1MIEL

Crystal structure of the fab fragment of esterolytic antibody ms5-393
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
218
structure length
218
Chain Sequence
EIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLNWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSETAFTLRTSRVEAEDVGVYYCMQHLEYPFTFGSGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN MS5-393
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2002-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mieL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mieL01
1BBDH 3VA6A 3FQUB 2JB6B 1T7ZA 1YN7A 5F6IB 3WNPA 3SKUD 4ODVH 4X9IA 4XPFL 5I76B 4CVXA 5KW9H 5FGCE 4Y88A 1RZJL 5JW5B 3O3AA 1TVHA 3F6IA 3GKZA 4N9GA 3HHRB 3G6AA 4R96B 3MRMA 3ZE1F 3K4ZA 3RY6A 4PGDA 1I9RH 4XHJD 3QZWA 4C57C 2YK1L 2OR9H 3KPPB 1F42A 3EOYG 2YPLB 1I8KA 1IGTA 2AQ2A 5IMKB 4E5XB 1PAMA 4JDZB 2D7MA 1D6VL 1YEFH 1ZHKA 4PR5A 4XVTH 3DVGA 2DWEA 2Y9RT 3P40A 3QIUD 5FA4A 5EBLA 3L3IA 4OFIA 5F9WC 4PYGA 1NFDF 2PCPB 4PJ7F 5D2NA 1WEJH 3RWEA 5JW4M 3KPNA 3PL6A 3RZCC 3VXME 5KG9A 2E8YA 3TPUA 4PB0L 4CAGA 4FFZL 4N0YL 3LQAL 3TBTA 2ZUVA 4X6DB 3NIDF 2YPVH 3O6KH 1C1EH 4LLDA 2P5WD 4RMRA 3HR5A 3X13B 1MI5E 5D1XA 3VXTA 1L9NA 3HG1D 3DECA 4G42A 5TPWL 2VABB 1FZOB 1ZLSH 2DICA 1UCBL 1UYWH 2LVEA 3BUYB 2HJFB 2ZSWB 1HH9B 3T1FB 5JDJA 2EO1A 2XZZA 4C54A 4HWBA 5F3BB 1KGCE 3QQ9D 4ERSH 1CD1B 5I1JL 1EEYB 1BD2A 1AGEA 3K2UL 4K94L 3VMPA 1S7QB 1I8MB 1WWWX 3IFNH 1FZJB 1PVHA 2A73B 1IRAY 3RIFK 3SEPA 1HE7A 3U82B 5BVJA 3HCVA 3D39A 3I9GL 3MV7B 4NJAL 5MP6L 1CDIA 3B6SB 5C0AD 4LGSB 4NBXB 4P2QE 4GW5A 4EI6A 2BNQE 2VDPL 4M7LL 3KYOB 4DOHE 1ZLUH 4AL8L 5LWYL 3NABL 1FSKC 3WFBH 2P7TB 4U05A 5D96B 5EOTA 3VRIB 2FO4A 4P2RB 5EU4B 1NCWH 2R0LL 3CVIH 4URTB 2XZQL 5DEGA 3X14A 2AGJH 1WZMA 