A;  1O7Y A;  3F2U A;  1JOR A;  4QF4 A;  2AWO A;  1II3 A;  1JWM D;  1O7L A;  2VB3 X;  2WAC A;  1PFM A;  1RTO A;  1B50 A;  3HOZ B;  1SE2 A;  1B1Z A;  2KEE A;  2O5I C;  1B3A A;  4X3K A;  3D3R A;  3E6Z X;  1SYD A;  3OWE B;  4PV1 C;  1BXT A;  1IKL A;  4K6L A;  5D3D A;  1Q8I A;  4RAU C;  2WV6 D;  4FF4 A;  2N55 A;  4M1U B;  1LO5 D;  3GTK B;  3PUY A;  3BZD B;  2XWB B;  3A7L A;  4B9W A;  2Z4H A;  1F2M A;  4XT1 B;  4JBW A;  1GXD C;  1WD0 A;  4RGN A;  1CHP D;  4TQU S;  3W2D A;  4C3H G;  4MN3 A;  2LKV A;  3A7A B;  3DM1 A;  3ND8 A;  1ZKO A;  1QNU A;  2YYZ A;  4KTA A;  1F9P A;  5I2X A;  4V19 0;  3GD7 A;  1GOZ A;  2B2V C;  2TMP A;  5EPJ A;  4OO1 I;  1SAP A;  4A93 B;  1EY9 A;  2K28 A;  2FHT A;  3VYU A;  1GUS A;  3LNN A;  2Y0S B;  3CHB D;  3SK6 A;  4IZ8 A;  2X6G A;  3NTH A;  1KTK A;  1BF4 A;  2NWG A;  3N52 A;  1WTO A;  3NUC A;  2ID0 A;  4XYQ A;  1LTB D;  2MUY A;  2MP1 A;  1U4M A;  2PQE A;  3BDC A;  3HZX A;  4IUV A;  4IUT A;  5JEA H;  1A3U A;  5C4X B;  1CK1 A;  3BVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...