1MIEH

Crystal structure of the fab fragment of esterolytic antibody ms5-393
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
213
structure length
191
Chain Sequence
QQPGAELVKPGASVKLSCWINWVKQRPGQGLEWIGNVYPGSSSTNYNEKFKNKATLTVDTSSSTAYMQLSSLTSDDSAFYYCVRPYWGQGTLVTVSAAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
molecule keywords IMMUNOGLOBULIN MS5-393
source organism Mus musculus
molecule tags Immune system
total genus 37
structure length 191
sequence length 213
ec nomenclature
pdb deposition date 2002-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mieH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mieH02
4LPUA 3FO0H 4JFHE 3VWKD 2DKUA 2PKDA 4U0QB 3L3HA 1A7QL 2Q6WB 2CMRH 4GW5B 5JZ7C 4YHKH 4X5XA 1QSED 2BXZA 5IMOA 1NMCB 3MFGB 3DRTA 3LPGA 4TUKL 3IAQA 1I9RL 1OPGH 3BIBX 3QIUD 1AXTL 4GMTL 3RZWA 1DVFA 2R4SH 2W92A 4Q58C 3OAUL 4QCIB 1YNKL 4HPOL 3BWUC 1P7QD 3MXWH 5ISZA 1KN2L 1YY8B 2VZOA 2NY4C 3QXAB 1EEQA 1PAMA 1Z6JT 5AYQA 4CVZA 5C9JB 1F6FB 1QBLH 5F7YC 4QXWA 3RWEA 1NMAL 4G7YH 2CH8A 4QNPF 1ORQB 2WUCL 5I1CH 3O4LE 3RNKA 1UWGL 5BRZE 1FNSL 3HR5B 1JPFA 4NDMB 5CLTA 1ZWIB 5GPRA 2HJKB 4FNLL 1CGXA 1JIBA 4O5LL 3QHZL 3VXTB 3O6FC 1U8QB 4IJ3B 1U3HC 4ZFZB 3DIFA 2Q3AA 5DJ8A 2NZ9C 2HG5A 1MFCL 3BW9B 3IRZA 4NQDA 5EC1B 4NC0B 2X1WL 4GKSB 1AQKL 3VGAB 1BEYL 4LP5A 3G04B 4XRCA 3D9AH 5HYFA 2CIKA 5GGTH 2X42A 5DZOA 4EN3A 4F8QA 4MHHG 5JR1H 4PTUA 3ILPA 1NH6A 1YECL 1NGYB 3MV9A 4FFYH 2NX5A 3VMNA 1GOGA 3O0RL 1SYVA 2ZOLB 1HKLH 3TVMA 3T1FA 2FD6L 3V6BR 1KIPA 2BX5A 3D0VB 4JREC 4X9GA 3FQTB 3MLXL 2KZ1B 3OJDA 3AVEA 1P84K 2AEPH 3D2UA 3EGSA 4XP4L 3SBWC 5L6YH 4MDIB 3V4PH 2UUDH 5CJQL 4NYLA 3LDBB 3L3JA 4GUPA 2OM5A 3R06B 2OZ4H 1U58B 2JJTC 4PGBA 4JM2C 5AAMA 1PKOA 3AY4A 3TV3L 4OCLC 3KR3H 3I6KA 1EEZB 2QEJA 1S5HA 5IB5B 1A1NA 1LNUB 1YN6B 3EYVA 1TFHA 4WI3A 5CKGA 4U6YB 2C3XA 3H7BA 5C0BA 1FFNA 1RV6X 1OGAD 3QHTC 5KSUB 3TYGL 3OKMB 4NQXB 4JPKL 5HHXL 3T4YB 5ITFB 3PDOA 5M94B 4N1CA 2PTTB 3O11A 1SJEB 2HTLC 4JFHD 3EOTL 1YYML 4ZTPH 1VFOA 3VI3E 1U6AL 4LCWB 5DJ2A 1FO0L 4PGDB 4XBEL 4YFEA 2OBGA 3HE6B 4G8GB 3TNNA 3V9FA 1QR1B 1J9CT 4CRPA 4DOHB 1QTYT 1I7TB 1WSST 3QFJE 4D0CB 2XA8L 4G6AD 4XBPA 4Q74A 2PO6D 3LKOA 3RAJL 2YPLA 4RIRB 3N50A 4APQA 1WWWX 4FA8A 1CE1H 4HKBB 4MJIB 4MNQB 4HC1A 1QKZH 1E28B 2FBJL 3HC0B 4YHPA 2VH5L 2DQCL 3L7EA 4OZHB 2QHLA 2W65B 3QQ9D 1D7FA 3DECA 4N90E 1BJMA 2BRRH 5SWSB 4WWKA 3UBXA 4OSUH 3O4LD 4PJXA 4CW1B 1LO2H 4UUJB 2DOCA 4C4KO 5ICXB 4PGEB 4Z7WE 3IF1B 3CUPB 5D1QD 4PBWD 3KPMB 2HT2C 2J12B 1R3KA 3BDYH 4H1LG 1OCWH 4MX7B 3WFBL 1BOGB 3DUHA 3D18B 4Z95L 5DQJB 4CMHB 3VH8B 1BVKA 5CAYB 1KNOB 3V5KB 2XZAL 5CP7A 2J8UB 3SPVA 5CINH 4MGXA 2YZ1A 4HKJA 1KIQA 5L88L 2RJMA 3MLTB 2BNRB 2Z31C 1HSAA 2F53B 4FOMA 5DMIH 5D9SB 5DHVA 4GRLB 4HAGA 1A02N 1NGZB 3CGTA 2NR6C 4U4BA 1HINL 4KRNA 1MEXH 4JM2F 4HGKC 3GSNL 1S8DA 4PJ9C 5DK0B 5K9OB 4ZQKA 2AW2A 4U7KA 2C4XA 1LP9F 4LAQH 4PGJA 1MRFH 1S7SB 1F4YL 4HAFA 4U7MA 1W72B 2VXTL 1MREL 2ZNWA 1P1ZA 4I8DA 4KUCD 1I7UB 1UYWH 4NC1C 5DLML 1CD1B 4KJYA 2IPKB 1AGBB 3AM8C 1R3HA 3Q3GB 1FV1B 4OKVB 1KC5H 2IPTH 5GZOD 4QT5A 1G9EA 2CK0L 1BFTA 3QUKA 5DZLA 1T66C 1SEBA 2R9HC 4H88H 4KK6D 1K5NB 4NQCE 5F6HI 1URLA 3BH9A 1W2KT 5I16B 2CXKA 1ZGLB 4WW1B 1MCBA 5IIEA 4YXLL 2WBWB 3P2TA 2NY0B 3VXRE 2IBBA 3BE1L 1T22A 4ZUWA 3IDIA 4EIZC 2HH0L 1Q9KB 4M7LL 4TSAH 1CFNA 4PRBB 1F58H 4F7CA 4DKEH 4K3EH 2FO4B 1WIOA 2AXGB 2H32H 4NFCA 4MQSB 4ZNEE 1FAIL 4O4YL 1TVBB 4P5MA 3GGWB 3TZVA 3DOSA 1CFQB 4IRJD 2AVGA 5E8EA 2Q86A 2LU7A 4XVJH 4KMTL 3D3VA 4X6DF 4X4XA 4NM8H 1DZBA 4JFEB 4F2MB 3CDGB 5KAQF 1WQVT 3QFJD 4IDJH 2BSRB 1IVLA 5EPMA 2HLAA 4JRYE 3FRUB 3U7AA 1NAKL 5ANMA 3HMWH 3ETBF 1MY7A 1JNLL 5IEKB 3KLAB 1A7RH 3WNPA 3PQYB 1EGJH 2EDOA 5GS1A 1J18A 3IVKA 5DUBB 3WFDH 2VIRB 4MCYB 1EAPA 1MRCL 4WEBH 2AEQH 5CMAB 1JUFB 1FNGA 5DJYB 4G6JH 1QA9A 3B2VL 4BQ6A 1XGPA 2VISB 1FDLL 3BDBA 5K59E 1ORSB 5MEPA 1CGYA 2O5YH 4RGNE 4FFVC 3JWDL 1S9YA 1OTUD 2AXFA 3OTTA 2VAAA 4LNVA 4TULL 1MCWM 4LQFL 3F7PC 5FGCE 5KSBB 3IFLL 4P2RA 5JIHA 1SVZA 4NP4L 2Z8SA 5ERWA 3QO0B 5ALBH 2R0WH 4FTVD 4K7PH 5L8LB 3E3QC 5JW3H 5L2KA 3IU4L 1S9VA 3DHJA 1RIHL 3CMOH 3T77A 3CX2A 3VWKA 1MJ7L 4RMRA 3VXNB 1E27B 5I1JH 1N5YL 3EO1A 1FO0A 5C3TA 1ZGLP 2IH1A 1F8TH 1QSEA 3DSNA 3MRQA 2VO5A 1DE4B 3BH8A 2R8SL 1T1YA 3ECBA 5EBLA 3QUZC 1CG9B 4DJMA 1D5BA 2IQAB 4OD1L 4YDJA 5E4EC 1KTDA 4JHAH 3QIUA 4FXLA 1EX0A 3UJJH 2NY5C 4RQQA 5CILL 3RP1A 1E4XI 1R0AH 3EJYD 5EO9B 1P7QA 5AZ2H 2QQLL 2WINB 1RK0B 4KXZI 4Z7NE 1BOYA 5D72H 1NL0H 2EDDA 5HI3C 4NHCH 4LVHB 4OLZL 4OZGE 1IE5A 2CO6B 4I77H 2Q7YB 1M7IB 4TUJA 3VXRD 4WDIA 1JFQH 2ZPKH 1N8ZB 2VSDA 4KI5C 3QNYB 4RFNB 2NXYD 4OF7A 2NTSP 5DWUL 4P5KA 1MFNA 4JKPL 1FNAA 4NRYA 4XP5H 5D2LE 5DD0H 4E0RB 3X14B 4OZIA 1IGYA 3KYMA 3MRCA 3NACH 1PVHA 2JF1A 3HUJA 2FL5A 5HVGB 4HHAB 1AO7B 2YN5A 3DSFL 3M07A 4QWWD 4L3EB 1LD9B 5FUCC 3IDXL 1S7RB 1X5ZA 4LHUG 2HA1A 2MCG1 4UDUB 3U4AA 1P9MC 4J4PC 3MYJB 3UYPA 4U1LA 3MRPB 4HIJA 3FB6B 3VG0L 2HVJA 2NY4B 2YN3A 4Q6YA 5ILTH 4KHTH 1EV2E 1BFOA 1WWBX 3ARFB 4HXBH 4RWYH 3BP4A 3GJFB 3DTXB 2GT9A 3Q6FA 5GS0H 3IJYA 1KJ2B 4EDWL 5D7JC 1KB5A 3UTQB 4JO1L 4WUKL 5FB8A 5A43C 