1MIEH

Crystal structure of the fab fragment of esterolytic antibody ms5-393
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
213
structure length
191
Chain Sequence
QQPGAELVKPGASVKLSCWINWVKQRPGQGLEWIGNVYPGSSSTNYNEKFKNKATLTVDTSSSTAYMQLSSLTSDDSAFYYCVRPYWGQGTLVTVSAAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN MS5-393
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 37
structure length 191
sequence length 213
ec nomenclature
pdb deposition date 2002-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mieH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mieH02
4OCLC 2QADB 2DICA 4WY7L 1KB9K 1CF8L 1T1YB 2C3WA 5J7CC 5GRVK 2UVFA 5LWYL 1JI1A 1X7QA 2DMCA 5I73C 1URLA 3MRDA 1AHWB 1F8TL 4DEPB 3LIZL 1LK2B 5I1EH 4KKLC 3P0YH 5E8EB 4L9LA 1SYVB 2NY1C 4MYWB 3TIDA 4JG1L 4NWTH 1BFOB 3DI2B 5F7MC 3CCHA 1B0GA 3UTOA 4DN3H 4ZSOB 1G6VK 5FOJA 2OL3L 1YUHA 2BDNL 1W0VA 2PTTA 3GRWH 5I1IL 3BH8A 3A6OA 4P5TC 4NM8L 1ZOXA 4Z7WF 3RTQC 2IFFH 4GRLC 2YZ1A 3NZHH 4OQTH 1QR1B 1PLGL 4R3SB 4MA1C 1P7KB 2HJLB 3IDMB 2VAAA 3S88H 1CE1H 1DLHA 1K6QL 2BNUA 4PJXA 2R8SH 2IQ9L 1G7HA 2BXYA 4NCC2 4FQ1L 1B6DA 1U8HB 2ITDB 3SO3C 1JUFB 3D5OF 2PO6D 1RHFA 4N1HB 1ZT7A 4ELKB 2ED9A 3RIFK 4XNYL 4Y4FA 1MQKL 3MRMB 3JVGC 4MNHA 1IFHH 4KJPC 4WO4C 3TO4C 4PV8B 3SQBA 4KPHL 2VXSH 5GGTH 1KCUL 2DB8A 4KI5C 2XNAB 3W5MA 4RBPH 4OLYH 4LSRH 1WT5C 3JWOH 4RMVA 1BAFH 5MENB 2VE6A 3ULVH 1DBKH 2XA3A 1IM9A 3DSFL 5F44A 3PDGA 3WYRA 5IBUB 1YZZA 5JUEH 3G6AA 4EI6B 4XC1L 1BGXL 3H7BA 1OTSC 4OD1L 4ZAKC 1BLNA 1UCBL 3LMJH 1UB6A 2VABA 1HSAA 2GTWA 3DX7B 2I60H 3OV6A 2D0FA 1J88A 5MI0C 2E9BA 2XTJB 4W4NA 3L5WA 5FA3A 5DEGA 3IJYB 2EDTA 4HJJL 3U9UB 2GSGA 4P46C 1A1NA 2R23A 1KJ2B 1NGXA 3Q5OA 4S1DC 5AZ2L 2XKUA 1N5YH 1U8LA 2ED7A 4ODHL 4I0PC 4Y4KA 4ZD3H 1IGFH 1E4WH 4IMKC 1HIML 1FSKB 5I1GL 2J5LB 2E7HA 5JPNA 4KDWA 2CXGA 1ZLVH 1YMME 3QQ3B 4LASL 2ARWA 1RUKL 5IGXH 4OLEA 2FZ3B 4M43L 1N6QH 5FGCE 4PJFA 4MNGB 3SKNB 4XCCH 1G6RL 3VD5A 1I8IB 4MA7L 2DQDH 4ZUWB 4AT6A 1T80A 5H35A 3LKNA 1L0QA 3VMNA 1NAMB 3FL7A 4XZUA 4D3CH 1WVZA 2HT4C 2ID5A 2GAZB 1OF2B 5I66A 5CBEA 5GQBA 5IFAH 1RZIB 2NMSA 4N8VG 4O58L 1BEYL 4HKBA 1JI2A 2APXA 4PJIF 1N5AA 2XZZA 3O3DA 5MEPB 3QO0B 1WFOA 5HHPB 5TGBB 4AQOA 5E6ID 4FFYL 5SWSD 5DEFB 5F3HB 4YR6A 4FXKB 1HHGB 4OGAC 1HKLL 1MEXH 1VESA 5HGAA 1QPPA 2V7NA 3SEPA 1UQSB 3MV7B 4GBXC 4HKZB 4B5EA 4DUWA 4D0CA 5ETUB 2P48B 4JM4H 1DVFC 5JA8B 1MFNA 2W65A 3EZ8A 3QEGH 1WZ1H 2OM5A 4GW5B 1NFDA 3LPWA 4G9FB 5ITBH 2Q3ZA 4JFEA 2DD8H 4P3WA 4HBCH 4LHUA 3A67H 1GRWA 2AJVL 5DD6A 5CGYC 2OZ4L 2OQJB 3RWGA 4BSJA 2FH6A 1J87A 1HINL 3I2CL 2P4AB 3HPLA 2Y6SD 5GHWH 5DJ0B 5EPMB 4X6DB 3MV9A 1YPZB 4HQQH 2AAVA 4JKKA 3TA3C 5EBLA 1WBYA 1RK1A 3ZDXE 4RAUA 2X4UB 1FNAA 1WCQA 1FV1B 3H42H 1X5ZA 4UDUA 5D2LB 3AU1B 5IVZA 4RMUA 1GPOH 3C8DA 4HC1A 3EKCA 3UYPA 5EZJB 1P7HL 1CGVA 2BMKA 3B9VA 1FBIL 4FZ8L 1MFEL 3C9NB 1IILE 3S3PA 4BK4A 5CMAB 3FCTB 4YXHL 1R3LA 2FHFA 5KVMC 3H2WA 1NMCB 1Y18A 3ULUL 5AZEH 4PRDB 5FV2A 5DGRA 4ERSL 1TJIH 3MUGB 4PJ8A 3WFDH 3WDIA 5HYQB 3GSNB 4Y1AB 5K9KB 2VDMH 2QSVA 4DWHA 5DUML 4MXVE 2R1YA 1VERA 4GOSA 4KU1A 2B20A 2NY4B 4WEUD 5IW3A 1XGTB 1PAMA 5L0QC 3GIZL 1KLUB 2DWDA 2QQKL 5ICZB 1C7TA 1BBJB 4NZUH 4YFEA 4Y4FD 5JO5A 1H3TA 1JNHB 4LQFH 3WO4C 1D9KB 3QCTL 2NNAA 4M5ZL 3VWKB 2BNQB 3FO2B 2WP3T 1BFVL 1NCWH 2AJZA 3WJJC 4XNMB 1UB5A 2DMBA 4FQHB 1X9QA 2EYRA 3ARFB 3FOMB 1QUNA 4BZ1H 2AKRB 1IM9D 5I76B 3HS0B 5CD5D 3MYJA 3M8OH 4U6VH 4AM0A 1HKFA 1F4YL 5IEHB 2I5YH 3SDXB 2XZCL 3C08H 4PJFE 4CADB 5I1DA 3MLZH 4LARH 4FTVB 4C57C 5KANG 3G5XA 1UH4A 2HJFA 1ZVHA 4E0RB 2B5IC 3CX5K 4P5KB 1J0IA 1LEGA 2PUQT 3RY6C 1J1XL 5DHVH 4P5MB 4AEHL 1YN6A 3MLWH 4K8RC 2BJMH 1TZGL 1MIML 1XF3A 4RISL 1NGZB 3B9AA 3QNZB 4QY8B 3AB0B 5D1QC 4O9HL 3HLAA 2JJTA 3RVWD 3WN5B 3WUWG 5I30H 4J3TA 5FM5O 5JIPA 1G7LA 3IF1B 1ZS8A 4PJEA 1W72L 5D6CB 2GK0B 4HZAA 5L2KA 2XG5A 5HI4C 4MWFB 4X9GA 1MJJA 4OKDA 3VFOA 1JZ5A 3PHSA 2Z8RA 3OWEA 2CUHA 4LCCB 3WKMH 2XWJB 1KG0A 5D1ZB 3QUML 2Q8BH 1XIWC 4WRLA 2FECL 4DCQB 3GEWB 1D5IH 1CGSH 1A9BA 4LCIL 2R4SH 4M4RA 2OR9H 2NTFA 1VGKA 3G9AB 1F6LL 4ISVA 3VGAB 4EBQH 2HFEA 5I9QB 1X5YA 5FGSA 4WV1B 1CL7H 2DYPB 2JIXD 3AY4A 5BOPA 1G7MA 3MC0A 4FFVC 3QH3B 1U3HC 1JHLH 1EJOH 3JTSA 3KJ4C 1C7SA 4DFHA 3PP3K 1J05A 2CKBL 4C4KT 4JN2A 3DRTB 4NO2A 4ZXBC 4EUPG 1UM4L 3B4NA 4JFED 1X5FA 4IJ3B 4LHUD 3LVEA 3GJEA 1AGDA 2A38A 3HRZB 4XHJD 4JO1H 2XZAL 5DHXB 3DXAD 5FO7B 4G6JL 4HJ0C 3EYFB 1B2WL 4A6YA 1BBDL 5C9KA 3FQRA 4YDJA 3QEUA 3OKDB 1NJ9A 4M7JH 4YX2L 5D7SL 2OTWB 3MV9D 3LS4L 2X4QA 3T2OA 3T0EC 2W91A 4DGYL 3CVHH 4RRPG 4JFOA 1U2CA 1S9KC 5EO0B 4L8CB 2NXZC 5DD3H 3EO1A 1MUJA 5JA9A 1XF2A 2W0PA 4GW4A 4Q9RH 2NR6C 4KAQL 1NEUA 3BJLA 2BSRA 2UZIL 2D7QA 4EDXA 5KSUA 1KSRA 1QSZA 2J4WH 3TCLB 3D0LB 3KPSB 3X11A 1MCIA 3NGBB 2ESVB 1S7TA 4G8GA 4PJ8D 4G7YH 1Q38A 4XNUL 3T8XB 4Z18A 3GRWA 5F9WC 3GNMH 5E94A 5E0QA 1UEYA 1AGFA 4DVBB 3IDXL 4R4NC 4BJLA 2EDBA 3DPBA 5C08E 4I3RH 5DK3A 4UTAL 1FFOB 4QGTA 4BUHA 3DO3A 2G9HA 2IAMC 5DEZA 2X4TA 3HRPA 3UTZA 1CFVH 3L3KB 1JGLL 7FABL 4K23H 4PJAF 4LSUL 1G7JA 5F9OH 3R8QA 3HB3D 4J6RH 3D25B 5I73B 5DD5H 4XMPL 4GG6F 4J1UB 1PJ9A 