2O5YL 1NH6A 1XF4A 1IEHA 5DRZA 5E9DA 1KULA 2APXA 3RZCA 1OLLA 4U1JA 4HDIB 3C2SA 4CKVX 4ZTOH 5GGRY 1JGLH 4JFYA 2AEPL 3DYOA 1I9JL 1CFBA 4HWBL 1RUKL 1W0VB 3T77A 3DVNA 4WO4D 5EUOA 3ABZA 3ZKQD 1FFNA 3S35X 1ZA3A 1E4WH 3MXWL 1D5IH 5E8NA 1P84K 4WVRA 3L3DA 1UWGL 3ISWA 1JFQL 1S9XA 4OUUB 5CP7A 4WUUA 4DEPC 3CSPA 3W9DB 1FDLH 2MHAB 4YGVB 3GJEB 5E1HB 3JWDH 1DQMH 2NY4D 1CQYA 3TNNA 1N2RA 5DWUL 3FAWA 4D3CH 4IHOB 2AJVH 2Q7YB 2F15A 2Q8AL 4KI1A 2WBJD 3SJVD 2ESVA 2F19H 1IEAB 3VXUA 5DJYB 4TRPL 5I1IL 1T03L 1BF2A 2VKWA 1KPUA 1NGZA 4RZCB 1EJOL 5EO1B 3H0TA 3MLSH 4OGXH 1S8DA 4Z0XA 1EHAA 5IUSA 1OVZA 1F6AA 3MRLB 1NGPL 3RVVC 4OZFG 2KKQA 4PS4L 5FUCC 1IKNC 1FV1B 5EUKB 3OAUL 2Y5TB 2WINB 3R1GH 3BPOC 5F7EL 3H3BC 3N1PC 1MJ8L 3P11H 2X9WA 1V7NH 4BZ2L 2MCPL 3MLRH 5I1EH 3CSGA 1CU4L 5JXAH 1M7IB 5JO5A 1ORSA 4AYFA 4X6BB 4QF1A 2OJEB 5KSBE 3T0VA 4OAWA 2ADJB 2W0LA 2B0SL 4LP4A 3MACH 2PW2B 3BIAX 4FXKA 5SWZB 3QR2A 3NTCH 4NFBA 4LEXH 4MNQA 4LQFH 4XRCA 3U7WL 3RWDA 2X41A 3QHZH 1HEZA 4C56E 4F15C 2Y06H 5KSUB 2EDOA 5EZJA 3QFJD 3E6FA 2W07A 3LH2H 5A40E 4QYOB 5IHBA 4FXGA 1P7QD 2ITDA 4JFDD 5E7BA 1FGVH 3T65B 3VG9C 4R26L 1U8PA 3GSOA 1XGPB 4QOKE 1EH9A 2GY7B 3GBNL 3NN8A 3MRPB 4WNQB 5ESQA 1Y6NR 4PGEB 4W70A 5ILTH 3ZO0A 1U3HD 2HT3D 3TWCH 4JQIL 5IBTH 1BFOA 4B7LA 3ECBB 4JQXC 4PRIB 4MXQC 5DVLA 4I5BB 1JGUL 2VKXA 2J8UB 5BCAA 4MB3A 2CSPA 1UWXK 1IKNA 4F7EA 4JFZH 2O5XL 5DD3H 4JRXB 1B6UA 1RIHL 1NCCH 1U8HA 5IVXB 4PYHA 4NRZB 1G7QB 3MFGB 4BSVB 2P46B 4XPHL 5T3XH 1SJVA 3Q3GA 1R3HA 4UUJB 5D93C 4MHHI 1QFWL 1B4RA 1LEIB 1E28A 4JPWH 4GO6B 5ANME 5GQBA 2ITCB 3FB5A 4YBHA 4APQC 1NL0L 2E7BA 3BP7B 4OZFH 1KSRA 1H8NA 5D7IF 4MNGA 2LTQB 3SGKA 2CKBA 2EDQA 3A6CL 2R0WL 3WS6C 3BESR 4EI5C 4LCIL 4YDLC 3AM8C 5L2JA 3RWGA 4EUPG 3O41A 3G04A 2OZ4L 4KC3B 2AV1B 1ZTXL 