1RU9H 3PWLB 5A1AA 3CVHL 3QBTB 2ZUQC 1CT8B 5C09E 3L7FA 2KL6A 2BMKB 3G5ZA 1NQBA 2F5AL 3GMMB 1AD9B 2VLRE 1PD6A 5AG8A 3MGOA 3QIWC 3VFTA 3MX0A 3O6FB 1J0JA 4KHXL 3RUGA 1U3HB 5B39B 4ELMF 2OCFD 4MQXD 3FB5A 4PYGA 4Y8AA 3K8MA 3B6SB 1DVFB 3NIFE 4FXKA 4P5TC 3DX7A 1SMAA 3MCKA 3CXDH 1NCNA 4LVNB 5ISZB 1OGAA 1AJ7H 4JFYA 4XCFL 2ENYA 3KNBB 5SX5K 4CVZB 4Z7VA 3Q5YA 3QUYD 3O9WD 1A22B 4MCZA 3RWEB 4PP2B 4WO4C 3PV6B 3T0BA 4YAQA 4J3OC 4PJFA 4P59L 1QO3B 3MLVL 2KPNA 2ARJQ 5E6ZA 3GSOB 5GHWL 1IM9D 2I9LA 4TN9A 4UIMB 4Z7OE 4JVPA 4JREB 1T6VN 2I24N 1AE6H 2ADFH 5CEZE 4OLXL 4KI5F 4YGVB 5EOQL 3BQUC 3MV8E 4ZOCA 3WUWG 3QUMB 1CZ8H 1Y6KR 5KVFH 1HE7A 3IJHB 3O8XD 3QXWA 1U8KA 4JY4A 1MAML 5DS8A 3SE4C 2E9JA 5DJ8B 4ZD3L 2PO6A 5ECJE 4PS4L 4B0MM 1A9EB 4J1UB 4JM2B 4TVSa 4GRWH 5JIPA 1MH5B 4P46D 2GSIB 4L4TB 2IH3A 3BGMA 1WK0A 1LP9B 4OJFL 2UZIH 2XRAH 3I6GB 5E70A 2CIKB 4GG6F 5K33A 1D9KD 4KKAC 4NJ9H 4EN3B 1GZQA 4LBEB 5GGRA 4PTUB 3TA3D 3GSXA 1CDIA 2NX5B 4MA7L 3SKMB 5A40E 2A9MH 3O4LA 1XGQA 1SBSL 1PKQA 1SYVB 2VLJD 3PL6D 1IBGL 3T1FB 1LE9A 3NCYS 5D1QA 1IC4H 3RBSA 4H5SB 3RJDA 3C5ZD 4IS6A 2CKBH 3KPQA 1I3VA 2ESVB 3NIDE 3DVGB 1CXHA 4NYLB 3BMWA 1AH1A 5C0JA 1MVFA 3P73B 4FN0A 4WU7B 1CS6A 3FCTB 5DTFA 3GHEL 4PGBB 5DVNA 4KH2A 1OL0A 3I6KB 5D7LB 1S5HB 4L5FH 4RMVA 4JPWL 5CKAA 5ESAA 1L7TH 3H7BB 4RGOH 1DLHB 5C0BB 3G6JA 4F7TA 2JJWA 3OKKB 3I3EA 4EKXA 4NKOA 4KKBC 1G7HB 3O3UN 1FPTL 3O11B 1B4RA 3LIZL 1UACL 3OKLA 4YDIH 5T33H 5DVMA 1B4JH 2ORBL 3T09A 3EOAA 1KCSH 1BFSA 3JWDC 5C09D 3VXPA 3KJ4C 1H0DA 1S7UA 5TFSH 1LHZA 3JZ7A 2CDFA 3CLFL 2VLRD 4FP8H 3FB7A 2ZUYA 3KDMA 1EJ6A 1YNTB 4I48A 5C0AE 1IM3B 2D0FA 3RWIB 4S1DD 4XBPB 1CDYA 2QADD 2X4NA 3NCFB 5I1IL 1OP5K 5DURD 2X9WA 3LKOB 2YPLB 3BO8A 5LG1A 1A7PH 3WFEL 5E5UB 3O3BA 3QEQB 2RBLA 1JTPA 2AEIT 1FGNH 5E1AA 3W39B 4P0DA 4X9FA 1E4XH 1UXWB 3L3DA 3PGFL 4LAJH 2YWZA 2MHAB 3UTPE 4PJ9B 1WIUA 2NY2D 4KXZH 3L7EB 1OGTA 1U8PA 5IOPB 1I7ZB 4LPYA 3F12A 4WWKB 4G8EA 3UBXB 3TWCH 1VKXA 1ZA6A 4GFTB 1NUDA 1RZJC 5HVHC 3MLUH 2PXYD 4IRJA 1TZHB 3VFMA 4NCC2 4X5WA 3V0AC 3BKYL 3PWVB 2A73B 5CEZD 5D7IE 3GB7A 3F7RA 1BGXL 3MV8D 5IESH 3REVB 5FYJE 5DVKA 4PGCA 3QFJA 4ELKA 1EHLH 3E0GA 3WEXB 4HJGB 2GHWB 1HSAB 3BT2L 1IEBA 5DHVB 3HA0A 1YEDB 4R2GC 4MA3A 3CVHA 5IJKC 2VDLL 4JFFE 4XCCH 1S8DB 2EDBA 2Z8VC 2B4CL 3V52L 1ACYL 2ICWI 4P23D 3ULVH 4KJQD 3MRRA 2E7CA 3QEGH 4URTB 4YHZL 1T5WA 5IEHA 2OSLA 4P4KC 4QYOB 4Y0GA 4Z7WA 5TE4L 3RVUD 1I9JH 5C0ND 1UC6A 5KJRH 1IAOA 3G6AB 2XWBA 3X3FL 4OQTL 1UM5L 4Z76B 3BHBA 4DN3H 2ATKA 4OLVL 4HUXA 2YPVL 3OG4B 1P7HL 4U1HA 3TT1H 3BH9B 2XNAA 2C1PB 4FTVA 3ES6B 5SWZE 2W59A 1DP0A 5JNYB 4DVRL 4WEUD 4K9EL 1J8HE 3IFNL 3QPXL 4E9LA 1T22B 5CP3H 3U36A 4ZUWB 2DM3A 2A0LD 5F1NB 3N1QC 2DQDL 3EYQD 2IANE 4J8RA 1S7XB 4XCNB 3DNKA 4HMDA 4JFDB 5F7EH 2E8YA 2RIKA 4U0RC 1B90A 2ATPB 1CN4A 5J13B 2VUYA 2VZ3A 3EFFB 4G6FB 3CCHA 4TPRL 5E2WL 5IT2L 5BV7C 4YFDB 4L4JA 3PNWB 5I19H 3UTSE 5JHLL 4WRLA 2P8MB 3ZL4H 4R90H 32C2A 3QQNA 2YWYA 4FRWA 3P4MB 3SDCC 3SDAC 4MD5B 2CDEA 1N0XH 5EU3A 4Z0BH 5C0AD 5EPMB 2HLAB 4LLYB 3LHPL 3HG1B 3I9GL 4KZDL 4X6EB 2HVKA 3VXRA 3P9LB 4HIEA 1WJ3A 3VGBA 3SO5A 3BPOC 2PW1B 2YXFA 3DX8A 1XIWC 4I4WB 2HLFD 1L7IH 4MXQC 2YMXL 4GRMA 2KKQA 4B7LA 4ELMB 4NNXB 1QA9B 1OTSD 4KTEL 4ZNEA 3F7VA 3F6IA 1M6OB 4FZ8L 5GRUL 1IGCH 2DM7A 4ZPTB 4EUPB 1K2DA 4GQ9L 3RZCD 3QUZB 1G0YR 2AJUL 1KCVL 2NYYD 3N85L 2R2BA 4XPAL 4V1DE 1DQQA 2EKJA 5E4EB 1INQA 3ALPA 3RWCB 1UG9A 2FZ3B 5CEZL 2X4TB 4CN1A 43CAA 4NFBA 1DBBH 4OF0A 3EOBA 3C2SA 1QFUH 2ADIA 1LO3H 1NDMA 2ZSVA 1W0VA 3U7WL 3JV4A 5CSZA 1T03L 4MVBD 5JXED 3VI4F 3NAAL 5FECA 1CGSH 3MLYH 5JA9A 3CFCH 3MOAL 2EDKA 2BSSB 4AIZB 4E41E 1QLEL 1JV5B 1JF1A 4WUUE 4IIQC 2X10A 3NCCB 1AGEB 4AT6A 1DBMH 1NAMH 1TZGH 5DFTA 4LNRA 1FO0B 1WAAF 4PG9A 4ONOA 4NN7C 1T1YB 4I0KA 1X6NA 2VXUH 4DAGL 1D5BB 2AJSH 5JDSB 2APBA 3MBED 3DWTA 3RKDD 3X11A 1CICC 3PHSA 3S5LG 4RMQA 5GSRB 1JZ7A 5L7XH 4MNHA 2C7UB 4XH2A 4BSVA 2YR3A 1JHKH 5J1TC 2C3GA 3W0WE 2W60B 2OYPA 3DETC 3QUYA 3O9WA 4LDEB 1FH5H 3S34L 3MA9L 4PJIE 3T1WA 1DDHA 3RU8L 3TJHC 3B9AA 5EBMB 4H20L 4N8PA 8FABA 3VGHA 1N5AB 1IM9A 4UDTB 2IAND 2NLJA 2AGJH 2ZUQB 5E7FA 1SEQL 4NRYB 1A2YA 2IQ9L 2AKRA 3I84A 5MI0C 2B7DT 4S2SB 5DJXA 4NJAL 5DDHA 4OGZA 4RGNC 1EHXA 2BNQE 3QIWB 4R7DA 3HUJB 3O8XA 3G5XA 3UTSD 3TNMB 5B22A 2D7NA 3U9UB 3BZEB 4M1DH 3FRPA 5ADPL 4YE4L 3CFEB 1MFBH 4LVOB 1F3DH 3LEXB 3CH1A 4P46A 4MAUH 5KVDH 4K3JH 2UVFA 4P5TB 1DN0A 1F00I 1K9TA 3GK8H 2B39A 4YXKH 3U1SH 1DBAL 1IEAA 1MOEA 2HVJB 1GGBH 3GMQA 1D9KA 2R0ZL 1OP3K 3Q5TA 4HMEA 2Q8BH 1JGLH 2OXGA 4DGVH 4CMMB 3TA3A 3UJTH 1M7XA 3GSNB 1QYGL 5DRWA 4M8VA 4WO4B 5DO2C 2E7LC 2VLJA 3PL6A 5FB8B 2HFEB 1HZHH 2NW3A 4PUBL 2XFXA 3WLWC 3FO0L 1OLLA 1C16A 2IBZY 4ORZC 2H41A 4LPXA 3C5ZA 1FCGA 4LDLB 2CMRL 1VFBB 3ARSA 4OFYD 4YHKL 1XF3B 3BQUB 1EEUA 5J6HA 3ARED 1A3LH 1CYGA 1H3VA 1S9WA 3DMMC 3X13A 5HHOB 3EFDH 1OPGL 4XVTH 5CWSB 2P5ED 3V6OA 4W6WB 2R4SL 4UI2A 2Z92A 3DX7B 2OS7A 2VLKD 1G6RA 3MCKB 4R97C 3MXWL 5TGBB 3MUY1 1BREA 4ZG1A 1BFVH 3VCLB 5I74C 4X6CB 3TA3C 3U6RA 1QLRA 2J4WL 4HWBH 3VD9A 5C2BH 2B4CC 1QBLL 4MCZB 3MRLA 2QV2A 3OKEA 4GAYB 4PJFB 4G7YL 4BFIA 1FRGH 4HSQA 5I1CL 2RR3A 