2X4PA 1P9MC 1J8KA 5EUOF 5A40E 2FATL 4QXGH 2NY1B 3UBXB 2DRUA 3BX7C 1QVOA 1S78D 1K8IA 4NRXB 4HZLA 3FRUA 5HDBF 5I8CB 4P23A 2F5AH 5C0FB 3IFOB 4DAGL 5DJ6A 4PJEE 4IIQC 2X09A 2Y4SA 4GUPA 5A3IC 3KPNA 1CIDA 3CSYB 2UUDK 5L2KE 1L7TH 5D7JB 2OSLB 25C8H 4GRLB 1MVUB 3AREC 4Z0XA 4JRXB 5F89B 1IL1B 2XKSA 2DDQH 3QHFL 32C2A 5F7UA 1N7MH 4NO3B 2OTUA 4G80A 3VI4F 1OLLA 4IMLA 2F54B 3X14B 4HIJA 1KT2A 4MNQD 4LLDB 3ILQD 5HHVH 2W9DL 3MNZA 1FZOA 3O81A 4OZGE 3SKOA 2ZNXA 3ARDA 3Q2CA 1A1OA 3TPUB 1NCDH 4JFQA 5FOBA 5IVXB 5KSAA 4Z7OF 5AYQA 2MSPA 3GHEL 4ONFH 1DUYA 1QPXA 4WFGE 3O9WC 1FAIH 3VGFA 5DJ8A 4NWUH 1BVZA 3EDJA 4YDVA 2BC4A 3QCVH 5L2KD 4OJFH 3STLA 2EE2A 2P46B 2ATPB 4LSVH 3LPGA 3SKUD 3MX0A 4XGZA 4GMSH 1ODAA 3PWPA 3EYOB 3IDJB 2Z91B 3RA7H 1IAMA 4JO3L 4K7PY 1TNMA 4QWWD 4OV5B 5GZOC 4ZAKB 5IEKB 5TF0A 5HDQL 1I3RA 5IB3A 1DBJL 3DRQA 3RWCB 1ACZA 3TT1H 5LCVH 2HT3D 3I3BA 3QG7L 1VDGA 1WIPA 3BD5A 1YDPA 4OZHF 3L3HA 4P46B 5BV7H 5K9OB 2RB8A 1QFWI 3DUUB 4QHLA 3SPVA 4JDZA 4CU6A 1QA9A 5EOCH 4NZTH 3LKSA 1C5DA 3DARA 1SBSH 4PR5A 5FUCC 5I8KL 2HVJB 1KBGH 4LCYA 1EA9C 3LRSA 3EYUL 1JWMA 2KL6A 3QI9A 1HWHB 4M7ZB 4OLWL 1G9ML 5DHYA 4NKIL 3DO7B 2I24N 2DM2A 3UAJD 1FRGL 3IAQA 2A6KA 4K7PL 4G8GE 1NC2B 3TO2B 5AUMA 1DUZA 3NFSL 4HIHA 1TVBA 4WFFD 5GGRY 1V3KA 3JV4A 4N0YH 2E8ZA 5E1AA 3WV0A 1WAAA 2F8VA 1P5UA 2CR6A 5MEOA 4RWHA 5ICXA 4PGZA 1M7XA 1D6VH 3REWA 3SY0A 4HEPG 3RZCC 2L7JA 1NBZA 1G9NH 1KFAL 3UJJH 1R5WA 5D5MF 3ULUC 1P6FA 3O8XA 1GGIH 4QRTB 4JFHE 1YQ2A 1DVFB 1H3UA 3GSQA 3RKDD 4G8GD 5GISH 4UT6H 3KPRB 1JGUL 4F7CA 5FCUH 3CVIL 4JPVH 2JELH 3RAJH 3ULVF 2VR9A 4PJ7A 1MREH 3BPLC 2QR0B 1FYTB 2O61A 2ZUQC 1FC2D 1B90A 3HE7B 3QHTC 4RIRB 3ALPA 1IKNA 2IQAA 1F6AB 3VFSA 5GSRB 3T04D 3VFNB 4FQLL 1IEBA 1X44A 1BFSA 4RZCA 4POUB 4PJ5D 4JFHD 5HHNA 4D9QE 1S5IL 2Y72A 2QQQA 3TA3B 4MD4A 2W38A 1MI5E 1NMBH 1H0DB 4OF3A 2AJ3A 4BZYA 4JFYB 1L9MA 1EEUA 4XC3L 2M2DA 2E3VA 4GKZA 3VFTB 5KSBF 2Y36L 3BP7B 1DANU 5EULV 1LDPH 3FT2A 3MA9L 4AK1A 4WI3A 4PJ9C 2DWEA 2VWEE 3ARGC 4KK9C 1F90H 3U7WH 1D5BB 1ADQH 3ULVD 4PJDF 1LO2L 4XP5L 4UIKL 3W39A 3PWPE 1ZHBB 1T7XA 4PG9A 1AH1A 3PNWA 1ZSDA 3CDGB 2YBRA 3IAGC 4MLIA 1SY6A 1YEKH 2VO5A 3ARDD 4ONGL 1T2JA 3C5SA 4JFFA 5L0QB 3IU4H 3OB0K 5KSAD 1INDH 1XFPA 5DHVA 3BPNC 5EORH 5B8CA 1U92B 2Q7YA 4X8JB 2FO4A 5AAMA 5IOPB 3QWRA 4RWYH 2PXYC 5KZCB 1EAJA 3QNYA 3VXTA 1G7PA 4AEIL 4RGNE 3WCYA 1RFDH 3QIWC 4XPTH 4PLKD 1MFDL 4XB7A 3HMXL 3PWPD 4OD3L 3MUZ1 1A14L 3BN9C 3VFMB 3DYPA 3RDTA 1KB5B 1HXYA 3QPQD 5DURD 1K3ZA 1TCRB 1R3JA 3P9LB 4KKNA 2P8MA 4G5ZH 4TPRH 1FZKB 5CCKH 3WNKA 2V5TA 1NCAL 1MJ7H 1ORSB 2EKSB 2VLLA 3E8UH 1HNGA 2B5IB 1IMHC 3ARSA 1I3VA 1P69B 2FGZA 2WBWB 3H9HA 2H8PA 3LN4B 2WBKA 4RGND 1WICA 2YA2A 3O6FA 1A4JA 3Q5TA 4PD4J 3KNBA 5D1QB 5JPMB 8FABA 1WAAE 4Q9QH 4UQ2A 5EOTA 5IMKA 3UTSB 1IEHA 1YEGL 1F2XK 3D9AH 5ADOH 5DRNB 1WJ3A 4JREC 1T1ZA 1QYGL 4H8WL 4XAKE 5HHQA 4OCYL 3CFEB 4MA8L 3MNVB 3V5KB 3QI9D 3TH4T 1YMHB 3BKJH 1T66C 3CFCH 3QQ4A 4NUJA 1A5FH 4JJHA 5E9DA 3K80A 3OX8B 4LP4A 3O2VH 5KVDL 1LD9A 1UYWL 1NCNA 5I18L 2ADGA 2C9AA 1XIWB 1C12A 2PF6A 4F8TA 4LLQB 1R3HA 1SEQH 5J1AB 5CINL 3IFLH 4PJ7E 1T04B 2Y5TA 3F6LA 5M7QA 1HHIB 1RVFH 3LS5H 3MJ7B 3VXOB 4E42B 3HAEG 5DMGC 2ZZUT 4QTIH 3F58H 5FUZH 4EZMA 2BY2A 1CT8B 5C71A 4NCC1 3CLEL 4P4KC 3CVHA 3O8XD 3DMMC 4Y8AA 3CUPB 3D48R 3KJ4B 5EIIB 1FO0A 4UUJA 3T3ME 2ZCKL 1U8QB 4JDVA 2CIIB 4RSVA 2ORBH 3D69B 3IKCB 2P5EB 5HI3C 2ZSWB 4ZXBB 3GBLA 4MJIA 3RHWK 4YHIB 1YEIH 2HKHH 1IGCH 3DX9B 5KG9A 3P4MB 4IS6B 3FQNA 3N1GC 3VXQB 4KFZC 2HYMA 2OP4H 4XT1C 3S36L 2DIBA 3QQ9C 2YKLH 1FZMB 4YH6A 4JFDA 3HHRB 2BFVH 2EC9U 3MCLH 5GRZA 2GITA 4Z5RA 1T21A 2HLAB 3T0EB 5L9DH 4L8DB 3ZKND 1FYHB 1Q9LB 1Q9OA 4LEXL 2OL3B 4CW1A 4HG4J 3OGCA 1CG9B 4JFFE 2NXZB 4M48H 4U49A 3NCFB 1EEQA 4NRZA 3ZZ1A 1ZHNB 4HXBL 4ODWA 5ALCL 4IOFD 4NOBA 3KLAA 5E8NB 4AIZA 4HKXA 5K9QG 4I48B 1II4E 2X41A 1ZE3C 2ICWI 4HS6A 2VLRB 4MD5A 1YQVH 3QXUA 1QSFA 2IEPA 5CZXC 5FDYA 2A6IB 3SJVA 3VDAA 4PB9L 5INCB 5ID0B 5J6GA 5F9WB 2EDWA 2DLTA 2FYYA 5TDNB 1OCWL 1CQYA 2YA1A 1UACH 3O6ML 1ES0A 3KPOA 3NN8B 1EHAA 1JNJA 4U1SA 4JFFD 4N68A 1S7SB 1AI1H 3BZFB 1LDSA 3KYNA 4K71C 4CUCA 2IAMB 2XWBB 4I77L 1KIPA 3GFUA 4S1RL 4YHKL 5CLWA 2VAJA 4M1GH 2PYEB 2VN7A 2QJDA 4X7SL 4BM7A 1J1PH 3EO0B 5FDWA 3QWRD 4LLVA 3RWJA 2VIRB 1KPVA 4KKAC 4XNXH 1R3IL 4LLUA 5IBLD 4IDJH 5D2NB 2YPVH 1HSBA 4N9OB 3DNKA 2E7LC 4IRZH 1RU9L 4X5LA 3DBXA 4R6UA 5HYFA 2IBZX 3BEWB 1QEWB 3CDCA 1JJUA 1UH3A 5ECJE 5C92A 1CD8A 1IC4H 3ARBA 2XPGB 4IIQB 1XCQA 3RNQA 3NTCL 3RUGB 1MCPL 1A4KA 1V7NL 5DJCB 5GRWA 3AREB 4NQDB 3RVXD 1J18A 1EHLH 4PUBH 3RL1B 4R90L 2CQVA 3E2HC 3IDGA 5E9DE 1GAFL 5IHBA 1UZ8B 3OKEA 3BZEB 3K8LA 4OZFH 5IW1A 5BVPH 3O6FD 1NBYB 3FOLA 3X3FH 4KV5E 3BGFC 3UTPE 4JHWH 4O2CB 1OP3K 1JZ6A 5F93C 1E4JA 1UADC 3IXTA 1YA5A 5JMRA 4DKDC 4P2RB 1B0WA 4X9FA 1A02N 3AM8C 1MHCA 1G6RB 5KBNC 2MPAL 3I9GH 3O9WB 4C58B 1R5IA 1U8MA 1ZT1A 3C6LC 3IS1X 3IU3B 3UP1A 2H3NB 3MRJA 1KN2L 2MQ0A 3INUH 2RAMA 3PWJA 3FN0H 4GRWE 3MMEB 4KTDH 4TSAL 5E9DD 3GSVA 2DTML 3A6BH 4UNUA 3F6IA 3ZTJH 4MJIE 1GXEA 3O6LL 2YRZA 4MCZA 1Q94A 3MRNB 3T0XA 4TSBL 4I18C 3UTTE 4HK0A 1UXSA 1S8DA 3P73A 4FZEL 2Z93A 