1AGCB 2NY5H 2E9IA 1CXEA 5JOFA 4X83A 5DUPL 2FSEA 2BHZA 2XT1B 5DQ9B 2FH8A 3E1F1 1MFCL 1NBZB 1A6TA 4XPBL 4D0DA 4N0UB 3AREB 1FG2B 1X4ZA 2QKIB 4KKNA 3I50L 5CLTA 4UILL 5ESAA 4AEHL 1A3LH 1FNFA 3LRGA 1F58H 1Y18B 5C7XL 4ZSOA 4ZFFB 4KK5D 1LO3H 5H35A 1MCIA 3EJYD 1JHTB 4TOYH 6CGTA 1MHCB 2DQFA 1CDGA 5MERA 4X0KB 1R3JB 2DTML 4ODSL 5HVHC 4JQXA 4LSTH 4GKSB 3CH8A 2EYTA 1G0DA 2F53E 4P2OB 5J13B 3CXDH 3V52H 4DKEH 5ADPH 5CSZB 2FRGP 5BOPA 5CFHA 4YHLH 3OR6B 1HHJB 2I5YL 2CKBL 1GJIA 5JW3H 2SEBA 2BCKB 3QQ3A 1FO0L 1P7HL 4J4PC 1A7NH 3MRRB 5BO1L 1GPOL 4PJBB 4KQ4L 4ALAL 4KKLC 4OZFB 1DN0A 5DJ8A 4KVNH 3D39D 2B2XH 3WEXA 4JN2B 4NWTL 3TBWA 5DMIL 4GAYA 2A9NH 3VXRA 4APQA 1CVRA 2N7BA 3VFTA 3NFNA 1FH5H 4BZYA 1RURH 1Z3GL 3WS6A 3O6FA 1CGSH 4EI5A 3EYUL 1IARB 3AM8A 5GS1C 3T0AA 1NJ9A 4OFKA 3LS4L 3MXVL 4MJ2A 4XVJH 3SDXE 4J6RH 1SYVA 3UP1A 35C8H 1FJ1B 1B0WA 2CO6B 4QRRE 3IF1B 1X4YA 5DMKA 4OB5H 3BEWB 3TT3H 5IR1A 1NAMA 1KCVH 1YEGL 43CAB 2AJZB 2EE2A 2VH5L 3V4PH 2DLFH 2YN5A 1HILB 4G5ZL 3UROR 3SGDH 1B0RA 1BIIB 5I76A 1T7VA 3B5TA 4LPYA 5C0CB 1I7ZB 1IM9B 3EYVB 3HNVH 3TVMC 2N1KA 3L95B 1GIGH 1G7HA 3FB7B 2AS5M 3MCKB 1HHIB 4EUPH 1R3KA 1RIVL 3BX7C 3Q1SL 1N6QL 3KPPA 3U4EA 3PGDA 4P9HH 1IGJA 4TUJB 4S0TD 4IDLA 4KU1A 4JDZA 3FQTB 3A6BH 3N9GH 3FOLA 5LBSH 4JY5L 1A2YB 4J4PA 5DEFB 1FVEB 4OF7A 5CINL 4ENEC 2X4OB 3OAYK 3OKLB 1FRGH 1I3UA 1MFBL 5JMRA 2ESVD 3G5XB 2NTSP 3VXUD 1B2WL 2H32H 5FO8B 1FORL 1A6UL 4GRWH 1XZ0B 4HS8L 3JBG7 1WWAX 3F5WB 4ZOBA 3RX5A 4G6FB 4XAWH 5DRNB 5FYJH 1CGXA 4IMKC 3WSQL 4Z5RA 1C16B 1T1YB 2BVQB 1A5FL 3MJ6A 4JFXB 1UWEH 2X4TB 5GS1A 4MAYD 3THMH 4MXWL 5HDQH 3G5ZB 3X13A 4HKJA 2GTWB 1MI5A 3ROLB 1EO5A 3VD5A 3P3YA 3V9FA 3PIQA 4JKKA 5DDHB 3O4LE 2VABA 2XA3A 1FZOA 2DYPA 1S3KH 3BUYA 4KVCH 3JTTB 5IIEB 5L2KE 1HH9A 2NZ9C 4EUPB 