4U6TA 3TBVA 5KN5A 2OMNA 2MPAH 4Y4FC 2I9LB 2PR4H 2V2WA 4O9HH 4ODXB 5C09A 1BM3H 3E8UH 4XNXH 1I85A 1P7KB 2VLRA 5D6CB 4MAYC 1CL7I 4YBHA 1S7TA 3ESVF 2H3NA 4KQ4H 1NANI 1BQLH 2JCCE 3GMRA 2E7HA 5BVPH 3PGCB 1V3JA 1B0GA 5DS8B 1FL6A 3OJ2C 2PO6B 3B9EA 4K7PX 4G80A 3NGBC 1EJOH 2DIAA 2IH3B 4GW1A 4Q0XH 3BGMB 3FTGB 4LEOA 1KGCE 1KLGA 3W0WD 1NBYA 5HJ3A 3D9AL 4X83A 3QXDA 1GCFA 4NWTH 1WGOA 4I2XA 4R26H 5GGTL 5GGRB 5JR1L 2AK4D 3GSXB 3GSRB 4FFYL 4KJWC 3WIFB 5F1IA 4MJ4A 2WIIB 3AAZA 3O4LB 2X1QA 3QO1A 5BRZB 1BECA 1HKLL 5E94B 2PXYA 2VRAA 3MJ9H 3KJ4B 2AEPL 1JI1A 3MV8A 4IS6B 1RZKC 1VHPA 4ZXBD 5L6YL 3ROLA 4ENED 4PRID 3V4PL 3VFNA 1H3WM 3RVVC 1LDPH 3P0VH 5E8PB 1S7QA 1MCIA 4XAWH 5DTFB 3QG7H 2OZ4L 4OT1H 3OBAA 4WEMB 3HZMA 3KR3L 4YR6B 2LAGB 5ESAB 2NY6D 1WZLA 2WWMC 3MSPA 5A2KH 2R23A 1RUAH 3FB8A 4P23A 1V7MH 3HNVH 4U1IB 1GYAA 1YZZA 5FK9A 3VXSD 4N8VG 4X0KA 2C3HA 2QQNL 4OZGF 4NOFA 3WXWH 3EOAB 4ZTPL 4AMKH 5HVHB 3M1BB 4MD0A 4XAKD 1X5HA 3KYNA 1G7MA 5IW3A 1LQSR 3KPRD 4NPYA 5IUSA 4M5ZH 1NJ9A 4HPYH 2FBOJ 4GKOA 1QACA 1UKSA 1OF2A 5CCKH 4W6XB 3JWNC 3K8LA 2YD2A 5D2LF 4GBXC 5T1KD 4H1LA 2A9NH 3BOVA 5GJSH 2F5BH 3RI5F 3SGEI 5D6DC 1PEWA 1CE1L 4R2GB 1ZAGA 2CLVB 3L3DB 4JHZA 4NHUB 1QKZL 2VDMH 1IC1A 1IT9H 2EDQA 5INDB 1U8PB 3HRPA 5DEFA 3TESA 2ILLA 2BRRL 1Q0XH 4P4KB 5DMGD 4OSUL 3RWHA 1ZA6B 2C4FU 1LO2L 2P5WE 3EZJB 2VZUA 3MNZA 5F8QC 1BZ9B 4X5WB 1BQHB 4ZAKD 1QOKA 3BDYL 2X4SA 2A6IA 5EBWA 1OCWL 4FXGA 1WFTA 4WHYH 2E8ZA 3QFJB 5C0AA 4ELKB 2VITB 3TYFA 5FM5O 5KG9B 4CL7A 5CINL 1QSZA 4ODBD 2UYLB 4K94C 2B1HH 4MB4A 5IFHH 2EC9U 1KJMA 2BCKA 4J3VA 3OKOA 5F7MC 3LKPB 1NBZA 1J05A 1KGCD 4LLMB 5DMIL 3WIIH 3OGCB 1FBIH 2DM2A 3CVHB 3NIFF 1MEXL 3FT4A 4NZTH 2VLLB 5FAAA 3RZCA 3PXJA 4LAQL 5DJ0A 1T5WB 5IEHB 1MRFL 2LTQB 2OSLB 3WNKA 3RY6A 1Q0YH 4BQ8A 1QLFB 3PP3K 2DWDB 4GXUN 5ACZA 5F7DB 1UYWL 1IAOB 1UWXK 3OV6A 2XWBB 1JPGA 3O3DB 3UYRH 3P30H 3BHBB 4PJCE 1KC5L 4GRWE 5GRJH 1EXUA 2IPTL 2AV1B 2DQTH 3SDCB 3SDAB 4Z7OF 1JYXA 1XR8B 4Q9CA 5C0CD 4H88L 5JXEA 1MVUB 2GJ6D 2XNAB 3ARBD 4QY8B 3ZKND 2FCBA 4YBLC 2I25N 2FJGA 5HYJE 5HHVH 2A74A 1XIWB 4EIGB 1OQOA 4Z78A 2GCYB 4RFEB 3MLWH 2BVYA 2ZUVA 2J7LA 4J8RB 2OL3B 3FT2A 2D7QA 5E08H 3QDGD 5EDXA 2QHRH 4TSAL 4NUJA 4OF6A 1F58L 5I1GH 3FAXA 4DKEL 4B53A 2R1WA 4K3EL 4JVWA 1X5KA 2GY5A 3SGKA 2A6JA 4Y5VA 2HT3C 1IKNC 4AENB 1NEZG 2OQJB 3MBEA 4LDOB 5HDOA 4L3CB 4LCUA 5ID1A 3OSKA 32C2B 5D1XD 6CGTA 2PW2B 2N4IA 2PYFA 4XVJL 5CD3B 4X7TA 2BOCA 1J12A 3ARDD 2APXA 4OF3A 1U8LA 1N26A 3BAEH 4NQCB 4NM8L 5EU3B 2CLRA 4IDJL 4M43H 1NCWH 2BHZA 1CL7H 3CU7A 5B21A 3TT3H 4TYUA 3HMWL 5GGTA 2BSED 1J8HA 1ZT7A 1A7RL 1NANH 4DUXA 4HIEB 4BH7B 1EGJL 3WFDL 2IANA 3RQ3A 4IIQB 4OGAC 2F74A 4WEBL 2AEQL 5EU6E 1XFPA 2CQVA 2EEDA 3VDAA 1ZS8A 3OAYH 3QDJE 4G6JL 1OTTC 3D69B 2C1OB 2ICEA 1WISA 2MKWA 2XKSA 3OR6B 1B0WA 2C3VA 3VRLE 3UTSA 1G1CA 2O5YL 3BPCB 1ZGLM 1NUFA 4OD2B 1HWHB 2NY3C 5C6PB 4UOJA 5IHZA 43CAB 4M7ZC 5DUPH 3Q2CA 2ADIB 4Y16D 5IMLB 4JRYB 1W0VB 2XA3A 5I17B 1XGTA 3JV4B 2O5XH 1IL1B 5ALBL 4JY6B 4NRZA 3H3KA 2R0WL 4Y4KC 5IB4A 1YEGH 1BF2A 1BJ1J 4JFOA 4K7PL 5JW3L 5MP6H 3BDXA 2AS5M 1KLFA 3CMOL 5BJTB 4D3CH 2Y23A 3MR9B 3GNMH 3UPRA 5CJ8A 5I1LB 5I1JL 5JIIA 3HB3C 3TIDA 1S9XB 2FJHA 4OFYA 2Z93A 5HDLA 1F8TL 2E3VA 3U0WH 1F2QA 5MI0B 3HLAA 3AREA 4RGNB 4CKVX 2YD8A 4KTYA 1NGXB 4NBYB 5FOBB 3HPLA 1FIGH 4JHAL 4Y7MA 2O61A 2VQ1A 3UJJL 1JWMA 4JLRA 2P5EA 1I9EA 4PRDA 5FGCB 1R0AL 1JYNA 5DJAA 5E5RB 2VLKA 3BUYA 3MRGA 4BSVB 4EVNB 2E6PA 3QFDB 4DZBB 3U83A 5D72L 1NL0L 5I73C 4NHCL 3QUYB 5C6TH 1PSKH 3MACH 1A6UH 3MA7B 4I77L 1JGUH 4QRPD 3WO4C 1JFQL 4Z7QE 2ZPKL 4ACPA 1ES0B 2NCMA 4LCIH 3ULVE 1XR9B 1V3LA 1SVCP 1IM9B 3O3EB 1JTOA 5HHPA 4P4RA 4XP5L 5DD0L 1P2CA 1HQ4A 1WBXA 5DDHB 1CVSC 3NACL 5IMMA 5D93B 4R7DB 5JPNA 2VR5A 3DMMB 2MOVA 1GSMA 3QEUB 1TCRA 5JHDD 1IAIM 4P46B 5F6HJ 4I3SH 3PE9A 5DRXB 4X80H 1DN0B 4S1RH 3W0WA 43C9A 4NZDA 3HPJA 2DQJH 3DXAD 1IEAB 5JOPE 1PW3A 4OZGB 1D9KB 4HK3J 5HHNA 3GSQA 5I74B 1T1WA 3SEPA 2BXYA 3MUGA 5ILTL 3TA3B 4KHTL 4RWYL 3HZVA 4UT9H 2AK4A 4HXBL 5FKPA 4PJIA 3ZDYF 1RHHB 5GS0L 3MLSH 5DRWB 4M3JA 3VFVA 3LN9A 3MV11 5BXFA 3PL6B 1H3PH 1RU9L 1R5WB 2EIZB 1C16B 3IU3B 3DV6B 1WC7A 3O81A 4QF1B 4Y4FB 5D2LB 4ZSOE 5FOJA 3UYOD 4ETQA 3THMH 2O93L 4FQQA 5SX4I 3CFKA 2BSTB 2UWEE 4ZXBA 4KU1A 1XCTA 4ZUTB 4PRIA 4ZOAA 4MAYB 5IVXE 5J6HB 1VEMA 2D31B 2HN7A 2FEDD 3OX8A 4GAFB 4HG4J 3BXNA 4BELD 5KZCD 4OLEA 3G5YB 3TH2T 3MJGX 3WFHB 3CXDL 4B5EA 1D5ZB 2FECI 3HAEG 3U6RB 1QLRB 4JHBA 3LQAH 3VXSA 2Y5TB 3MRLB 4YDVB 3RVXC 4ZUSA 4NKMB 5HI5D 2ADJA 2VAJA 2X09A 3SDDD 1C08A 2CK2A 5KN5B 2FR4B 2EDJA 5C09B 2V2WB 2IFGA 1UH4A 3T0EE 1KCRH 3KPRA 2EYRA 4GG6A 4WW2A 2FGWH 1AE6L 4U33A 3VXQA 1J11A 4UV7H 2ADFL 4BK4A 1LO4H 5CBAA 5GJTH 3T08A 2H3NB 5T1KA 1TQCC 1CZ8L 3U2SA 5KVFL 3W9EA 5J8OA 2GTZA 1FL6B 4HUVB 4JFXB 5DURB 3CK0H 3MZGB 1NUNB 1I8LA 1WZ1H 5KVMC 1XF2B 4MNGE 2XTJD 2JJSA 2UZIL 5TQ2H 1NBYB 5HJ3B 2XRAL 5EC2A 1HDMA 3P40A 5DFVC 2NY2B 4NJ9L 3SKJH 2Z91A 1CD8A 1KTLB 5HGBB 1E4JA 3ROOA 2A9ML 4TVPD 1Q1JH 1IZKA 2PXYB 2HYMA 1IC4L 3V4UH 1WCBB 1V3MA 3QNXA 4ZAKA 5AD0A 3P4LA 3JWOC 1MWAA 3Q6GH 3SE9H 3ROLB 2CKBL 1ZE3C 3U79A 3DBXA 4YXHH 4U31A 4HGMA 2JCCA 