5TH2A 2R0WH 5FYLH 5DZOA 3VGDA 3ARWA 2NY3D 1UXWA 3LV3A 3IGAA 4UTBH 5JHDA 5KSVB 1AIFA 3VA6A 1S7QA 1IGIL 2BVOA 1HILB 3GSRA 3H7LA 3HMWH 4YHZL 1RUPH 4V1DA 4GKNB 4NQCB 4JY6A 5E6ZA 4ZUVA 3BP4A 5JW3L 5DC4B 3QUYB 5EU5B 3PJSA 1AC0A 5TE7H 4GKSA 3FFCA 3LKPB 4FFWD 4OKVA 3LB6D 4ZUSA 3QUKA 5LGHL 3TZVC 4KK8C 4NQVA 3MXVL 2H45A 3OKMA 3G5ZB 2EO9A 4LOUD 3STZA 3CXDL 4JFDD 3SJVE 1J5OH 2IMMA 3NIFE 3U7YL 1DQDH 4MZ3A 3U1SL 2ZUWA 3KXFA 1QFOA 5EN2B 3QWOA 3BT2L 3FFDB 5EDXA 2EYTB 1TQBC 3GSWB 3MLSH 1FHGA 3QEQA 2WUBL 3VXSA 2VXQH 4S1SH 3LSOB 1OW0C 3QIUB 4XCEB 1RIUH 3RGHA 5IW6A 3RZCB 1ZMYA 4OF8A 1AD0B 5CWSA 4QRSB 4YO0A 5EBWA 4KZEH 1T22B 1S9VA 3Q3GB 3UC0L 1EGJA 1T3FA 3PWUB 3KG5A 1QSFD 3V95A 2ZKHH 1FL6B 5KW9L 1OY3B 3SJVD 3ZE0F 1INQA 3K0WA 4LCWB 1L0YA 4ZQKA 4P59H 4BH8A 4GAJL 2IALA 4UV4H 3RWHB 2XKNB 5C0AA 3VRIA 3L3IA 2DL9A 3TBWA 3TFKC 2HFGH 3M07A 4Z7QE 4HWZA 1I7TA 1F5WA 5I16B 1LO3H 1ADQA 2X1WL 4B41A 1SJVA 3BPLB 1JPTH 2PTVA 3MTRA 3H6JA 3BUYA 2ZUQB 5K93A 4P4RA 1JGEB 5KVFL 4LRIC 2NY6D 3SDYL 3NOIA 4HIXH 1I7UB 5DMIL 1JIBA 3GMRA 5ENWB 4G6KL 3NABH 4XVJH 4TUOA 4BZ2L 3HNTH 2G60H 1G7IA 2AV7B 1RUQL 1JYVA 3NA9L 3BPOB 3QIBA 2DBLH 3KS0J 1VFUA 5FM5M 3RGVB 3V6FB 5C07B 1I7RB 4QLRA 1NAKL 4TNVF 3G04A 5DTFA 4EUPB 1CDBA 2RQ8A 5IHUL 3ARBD 4H88L 4B7IA 1I85A 1MCCA 4U3HA 3SQOL 2VLJD 3CFJA 3VCLB 4HC1L 4K7PX 3ZL4H 5JLZB 1JN6B 4PJ9B 1T5XB 1U6AH 3ARGB 3OJ2C 3X12A 2AEPH 4UT9H 4NC1C 4M6NH 2ILLA 4PJGB 1N8ZB 2ENSA 2H26A 1TNNA 3W9DB 5F7EL 3SDDA 1G7QB 1F3DH 1FGNH 5IM7B 3BESR 4NQEB 2RHEA 1DLFL 1ZA3A 4O4YH 5DQJB 1MCBA 1B6UA 1FVDA 1Q0XH 1MRCL 4HK3J 1QHPA 5AYUL 1A6WL 2YWZA 4L8SC 2VB5A 2Q8AL 5IB2A 4N90E 4W70A 1JZ3A 2GJ6B 1UVQB 4H8WC 4QOKB 2WIIA 2W92A 4WENB 1W72B 5F3BA 1IM3B 4F7PA 5C0ND 5BZDB 2PXYB 1VFAB 4QXTB 3ULSB 1P4IH 4R97C 2W07A 4PREB 5JHDE 2PW2A 1H3XA 1J11A 3QUMB 4UILL 3QIWB 4FNLH 3P9MA 3TT3H 4V1DE 3C5ZA 5JMOC 4PRBB 1M6OB 2NLJA 4LHUG 1E27A 3TN0A 3SDCD 4OLXL 3FFCE 3PWLB 4KUCD 1MIEH 4OCWH 2IF7A 3D39B 3T1FA 3HUJB 2DBJA 3L5XH 4AH2A 3DROB 1EO8H 1X5KA 2P43B 1OD7A 4WTZA 2IANB 4GG8B 5K33A 5L2JA 3G5YB 1U0QA 1TLKA 4LDLB 1NUFA 5JHDD 4EI5B 1FL5A 2CKBB 4IRSA 2Q6WA 2AVGA 3KXFE 4LLMB 3WSQH 2ZUSA 2V2XB 3E6HA 2DQGH 2O93L 1S7WB 2F74A 1OGAA 3QRGH 3VXSE 1U8PA 2WW8A 3DV6B 4N0FB 4X80L 2OYPA 3PWVB 3FFCD 1JRHL 4X6DF 1YPZF 4JY4A 4QGYA 5C8JB 1CLZL 2XWTB 2MKLC 1EDQA 1SJHB 1HH6B 2FX9L 2XRAH 4N0UA 1WFUA 5D2LF 5EBGA 3GHBH 1UFUA 5KTEL 4I2XA 3PGDB 2R39A 3FB6B 5LBSH 3RIAF 4LRNL 3I02A 4AY0A 4HUWB 1U93B 4FMKA 5I8EB 2ED8A 2A6JB 2Z9TA 1QNZL 4CVXA 4X7EC 3QA3A 2AJSH 4NOFA 5IF0A 4YFLI 3BMVA 4L1HA 4HGWA 3QEQD 3VXSD 1XCTA 5E6IC 5CEXA 3BH9A 1J8HB 4U1HA 4HXAL 4NM4H 4OFIA 3V4UL 4F80A 1MH5A 4F9LA 3MRPB 4CVZA 2DKSA 4P4KB 5C0RH 3CFBB 3DMMB 4A2MA 2EH7H 5J0BA 5IMLB 5F9AC 4M62H 4XCNA 2P49B 1NGWA 1GC1L 2H41A 5HI5D 3GO1L 4JZNB 4L29A 4HHAA 4KHTL 4PBXA 1JF5A 4LMQE 5ESVB 4S0SD 5MP6H 5C0AD 1OAQH 5DFVD 3T4AA 4KMQA 2BVYA 4HT1L 1F13A 5IB4A 4Y2DD 3U4EB 5E24E 4C83A 4Q2ZA 1GIGL 1LEKB 2DQCH 2FBOJ 4KHXL 4TOYL 2BY1A 2Y6SC 3RKPA 4UDTA 4A6YL 3CGTA 5DSCB 1ZTXH 3L1OL 4L3CB 5A2LH 3SDXF 4DW2L 5EZIH 4L9LC 4NDMB 4TUKH 2YUWA 3QIBD 5IQ7H 2R1WB 1MCLA 4XTRD 5CJQL 4PRIB 1GGCL 4NP4L 1K8DB 2V5MA 1A6TA 2UVEA 3W0WB 5TE4L 4EOWL 1X5AA 4MQ7B 3P0VL 4ZTPL 2XICA 5IG7A 3NCBB 1Y0LB 5CEZE 5GRJH 4U2ZA 4P49A 3GUTB 5MHSD 2VQ1A 5HDOA 4CKVX 3P0YL 2JK5B 3SDDD 4D9RD 3D0VB 4WW1B 4YHPB 4NWTL 4GT7A 3V0VB 3B9EA 4LSPH 4DN3L 3GMQB 1DQJA 4D0BA 3I50H 5C86A 2OJZH 3LQMA 1GZQB 5ICYA 3GRWL 1FH5H 5B3JF 3FTGA 2LABA 4K71B 3K1KC 3NZ8A 2P45B 4Y4FC 4CNIB 2FIKA 1LNUA 2IFFL 3NZHL 4OQTL 4F2MA 2WWKT 4MQTB 4OFVA 5D93B 1S7UB 2EH8H 4XX1E 3S88L 1CE1L 3ARYA 1OP9A 1RURH 3H9SD 1NBQA 2R8SL 3VFWA 3U4AA 4U1JB 1KIQB 4HGKC 1U2HA 3U48A 3C5ZD 1P4BH 4ELMA 1KYOK 1OGAE 3CDYA 4S2SA 2Z31D 3TN0D 5AD0A 15C8H 1EBPA 3VXRB 3KR3H 5CD5C 2BRRH 1JPST 1IFHL 2IC2A 3QXDA 2AGJH 5FKPA 3HPJA 1XF4B 5AWNH 1PKOA 1A7BA 2VXSL 5GGTL 1DEDA 5H94B 4OLYL 3ES6A 4LSRL 1UKTA 5MEQB 4QRUB 2LE9A 1I1FA 3E2HB 3JWOL 1BAFL 2ZG1A 4IRSD 5AAWA 3RBSA 3ULVL 1A7PH 1CDHA 5B4MD 1DBKL 3FB8A 3W11D 1ZV5A 1QFWM 2WSKA 3QNXA 1BX2B 5JUEL 3PQYA 3UXFA 5ADPH 2F15A 4PYGA 2YPLB 1OGAD 3LN9A 1DP0A 3HZYA 3RVWC 2JJVA 3MRBA 1BOGB 2X70A 3L5JA 3LMJL 3MCKB 5EH1A 3HR5A 1CFTB 4E41A 3MZTA 5JHLH 2I60L 3HZMB 2DQFA 2AEIT 2FECI 2WAHA 5FYJE 3C6LB 4O02H 3QT2A 4B50A 5J12B 2F53B 4OD2A 4WHCA 3VGGA 5T5FH 1ACYH 3KPTA 5E00A 1CXHA 1M7DB 1UJ3A 3RI5F 2PW1A 1N5YL 1AR2A 4ZD3L 1KF9B 1IGFL 3F7VA 1E4WL 4PGDB 4OI8A 3OAZK 3U36B 1FVEB 2J8OA 5C0GA 4X9IA 4TTDD 5DO2D 2RGSA 3O4LE 1CGXA 1C16A 1H5BA 1XF5A 5E7BA 5LXGH 5IGXL 4I18B 3MO1A 5A16B 1N6QL 1KLGA 4BFIA 3PGFH 4JKWA 1RJYB 5GS1A 35C8H 5HHOB 4XCCL 1VEMA 5DR5H 2DQDL 5IV2B 2D3VA 3TBVB 4R96A 1BD2A 3HA0A 4D3CL 4NKOA 3D1MC 1U8OB 5EBMA 3OKNB 3TGXA 1FVCA 5IFAL 2CKNA 4UB0H 3T65A 4R0LA 1A7OH 4LKXA 4X5WA 2P8PA 1IGTB 3I6LE 4XB8A 4J7RA 5I6XC 5I8OL 5KN5A 1D5MA 3PP3H 3ZYZA 5I1LB 3WLBA 2E7CA 3NPSC 5GGRB 1MCJA 1EEZA 4KROD 4XHJC 5LAXA 1MEXL 4WUUB 3RL2A 5DFWH 3CFDB 4LLWA 4X4MA 1D5XB 4HKJB 4OCRH 5IROA 4NQXB 1ZEAH 2K7PA 4WU5A 5D1XD 4N0RA 4JM4L 1QBBA 4YAQA 3L3JB 3RPIB 1HNFA 4S1QH 3QEGL 1WZ1L 2EDFA 