2C7UB 3B9DA 5D72H 4NO5B 4LFHD 3TVMA 1I8MA 4GH7B 2VLKB 1S7QA 4FQIL 4WI7A 4HSQA 1RIUL 4Z7UB 4WHDA 1WV7T 4P9MH 4UV7L 1HZHH 5FCUL 4C55A 3BIKB 4KTYA 5D6CB 2W9DH 1OM3L 3BMVA 2I25N 3S4SA 4LDOB 3UTQB 5E8PB 1OWWA 1EMTL 2NW2B 3QIWB 2H32B 1H3TA 4NFCA 4KAQL 4POUB 4IIQB 3MV9B 4GRWB 3T0ED 3PWUA 2B1AL 4OV6F 3ULVF 4HIXH 5DJ2A 4M8VA 3KPOB 1IGIH 3MLVH 4MWFA 4EDWH 4OCXH 3DETD 1OAKL 4HGWA 4LARL 1SMOA 1MCSA 3C87A 1HDMB 1J12A 4R9HA 4ELKB 5T3ZE 4IMKA 3RVVD 1T2JA 3GHBL 3GO1H 1KTDB 5JHDB 4N0CC 3CFKB 1FLRH 1S78D 3SDCB 4PJCE 4QHNB 4F37F 1ZVYA 4L8BB 3RX8A 5AYQA 3JWDC 4XNMB 2HN7B 4X6EA 2EO9A 1AD0A 2BSTB 2H2PC 3WE6B 1KG0B 5HHXH 5L6YH 1WT5C 4NZRL 4HS3A 3MRBB 1CF8L 5M94B 5GRJL 1ADQL 1YYML 3ZDZE 1A4KB 1TNNA 1MUJA 4E41B 4JQVC 5FM4A 4Q9QH 2Q7YA 4AQOA 4OD1H 4YE4L 4H1LA 4OZIE 5DJYA 4U6XB 3RJDA 1T1ZB 1QBML 4JANA 3SKJH 4WU5B 4XH2B 3GSNH 2CK2A 2NY0C 5B39B 5T1LB 1FFOB 3LSOA 2NXYB 3QEHB 5T5FL 1YY8A 2OTWB 5IQ9B 4JJ5B 1FV1A 4HK0A 4IS6A 1CFSA 1XGTB 3MCLL 2EDJA 4YIQA 5HDBE 5HBBA 1EFXD 2WINA 2Y5TA 4DW2L 4MA8H 3P2TA 2ICWI 4RGNC 4TYUA 2BRRL 5E6IC 4KY1H 5DJZB 3S34L 5D7JC 1KJVB 2AAVA 1BVLA 2NLJB 2RB8A 4Y5VC 4NQTA 2OJEA 2AEIT 2DQEL 1VB9A 2Y07L 4MXQD 1YPZF 4XCYB 3V6OC 1LDPL 4Z7NF 3BD4A 4TSCL 2PW2A 1MCOH 3D5OF 1PG7X 4UZGA 4XP1H 2LTQC 5EC1B 2EYRA 3P9WB 2AJUH 5FF6B 4ZO7A 4JO4L 5DHVH 1R5IA 4FHBD 1IAOA 3B2UC 3O8XD 4CU8A 4HKXB 2ADIA 3VRLE 1LO0L 1NBYB 1EXUB 3ULUF 4CRPA 5DC9B 4C56A 4GLRI 2BNRB 3HZKA 1WT5A 2HT2C 5HYJB 3EYSL 1A9EB 1RJZB 2NY1B 4HX1A 4M00A 4JQVA 3T65A 2X4SB 3AREC 3UPRB 4F33B 3NCEB 1XGPA 3GSNB 1MF2H 4ZODA 4OI9A 1RZIA 4L9LB 3NIGF 3C60C 4WNQA 3O6FD 4M5ZL 1QR1B 4DKAA 2EZ0D 1GSMA 5KS9E 4NKMB 2LU4A 3N06B 1LK2A 1G6VK 5D7LE 1OY3B 4YR6B 5KZCB 4BSWB 2Q3AA 4ZMAT 4GXVL 4G6MH 3I6LD 4OCSH 1OAZL 2APFA 5IEHA 3L3OB 5J13C 