2QQQA 1MLBB 1B2WH 4GBXB 1S7QB 1AGCA 5D96B 1TJGH 5T1MB 1IARB 3FO2A 1J7VR 4J3SA 2XQYG 4PJGF 5DQDH 4NRXB 2UZXB 3O2VH 4L5FL 1S78C 2EO1A 1OOAA 4ZODA 2CIIB 1L7TL 4RGOL 2XKUA 3U82B 1IGTB 3LKNA 1N59A 2E9IA 4D9LH 3BN9C 2BY2A 5FK9B 3S35L 3SY0A 5E2TH 2XZZA 2YD1A 4YDIL 1JF5A 3DX6A 4OGYH 1FE8H 5T33L 1B4JL 1KCSL 4PJHF 4M6MH 3QUXD 3TN0C 5HSFA 1NJ9B 2P4AB 5TFSL 5HGAA 1X9QA 4PP1C 5C0CA 1HQRA 4C4KT 5A2IH 4P2OC 1D5XA 3VWJD 2O26U 1HHGA 5FGBA 3NPZB 2GJ6A 3ARBA 2EYTB 3MMEA 3P11H 2XI9A 3WNMA 3RWDA 5IBUG 5F7LB 1HEZA 2EXYC 4U1JA 1HXYB 4U1GC 5FYJU 1A7PL 1QPPA 2FWOB 4YIQB 1FGNL 1FZMB 4KTDH 1E4XL 3QDGA 2E9BA 4P3CH 3SGJC 4X4YA 4H0GA 3T3ME 4QTHA 5HDQH 3C5SA 5DEFB 2DQUH 1FJ1B 3KPSE 3QEHB 3UROR 4CGTA 1T04B 3PIQB 3TWCL 1X5YA 3MLUL 3MNZB 3EJJX 3T0ED 5D1XA 5F96H 5DJZB 1ED3A 1OVZA 2F54E 1H9VA 3ARDA 2ZWLT 5HPMA 1NPUA 4KMQA 5IESL 1ZVSA 5C0AB 4RAVA 3UZEA 1EHLL 1AGFA 3MROB 1QHOA 5B4MD 4WU5B 5IF0A 5J06A 4P48A 4Q7DA 3MPCA 3E6HA 2YD4A 4YBLB 2BCKB 5K9KA 1DBKH 1WT5A 1NC4D 1K4CB 4CVWA 2X70A 3G08B 1JHTA 3T65B 1NCBH 4OB5H 5DUMH 4XCCL 4HUUB 4JRXE 3ULVL 2VOTA 3BJ91 3QEGL 3FT3A 4XVSH 15C8H 4POZD 3ZZ1A 1U3ZA 5E9DD 2GK2A 5FYLH 4JDVB 5ACZB 1BX2A 1PG7H 1TCMA 5CUSH 1CFSA 1I9JL 5KJRL 3L3GA 4GQPH 1K4DA 4YHYB 4O58H 5D7IB 5CD5C 1W0WA 4DN3L 4Y16A 1MCDA 5IMKB 1BQSA 1EXUB 2DDQH 4JPVH 2COQA 5SX4H 2XG4A 2MNUA 3TT1L 1IQDB 2Y9RT 3LKQA 3QQ4A 4PJBE 1P6FA 5ICZA 1JZ3A 4U7SA 5GS0C 1Z3GH 3MRKB 1JZ2A 5KVGL 4XWOC 1NFDE 3LN4B 4EI6A 4Z78B 5KSAC 4JFFB 3W11D 3FT2B 2Y7QA 1AQDB 2EC8A 5F7EL 4XPGL 1C5DA 2Q87A 2BOBB 4NO0B 3WN5C 1DANT 1FL3A 2R1WB 1UFUA 2ITDB 4ZYKB 4LQ1A 5T3XE 5BZWB 3FOLA 2A6JB 1HI6B 4Y5VB 1JNJA 2J8OA 4UV4H 3MBEB 2UUDK 5I19L 4P9MH 4LCUB 3ZL4L 5EZJB 4R90L 4PJCA 4X4MA 2PYFB 4M7ZB 2DI9A 1T1ZB 4NO3A 2BOCB 3IFPA 2DRUA 2J8HA 4EDXA 5EFIA 2DL9A 4Y2DD 1REIA 4RNRA 1TQBC 1N0XL 2WBJD 2GTWB 4Z0BL 4UZGA 3QCUH 5SWZB 2CSPA 3KS0H 2DJ4A 4Y1AE 4Q6IA 1EO7A 4QRPA 1UENA 4Y4KB 1J8HB 1RUKH 3GBMH 3LAFA 1IGJA 2IANB 3K4DA 4H0IA 3UDWA 4K8RD 1L7IL 2DQFB 5DMYA 4NO2B 2NPLX 2BY1A 1MFDH 1S7WA 2GJJA 5FF6A 2A38A 2ICEB 3VG9C 5F3HA 1IGCL 2CKBA 4MMZC 2XV6B 4YNYB 1U92B 4GSDH 1JWUB 3DROB 2HMIC 2V9RA 5JHDA 2HJFB 4ZO6A 2R69H 2ARJA 1G7QA 1EMTH 4JO3H 9CGTA 1WAAA 4DEPC 1DBBL 3DXAA 5DGRA 3S5LA 1QFUL 3KG5A 4UTAH 1LO3L 1RZ7H 2V2XA 5I73B 3UZVB 3P4OA 1FGVH 1J88A 2VXQH 4NRZB 1CGSL 3MLYL 3CFCL 1IC5H 4HJ0C 4CJ1A 4P9HH 4L4VE 1Y18A 3W9DA 1FFQA 2YPKA 1PX4A 4WV1C 1EEYA 1DBML 1NAML 1TZGL 2ED7A 2F8XC 1R24A 5ALCH 3WDJA 1BLNB 4JRXD 4F7PA 2WQ8A 1MCEA 1CR9H 1YMME 4Z9KB 2X4UB 2VYRE 4G8FA 2VXUL 4V1DB 2XWTA 2AJSL 1JWMB 4RRPG 4YO0A 5DJAB 2Z35A 5L7XL 2DTSA 5ENWB 5IR1B 1OQXA 3AGVA 1E6OH 2ZG3A 1JHKL 1XF4B 4BA8A 1MI5E 3N06B 1HH6A 4LHUB 2QJDA 4PLKD 5DFWH 5IW1B 1KYOJ 1UM4H 3OZ9H 1FYTD 1LO5A 1RAMA 4NO5A 1FH5L 3DX9B 1IC7H 4L9LA 4P2QD 4E41B 3SDDA 4Y89A 3V5HB 4WUUB 5E5MA 3ULUC 1B3JA 1GGUA 5F88A 5HHPB 4BH8B 4P4RB 2AGJL 1OW0C 3ME0A 3NA4A 1CK0H 3DVFA 2EEBA 4HF5H 3MLPA 1P2CB 1HQ4B 5M7QA 1A1MA 4R4FH 5IMMB 1JZ4A 3MJ6A 5JPNB 3WL9A 4M1DL 4XC3H 1MFBL 2W9EH 1ZTXH 3V7MA 4MAUL 5KVDL 1FL5A 1OD9A 4K3JL 2B20A 3W0WB 3SCMD 4HUMB 3GK8L 1F11A 4YXKL 3U1SL 2Z4QA 1GGBL 2Q8BL 1T1WB 4R4BB 4NGHL 1JGLL 4DGVL 1T7XA 3DV4A 3QYCA 3HZVB 4YEEA 2UZYB 4Y1AD 3UJTL 3IJSA 4GRWF 4PJIB 1DUZA 2DLFH 4EI5C 5BXFB 5TDOB 2YD9A 1M7DB 4AL8H 1HZHL 3ELAT 3NH7H 4XX1G 3GSUA 1YPZE 3ZHKA 4ETQB 1AR1C 3O45A 4OUUA 2QSVA 3FQRA 1QBMH 3L3OB 4FQQB 1A7NH 2Y25A 5CZVH 2DWEA 3MO1A 4PJ5D 4AM0A 1XCTB 2JB6B 1EDQA 2BNQB 1UB6B 3IDGB 3LN5B 2HN7B 4H8WC 5BCAA 4L3AA 1TQCB 3LS5H 4FQXD 3S6CA 1A3LL 5CGYC 1N64H 3RBGA 2ED8A 4ZMAT 3EFDL 3WUWB 4UQ2B 3CSYA 1PQZA 4XVTL 1A6AA 1HHJB 3F58H 3OR7A 1L9NA 3CMGA 2OTUB 5CP3A 1B6UA 1BFVL 12E8H 1MAKA 4JFPA 2HFTA 5F6IC 3O3AB 4HWBL 2I26N 5I1AB 5C2BL 3EDDA 1U8MB 5CEYA 2YC1B 3ULVC 2HKFH 2H32B 1FRGL 3KXFB 4L4VD 1J0KA 4ZSOA 3PG2A 5IV2A 3QUXA 2PR4L 4O9HL 1WF5A 2EYRB 4I13B 1R3LB 2UWEA 1BM3L 3IDJA 3E8UL 2R29H 3U4EB 5DF0A 4XNXL 5CBAB 5IVXA 3G9VA 2DD8H 4WGWB 5JXAH 3ULUF 5A2LH 3BP7B 3VWJA 4KQ4L 3I6LD 1BQLL 3W9EB 3ZE2F 4DGYH 1I1AD 4YFLI 2VKWA 5BVPL 4TUOB 4PBVC 2FSEA 3BN3B 3VRLF 1MHEA 4AG4H 3PJSA 2JKXA 1EJOL 3TCLB 2DI8A 4Q0XL 2APWA 4RA0C 1MI5D 1ZLUK 4QHLA 2ICES 2EDLA 3AFLA 1RK1B 3BJLA 3WKNA 2Y6SD 3B3IA 1HDMB 1ZT1B 3VRJB 4LU5H 4NWTL 4R26L 1UZ6E 4JDZA 3H9SD 4QHKI 5FXCH 2J6EH 2H2SD 1XMWA 3T0EA 3I3BA 3P3YA 3IKKA 5AD0B 3TN0B 3MJ9L 2VWEE 2YZ8A 4LKXB 4U1MA 5I0ZA 3BEVA 3CSGA 4KJPD 4JFQB 4M4PA 1T2JA 4GW4B 3ZKMD 5EB9A 5FKAA 2JCCB 2VZ1A 1VEOA 4NZRH 5IROC 4P2OB 1LDPL 4KK8D 3X3GH 3P0VL 1KJ3H 4WI2A 5ADOH 2V5MA 1CDJA 2VDQH 4XAWL 3QG7L 4NQSA 4OT1L 4G8IA 4M9OA 1NC4A 1HH9B 4MNGA 1QEWB 4U1GB 1F90H 3VFPA 5B8CC 3VD7A 2YA0A 5KOVC 3FN9A 2G60H 1KB5H 2EYSA 1GRWA 3LKNB 1RUAL 1OSPH 5ID0B 1CDHA 4PRAA 2GY7B 1ONQA 1V7ML 1UZ8B 3HNVL 4MSWB 1QVOA 4TTDC 5FDYA 2V9TA 5E9DA 4MQTB 3QXTA 4WWID 1F3RB 3TH4T 1B0RA 4CVXA 3WXWL 4Y19D 5CBEA 4AMKL 1ERNA 3OXSB 4M5ZL 5C3LD 3ULVF 4HPYL 2MMXA 3MRHA 1YEHH 4X6FB 5ESVB 3MV7E 1HQRB 5CCKL 3RTQD 1NKRA 1D5XB 1G7PA 1FVDB 2A9NL 1LDSA 5EUKB 1UB5A 3RWDB 1P6AB 1HOCA 2PF6A 5GJSL 2F5BL 1ZLWH 3FMGH 3ARGC 5FO9B 3V5DA 1Y0LA 1PZ5A 5JORB 1MJUH 2VDML 