1AKJB 4BSVB 5ITBL 3KYMA 2UYLB 4TRPH 3ORJA 2DD8L 5EZLA 2NW3B 4HBCL 3SCMB 4CN6A 3A67L 5FYJU 4GG6E 5FYKH 4X83A 1E4KA 3PHOA 3BZ4B 1CI5A 2KZWA 2Y7QB 3T0WA 1CDUA 5F7NC 2M26A 1CGYA 1KB9J 2GUOB 4ZODA 4POYA 1UM5H 4TYUA 5DK2B 3KPLB 4Y5VB 4XBGB 2NXYD 1RIHH 5GHWL 3WHE0 4FA8A 3ILPA 5BMFH 3TVMA 4HQQL 4D2NA 4N0CD 3JBG7 3CC5B 2BCKA 2DI8A 2D7OA 3ZT5A 5IVXF 1WBZB 4PJ8C 1ZT4B 3H42L 2HH0H 1GPOL 3VH8A 4AENB 3Q0HA 3ZDZE 3VI4E 2VDPH 1BM3H 3QHZH 5D9SA 3KYKH 1Y6NR 3EOAA 4KI5F 4J3UA 5GS3A 4LLAA 3FQTB 2R2BB 1VADB 5TDOA 3SGDH 3HAEB 1VKXB 5AZEL 4UBDD 3HB3C 1TJIL 2YD1A 3WFDL 4NGHH 4NYLB 2Z92A 1S7XB 2VDML 2XY1A 2HTKD 2NZ9D 4OLUH 5A2JH 3UMTA 2E7MA 1KPUB 3PQYE 2D31A 1S78C 2J8HA 3P11H 3V5DA 3MRRA 4PJDA 2Q86B 4NZUL 4X7TA 5IFJA 3NFNB 5JW5A 2YZ8A 4KJQD 4LQFL 2V7HA 4DZBB 3FQUB 1LEIA 1NEZA 3LEXA 4W6WB 2EZ0D 4FG6D 2GKIA 5F7KC 5GS2H 3FAWA 3SE4A 1F4AA 3BHBB 2YN5A 4J23A 1TJGH 1P4LB 4PJHA 1NCWL 5IT2H 2ICEB 3VGEA 5F70A 4NNXB 2A74B 4BZ1L 1CXEA 3ILQC 1RK0A 1WIOA 4PRPA 3E6FA 3M8OL 4L8SB 4U6VL 4HW6A 2BP3A 3PQYD 4LBEA 1EERB 1G0YR 6FABH 4HFUH 3C08L 1JHKH 2JJTC 2PO6B 3LOWA 4K7FB 2MCG1 3ZKSD 3OXRB 2D2OA 3MLZL 3ZYIA 4KUZH 4L8BB 4LARL 2W0KA 1A9EA 4LGRB 4LK4A 3SGKA 3WXVH 3DVNB 1WZKA 4E41D 4I3GA 1BD2E 1X3DA 4PTTB 2W0LA 3DTXB 4OM0H 3VE0B 4R97B 3MLWL 2BJML 4NZRH 5CJOH 4JJ5A 2VUOA 4EJ1C 5JOFA 4Y19B 2NX5A 8CGTA 1V8HA 4S1DD 4QHUB 2FEEI 5I30L 4WWKA 2FJGB 4NT6A 4QWWC 4LDEB 4KDTA 3QUZA 2FH8A 2X4OA 1U9KA 3B8SA 4X4ME 4EQ3A 2W0FB 3RWFA 5J6HA 3DURA 5I1AB 5GIRA 3AY4C 3ROOB 3WKML 1JPGA 2EEAA 1GC1C 2HT3C 3PIQA 5ALBH 3PV6B 1FG2A 2Q8BL 3G5VB 4YGVA 1R3KB 2BOBA 1D5IL 1CGSL 2R4SL 2OR9L 3L9RB 3LQAH 4MMZC 4BH7A 1KNOB 4I0KA 5C0BA 4EBQL 4XPAH 5CHNB 1A0QH 1DZBA 2AQ1A 4PRHE 1CL7L 2DM4A 1Q72H 2C1OA 3VRLE 1QRNE 2X1OA 3BEVA 4DKEH 1NFKA 1F4WH 2K1MA 1JPFB 3GMNB 3DI3B 1JHLL 2ICCA 1EJOL 1T0PB 2Y25A 4NNYA 1QBLH 3SO5A 3TNMB 3UAJC 1DSFH 1T0NB 2C1PA 3OKKA 3MJ8B 2OMBA 5C1MB 4K3JH 1JVKA 5C0CB 5FO8B 3I75A 1WZLA 4MSWB 2AJUH 2N7BA 3PABA 4JO1L 4K3EH 1A3QA 1K2DB 2FNBA 5E6IB 1EHXA 3QDMD 5SWSB 3MQIA 1AGEB 1TJHH 1OWRM 3D87B 1A7RH 1E4XI 2X4NA 4LEOA 5GS0H 4M7JL 1S7RA 3P77A 1KCRH 1Z3GH 3FT3B 1CD9B 4CU8A 2DQJH 1A47A 3RKDC 1LO5A 1JL8A 4MDJA 5HY9A 3R8BB 3WDHA 1EX0A 3CVHL 4YDIH 2J12B 4JKLA 5DJDA 4W68A 5DD3L 3RX8A 4PJDE 4X4YA 3WE6A 4MJ6A 4Q9RL 3UX9B 1DANT 1Z0MA 3VWJA 1U8NB 5DA4A 1RD6A 5JDSB 1PKQB 1IC7H 3OKOA 3VFGH 1V7MH 4UIMB 1M7IB 2FWOA 2J4WL 3G6JA 1KIUA 4CJ1A 2DJSA 2AXJA 5F96H 1M05A 2J88H 3BKYH 4PJIB 4G7YL 4HUVA 3GNML 2YRLA 4XH2B 4PRPE 1ZA6A 4OGZA 5EO9B 4I3RL 3TIDB 1DTUA 3OHXB 3FHAA 4N9GA 5HVFB 3CCHB 3MACH 3AXLA 1HOCA 4P23C 3VMPA 3ELAT 3BWAB 1CFVL 3WL9A 4DZ8A 3IETA 1VHPA 4K23L 4KMLB 1W0VB 5F9OL 3BH8B 4J6RL 1ZLSH 5DD5L 4CBPA 1C1EH 3JWOC 2XOTA 3SE9H 4QXGL 1TVHB 5IB5A 3DJ9A 3OJDB 1K3IA 2F5AL 2Y5EA 4PJXB 2YWYA 3V0WH 4PRPD 1G7HB 4JEGB 4PGCA 4YXLH 4XNQB 4BUGA 3KHOA 1DE4A 3ARDC 3VXME 2WBJA 5KSAC 1EK3A 1L7TL 4PRAB 25C8L 2FEDD 1E28A 5I1KH 3BQUA 2JB6B 5HPMA 3AMLA 5E2UH 3OB0H 4DUXA 2DDQL 2PN5A 1U8IA 3L7EA 1N7ML 4P9HH 2VWEC 5D7LD 3CK0H 4NO5B 3T08A 1QFWH 5F6HI 1KXQE 2GJZA 5HHVL 3QB7C 3VFUB 3GJFK 1AJ7H 4PLKC 3WNLA 5T5NG 2VLME 2AXGA 2CMRH 2AEWA 2NX5D 2VE6B 1NCDL 4P9MH 2HP4A 2P24B 3HFMH 5D7IA 4OBRA 4LIQE 2XT1B 3QPQC 4WWKD 5C0BE 3G6AB 4ONFL 4G8FA 2UZXB 1FAIL 4NWUL 1X4ZA 4U33A 1BLNB 2A9MH 3QUZD 4U7SA 1MFBH 5EU3A 5FK9A 3QCVL 4R8WH 1A6ZA 4OJFL 4L4TA 2VABB 5TQ2H 4LSVL 3V4PH 2GTWB 3LD8C 2YC1B 4YQXH 4GMSL 2YUZA 5FA3B 3P4LA 4RGMC 4DOHE 1G1CA 1ED3A 4RGNC 3RA7L 2R23B 1NGXB 2ERJC 2VLMD 1U8LB 2V6HA 2HA1A 1CDYA 1X4YA 4KJYB 4PD4K 4LPYA 1VACB 5JPNB 3KDMA 3B8YA 4XWGH 5C0BD 4Q7DA 4YEFA 5T1MA 1JWUB 3ESUF 3TT1L 5LCVL 3WMSA 3QI9C 1EUUA 2EIDA 3OPZH 3QDGA 4Y2OA 4AT6B 3FB5B 2VH5H 5BV7L 4O00A 4DVRH 3LKNB 2ZOLB 1CXKA 4QO1A 5CJBA 1U3HD 3FN9A 5EOCL 4NZTL 4YE4H 1PDKA 1RI8A 5CBEB 1FFNB 5DGQA 3TH3T 5I66B 1SBSL 4JLRB 1B4RA 3MYZA 3PGCA 1YEEH 1KBGL 4QHNA 1YNTA 4ONOA 1IAKA 2AS5M 2KZ1B 3RWIA 5MERB 4YR6B 1KJMA 4D0DB 2FJHB 2EC9T 2JIXB 1T1YA 3MOAH 1ZWIA 5BCAA 1WWAX 3O8XC 3GI8H 4D0CB 3K2UH 3TNNA 2XG4A 5TJWK 2H9GA 3MLPA 1T5WA 1NPUA 4N0YL 5E8EA 5I6XB 1NFDB 4KY1H 3NAAH 1FJ1B 2CLVB 1BFOA 4JFEB 4LHUB 3VWJD 1HI6A 2IPTH 3NPSB 4ZSOA 1D6VL 5B39G 1G9NL 3DXAB 3UJJL 2FB4H 4KMTH 1MNUH 3RWGB 3AROA 2EE9A 2A2QT 4Z7NF 4H20H 2XXMB 1AP2A 3HPLB 5GISL 4UT6L 4R3SA 4ZDHA 1A1MA 5JIHA 3QUXD 3MV9B 2IPUG 5FCUL 5SX5K 1NUNB 3M45A 5EBLB 3UZVB 1WBYB 5IJKA 1RK1B 4JPVL 2VISA 2JELL 3IFPB 4RAUB 3RAJL 3TJHD 3ZKNC 3FO9B 3RUGF 4X6FA 1MREL 2DI9A 5SWZA 1D5ZA 1U8HA 3DHMA 1JUFA 2Z8WC 3QXVA 3SDAB 4HG4K 5DRXA 2P7TA 4IOFC 3LRGA 5ANMA 2F5BH 3BUTA 4OTXH 3K4AA 2BZDA 5DS8A 4JPKH 3WNNA 1PQZB 3GM0A 4HS8H 3OF6A 2R1XA 3ZT7A 4PJ8B 1NMBL 5MENA 3AFLA 5D7IE 3MJ9H 3T77B 3B5HA 2DWDB 2WBJD 1LDPL 3LN5B 4L4TE 5JO5B 4CN4A 1F90L 2A0LC 3U7WL 2KH2B 1UA6H 1ADQL 5B8CC 2NNAB 2R2CA 4KKCD 4HGMA 2DF3A 4KRPD 3MV01 3NCEB 5IBLC 3L5IA 3IJYA 5L88H 4R4BA 3U9UA 4WW2A 4BELD 1YEKL 1UB5B 2DL2A 2EYRB 2VSDA 3IU4L 1NFIA 4MD0A 2JCCA 1JNNH 1INDL 4QXUH 4P2QA 3MYJB 2P8LA 4FQ2H 1NDMB 5EORL 5EU4A 1C08A 3L3OA 4Q9CA 4OQ1A 4RWYL 4J8RA 5I1DB 3QDGE 3WD5H 3V7MA 3O41B 4YHMH 5CIPH 3BP5B 4ZUWA 