5FO9B 2D2OA 2VAAA 1Z0MA 4JRXA 4MD5A 3V5HB 4GSDH 3BDXA 1K6QL 4UV4L 1S7WB 2CJUH 3GBML 4QT5B 2W91A 3ARFB 5E6IA 3PV6A 2W0FA 2MFNA 4U7SA 1U36A 4O4YL 5D7JA 1INQA 4U6VL 1FFQA 2IH3A 2IPKA 4HH9B 1F3DJ 4Y5VA 3U1SH 5DGQA 3IVKB 1HQ4A 4TUKH 3LRSA 3V6OA 5GGTL 5DHVB 2HJLB 2EICA 4F8QA 3IFLL 4NDMA 3MNWB 2LAAA 5EU6A 2DMKA 1RUQL 1QSFB 2NY5C 2KZ1B 1NUFA 4WI5A 1LWRA 1CN4A 1KPRB 4Z7QF 2DD8L 4OF6A 3E8UL 1Q1JL 1V8HA 1AGCA 1NCNA 5TE7H 3BO8A 2CPCA 2E7CA 1HYSC 4QLRA 4XWOC 1E27A 3VXSB 4K8RC 4LPWA 2APWA 4NPYB 1YY9C 3ARTA 2R9HD 1JIBA 1A14L 4N0UA 3AREA 2J88H 1FG2A 4Y16D 3VXMD 4F2MB 2NY7L 2UZIH 3G08A 4MAUL 3G6JB 3KPSE 2DQTH 4JPVL 5DHXB 3C60A 2K7PA 2R1XA 3BXNB 3HZVB 4JFPA 1JHTA 3NBNA 5LAXA 3X3FH 1MHCA 3I6KB 4X0KA 1R3JA 3BJ91 3TBVA 4JPIA 4MMXC 1MI5D 5DJXB 1JYWA 1SY6A 4HWZA 5FA3B 2AK4B 1KEGH 2F53A 1AP2B 2X1WL 2DYPD 5GGVH 4J3TA 1IJ9A 1CGYA 2XN9E 3FCTB 3OR6A 3U0TB 3WIIL 4K3JL 1HHJA 1ZGLP 5GS3A 4BZ1H 1T6WA 1EUUA 1F02I 1KGCD 1QNZL 3MRRA 3TVMD 1Y6KR 4LLQA 1PG7L 4PJBA 3LB6D 4Z7WF 4OM1L 12E8L 5IHUH 3PWPB 2CKNA 4OLUH 5ESVB 3B4NA 4OTXL 3SDAD 4OJFL 2FO1A 2PYFB 5HGDB 3WIHL 4QTHA 4OIAA 4MHHG 5F21B 15C8H 4P2QD 4P59L 1NAKH 2KH2B 4K7FA 2VXVH 2HRPH 2BNQD 3S9DB 3FQNB 4XCFH 2FD6H 1MSPA 3NZHL 2A6KA 2AJSH 3KPLB 3DXAE 1F6LL 4D94A 3DRTB 3RZWA 3DUSB 3MBEC 5GGSY 1SY6L 4PRPB 5BMFL 2YD9A 3OJ2C 4POZC 3BEWA 1NC4B 4HJGB 2NPLX 5DFVD 3P4MA 1MHEA 2DQIL 2E6PA 3WXWH 4KKBC 4OZGF 1I7ZA 4K3EL 5LCVL 1JGVL 1G0XA 3FB7A 4NJ9L 4JREB 5CIPH 3MCKA 1AO7E 3GI8L 4KI5F 3IDUA 1IFHL 4P9HC 3C8HA 3CFCH 5KVDH 4JZOB 2A9ML 5FGRA 3A67H 1NUDA 4K55A 5T1KA 3EO0B 4KUZL 3S88H 4CDGC 3EZ8A 3DSNA 4WW2B 4HUXB 1E4XI 5DMJB 3GUTA 4TUJA 2NZ9D 4OQTA 1BF8A 3BKYH 3FRUA 4RMSA 3QIWC 3SQBA 1A2YA 3SGJA 5DEFA 3TA3D 1IC7L 4XWGL 4K7PH 4JAMB 4LAQL 5EZIL 4YXKL 4OZ4B 4K8RL 