3RWJA 2ENSA 4X4YB 5ABDE 4ODWA 1IT9L 1H5BC 2OTWA 1I1YB 1FSKC 5L2JA 4JZJA 5FIEA 3HR6A 2A6KB 3MLRH 4ETYA 1Q0XL 1ZHKB 3NFPB 3U0PA 2H1PH 1T0NA 4MS8C 3G5VA 4KAQH 4QGTA 4CVUA 1YYLH 3VU2A 2P24B 2OJEA 3L3KB 4Y2DA 2UY7A 3WE6A 1ZVSB 4LIQH 2WBJA 1H3UA 4NQEE 1AGFB 3TFKC 5IBLC 4HS6A 3QWOA 1I4FA 4G9FE 4PJAF 2B1HL 5IFHL 1P84J 4M61B 3WIIL 3RVTD 5KSAB 1FBIL 1X4YA 3VXOA 3PWUB 3UZQA 3L1OH 3RIAF 5IW6A 2Y1VA 4JCMA 4NZTL 3WN5B 3L95A 1JGDA 5E00A 4X98B 1T83C 2JTDA 2P5WB 1Q0YL 3P9WB 1E4KA 4NFDA 2ICWA 3QIBD 4GKZA 5D2NE 3UYRL 4H26B 3P30L 2G2RA 3QH3A 3A6BH 3NBNA 1J0ZA 5DJCA 5GRJL 4U3CA 2DQTL 2AXHA 5CS7A 3MRFB 4W4OC 1TQBB 2CDGA 4DUVA 1TTGA 1WV7T 4KDVA 3UJIH 3LKQB 3ALXA 3O2DH 1X6LA 3L9RA 4HWBA 4ONFH 1FN4B 3ZKSD 4R0LC 3HE7D 3GBNH 4X7CC 5LQBH 4PY8I 3WFCH 5HHVL 1IAMA 2YHGA 4EI6B 2ZKHH 5J1SC 1HHKA 3MLWL 5HDBE 4F58H 3NZHH 2X4OB 1L0XA 3V6ZA 1C5DB 5E08L 3T2QA 4JRXA 2QHRL 3HCVA 4F9LC 5JUEH 1AD0A 3H42H 4HBCH 4F3FA 5I1GL 2NY7H 3B5GA 4JN1H 5I9QC 4PJ8C 2D03H 2XZQH 3GUTB 1ZVHA 3PHOB 3VD4A 4PJCB 4Z7UF 1WUNT 4GRWB 3VRIA 4DEPB 4N5UA 3BAEL 1MHCA 4Z0XA 5HTSA 5LBSH 1FYTA 5FV2A 4HKZB 4I0PD 3HC4H 1FORH 4GMSH 4M43L 2G5BB 1NCWL 1CL7L 3TT3L 1RJLA 4P2QA 3GIVA 5HYJB 1NFDA 1IGJB 2CJUH 4TNVK 1P4IH 5LJYH 4PLNC 5BO1H 3ILQD 3VXME 4PJEE 4WV1B 3LCYA 1CGVA 1JJUA 4OAWB 4QRTB 4HUWA 5C8JA 4XPBH 3MJ9A 1FZKA 1IGFH 4D0DB 1OT1A 1RD6A 4PLJD 2H9GB 3SJVD 3C9NA 4U3XA 3NIGE 1D5MA 4K3GA 5DUPL 4IOFC 5DC4B 3SCMA 3S5LB 2IC2A 2X6MA 2VLMD 1PYWB 1G9MH 5FDWB 4HFWA 4LPCA 4Y1AA 2O5XL 4O2FA 1FZOB 1NCAH 5TF1H 1KPUA 4X7DC 4OV5A 1W8NA 1YEGL 1U8IB 5MP6L 3VMPA 5EU6B 4HCRH 4D3CL 2YPKB 3GNML 3P0YH 4ZS7H 4XGZA 1U8OA 1NFIA 3QDJB 2IWGA 5KS9A 4PJ5A 4JZOB 1JI2A 3P0GB 4YHMH 4XX1E 1WWCA 4ZO9A 3U0WL 4HD9A 1JVKA 3RNQB 1MQKH 3FONA 4FQXA 4LLUA 1Z5LB 2DYPB 2NY1C 1ZK9A 3QT2A 3CDCA 4NQDE 3WS3B 4ZS6D 1FIGL 3GEWB 1I8IA 5GGRY 3V6FA 5FGSA 2X7LB 4PR5A 3WIHH 2VXSH 3DARA 1L9MA 1YEJH 4LHJB 5J1AB 3MV9E 4XXDB 1LO5B 6FABH 5C6TL 1PSKL 1WZKA 2NXZD 3MACL 4L9LB 1A6UL 5I0DA 2GW5A 2D9QB 2OI9B 5D5MF 4L4VA 4LGSB 5F88B 4LCIL 1HSBA 1A6WH 1PG7X 5EU5A 3GMPA 4FFWD 3O4OC 3QRFM 1U36A 1A1MB 3K2UH 3BP6A 4I3GA 1I1AA 5LGJB 2R0KH 2YK1H 1I75A 5LWYH 1BD2E 4L29A 4I3SL 3MRBA 1U95B 1A6TB 4X80L 1MI5A 4KK5D 4S1RL 2DQJL 4Y4HD 2Z4QB 5AYUH 3V0VA 3DV4B 4LOUD 4UT9L 2B0SH 3H9SA 3MLSL 5EOCH 4ORGA 3HHRB 4ISVB 2NW2B 4MJ6A 3IDYC 2R1XA 5DD5H 4ERSH 1H3PL 3LQMA 3P4NA 4Z77A 1Z9MA 2FYYB 4OUUB 3VXMD 3MUJA 3THML 3UTTB 4ONGH 2GK0A 4IJ3C 4LSDA 4U6XA 3B9KC 5J89A 1INDH 3VFUB 1J10A 5FGRA 2CR3A 5DHYA 1VESA 3SE3C 3WBDA 5KW9L 4TOYH 3RL1A 5J0BA 3CSYB 1R5IB 2GFBA 2VDPH 4OCYH 1MJJB 3EHBD 4ZFOA 2YUXA 2YUZA 3C60D 4D8PA 5C0EA 3RX5A 1V3KA 3QDMD 4OIAA 2CRMA 1U2CA 1NMBH 4POYA 3TPUA 3LQAL 1OAKH 1ND0A 5CEYB 4PJXE 5CGTA 4M7JH 1B6DA 1YPZA 5HHMD 4ZSOB 4OBSA 4Y19A 1KOAA 1MCOH 5IV2B 5C08E 3MNWB 4W81A 3UTZB 2MTPA 1KCRL 2UWEB 2P42B 5FO8A 5IVXB 4UV7L 2V2TA 1LO4L 5GJTL 3HC3H 4YZFF 2ADGB 4WY7H 3RTQA 1F13A 1G0XA 3VWJB 1F5WA 4F9PC 1N3NB 2Q1EA 3R1GH 3KYAA 3D85B 1GIGH 4IMKC 3P9MA 3V0WH 1RJCA 3C8KB 2E27L 3CK0L 5K93A 3PJSB 2V6HA 4S10A 1WZ1L 4QHUA 2XICA 5C70A 1QFOA 4PTTB 5TQ2L 2W0FA 2D0GA 4W68A 5DR5H 5H94B 4HLZH 4YHLH 1U8JB 5FUZH 4WI8A 3SKJL 4OGXH 2P1YA 2MKLC 2CO7B 4PJGA 1I1FB 4YDKH 3WJLC 3B9DA 1Q1JL 4JZNA 1EK3A 5C0FB 1QQDA 4BM7A 4N8VB 4OZFH 4YQXH 3V4UL 5FYLD 4DFHA 3TIEA 4QRSB 4FG6C 4U1MB 5A3ID 2SEBA 3TPKA 2PCPA 3Q6GL 4HUKB 5AUMA 1CE6B 3SE9L 5FKAB 4YXHL 3ZDZE 4Q97A 5JO5A 1B2WL 1KLUA 1BD2D 1TJGL 2VKXA 5EH1A 2H6PB 4PJHA 1BZQK 2CGRH 2EDHA 3T3PE 1QSFB 5DQDL 4MNGB 4QTIH 3O2VL 2IEPA 4ODUA 3ARGB 1P4LA 1K85A 2YKLH 1C12A 3QWRD 4M62H 1HHHA 1I8MA 4S0SD 3S96A 4DVBA 2WAHA 1NAMB 1YC7A 4D9LL 4PRAB 2G5RA 4XCYB 1H5BB 1FSKB 1QVOB 1JK8B 2H26A 1RZGA 5J3HD 5E2TL 5I8EB 1S7VA 1B0RB 4OGYL 5DEZA 1FE8L 5CBEB 1BAFH 3T04D 4M6ML 1UADC 3KPTA 1NCDH 3QIBA 3D3VE 1A9BA 4CMHC 3NOIA 4HS3A 4UT6H 2XACC 3KPOA 2PN5A 4PRPE 4C58B 3LZFH 5ETUA 2X5PA 3RVWC 5ANME 4NT6B 2XKNA 2VR9A 1GVIA 2YD3A 1G6RH 3P11L 4PV9B 3LRSA 3HE7A 4GJTB 4I5BA 4MD4B 4NNYA 5J6GA 4LCYB 1Q94B 1Y0LB 3LV3A 1ZT4B 4KTDL 1MLCB 4LPVA 4P3CL 3RWJB 4ODWB 3GMLB 4FQJH 1AHWA 5HDQL 2LU4A 2DQUL 3A67H 4XMPH 2G75B 5F70A 2XZCH 1BIIA 3U0PB 1LE5A 5C08D 3G5VB 2VWEC 1TJHH 1K8IA 4M00A 5F96L 4P2RE 2VZVA 4KGJA 2DMBA 1E4WH 2DQEH 4JR9H 4WHTA 4QRQB 2LFGA 5DXWA 4V2CB 4N0UE 4I0PA 2G9HB 4PREA 3RL2A 4HS6B 4JGJA 1HYSC 1MIMH 3QWOB 5L2KE 5IM7A 5DHXB 4U1KB 3CJJA 5E2VH 4R0LB 5TH2B 1T7ZA 3FFCE 1DBKL 3AXLA 1CU4H 3DVIA 3T4AB 3GMNB 3ZDXF 1NCBL 3VGEA 5TDPA 4OB5L 2AJVH 5DUML 5E7BA 3VXOB 1QSEE 4Z5RA 2BC4A 3EYFA 3V7AG 5J9PB 1CXIA 1MF2H 3RPKA 3KPSB 5EO1A 4KDTC 5I9QB 4XVSL 15C8L 4HKXA 4OZHF 2EE2A 5FYLL 5D8JH 1ZHNA 3C5JB 1PG7L 5CUSL 3SJVA 3NN8B 2ICWB 1CVRA 2XWJB 2F54B 4O58L 1NEZB 3ZO0A 5A16A 3KPLA 5T1LD 1SY6A 4XNMA 5DJCB 3GJFH 2DDQL 1KJVA 3D48R 5IVZB 4G9FA 5TE6H 1TXKA 4KQ3H 1U8NB 2ZUSA 3L9RB 5E8DH 3UO1H 3QPQD 5GSVA 4M6NH 1Z3GL 1U2HA 4J3XA 5F44A 1BVLA 3TO4D 1J1XH 3BVNA 4PG2A 3C6SA 5FM5M 4C56D 4OZIE 3V6ZB 1VADA 4JRXB 5IQ9A 1RZIA 4ALAH 3RWGA 1PLGH 1AD0B 3MRMB 5IB1B 3RPIB 4JQVC 2FECL 3K3QA 1MCJA 3C2AH 4S1SH 4ZDHA 4ZPVA 4UTBH 4UV4L 1I1CA 1J0HA 4P9ML 3EJZD 