3RVXC 1RFDL 1WLHA 4U1GC 4QT5B 4XPTL 2WLYA 5FHAH 1LEGB 1S9XB 1U3JA 4ORZC 5SV3A 1QQDB 5JW4Q 4ZFZB 1TZHA 2FJFB 1XGPB 1CZ8H 3O6FC 4MNQB 3U0TB 4HJGB 4PJAB 1RZIA 4WEBH 4Z0BH 4AEEA 4BKLB 2XTLA 3HLAB 4TPRL 5MEPA 5HHPA 5CCKL 1OP3H 1G7LB 5DEFA 1MJ7L 4DGVH 3E8UL 4PJEB 5T3XE 1HHGA 1HH9A 2HG5B 2PCPA 5L2KB 3QDGD 4FFZH 5FYKE 1UQSA 3MV7A 2BVEA 4HKZA 4OCMC 1MJJB 3HTLX 3NFPB 3OJVC 3VFOB 1IAOA 4LMQI 1CE6B 4MMXC 3JXAA 5HYSB 1A6VH 4Q9QL 3DHJA 2FDBP 4GW5A 3EFFA 4ZO7A 2LVCA 5ADOL 4QF1B 4WTXA 4CRPA 3ULUF 4ZSOE 1NANH 2WQRA 3FRPA 3AVEA 1A9BB 1JF1A 5M94B 2EDLA 1TENA 2C3XA 3BKJL 4I4WB 3CFCL 2HFEB 4ISVB 2OQJA 2DKMA 2NY3C 5T3XD 4X6CF 2AK1H 1RZGB 5FYKD 4OFYA 3O2VL 4LVHC 3JTSB 1SEQL 3IFLL 4F7EA 3H9YA 2X4UA 4NO2B 1B9ZA 1F11B 3U46B 5SWZE 1FV1A 1AFVH 1OGTB 1RVFL 3LS5L 1OARH 2C7UB 1IQDA 4QTIL 3F58L 5FUZL 1AGDB 1S7VA 4NSKA 3WJLA 5EZJA 5ANME 4FFWC 2OTPA 3LB6C 3BSZH 4KVNH 1OB1B 5EWIH 2VQTA 1FIGH 3PG2A 1XGQB 3C9NA 3KAAA 4FMFA 4A6YB 5CMAA 1OAKH 5CBAA 4LLYB 4LPWA 3FQRB 1MELA 1FGVH 4LOUC 5ACLA 5T1LB 5C6TH 4YNYA 3C09C 4PRDA 2ORBL 3WKNA 3VD7A 3MUGA 4KTEH 2YR3A 5MENE 2VL4A 3GSNA 1YEIL 2HKHL 3S5LA 1IGCL 2YS4A 4NJ9H 1DFBH 2BNRD 3EAKA 5FYKU 5K59F 1LK3H 5SWZD 2OP4L 1MUJB 1IBGH 5ICZA 1XF2B 4PJGF 5F7YC 5DMJB 2YKLL 1JNHA 1D9KA 2BSRB 4QHMA 2EDJA 1AGBA 4EDXB 1H8NA 2BFVL 3MCLL 2XTJE 2DJUA 3UPCA 3VWKA 3IVKA 3VRJB 2BNQA 2Z0BA 1FORL 1F4HA 5FECA 3FO2A 5GRXG 3OF6D 5L9DL 1S7TB 5F8QC 4J3WA 4Z76A 4M48L 4XNMA 1P2CA 1IC1A 2DM3A 5E94B 2JCCE 2OLDA 2XQYK 3KVQA 4LNRA 1AGFB 5M95B 5GS2D 5TQ0H 3HS0A 4PIRF 5A43C 2Y06H 2EICA 3G08B 5E8PB 4UINH 3CAFA 4WTZG 4XHQA 5EU7E 2X4TB 3UTZB 5B38A 3CIQA 1YQVL 4FTVA 5E6YA 4G43B 1X5IA 3MR9B 4P5KA 4PJ5B 3ZE2F 3H3PH 4NN6B 5SWQB 4HV8B 4M6MH 5DYOB 5ID1A 4PLNC 1UACL 2XI9A 1NGZA 3QNZA 4QY8A 1QVOB 3FRUB 5EC1B 2VL5A 4U1MB 5BO1H 4P2QD 3WN5A 4QNPF 4LVEA 3ARBC 4M1GL 1WV7T 3IF1A 1J1PL 3BDBA 5GJSH 5HVWA 3MV7E 2GK0A 4XNXL 2IGFH 1V3JA 4IDJL 4BQ8A 2DS4A 2YPVL 1YY9D 32C2B 4IRZL 2OTUB 4PFEA 2XWJA 4IMLB 4YBQD 1VPOH 5J1SC 3DOSA 1FZOB 4U05A 3LQZB 3FT4A 4KZDH 2XN9D 3SKOB 1IC4L 2P5WB 3ARDB 1AXIB 3PL6B 1DJSA 1F4XH 5KSAB 2CO6B 4JZJA 2GI7A 3U9PH 4YIQA 1DUYB 2NPLX 2OXGA 5DJ8B 1EHLL 5BV7C 4PUBL 3OZ9H 2BC4B 3STLB 4L5FH 5IJVB 5KSBB 3QH3A 1AGCB 5BVPL 3X3FL 4HCRA 2YEZA 4JHWL 3NBNA 1JGDB 1U58A 2YUXA 3GM8A 3PWPB 3ESVF 3GMLA 4XWOD 3RWDA 1I9RH 1KTRL 1FCGA 4TN9A 2C3GA 3RVUD 3SDCC 4Q74A 3L3DA 2AI0H 1DBML 1JV5B 2CIKA 4L3ED 4RAVA 1I3RB 5IB3B 4XI5D 4ZS6D 1JPSH 5FGBA 3UYRH 2HKFH 5EZOH 4DK3A 3LD8B 3INUL 3FN0L 4KTDL 1PX3A 4BQ6A 5HXMA 5F1IA 2IJ0C 3OKDA 5CFHA 2FL5A 4TVPH 4OFYD 4QHKJ 3HE6A 3A6BL 1Y6MR 4RGNB 1YDPB 5DF0A 2OTWA 1GGBH 3L3HB 2ERJB 3BP6A 5CJXA 1L9NA 4QHLB 3CXHK 3SPVB 4JDZB 1QA9B 3REVA 3LKSB 2EDRA 1G9NC 5GS0D 5FYLL 2Q87A 2AP2A 4LCYB 3FO0H 4IRJA 4PY8J 3QI9B 4HIEA 4UTBL 3VW3H 1MCDA 5DHYB 2BNQE 3UZEA 3HMWL 2EDYA 3KPSA 1RUPL 2A6KB 5KOMC 3JUYA 2ESVA 1OHQA 5AUMB 1TVBB 3T8XA 5C3LD 3MROB 1W0WA 3JV4B 3ARZA 4KWUA 5TE7L 5IQ9A 4DVBA 4NHUA 5H37G 4UNTA 1NDGA 2A1WH 3O2WH 2NY4D 3SDXE 1FFOA 2AEQH 5MEOB 1FDLH 3EIFA 5DFTA 3REWB 3SY0B 2OS7A 4FTVE 1K4CB 1NBZB 1D9KD 4YBHA 2BDNH 2NY5H 3DVIA 1R5WB 1J5OL 3O8XB 5T3ZE 1DQDL 1OTUD 1N2RA 3VWKD 3NPZB 3GSQB 1EAPA 3G6DH 2DM7A 5FCSH 1KCLA 3BGAA 3MLSL 2VC2H 4F7CB 2VXQL 1OT1A 4S1SL 4NRXA 5DFVC 1AXSA 1K6QH 3Q6FA 5C0FA 1RIUL 3D2UA 3IFOA 4U7MA 4FQ1H 3ZDYF 3QJHA 4HUXA 2MCPH 2BHYA 3FQWB 4KZEL 1I3GH 2YD3A 3ZTJG 4DKFH 2XFXA 5E8DH 2IQAB 2OSLA 5D7JA 3BI9X 4LCUB 5ISZA 2QLVB 1Q1JH 3VFSB 1CXFA 2ZKHL 1FCCA 4C54A 5F89A 5FA4A 2IH3A 1IL1A 3LH2H 4P59L 3P40A 4GMTH 5T3ZD 5HHNB 4UV4L 1BJ8A 2X9WA 3BIKA 4IBLT 1JF6A 2HFGL 3X14A 2DLFH 4XBEH 5J56B 1DBAH 1WEJH 3ZO0A 1LO3L 3QIBC 4QRRB 5F7DA 4PGEA 4XTRC 2QTEA 1KV3A 2AJ3B 4J2XA 1FC1A 1JPTL 5J1TC 4G6ML 5L8KB 5IVXA 1A6AA 1K9TA 1I85C 3FT2B 4HIXL 2OCFD 1NCCH 4ZS7H 2DWEB 3NABL 4HUNB 1FNFA 4XVJL 3JTTA 4X98B 3HNTL 2G60L 2ATPA 4MS8D 4IM8A 3SDDC 2VITA 3W39B 3F62A 2DBLL 1AD9B 1BMGA 3JV6A 4PG9B 4YHNA 1KTLA 4KK6D 5I19H 2L4OA 3IDJA 5HJ3B 4HJJH 1GZPA 2D0HA 2LAGB 4H0HB 4WI5A 3N9GL 3EJJX 1QLEH 3C5SB 4OV5A 2VNCA 4ZNCD 3MLYH 3ZL4L 1U6AL 5DHVB 2AEPL 2D9CA 3MRHB 4UT9L 5F1OB 5B8CB 1CGTA 4M6NL 2Q7YB 1T7YA 2FO4B 4H5SA 1XT5A 4NKQB 5LQBH 1H3PH 5DC0A 1Z9MA 2PR4H 1FGNL 3PXJA 4BA8A 3VXTB 2CUMA 4O4YL 1ZHKA 1Q0XL 5GRUH 4EXPX 5K9OA 2R4RH 4P46A 5TF1H 3C5ZC 4X6EA 4OLVH 4YEEA 4N8CH 4C56D 4DGIH 4G6FD 2ZSVB 2W60A 4ORGA 1UEMA 3TN0C 2EKJA 1HXYB 3X13A 4PPTA 3TV3H 4C55A 2P8MB 3HR6A 1CFBA 5DJYA 4NKDB 1P4IL 3MV11 1P7QA 4XPHH 1YEDA 4U1GB 3KPSE 1GHFH 1H8SA 4FNLL 3H9HB 4U6YA 5EFIB 1RIVH 2ESVE 3TT3L 5LGJA 2AJYH 3HE6D 4IRSC 3TO2A 5B4MC 5CGTA 3CLFH 1A4JB 1D6EB 3CMGA 3W11C 2E5EA 3O3BB 3T2NH 4ETYA 3IKKA 3EDEA 4YC2C 1GYAA 1BREA 1BQUA 1MIEL 5EOTB 4OCWL 5IMKB 1S9WB 2NY7H 2NY0B 1LO0H 3L5XL 1MF2H 1EO8L 3IB4A 5HHQB 4JRYA 4IRJD 1ZHLB 2AJXH 1WITA 1HHKA 1SEBA 1FLRH 1I8LA 3QQ4B 4NUJB 4QRTA 1FZJA 3WSQL 3LKQA 2R0LH 3KYOB 2DQGL 4U7KA 3I2CH 3BKMH 4H26A 3NIDE 3VH8G 1LD9B 3QRGL 4LVNB 2ZP0T 5DQDH 2M1KA 4YDLC 1R0AH 4TTDC 2ICWA 1NBVH 5KJRH 1RJZB 3OAZH 4GXUM 2WWMD 3BGMA 2APTA 3T2QA 4TTGA 4Q9BA 4XMKH 2ARJB 3UDWA 1FYTA 2FSEA 2XRAL 1T1XA 