4N9GB 3O41B 4ODVH 3L5XH 1NKOA 2X1PA 4PRPD 5KOMC 4LPTA 3N1FC 4YJZL 3OGOE 4RDQG 4Z0XB 4YHNB 1CFTB 4PJBB 4C83B 1VGEH 3QCUL 4BFGA 3QG6B 3LQAC 4ZFFA 1TLKA 1RUKL 3GBML 4HC1L 3SO3C 1NFDB 1CXLA 5E4IA 1H8NA 4MJ5A 3OF6D 2XN9D 1MFDL 1G1YA 2HTKD 2OTPA 1U41A 3GSWB 5CZXD 4LKCA 1YJDH 3WV0A 4JEGB 2ERJC 4FQHA 3KPNB 4LLVB 3RUGE 2N7AA 5I2IB 4KRPD 1CDCA 4IRZH 3KLHC 4GSDL 2R2EA 4JGUA 4XI5D 2I07A 3NCJH 5D2NC 2R69L 1CXFA 4JO3L 1EMTL 3TO2A 1PGRB 4YBQD 5JW5A 4HLZG 4RRPA 4Y4HA 3C6LC 4UTAL 4Z7VE 5DC0A 1RZ7L 1FGVL 4O2FB 4DWHA 4A2LA 2VXQL 3FZUC 3MREB 1KPUB 1S5IH 4OV5B 1YY9D 1XZ0A 5DRZB 5JOFA 1IC5L 3FFCD 2HRLA 4P9HL 1LO0H 4OZFG 4QXUH 2AXJA 1G7LB 5LAXA 3EUUA 1UVQA 3VXMA 4PJEA 3LEVH 3FRPG 4OD3H 5ESQA 5ALCL 4KKNA 3O4OB 3T0WA 3ZE0F 3WS6C 1CR9L 4M93B 1RJZA 1A4JB 1EO5A 4RA3A 3VE0A 2VE6A 4LIQE 1C5BH 5BZDB 3EDFA 3SDXE 4JKMA 3MNVA 4L8CA 1IZJA 4X6BA 1M71B 3C60A 3SGDI 4PJDA 2DF3A 3AS1A 3PWJA 3ARFC 3QDMA 3X12A 1E6OL 4D9RD 5KSBF 3RDTC 2DMCA 1FNLA 1UM4L 2D4DA 3OZ9L 4WJ5A 5IJVA 1IC7L 3M17B 1PKQE 2N56A 5F89A 1BBJA 3IDYB 4L4VB 3RKPA 3IGAA 4PV8A 3VFRA 4DW2H 1A6ZA 5D1ZD 5FCUH 4N0CD 3RGHA 5JW4R 4LSVH 3HRZA 4YUEH 1A4KA 4H0HB 4YK4B 4M1CD 3SN6N 1CK0L 1M05A 5DMKB 1YMMB 4HF5L 4O51B 4O2CA 3B9KB 3AS0A 1FVCA 2HRPH 4R4FL 2W91A 3BP6B 2XPGB 1UT9A 2H2PC 2MJWA 3KPPB 1DVFC 2RFXB 3RWFB 4KUZL 1T5XA 2D7MA 4U6HB 3ZTNH 3D6GA 3ZMRA 1Q9OB 4XC3L 3ARYA 5DYOB 4LVNC 2W9EL 1ZTXL 3S98A 4L29B 5HYSG 1VFAB 3WJJA 1MI5B 3G6JE 4GG8A 4XMKH 1GGIH 3D0LA 3BZDA 1MNUH 1ZHBB 1H8OA 2YA1A 5FUOL 4XB7A 4HH8A 2P48B 4BK5A 5JLZA 1T21A 2VR4A 4R8WH 4NZJA 2DLFL 4ORGB 3HAEB 4HIHB 2EIDA 4LFHD 3P4NB 2DIBA 4KK9C 4AL8L 3NH7L 3VFSB 3SKNB 5GIRA 4QXTB 1U93A 3QQ3B 1QBML 1A7NL 1EFXB 2Y06H 4FQ2H 4JB9H 3UTOA 5CZVL 3KYOA 5FA4A 4OCWH 2GK0B 4U6XB 4HH9A 1X5IA 1ZXQA 4RGMB 1G9NH 3LS5L 4XVUD 3D39D 1BD2A 1N64L 2KZWA 4XNQA 2YBRA 1O7SA 1RURH 5CHNB 3BPNB 1FNEA 4UAOC 1OAXH 1HXMA 3F58L 5GGQH 4EN3C 4LSRH 5C0EB 4KKCD 3SHSA 1YDPA 3QWRA 4LSPH 4ZUVA 5FO7A 2XQYK 4O02H 5E6ID 12E8L 2VL4A 4R7NB 3TPUB 3K46A 4Q2ZB 3TVMC 2XQBH 3OAYK 1VGKA 3OL2A 4U6VH 1SJXA 2HKFL 4LLDB 4P3DB 5HD8D 1YPZB 5GZND 3W81A 3IDNB 3BKCH 3EO0B 4Q9BA 3UPCA 2D2OA 1AR2A 1GGYA 2BVPA 5F3BB 5H35A 1JPSH 4XHJC 3LKSA 4JPIA 1FFOA 4WI9A 4K2UH 3ZSTA 2WUBH 3FQWB 3FN0H 5DI8B 2R29L 2V2TB 1WWAX 2DD8L 5GGSB 5JXAL 2F15A 3AY4C 5HGDA 4BSWB 2NTFA 4FQIH 4DGYL 1LK3H 3W5NA 4D0BB 3FQNB 1FVEA 4A6YH 4NSKA 4FZEH 4AG4L 1O0VA 3EDKA 3LQZA 3OKDB 4BUHA 4HWEH 1OARH 3MJ7A 2EXWD 2W0FB 3NIGF 4MMXC 2Q3ZA 4LU5L 3WNNA 4XTRC 4P3WA 4MJ2A 2AJXH 2FLBT 3ET9F 1D6VH 2BVQB 1H8SA 3B4NA 4N8CH 4N1HB 2J6EL 4P57A 1WFUA 5DEGA 4CN6A 1QQDB 4RCAA 5C08A 5HGHB 5IB3B 3IXAA 3MRJB 1WCQA 2DQIH 2C3WA 4MZ2A 5LXGH 1VEPA 2HFFA 3E1F1 3ARZA 1KT2B 1Y6MR 4HWZB 5JO5B 4I18A 4NZRL 4FTVE 3X3GL 1KJ3L 5ADOL 4J3WA 5HI4D 4APQC 2VDQL 3NCBB 5IG7A 3U46B 3CC5B 4NUGH 4X5LA 3FFDA 1F90L 4ODUB 1JGEA 1P4LB 3OXRA 5FA3B 5IKCB 1RPQA 1KEGH 5IBUB 2ZOKB 4WHDA 1GZPA 2YD6A 2G60L 5I8CB 1KB5L 1AY1H 3S96B 4KDWA 4WWKC 5TQ0L 3T8XA 2ZSWB 1OSPL 5JQHC 4UBDD 4QRUA 3K81A 4RMWA 5BQ7A 1NGWA 3MRNB 2NY5H 1T6WA 2HAZA 4BQ9A 1EO8H 4UU9B 5I66B 3L6FA 4EXPX 4YX2H 3V7AE 3LKRA 3GMOA 2QKIB 2EKSA 4HZLB 3OKNA 2MQ3A 3RGVD 3UC0H 5T1LA 4AQOA 4OCSH 1YEHL 3CFJB 5ETUB 4LCCA 1T7WA 3NZ8A 3L5WA 1IAKB 1M1SA 3S88H 1KIRB 5D7KD 1G6VK 3ARPA 1TTFA 4I5BB 5SWSE 3RIFK 4BKLA 1AGDA 5J6GB 1JCKA 1EUUA 3ZE1E 3FMGL 1OSZA 1A64A 3TO4A 2HT4C 1A0QH 1RJYA 1JNNH 3SGDH 4C56A 1MJUL 5MENB 2BNUA 1GGCH 1T0MA 2K7QA 4J3TA 3MLRL 1JN6A 5B3JE 2CUMA 4RAUB 1BIIB 4MDJB 4L8SA 1YC8A 4JN2A 2H1PL 3K4ZA 2BERA 4KAQL 5H2BB 1YYLL 3KJ6H 3OMZA 1JMXA 1K8IB 4U2YA 4L8BB 4PRPA 3HMXH 3MV7B 1PBYA 1F2XK 1MPAH 2Y36H 4LIQL 3CZFB 3DGGB 1KCKA 5KAQG 1ZSDA 1KULA 2DKMA 2VL5A 2AERT 1MHHA 3UMTA 4L8DB 3MUZ1 4Y5XA 3AXLB 3K0WA 3OF6A 2XN9A 4MYWB 3CVIH 5F7FA 2W07A 5J13C 2UV3A 4PGZA 4H25B 1KPRA 4PD4K 3L1OL 1J1PH 4KKLC 3T0DA 2QR0B 4N5ED 1BZ7A 3DVNB 2HJLB 3IRPX 3TZVC 4HKXB 1MWAH 3BIKA 1TVHA 2VDRH 5T5NG 4R4NC 4F7EA 3U7YH 4E5XA 3BZ4B 1KXTB 1ZEAH 5A16B 1NFKA 3KPLB 1PX3A 3A6BL 4XNUH 4NQEB 3HNSH 1UKTA 4N0UA 1NC2B 2BJMH 5C0GB 3RY5A 3I75A 2FJFB 4G9FB 5GS1C 1UQSA 3UJIL 4F80A 3O2DL 4ONFL 3ZSSA 3B2UD 1XH3A 3FFCA 2JK5A 3SO3B 3PV7A 3GBNL 5LQBL 3WFCL 4LCWD 2JE8A 3STZB 4QHKJ 4WGVB 2ZKHL 3HE6D 3TBWB 4F58L 1NLDH 3NZHL 4FABH 5IQ9B 2DQGH 5DSCA 3RWGB 3CX5K 1WBZA 5JUEL 3H42L 4HBCL 3QI9D 4JCLA 5MEOA 2NY7L 3EKCA 4GS7C 4JN1L 4K3HA 2ERJB 4ZDHB 1TVDA 2D03L 2XZQL 4MXWH 1I3RA 4JAMB 4JDTH 2BVEA 4O2EB 4ONHA 1CIUA 3LB6C 5D2NB 2XY2A 2I9TA 4MNQD 3REWB 3WLBA 1JZ6A 5ICYB 3SQBA 2X4QA 4M03A 3C6LB 4XPFH 1T4KA 5C0IA 5LBSL 1Q9LA 3BZFB 1NBQA 3PWNB 3HC4L 1FORL 4GMSL 3PF2A 3JTSB 4Y5YA 2GAZA 3VWKC 2VLJE 3CD4A 5SWSD 4ZFFB 5HHQB 1I7RA 4XBGA 5D1ZA 3AU1A 2P7TA 4ZTOH 2CJUL 2J6EA 1P4IL 5GRWA 3HI1A 5BO1L 3L3IA 2R2HB 4CDGC 4XPBL 4Z18A 2PTVA 1IGFL 3QIUC 1NAKH 1T89A 4FQHB 5FM4A 4M7KH 4NKIH 1YEIH 4HX1B 1I9IH 1MRDH 4RZCA 5IWLA 3F62A 3VDCA 1N2RA 3V6OE 3HKFA 3I3DA 3DYPA 4ODSH 2BNRD 2F53D 2NNAA 3VFOA 4PJ7A 4GRLD 5KTEH 2EH8H 3ARVA 4S1QH 2F8VA 3ULSA 4Y4HB 5E8NB 5EU4A 1K8DA 3MQIA 4JKKA 3RDTB 1G9ML 1DUYA 1NCAL 3NCYP 4J3UA 5TF1L 1XZ0B 4OI8A 3K80A 5ITBH 4UNUA 4HJJH 3L3HB 1K6QH 3VXMB 4IRSD 2AJYH 4PJEB 4HCRL 5JDJA 3P0YL 4X5XB 4ZS7L 2X05A 5EZLA 4BSJA 5IMOB 2GUOA 4YHML 1Y6NR 5F9AC 3DRTB 1T89C 3NPSC 2AV7A 3PGDA 3WUZA 4LVOC 1MQKL 5D5MA 1KG0A 2VC2H 3D39A 1CIDA 2VE6B 3UAJD 4OLUH 4WFFD 3FOMA 5EUOA 1FAKT 2NY0D 3MNVB 3AMLA 1DL7H 3BYTA 3T2PA 2WBKA 5IBTH 3VJ6A 3B8SA 1C1EH 3WIHL 2VXSL 1YEJL 4I2XE 1QPXA 5E6IA 3EO9H 3CIQA 1WICA 6FABL 1H15A 4WJ5B 5IJVB 1LEGA 5F21B 1RZJH 3RNKB 1JPFB 4N0RA 4PV8B 4K3DH 2J2ZA 3QB7C 1A6WL 5CJXA 3JVGA 1C5CH 2N7BA 1XGRA 1FFPA 4OZ4A 1JZ5A 2X1XR 4NWUH 4JFED 5DVOA 4JVUA 3H7LA 3DIFB 3K2UL 1EPFA 2HG5B 2X4RA 4NQDB 3TBSA 2R0KL 3SDXA 1J87A 1T5XB 2YK1L 3PQYD 4JJ5A 5LWYL 5F7WC 2WLYA 1LEIA 1BIHA 4XRCB 4UAOB 3X17A 4XNZC 1ZLVH 3JUZA 4GG8B 4N1EA 2M2DA 2R4RH 3ILPB 3MV9B 5AAWA 5AYUL 4HXAH 4N0FA 3VW3H 3BD5A 5T1DH 2B0SL 3TVMB 5EOCL 1KIPB 4JQIH 2BHYA 5DD5L 4ERSL 2IAMD 2Y5EA 3OJDB 1DEEA 3D2UB 3EGSB 3JVGC 5GIRB 4U49A 1EBPA 4AQ1B 3S3SA 2FIRT 4ONGL 3KYOB 1OAZH 4KROD 4G6AC 3L3JB 2EZ0D 3IFOA 4GUPB 5DJ6A 5BMFH 3QWQB 2PO6C 1INDL 4B7IA 1A6VH 5B38G 4OZIF 2JJUA 5L8KB 2RGSA 1BD2B 1EZVX 1R3JA 2AAVA 1A1NB 3EYVB 4TOYL 2KBGA 3HUJF 1FNEB 2VDPL 3O2DA 4OCYL 4DKDC 1FFNB 1C8PA 4OBRA 4FMFA 1A7OH 3DO3A 3NTCH 5DD3H 7FABH 3VA6A 3QQ9C 3PDOB 4GW5A 1MY5A 4DTGH 1NMBL 5TJWK 3WKMH 4BQBA 5BV7H 5E2UH 1OAKL 4AJ0A 5D1QC 4TTGA 2GI7A 3NVQA 1SQ2N 1OP9A 5DJ2B 4XPTH 4M7JL 5H35B 4KRLB 5BOPA 1MCOL 3TNNB 4QCIA 5E1HB 3S36H 2YRLA 3RGVA 1QHPA 1AIFA 4L4TE 4LLQA 1YY8A 2H45A 1VENA 3QXAA 3HC3L 1F4WH 2QLVB 4WY7L 5C9JA 5BW7A 1GGTA 5EN2A 2EH7H 3R1GL 3NCMA 1GIGL 4APQB 3NABH 1ORQA 3V0WL 3RUGF 4NKDA 5DC9B 2OL3H 3HR5A 2QSCH 1JRHI 1ZWIA 2EDXA 4YHPB 2HJKA 4AEIH 1KB9K 4HMCA 5DR5L 3N9GH 5JZ7D 5J11C 4YHLL 3QCVH 3VXTA 4C57C 4PJXB 5FUZL 1U8QA 4X6CF 4OGXL 4Z7VF 2FLRT 4ZFZA 1UWXH 4YDKL 3IS0X 4L3ED 1KIUA 3BW9A 1R3KB 5C08B 5EC1A 4PJFF 4HZAA 5GZOC 3IAGC 4YQXL 4GKSA 4KK6C 1N6VA 1PG7W 5EZIH 3G04A 2W38A 1BVKB 5CP7B 4KC3B 3SPVB 2NY4D 1RMFH 4HKJB 4I18B 1KIQB 1NGYA 1GOFA 1F97A 3CLEH 1G84A 2FEEI 3F65A 3DYMA 5IG7B 1R6VA 2ZOLA 3ZYIA 3TH3T 2CGRL 2E6JA 4X6DE 4QTIL 1DANU 3D0VA 1JGEB 2RHEA 2X44D 4ZQKB 2YKLL 4TVPH 4M62L 4HCRA 3OAZH 3TC9A 4MDIA 3ZKXB 3QCTH 4QRUB 1P1ZB 1YQVL 3O6FD 2Z0BA 4IRJC 4JJHA 3R06A 4HGWA 4KJYB 1U3HD 1U58A 4NM4H 1R3HB 3LKRB 4JG1H 1EEZA 2NZ9D 1V5JA 1LNUA 1BAFL 2EE9A 4QT5B 1NCDL 2VABA 3B5TA 3OKNB 3QUKB 1SEBB 4UT6L 5T1LB 2Y72A 1CLZH 5ISZD 5KSUA 3LZFL 3WIHA 5IIEB 1MCRA 5IFJA 1JTTA 2VERN 3H2WA 5LGHH 1GH7A 1G6RL 2PTTA 4DQOH 3IDIB 1SJEA 2RCSH 1ZV5A 5I1KH 4LCWA 4G6KH 5SV3A 3TO4B 4PGDA 4NC1E 1CFNB 3HE6A 4F7CB 4HFUH 2LTQC 3G6JF 1I7TA 4FQJL 5E99H 3QI9A 3IDMA 4D0CA 1OTUC 2WLZA 4P5MB 5JA8B 3A67L 3H0TA 3TZVB 4XMPL 1JN6B 3CFIC 3VGGA 5E8EB 2Q86B 2XZCL 4L8SB 4WTWA 4EOWH 3ZT7A 4JM2D 3I50H 3D3VB 1TJHL 4X4XB 4L4TD 4PRPB 4G3YH 4MNQA 3OPZH 3U4BH 1E4WL 2DQEL 1E28A 1R3IH 5ANMB 4JR9L 3HC0A 4OZHA 1WIPA 3IB4A 2W65A 5GS1B 1ZSDB 4BYHA 1MIML 3IVKB 5SWSA 3FQXA 5IHBA 1MHHB 4CW1A 1EAPB 4UUJA 5E2VL 1QD0A 4OFKA 5ICXA 2HTLD 4PGEA 3IF1A 3CUPA 1FNGB 2IG2H 1CU4L 1T80A 3KPMA 3K7UA 1RVFH 1FHGA 1XGPB 1YUHA 3DRQA 1U3YA 2AJVL 1BOGA 4UIKH 1QZ1A 3V2AR 3VXUE 5MEPB 2ESVD 4GKNA 3VMOA 1KNOA 1MF2L 3V5KA 4YFLF 5DZNA 2J8UA 1S9YB 1FLRH 4GS7B 4EZMA 2AXFB 3EJYC 1Q38A 1NSNH 2VAAB 2IALA 5D8JL 2P5EE 1MCPH 3MLTA 5D7LD 2BNRA 1OWWA 2OK0H 2F53A 4P2RB 5D9SA 2VLKE 3VI3F 4GRLA 3H9YA 1NGZA 2OLDA 4LRIA 5C0RH 5ERWB 1K3IA 4N0UB 3MYZA 5DK0A 5K9OA 3V52H 5AG9A 2YEZA 2K1MA 2WP3O 5L2KB 1S9VB 1XGYH 2NXYC 1E6JH 5TE6L 5DT1H 1S7SA 4KQ3L 5E8DL 3T77B 1XH3B 3FFCB 1W72A 3UO1L 3VWKB 4M6NL 2JK5B 2YUWA 2VMFA 1I7UA 2LABA 1CD1A 1Q9WA 5SWQA 2IPKA 1AGBA 3EO1B 4IRSA 2IH1B 1J1XL 3Q3GA 2HT2D 1QSEB 3MRQB 3BH8B 2ZCLH 2Q76A 2A77H 4LEXH 3ECBB 5EBLB 1QFWI 4YDJB 4PIRF 5GGVH 4ALAL 2CD0A 4QWWC 1PLGL 1WBZB 4WI4A 1K5NA 1KTDB 5MEOB 3QIUB 3C2AL 4RQQB 4WW1A 3OG6B 4S1SL 4UTBL 1I3RB 2X4PA 1P7QB 3E3QE 1QBBA 4Z7WF 2Z31D 2VDKH 4ODVL 3L5XL 1FG2A 3QEQD 5FEBA 2NR6D 1Q9KA 1A47A 4PRBA 4PJ9D 2AK4E 4TUJB 1Q9LB 4WDIB 2AXGA 1VGEL 3GO1H 3ABZA 3NA9H 1I7RB 4P5KB 1TVBA 3GGWA 5D1ZB 3KHOA 4JQXA 1CFQA 1QP1A 2P7TB 1ZA3A 3KHQA 5HVFB 1RZKH 3VD3A 4OZIB 1IGYB 5LKNA 3KYMB 3MRCB 4OZFA 1JRHH 4PRIE 4PLOB 4JFEA 3AS3A 4F2MA 3CDGA 1RUQH 2FL5B 2E5EA 3TP4A 2BSRA 4MQXC 1YJDL 5IHLB 4G5ZH 1T66D 2R9HD 3NPSB 2AQ2A 4G6MH 4GAJH 5IEKA 3KLAA 4IRZL 3PQYA 4XP1H 4XXCA 5DUBA 3NCJL 4XPHH 2DLTA 4U1LB 4HIJB 4MCYA 2NNAB 3LOWA 1AI1H 1NUGA 3QUYC 5CMAA 3O9WC 1JUFA 1ZLWK 1BFOB 3ULSB 5DJYA 3BP4B 3Q6FB 2GT9B 1K8DB 3IJYB 2VISA 3VXSE 1KB5B 4K8RH 1ORSA 1S5IL 2ZJSH 2IAMA 2MQCA 4XAKE 1LO0L 4QXUL 3WD5H 3KPRE 3L7FB 4GG6E 5FUCE 3G5ZB 3H3PH 3LEVL 3FQUA 4OD3L 3MGOB 3VXUD 5D93C 3ZE1F 3O8XC 3VFTB 1T20A 3GKZA 3RUGB 2OR8A 3PGDB 3QO0A 3JV5A 3FB5B 2ZP0T 4P46C 3LRGA 4FXKB 2VXVH 3WNOA 1C5BL 1MFEH 4WI5A 4OUOA 3D25A 1OGAB 4JFYB 1D9KC 1OB1A 1S3KH 4XNZB 3VXNA 3VJ6B 1DSFH 4Z7VB 2GKIA 1I8KA 4JFDD 2YRPA 1MELA 1L6XA 5E6IB 4NN5C 5HYSA 2IADA 4HIXH 4YAQB 3PL6C 1H15B 1LEGB 2FX7H 4G6FD 2IQAA 4Y88A 5CGMA 4XB8A 2FX9H 4JO4H 4FFVD 4DW2L 3C5ZC 5FCUL 3VDBA 1JNHA 1I3GH 3J7HA 4M8QA 4LSVL 4YUEL 1RK0A 1XGRB 4ODHH 3SDYH 1U8KB 4JY4B 3BRFA 4AEHH 2HRPL 3HG1D 4K94H 