3HE7A 4F9LC 1V3LA 3GHBL 4HAGA 5ACZA 5GSRA 2Z8VC 3CVHB 3ZE1F 5LBSL 5BRZB 1ND0B 4LVHB 1OLZA 1IAII 4YXHH 4M7LT 4UUJB 4MHHG 4JDVB 5KS9A 1J1OH 2AJSL 5DQ9A 2DLHA 2X44D 3OKYA 3RX5A 2BSTA 3BZDA 4HUUA 1VA9A 1I3UA 1NEZG 2PKDA 4JFYA 5IVXE 5KG9B 3VFTA 3D2UD 4NM4L 5JW4M 1PBYA 3FQNB 4KROC 5SV4A 1U42A 4UV7H 3GMPA 2E9WA 1BECA 1IZJA 5C0RL 1CLCA 2EH7L 4GAGH 5D1XC 4OGXH 1MAJA 5D7JD 5ISZD 3HZKB 1T20B 4KI5E 4JFDB 1QRKA 5C0EB 2JJSA 1MCOH 3V6BR 5MP6L 1V05A 1ZHBA 1OAQL 3JWDH 1WQVT 3V8CA 5DI8A 5ESQA 1Q9OB 3P9WB 1R24A 4CW1B 4FQCH 4GQ9H 3ZHKA 3BIBX 3EW3B 5F1KC 4NRZB 3U0PB 5SX4I 3QBTB 2GFBA 2DQCL 4Y4HB 2B1AH 2NXYC 1IC5H 3MRIB 1ZXQA 4N0CC 1ZTXL 1YYMH 4MD5B 4AEFA 1QSFB 3DIFA 5EZIL 3V6OA 2QL1A 3SJVB 1A7QH 4TUKL 5IQ7L 3WJJA 5KVEH 4XPFH 5J6GB 1QACA 1Z9OA 3WIFA 2GSIB 2UZYB 2WM0A 9CGTA 2ZUTA 4OF5A 4KI1A 1EMTH 4R7NA 5CKAA 1ES0B 3KPOB 3LHPH 3R06B 4MQSB 2UY6A 3O45A 3L6FA 1TCRA 4JFPB 1YYLH 1ROWA 5GRJL 3KYNB 3NA4A 4R2GB 3Q1SH 2NY6B 2I07A 4GLRI 4UBDC 5FDWB 4LLVB 1MCKA 1WWBX 4LLUB 1H3GA 3LN4A 4LSPL 2HTKC 1HSBB 2NZ9C 1K4DA 3I50L 2OJZL 4OCXH 1T83A 1FH5L 3DBXB 4H25A 4KJQC 5CEYA 1QKZH 2EZ0C 4JRYE 4PYHA 2EH8L 3RNQB 4FG6C 2VLJB 5B39B 2E8YA 3V5KA 1A4KB 1P7QD 3CPLA 1RURL 1U91A 3CSGA 3K1DA 3IDGB 4PLJC 1P1ZA 3VFRB 1P4BL 3OKEB 5IW1B 1OAZH 3FOLB 15C8L 3KR3L 1UT9A 2BRRL 1CFSA 2AGJL 3Q5YA 4LLQA 5J1AA 5IHLB 5AWNL 2VJXA 2CJUH 4HS3A 4IOIB 1HHIA 1MHCB 3MJ7A 1FYTE 3VXOA 5BV7B 1R5IB 4JRYD 1C8PA 1OM3H 1CT8A 1U8MB 2IG2H 2VOTA 1A7PL 1J0YA 1EHNA 2AERT 3MRJB 1XAUA 4F58H 1UJ3C 2DQHH 5EIIA 5KS9E 1RZJH 2KPNA 5ADPL 3GSVB 2Z4QA 4ZPTB 5E2VH 3VG9C 1CDJA 3D69A 3S96A 3IKCA 2P5EA 1DBBH 3SDCB 1HQRB 3OMZA 1M1SA 1PZUB 2Z35A 1H5BC 4F37F 1Q94B 5JHLL 3DX9A 1N0XH 4IS6A 4JO2H 2DLIA 4HK0B 5D8JL 1UXSB 3DX6A 1FNGA 1S8DB 3MUY1 3P73B 4O02L 2QHRH 4X9BA 5GS1C 5TH2B 3VXQA 5I1HH 3QR2A 4OFKA 5T5FL 1ACYL 1CN4A 3VXUA 2Q76A 3HE7D 1OAXH 2EE6A 1FZMA 3IGAB 3AS2A 5FFLA 4X5XA 1AIFB 1JTPA 1S7QB 3BAEH 5HVHC 3DUHA 1F42A 1A22B 4R0LC 5LXGL 2NQCA 1Q9LA 5JR1H 3IFNH 3QEHA 5E56A 4ZUVB 4Y16A 2FR4A 3PGFL 1EFQA 3BP4B 5E5RB 35C8L 1TVDA 3MOBH 3GB7B 3PJSB 5DR5L 1X5GA 4PJBA 1FNSH 5CJ5A 1ZHNA 5HHXH 4OKVB 1KCSH 3SOBH 3P4NB 4ZUSB 4I48A 4JRWA 5IROC 1YMMD 4NQVB 2F8XC 3AC0A 1NUDA 4IHOA 3TEUA 1JGLH 4UB0L 3STZB 3ALXA 3V6OE 2BVPB 1A7OL 2VRAA 2A6IA 4XMPH 2NY2D 4YBLC 3N1MC 4WEMB 4QRPA 2ZPKH 5C0JA 4UOW0 4QYOB 2HJKA 3NN8A 1E4KC 3QEQB 3VXSB 1HXMA 4HF5H 4OCRL 1S7SA 1ZEAL 3KJ6H 3WFBH 5IW6B 4GKOA 1NL0H 1NC4A 2RR3A 3CZFA 3U0WH 4S1QL 5CWSB 2PYEA 4PJXF 1S9VB 3EO0A 3ZDXF 2VIRA 3TVMC 5E4EB 2X4SA 3VI3E 1T3FB 4TRPL 4Z7UA 3E0GA 5D2NA 4F7TA 4ZQKB 5FYKL 1CD1B 2IALB 5F71A 5C0AB 3VRIB 1F00I 4FXGB 3TBWB 4ENED 3UTSE 5JXAH 3A0OA 1I7TB 4FOMA 2D7NA 3K7UA 3QZWA 4Y2DB 3P3YA 1UM5L 1QBMH 2CLZB 3BJ91 1RIHL 2AK4B 5BMFL 3BUYB 1WWCA 4U1KB 1E6OH 5ILTL 1CIUA 5DJCA 4NQDA 1MCWM 5JXEA 1KULA 4HWNA 4NZDA 3GMRB 4JDTH 5FV1L 2K3TA 2HH0L 1REIA 3BZEA 1RZ8A 1G7IB 1F3RB 2MHAA 1ZVYA 1NBYA 3QIBB 2VDPL 4O2CA 1BM3L 3ARPA 3QHZL 3KYKL 3G04B 5DTFB 1UM6H 4TVPE 4NQSB 3BXNB 4GS7C 3QFDB 2VERN 3SE4C 4NGHL 2FX8H 3IU3A 4OLUL 2H26B 2DQEH 1FP5A 3SDDB 1NGPH 2H3NA 4RFEA 1SQ2N 3VD4A 4Q58C 3MMEA 1JYWA 1KYOJ 3P11L 1ZA3B 4G8IA 1FVDB 2P44B 2P5EE 2FBJH 3U7AA 4PJFF 2DKUA 1YECH 5I17A 5IB2B 2GY7B 1Z0NA 5HPOA 2ZUUA 3MRNA 4WJ5B 2XYCA 3U82B 3GSXA 4LSTH 5C08A 3RVVD 2FEDC 3SGKC 4TVPD 1TJGL 3VXUE 2VZTA 5I8KH 3U6RA 4MB3A 3BISA 3IJSA 4H0IA 4F7PB 5IT2L 1SY6H 2YMXH 4MXWH 4LSQH 3H9SB 4OB5H 1N59A 1J0HA 3F12A 3RY4A 2F9BT 1HILA 1U8KA 4MA3A 1T6WA 1C5CH 3P9MB 5E7FA 2LV4A 6FABL 2FHBA 4HFUL 1JHKL 2NLJB 5CGMA 4GKNA 3GJFH 2Z31B 3TN0B 4FABH 3BN3B 1VEPA 4Y4KD 4WWKC 3QUYA 3WXVL 4PJBE 2DQTH 5B22A 1CDGA 4KDTC 5INDB 3LKPA 1HE7A 3QUZC 3N0PB 4OM0L 3WS3A 3T1FB 4NZRL 3VXUD 4AH2B 4WUKH 2VZSA 5CJOL 1A6UH 3QCUH 3VGHA 5L2JB 1NFDF 3G5ZA 5DJ2A 2VZUA 4Z7VA 1BQLH 1FL5B 4IRSB 4ONHA 2RIKA 4OZIA 1I4FA 2Q6WB 2IBZY 4QRPE 1FNEA 2A6DA 4YC2B 2WMPA 1CS6A 5EN2A 3FFDA 4Y16D 2EYTA 2F74B 1E0OB 1OGAB 3GSWA 4M3JA 1CFQA 3P4OB 3WO3B 1HK6A 4OZGA 1L6ZA 3LSOA 4U4BA 1E4XH 3QIUA 5LG1A 1NGQH 5TFSH 2PYEE 3ZKQD 4UOJA 1GCFA 3SBWA 4QRSA 5ALBL 1MAMH 1Q9WA 4N0UB 2QSQA 4Z7UE 1QO3A 3O11A 5D2NE 3PWUA 3O3EA 4LQ1A 4I2XB 1FL6A 2AQ2A 5CILH 2ZNWA 3DUSA 3L95A 2LFGA 1MCEA 4ZFOL 3LQAL 4JG0H 5IBUG 3RWHA 2XKNA 4QRPD 1EFXA 1BF2A 4XPAL 5CP7A 3QA3B 2E27H 1A0QL 1Q0YH 1Q72L 4ALAH 4HGWB 4ZYKA 5I71C 2YSSA 2WANA 3EYQD 4KVCH 4DKEL 1F4WL 4KKBD 3BH9B 4CN1A 4F7MA 2RJMA 4U1HB 4LF3A 3RUGE 1QP1A 5T1KA 3MOQA 1NC4D 1ZAGA 3MNWA 1MH5B 1QBLL 1H3WM 4NQDE 5KVGH 1DSFL 4CVZB 2PYED 2QQLH 4K3HA 4YZFF 1I7UA 3MRLB 3VA2C 2NCMA 5FHBH 2O5XH 4K3JL 4PJCA 4P2OB 4XCNB 2AJUL 2AV7A 4L29B 4HHAB 5FB8B 3BVNB 4K3EL 4PB0H 3T4AB 3RGVA 3V6FA 1TJHL 5EOQH 3GIVA 2G75A 1NLDH 5C07A 3VWJC 3C60A 3NACH 5IB4B 1JTOA 4KROB 1F58H 1A7RL 1EPFA 1FO0H 4Y5YA 3VFVA 4EUPA 1AR1D 1VEOA 5GS0L 4GRWH 4POZD 1KCRL 1Z3GL 3VCLA 4C83B 5ITFA 5D1XB 4PJ9A 1T5XA 2DQJL 1S9YB 2AV1B 1QHOA 5JXED 5EUKA 1CVRA 3RU8H 5JZ7D 4YDIL 2CDGA 4NC2B 3W9DA 1KGCE 1FFQA 1G7QA 3QUXC 1BJ1J 1BQHA 3TJHC 1IC7L 2YXFA 4OM1H 3VFGL 3GMOB 1V7ML 5SX5H 4UT7H 1A6TB 1MCSA 3QISA 4QOKA 2RFXA 4JY5L 5IVOA 1JP5A 5IG7B 3B5TA 