3V6OC 2Q7YA 1M7IA 5K59F 3SDXB 2X1OA 4K9EC 3N1MC 1N8ZA 4DUWA 3ZTNL 2WSKA 4EJ1C 2XG5A 4IDLA 4Z6AT 2R15A 4U2ZA 1GZQB 1GGIL 3A6CH 4XMKL 4E0RA 3X14A 1MNUL 3HNTH 1DQDH 2QQKH 2MSPA 4YHOH 1XGQB 1PKQB 4R8WL 1ROWA 3QUZD 4X7SH 1LE9B 4HHAA 1OAUH 5D1QB 3O6KH 1LD9A 2DL2A 1S7RA 1ULVA 1I85C 1UH3A 3KPQB 2V7NA 3MYJA 4MLSA 3MRPA 2Y06L 5DA4A 4RAHA 4FQ2L 5C0CE 4GOSA 4JB9L 5C0JB 3WCYA 4OCWL 1LVEA 1QNZH 4S1DC 2QADC 5DJ6B 3KGRA 5H37H 5HI3D 2GJ6E 2MQ0A 4LGPB 3GJFA 1G9NL 3DTXA 1R3JB 4M5YH 1FZJA 3UTQA 1RURL 3WO3B 1H3GA 4KI5D 3PWLA 1OAXL 3G6JB 4F7TB 3DGCR 4WTZG 5CIPH 5GGQL 1CT8A 2NY2C 4LSRL 1VERA 4Q9QH 3QDGE 2D7OA 1CXEA 5FV1L 3V8CA 4NKOB 4O00A 4LSPL 5IFAH 2BMKA 4Z7NF 1W0YT 4O02L 4GXUM 3GMMA 1AD9A 1AP2A 3OB0H 4WI7A 5C86A 5J11B 3OKLB 5I15H 3LH2H 4HK0A 3O6FA 2PXYC 4POUB 2XQBL 3DUSA 3IAPA 1U3HA 4U6VL 5B39A 4V2BA 1EHNA 3VXPB 1XGUA 5HVWA 1H0DB 1S7UB 3BKCL 5FYJH 3B6SA 2CDFB 1JPSL 1QRNE 4HUNB 1NGQH 4K2UL 4J2XA 2YXMA 3RGVB 1AIFB 3FB7B 2WUBL 3KDMB 3FN0L 4J4PD 1MCNA 5F72S 4LLQB 3MOBH 4I48B 5C9KA 2J4WH 5D96C 4B41A 3KNBA 2X4NB 1QFWH 5EN2B 5J7CC 4PP2A 4U1NA 4FQIL 4YDLC 2AP2A 1LK3L 2VN7A 3BO8B 3LMJH 3PV6A 1S9KC 3O3BB 5E6YA 1QO3A 3O2WH 2ZUTA 5D7JD 3I02A 8CGTA 5E1AB 4NKDB 4A6YL 3GSOA 4FZEL 3I2CH 4UIMA 2ARWA 1UWEH 3QP3A 4OQ1A 4P23C 4HWEL 4KJQC 1OGTB 1OARL 4YGVA 3SBWA 4KVNH 3F12B 4G8EB 3QUMA 3RVUC 4HULB 3IYLW 5C0NC 1VKXB 3IJHA 3QIWD 2AJXL 4M4RA 1D6VL 4IRJB 3VFMB 2EICA 2WANA 4N8CL 2JJTA 1A9EA 4J1UA 1N4XH 4JM2A 4NBXB 1MH5A 3GB7B 2GSIA 4L4TA 1BVZA 4PGCB 4P5TD 1LP9A 1V8HA 2DQIL 3I6GA 5LXGL 1ZVYA 1JMZA 2D7PA 2ITCA 4LBEA 5I1HH 4W70A 3TF7C 3SKMA 4GXVH 2A0LC 4WO4D 1IEBB 3EYQC 2JIXD 3L5JA 4MA3B 3GM8A 4NUGL 1CGWA 3LRHA 4H5SA 2K7PA 1KEGL 1Z0MA 1KV3A 3MRRB 1AY1L 2ESVA 3DVGA 3QDHA 3BQUD 4BZYA 4Z7WB 3BD3A 4WFGD 3P73A 1YJDC 4WU7A 2NY5L 4HGWB 3FCTA 5HHOD 2V5YA 5DD1H 1L0YA 4WFHE 3RHWK 1EO8L 5FYKH 5D7LA 1CF8H 4YX2L 4X4ME 3DI3B 2ATKB 5GISH 3S4SG 4HUXB 2VABB 1DLHA 4U1HB 3UC0L 1HCFX 3OKKA 4OCSL 1ZMYA 1VA9A 3OKYA 2DBLH 4FTVB 1QSVA 1A6PA 4KKAD 1G7HA 5IFJB 3S88L 4QRPE 2HLFC 3U36B 2QQNH 1OT2A 5EIIA 1NCTA 4J7RA 4X6DA 4M1GH 1MHPH 1A3RH 1OTSC 5GQBA 4F57H 1A0QL 1NGPH 1XF5A 1WTGT 3VI4E 1JNNL 2MWCA 3RZCC 4WCYH 2JB5H 2NYYC 3CCHB 3RY6C 3QI9B 3IDMB 1T1XA 1GGCL 1YNTA 1GPOH 4IBLT 5TPWH 2BFVH 2GQHA 1IM3A 3RWIA 3H0TB 3NFSH 5KVEH 4YHYC 5JHDE 3Q1SH 2PTUA 1QRND 3BWAA 2Z31A 1D5IH 2BRQA 3KJ6L 3IT8D 1WAAE 3IXTA 3WHE0 4Z8FH 3QEQA 2CDEB 3DXAE 3W39A 3HMXL 4MVBC 5JXEC 1UXWA 3VFGH 2V17H 4MLIA 1MPAL 2MHAA 4PJ9A 2Y36L 2HVKB 3PHQA 4S11A 3NIDF 3VXRB 4NQUA 3BRDA 4C54A 5IOPA 4KKBD 1I7ZA 2NXYB 3FQXB 3DX8B 1M4KA 5BRZD 4GRMB 5EIVA 5C7XH 1TZHA 1WTLA 3E2HC 3PWVA 3AM8A 2A73A 3CVIL 1YUHB 3DRQB 3F7VB 5JQ6H 2C9AA 3REVA 1K2DB 4JG0H 4UQ3A 4GH7B 4Y5VC 3S36X 3SGKC 1J1PL 4GKNB 3MBEC 3RKDC 2R2BB 1MQ8A 3BEWA 5I1EH 1DQQB 1INQB 3MV01 1MWAL 4MB5A 4YC2B 2IALB 2VDRL 4HJGA 3WEXA 5EOTA 5L0QC 3TJEH 2EO9A 3U7YL 1HNGA 3ALWA 3EOBB 1FCCA 1YEDA 1NDMB 1ZEAL 4ZUUA 2ZSVB 2IFFH 3UEZA 3OQ3B 5CSZB 2WK2A 4XNUL 3HNSL 2YEZB 5FECB 2BJML 4NQVA 1DQJA 3BRGC 1CBVH 1JF1B 4QYOA 4N68A 1GL4B 4XP9H 4AT6B 1GOHA 1Q9WB 5SWQB 4IRSB 4LNRB 3G6AA 1AC6A 4PG9B 1C7SA 4Z76A 4J6RH 2Q76B 3VXUA 1NLDL 2X40A 4XT1C 1E0OB 5H37G 4FABL 2DQGL 3X11B 5JMRA 1HNFA 1EA9C 2C1PA 3BYYA 3ES6A 4MXWL 4WFHD 1G9NC 1NLBH 4AEEA 5JNYA 2X4PB 4MNHB 5MHSE 1JBJA 4JDTL 5IK3A 4XH2B 5AZ2L 2XTJE 1F42A 5F1NA 1FG2B 2A1WH 2W0PA 1KELH 4R2GD 4A6YA 4MA8H 1S7XA 4XCNA 3O9WB 4JFDA 5D7IF 1Z9OA 1Q72H 1DBJH 3BKMH 4XPFL 2ATPA 1DDHB 3LEYH 3EFFA 8FABB 4TVPE 2LV4A 4P4KD 3PNWA 3H9HA 2NLJB 4K23H 4S0TD 3ARUA 2P8MA 3JWOH 3EAKA 3SKOA 5JMOC 1A2YB 4DCQA 1ZA3B 3Q0HA 4ZTOL 2AKRB 3BGFC 3P4MA 3AREC 4OZFB 5DJXB 4MD5A 1BP3B 3O8XB 3G5XB 3BGAA 4TQEH 4LLYA 3HG1A 4BFEA 4X6EA 4M7KL 4NKIL 1YEIL 4LSUH 5J4MA 3CH1B 2F58H 1I9IL 1MRDL 3P9LA 1DCLA 3KLDA 2H8PA 2PW1A 4ODSL 4I4WA 2EDFA 3R0MA 3GMQB 5KTEL 2EH8L 3QXVA 4S1QL 3S97C 4ELMA 3BSZH 4NNXA 1TETH 4NN5B 1M6OA 4N90D 2VLJB 4ZPTA 4EUPA 5T5NF 3QUZA 3SE8H 2NW3B 2XFXB 1I1RA 5C07E 3L5IA 3MTRA 5ITBL 2IAMB 1VPOH 5GGSY 3RWCA 4HJJL 2FZ3A 2X4TA 1K6QL 3C5ZB 2D0HA 4WFEE 4WHYG 2AJYL 2JJVA 3FQUB 4KROB 3SDCD 3SDAD 4PRNA 1T20B 1S9WB 3X13B 1FNFA 1FP5A 4QOKE 2VC2L 3CZJA 1SY6H 2BSSA 4OLUL 4AIZA 2Z92B 5DQ9A 1ZLUH 3R4DA 3G6DH 1G6RB 1JV5A 1J0IA 3D25B 1DL7L 2XIDA 3F5WA 4UT7H 1XIWD 1OB1B 2DN7A 1AJ7L 1X5LA 1AGEA 5IBTL 4MXQD 2I5YH 5D71H 1C1EL 2A83A 2CUIA 1I8KB 3T2OA 3W2DH 1N6UA 1A14H 4RBPH 5HYSB 1U8HA 3EO9L 2IADB 3OKEB 35C8H 4BFIB 1MCLA 3CSBA 3B5HA 4FQPA 3TBVB 1RZJL 5JDSA 4DN4H 4AK1A 4WIQA 4K3DL 5GSRA 2LAAA 1U91A 1JNHB 2VLRB 4ZXBC 4ENEC 4M8QB 1CLOH 2C7UA 1S7TB 1C5CL 1IJ9A 1P9MA 4J4PA 4XCEA 2GJZA 2W60A 4P99A 4NQCD 4NWUL 3GMRB 3HMXA 1B0GB 2QADB 3KVQA 4X7EC 3T0XA 1UA6H 1Z9SA 5ELIA 3GJFK 3ARXA 3GI9H 5MHSD 4G80B 2DJSA 4OCXH 1XAUA 5EBMA 4GW1B 2NY6C 5D7JA 4LEOB 1NEUA 5E8OA 1N5AA 1AXIB 5I18H 1KLGB 5B38A 4UDTA 3MCG1 3SQOH 3QXDB 4WTXA 2WQRA 4I2XB 1MSPA 1O5DT 5E0QA 2DIJA 2R4RL 4K55A 4HXAL 5F1IB 1TENA 4S2SA 1U9KA 3AAZB 3VW3L 1BJ1H 3QO1B 5T1DL 3QZWG 5E9DE 3QIWA 2Y07H 3TNMA 3U9UA 4JQIL 3BZEA 4M02A 4WW2C 3CFEA 4R6UA 1CICD 3LEXA 3MV8B 2FB4H 1DEDA 4P5TA 2FX8H 2V7NB