5F96L 4P3CH 5IMMB 3IDYB 2J88L 3BKYL 3KLDA 1QFUH 2NXYB 5J4MA 5E2WH 1VFAA 4QXTA 4PREA 3S4SB 3MLTB 2VKWA 3PDDA 3QUMA 3QIWA 5JW4R 2AXFA 5DA0B 3MACL 4PJEF 3FRPG 3MBXH 1NMAH 4K55A 1MPAH 5JNYA 2IPUK 3W5NA 1MLBB 2WBJC 1ZLSL 3EYSH 1O7SA 2FIKB 1LNUB 5C08D 1C1EL 4JKPH 2CDFA 3D39A 3BQUC 1RZKH 4OZFB 4JAMA 3HUJA 3SE9L 4P5TB 3HZVB 4KKCC 1P6AB 2A73B 3FB7B 4KRPC 3PHQA 5HYEA 2IANA 3RTQB 4GG8A 3RNKB 4Z7VE 1UC6A 2HN7A 4PY7B 4EI5A 4OZIE 2CKBA 1HHJA 4MA1B 3V0WL 4DKAA 3VFWB 2HMID 1MQ8A 2X9XA 4TNVK 4YXLL 1CWVA 4ELMB 2V2XA 1VSCA 3EFDH 3BPCB 2ADIB 4BK5A 1MHHA 2NYYD 5ACMA 3SO3B 5I1KL 1MI5A 1EBAA 2R69H 3QXDB 5E2UL 3PWVA 4M1CD 1XGRB 4P9HL 3CK0L 1EIBA 2XWTA 3BDXA 4WO4B 1QFWL 3TO4B 5GJTH 1SJHA 3C6SA 1HH6A 1PY4A 1AJ7L 3ES6B 4JPWH 1I1FB 2CMRL 4WI6A 5FIEA 1Z6JT 4LCWE 3S5LG 4P9ML 5JQ6H 2NTSP 3BDYH 3PGDA 3HFML 4HX1A 4ZFGH 3TF7C 2WV3A 3QNXB 4JGMA 4L4VA 5I8EA 3I6KB 3HZYB 2A9ML 1MFBL 1ZANH 4R8WL 5JORA 3R0NA 2X70B 5TQ2L 3HR5B 2ZJSH 3QIUD 4DTGH 2ATKA 3V4PL 4E41B 3B9KA 4YQXL 2HLFD 2YPKA 2DQFB 2CSPA 4OD2B 3V5HA 3RJQB 1JK8A 3ARXA 3WBDA 1JYNA 4WFGD 5E00B 3CFBA 1OQOA 3OL2A 5HGDB 5MI0B 4PJCE 3EOYG 3TJEH 5IMLA 2PW1B 2LVEA 5GXBB 5IR1A 3F7VB 4ZPVB 3ROLA 1G84A 2V9QA 1U3YA 4JZNA 4GAYB 2X1QA 3VG9B 43CAB 5ESVA 5DC9B 4XWGL 1EFXD 3DGGB 4G3YH 4I0PB 5C07E 1XF5B 3MO1B 4LHQB 2XA8H 1KLGB 4HH9A 4BFIB 5B38G 3U4EA 1PZ5A 1LO4H 5DJAB 3OPZL 5BW7A 3R4DA 3QXWA 3WFEH 4CGTA 2VZ3A 5T1KD 2VH5L 5K59E 2EIBA 4XPBH 4DVRL 4R96B 3TPKA 1RMFH 3Q6GH 1YEHH 1TTUA 4NKOB 1CLOH 1CTNA 1RUAH 2HVKB 5EBMB 4YE4L 3EOTH 5GGUB 4APQA 4X99B 4FQQA 1I8MB 3BYYA 4PP2A 1QLRA 3DETD 3HN3A 4GFTB 3T65B 4R0LB 4LKXB 1ZGLM 4X5WB 1YEEL 2P8PB 4NDMA 4O2FB 5KN5B 2V17H 4NO0A 4PRIA 5DUBA 4QOKE 4I0CC 1K8DA 4NC0B 3V6ZA 3W0WA 3RGVD 3WLBB 2EXWD 1OCWH 3CFKA 3C2AH 3C60D 5CD3A 2F58H 4JVPA 2YD6A 5LAXB 3MOAL 1Y0LA 2ICES 1RHHA 1T6VN 4QCIA 4WU5B 3GI8L 4NNPH 3K2UL 3RIAK 1PG7W 4S11A 3HG1A 4PLOB 4GBXB 4U1IA 2JK5A 3D0VA 5BZWA 1J0JA 3NAAL 4KY1L 4YBLB 3V0VA 3RWEB 1F6FB 2IH1A 5IJKC 5EZLB 2GTZA 2IPTL 4XNZC 1GOHA 5F1NA 5HGBA 1PY9A 1GZQA 2FB4L 4QOKD 3SGJA 3QDMB 1MNUL 3V4VH 3D39E 4QHKI 4CNIA 3HUJE 4H20L 4OCSH 4BQ9A 2IANE 4JR9H 3CU7A 4XVTH 4TSCH 2VTFA 1YN7B 5F8RC 5C3TA 2BCKB 2ZWLT 1PYWB 2KUTA 1KIQA 2DQUH 4M1DH 3U2SA 3TBTB 3IS0X 4PY8I 4KTYA 1EGJH 4CU7A 2F5BL 4P23D 2Y1VA 5DJZB 4OTXL 5AG9A 1KENH 2OR7A 3MRCA 4JPKL 2BVTA 3IXAB 5DDHA 2GW5A 2GCYB 4HS8L 3OAYK 5F97E 2IAND 3S35X 5MEQA 2JB5H 3VJ6A 4EI5D 2VN4A 2D7TH 2XIDA 3MGOB 4NQUA 4RNRB 3MJ9L 1HQ4A 4L4VE 4WW2C 4D9QD 1BX2A 1VENA 4OIBA 5BVJA 3MRRB 4X7TB 5JW5B 2V2TB 3MREA 4JHAH 2DQIH 1BOGA 2V7HB 1MI5D 1UA6L 1U3ZA 1LEIB 1NEZB 3LEXB 2FO1A 4EN3A 1MAKA 3E3QC 1CFTA 3LEVH 4GS7B 1UKQA 3WO4B 3KS0H 4ODUA 2F53A 4P3DA 1EVUA 1CU4L 1MY7A 4PJHB 5L88L 3UBXI 3B2VH 1YY9C 3GJFA 3M17A 3CJJA 4YBQC 4PV9B 4U1NA 1JNNL 3U36A 4QXUL 2BY0A 4PRPB 3E6FB 3TYGH 4FQ2L 4L4VD 3O4OC 4LBEB 2L0DA 3NCCB 4KQ3H 4M93C 5A16A 2P47B 4O5LH 2LTQC 3NIGE 3WD5L 5L7XH 2UWEA 1A9EB 4YHML 5D71H 5DUPH 43C9A 2OBGA 3B9KD 2BVQA 2FCBA 5FHAL 5C09A 5CUSH 3QPXL 4MAYA 3T4YB 5D7LB 4HWEH 4ZOAA 3MSPA 2VXVH 4JJ5B 3OKNA 1CZ8L 1WAAF 3LQAC 5E8OA 2X2YA 3EUUA 4WEBL 3V52H 4Z0BL 5JOFB 3FHQA 3QXAA 4XWOC 2NX5B 5CEZH 3RVUC 4PRIE 3WUZA 3W0WE 4WWKB 4M7KH 5I1LA 4DGVL 4NT6B 3FONA 2OR8A 5GGRA 3QUZB 2X4OB 5J6HB 4FFZL 3GBNH 3DURB 1UWXH 4XI5C 4ZS6C 5J11C 1D5XA 4NQXA 4MJ2A 3HC0A 3HG1E 3SKMA 1WCBB 4ODSH 3L3JA 3GBMH 4FP8H 4OSUH 1JPGB 4J4PA 2OXHA 1A6VL 5FKAB 4APQD 1IAIM 1FG2B 4PJ7F 4BSVA 4R26H 4U3XA 2NW3A 3SCMA 1LP9A 1BFTA 2F8OA 3P2TA 4NO0D 5GS0C 3BZ4A 3W0WD 4BH7B 2ADJB 5C0BB 3M1BA 3WJLC 5CLTA 2HT2D 2C1OB 2Q3AA 2WINA 1QG3A 2GUOA 2AK1L 2JJUA 3RI5K 3BEVB 4D9LH 3KPLA 4Y5VA 4XBGA 4DFIA 3T3MF 4XAKD 4G8EA 5DK0B 4NNYB 3HG1D 2EDOA 1NMCC 3TIEB 4Z95H 1U3HB 2MQCA 2VDRH 3OKKB 1ZT4A 4JM2A 4YPGA 1AFVL 1OARL 1UWGH 1TITA 2CDEB 3I75B 4W6YB 2ITCB 2H1PH 3WIHH 4JFZH 2BSSA 3EDKA 3PABB 3N06B 4TQEH 2NY4C 4M00A 5I71B 1OSPH 3BSZL 4KVNL 5EWIL 1FIGL 1OAKL 3UTTA 1IEAB 5D72H 1JMZA 1FGVL 1GOFA 2YUVA 1D9KC 1ERNA 2R2BA 1DN2A 4LEOB 4LRIA 5C6TL 4MB5A 1RULH 2MWCA 1VKXA 1S7RB 3P77B 3RBGA 5DXWA 1OTUC 2VDOH 4KTEL 1CTOA 3VWKC 4MDJB 2A83A 1JWSB 4NJ9L 5F1SA 2B39A 4AMKH 1DFBL 5DJDB 1LK3L 1YY8B 5FYJH 4M7LH 4Z77A 1IBGL 2YPLE 3ECBA 3KPPA 4G42A 2PTUA 2KDGA 1ETZB 5F6HJ 3NVQA 5F21B 2Y23A 4RDQG 3FQUA 1AXTH 2FWOB 3R1GH 3G6JB 3ZYOA 2F53E 4D94A 3ZT6A 3BHBA 4F3FA 2CGRH 2H2PD 3TESA 1RJLA 2V5RA 1KN4H 3QUXB 4D8PB 2C3VA 1MRDH 2ICEA 1A3RH 4NNXA 1CD0A 1XEDA 1TMCB 1I8KA 1ZA6B 5TQ0L 3RZWA 3AS3A 4NN5C 4PTUA 2UV3A 2Y06L 3ZHDA 4N9GB 1HZHH 2GIYA 3WDJA 3AXLB 5F9DC 1HOCB 2B0SH 2VQUA 4UINL 2PO6A 4K7FA 2UWEE 3WL9B 4FQJH 5HHOE 3WN5C 3IETB 4NUGH 4P9HC 4PG2A 4N8VB 4L8BA 1BVLA 2HFFA 3DVNA 4EN3D 5C09E 4XXDB 3D85A 2ADFH 2A0LD 4HLZH 3SKJH 3MLXH 3DTXA 1FN4A 2R9HD 3H3PL 1DQTA 3ZHLA 4M6ML 4RQQB 4MS8C 2CRYA 4OZ4B 4LGPB 3GKZA 1ZLWK 5A2KH 4MLSA 5IB5B 3WEXB 3STBA 3SE8H 3GZKA 4KK6C 4Y19A 4I8DA 4Z7WA 5BO1L 4KQ4H 3PP4H 3N85H 1DE4B 1SJEB 2FJGA 3EJZD 2WBJB 3RDTD 5GJSL 3UPRA 3DX8A 3L3GA 4JZJC 2IGFL 1OWWA 5I1AA 3V79C 1U8IB 4KRPB 5C09D 3P0GB 4JANA 1CLYH 3ROOA 5GGSA 4XBPA 4MAYD 2BOCA 4KV5F 4HIIB 3T3PE 4M8QB 1VPOL 3C8KB 3EHBD 5F88A 1N4XH 5H37H 1HDMA 3WNPA 3PV6A 4BFGA 2AXGB 4KZDL 4YHOH 1LP9E 3G5VA 1R5VA 1KTDB 3UJTH 5FAAA 3LEYL 1F4XL 1AO7A 3VFPB 1MFCH 1G1YA 4G8FB 1KNOA 4Q0XH 1S3KH 2CLRA 1Q9KB 2Q1EA 5CHNA 4ZTOH 4NCDA 5HBBA 5DMKB 5EU3B 5FK9B 1A6ZB 1QSEA 3KPMA 1J9CT 4L5FL 1AQKH 1I1YB 2YK1H 4ODVH 1DQQB 2NZIA 3BFOA 4LHJB 4JE4B 3QDJA 5T5NF 2BERA 4QXWA 4IOSD 2VYRE 3TH2T 3EYVA 4J4PD 3S34H 3HE6C 1ED3B 4ODBD 1CR9H 2AI0L 5CJXC 4NFDA 2NW2A 5E99H 1F2QA 5C0CA 3SCMD 5L6YH 4U6XB 3B43A 3DVGB 4B0MM 5EO1A 1XGUA 4JFXA 5L8LB 3UTPD 3V0AC 1JPSL 3UYRL 1AGEA 2HKFL 4RCAA 5EZOL 2ZCHH 2H2SD 4IRJC 3MODH 1MSPA 2BHUA 3QDGB 4TVPL 1KACB 2E6JA 4UZGA 4K3GA 2H32H 1GGBL 1HEZB 3VXPA 1RZ7H 2IPKB 3NGBC 4QTHB 3MLUH 3O6KH 4LU5H 4JM2D 5BJTB 2FGWH 2BRQA 1KELH 3PGCB 1W0YT 1SHMA 4QHNB 3FO0L 1NLBH 4KXZI 5C6PB 4MJID 1W8NA 1PKQA 2WWMC 4ZOBA 1IAKB 3VW3L 3RWIB 4H1LH 3IT8D 5CSZA 1KJMB 1B0RA 3UTTD 3NIFF 4NC1E 5CKGA 1ZWIB 5IVNA 3DV4A 4PJIA 1LWRA 3MLRH 4X0KB 3TNNB 2H9GB 4LPXA 4XAWH 5C0DA 1T5WB 4XH2A 5EO9A 2A1WL 3O2WL 4TUJA 4HPYH 1GGYA 3OHXA 2AEQL 2XQBH 1FDLL 1HI6B 2LU4A 3BWAA 3AS0A 3X3GH 2G2RA 2NY5L 4TNWF 3UTQA 4BSWA 3WUWB 1OSZB 4V2CB 4WNQB 5D7JC 3S37X 1CBVH 1AP2B 3G6DL 3ET9F 2OX5A 4RGOH 4ZDHB 1A1MB 4HH8A 4XRCA 2VC2L 4Z7QF 4Z78B 1TVHA 3FAXA 4Y19E 4RMWA 3OJDA 4MCYB 4Z7WE 3WHXB 2VISB 1J0KA 5BQ7A 4JPIB 4XNZB 4X6CB 3ZLQC 2BNRB 4X6FB 4XNQA 3BO8A 1AE6H 5SWZB 1D5ZB 2MCPL 4KC3B 4LPUA 1I3GL 3QJFA 5DRXB 3AS1A 1RQ5A 3O3UN 4DKFL 2LU7A 2P7TB 5E8DL 4PRAA 1TIUA 1Q1JL 5ANMB 2JB6A 3V9FA 3KPQA 3D85D 3LH2L 2DLGA 4GMTL 5DS8B 4AQ1B 3C5JA 5GGVH 4C4KO 4NO5A 2DLFL 2R1XB 4CVWA 4XBEL 4FQIH 4U6HA 1DBAL 4X7FC 1WEJL 3VFUA 1T0MB 5T1DH 3TYFB 1KPRA 1AO7E 4Y19D 1MHEB 2B4CH 2VXUH 3F7YB 2EXYD 2P24A 3IAPA 5IKCB 3GMMA 5A2IH 1BOYA 5DVOA 1E6JH 2ZG3A 1JHTA 1NCCL 1QSEE 4ZS7L 5C2BH 4P57A 2VUYA 3GGWA 3B3IA 3QDJE 5J9PB 2ZOKA 2EC8A 4F33A 2YC1A 5I19L 4KUCF 4R4BB 4JQVA 4F8QA 5C0CE 4WW2B 4HWBH 2AABH 3QXTA 1QLEL 4YLQT 4X8XA 1NFIB 4CDHA 4MD0B 1AO7D 2JCCB 3MLYL 4NBZB 1U8JB 4KJYA 4P2QB 2P8LB 3CU1A 1VACA 2X42A 5SWSE 3B6SB 3I6GA 3SGEI 1K5NA 5EU4B 1C08B 1VFBB 3L3OB 4OF6A 5LQBL 1H3PL 1JWUA 2PR4L 4J8RB 3BPNB 5HHME 1TTFA 4WU7A 1QSED 2XZQH 2CPCA 3O2DH 4M7ZC 5FF6A 2J8UB 5GRUL 3QDJD 3FB5A 2R0ZH 2YD4A 2R4RL 5IK3B 4CMMA 5TF1L 3BW9B 2ZOLA 1TZHB 4OLVL 4N8CL 4DGIL 2C4FU 3VG0H 4ETQB 5IWLA 1FFNA 5C0CD 4JLRA 3TV3L 3O4OB 2XN9B 3D3VB 3MV8A 5IIEA 4M93B 1PKQE 2LTQB 5AEAA 5I8OH 1N3NA 3I85A 1I9IH 3IDIB 3QULA 4N90D 4XPHL 2EO1A 5MERA 1WBXA 2JE8A 4D0DA 1GHFL 1HH9B 3GI9H 3GK8H 2FJHA 4ZFFA 5HHMD 1RIVL 2PCPB 2JIXA 3KWWA 4PJIE 1IAIH 3ZSTA 2AJYL 1I8LC 2X6MA 5K9JH 3W9EA 3CLFL 1IAOB 4OI9A 2G5BA 2WIMA 4ZFOB 3T2NL 1J0ZA 3CXHJ 3OAUH 3ARTA 2AW2A 4EQ2A 2NY7L 4OF7A 1LO0L 1O7VA 3EFFB 1FJ1A 2CLVA 3QZWG 1YEFH 3BE1H 4V1DD 1MF2L 1JF1B 1XGYH 4L3EB 1F3JA 2AJXL 4JREB 3DXAA 1FLRL 5J11B 3UDWC 3WIIH 1LE5A 3HE7C 3TM6A 1DDHB 2R0LL 2EEBA 1ONQA 1KJ3H 3HI5L 3BKML 3OR7A 3ZYJA 3WIHA 1B3JA 5C7XH 5DQDL 1R0AL 4OUUB 2GHWB 3CFIC 5C9JB 1GOGA 4PJXE 1NBVL 5KJRL 4MB4A 3IFPA 4F7EB 3FO9A 2I26N 3KXFD 4OCNC 4GW1B 5SX4H 4XMKL 3EGSB 1IQDB 1S7VB 4YXKH 4NSKB 3SDAA 1WUNT 3CMOH 2GYSA 5CBAB 1BIHA 4LKCA 1PQZA 4LIQH 1WGOA 3I3DA 1HYSD 3THMH 4YNYB 1ITBB 1J1OL 5F7HA 5JIIA 2JJSC 1S5HA 3MBEA 2NY2C 2EDXA 4NJAH 3S5LB 4O51B 5A1AA 1ZK9A 2YA0A 5BXFA 3T77A 3O4LA 4UV7L 1AQDA 4GAGL 3LN5A 5KANI 4KRMB 4OGXL 3DYOA 4GLRH 1MFAH 2I9LA 3IDNA 4QHMB 3D18A 1AGBB 4AZ8A 2W59A 1MCOL 4NRYB 3IVKB 1PSKH 1MRFH 3JWDL 4RFOH 5FECB 2N56A 5ERWB 1CICA 1KJVA 1ZVSA 3V6OC 4GRMA 1X4XA 4FQCL 3L7FB 4GQ9L 4GSDH 2R2EB 4Z76B 1T4KA 1P2CB 1T2QH 3QDHA 3UO1H 1EZVY 4LNRB 4ENEC 3MRQB 5CZVH 1B4JH 4HSQA 4Y89A 1NDMA 1QBAA 2B1AL 1IC5L 2W1NA 5CSGA 1OD9A 4YHLH 5B38B 3P30H 1YYML 3O41A 1CVSC 1L6XA 3BP5A 1A7QL 4QT5A 3MGTB 2GT9B 3SGDI 1V5JA 1S9XA 5KVEL 5I1EL 1QQDA 3MRKA 4XPFL 4ZFZA 4ACPA 2DMKA 2FJFA 5ID1B 1IKFH 1EMTL 1WFTA 1XGPA 1VGEH 4I5BA 4MNQA 3N1PC 4NN5B 4WHTA 3LHPL 3U0TA 4HJGA 4PJAA 5KAQG 3MV8E 1T83C 1IQWH 1YYLL 4UU9B 1LE9A 2VL5B 4BKLA 4GG6A 1XR9B 3Q1SL 5EUOA 3KLHD 4WI9A 2HG5A 1XR8B 3MRGA 5CEZD 5HD8D 4XP9H 4ODXA 3NFPA 1CE6A 4UAOC 1A2YA 4OCXL 1N64H 3CH1A 5HYSA 1NFDE 4JFEE 3FT4B 4QF1A 1QKZL 3MV8D 3QFJB 3ZTNH 3WFCH 3DXAE 4JQXA 5GGQH 4JZJB 3RVVC 1XZ0A 4YIQB 1T03H 4I4WA 1IGJB 3MA7A 5DRWA 1QTYT 1SM3H 3T0VA 1RZGA 4MJ5B 3CD4A 1Z5LB 1K85A 2IBGA 2N1KA 3MV9E 1OAZL 4U1LB 4NHCH 2YEZB 1LVEA 1U58B 1VB9A 2H6PA 3GMLB 3RWDB 4C56B 1BVKA 4G6FB 4YWGH 3HNVH 2CJUL 1D7FA 3BGFB 1F11A 3U46A 4HFWA 3L3DB 4Y4KC 1OGTA 4JZOA 5ESAA 2C7UA 2H32A 5HYJA 4HDIA 2CIKB 1YC8A 4WGWB 1OM3L 2IG2L 1ZGLA 1MWAH 4JQIH 4RAVB 2I9TA 1DQMH 1ORQA 1OB1A 1XGQA 2YD9A 4M02A 2VLKB 4LLYA 2DQHL 4F58L 1CK0H 1C5BH 1Z2KA 1RZJL 4MZ2A 5T1LA 5F1IB 2FL5B 5E2VL 3OXSB 1BQHG 3HE6B 3HI1A 4NFBA 1DBBL 2FD6H 4YZFE 3BP6B 4RMRA 4H1LA 5HTSA 3REVB 1N0XL 4JO2L 4Y16C 5CAYB 4TULH 2QHRL 1LQSR 2NY5C 5I1HL 3C2SA 1I9JH 1J7VR 3VMOA 3S35H 4MDIA 2QKIB 3SDAD 1SMOA 4OZHA 1OAXL 4IRJB 5IMOA 1R6VA 4HIEB 3HC4H 3BAEL 3NCJH 5FYJD 1ZGLP 3VRJA 1NGYA 2ZUXA 5F9JB 3TBSA 3IFNL 5JR1L 3MBED 5I1JH 4NFCA 3S8WA 1UZ6F 3MOBL 3ARVA 1W0WB 3D6GA 1FNSL 5IQ9B 4NHUB 5HHXL 1NDGB 3O3AB