1T83C 4LASL 1UXWB 2NZIA 4HF5L 4P49A 2BVPB 1FNEB 1MEXL 4HIHA 4I3RL 5E2WH 5I1KL 2BVQA 4ZS7L 3U9PH 2HTKC 2R39A 4OLWL 5CILL 5JQ6L 4HUMB 4KROB 5C0DB 4NN6B 4P5KA 2L4OA 5IVZA 4D0CB 1JK8A 4BK4A 3MBEA 5DDHA 4M6NL 1HNGA 5IB4B 4X4ME 1UEMA 1R3LB 2IQ9H 3PNWA 1MWAH 3JTTA 5CIPB 1WIPA 1BJMA 4GMTH 4JPKL 4OQTL 2C7UA 4EUPA 3FFCE 1EEUA 1VACB 2EIDA 4HFUL 3QA3B 4YUEH 2NTFA 1GZQA 4Y4FB 4NO5A 5SWQA 4KDVA 4AENB 3OPZH 4J3SA 1KTRL 4YBQC 4N0CD 1JZ4A 4LNRB 3WKMH 3WV0A 4JB9L 1RZ7H 3BAEH 3BIKA 4C56D 5GZND 4KGLA 1CDBA 2NXYC 4KZDH 1OSPH 3UTQA 4LHUG 5E8PA 2BVOB 2G2RA 2NW2A 1I1AB 3CFDB 3ME0A 1WISA 3QIWA 3RVWC 1UM6H 4N1HB 1BIHA 4ORGB 2X89A 3VD7A 3LVEA 5I66A 4QOKD 1T6VN 5JPMB 5IROC 3RQ3A 1T89C 5B4MD 1AXSA 1IQWH 3AXLB 1ZEAH 4UIKL 3KPOA 4XC1H 3OKMB 4PRNB 1T83A 3QDJB 2R1YA 2A83A 2QTEA 3U79A 2P43B 4NSKA 2RJMA 2NY0D 1VPOH 4NQDA 4YDVB 4WY7L 1CXHA 5I9QB 4EBQH 4KWUA 1UA6L 2D7PA 5HI3C 3KPMB 2O61B 3L1OL 4RGND 4YHOL 7FABH 3JTSB 1HINL 1MWAB 2CUHA 5I8EB 4JFFE 4XNMA 5E6ID 2BSTA 1XF5B 3JV4B 5D7JD 2YD7A 1E6OH 3SHSA 5KVMC 2AW2A 3MRBA 4J3WA 2LU7A 1UACH 5DD6B 1G0YR 4JFHE 4Q97A 4OM0L 5CUSH 1MAML 4HKBA 5FHBL 2GJZB 5T1MB 4R4NC 4O9HH 1RUMH 5SWSE 3VJ6B 1WTLA 5BV7H 4OZIA 3OZ9H 4L9LC 3CXHJ 3QUYA 4HPOL 4QRTB 4AH2B 4RISL 1KPVA 3EDDA 5I71C 1LEGB 4WU5A 5IJVA 2YMXL 3M8OL 4MJIB 2FJFB 2AJXH 4PV8B 3QFDA 3QNYA 3H3PL 3QEHA 1KB5H 4UQ2B 2HT2D 3BSZL 5T3ZL 5EZLB 2OTWA 5IQ9A 4W6XB 4IRSC 4JJ5A 3H9HB 1DVFB 3GSQA 1NGXA 3FRPG 2IPUK 3I3EA 4CMMB 4HLZH 1WICA 2HG5B 5IROA 1T89A 1QKZL 4M1DL 2VL5B 4NQCB 3C60D 4P4KC 5AUMB 5DJZA 1QFUL 1RK0A 2JLLA 2VLJB 4DVRL 1J5OH 4I18B 4FTVE 2CXKA 3DX9B 4OLVH 2WAHA 3JWOL 4Y8DC 4P5MA 3QUMH 4BM7A 4WGVB 4LCYB 2F53D 1BGXL 5HYQA 1JWUB 4FQJH 1OGTB 1KJMB 5KTEH 2FEEI 1ZE3C 5E1AB 5C0IB 3QIBD 1BPVA 4G3YH 3TV3H 1C5CL 2FX8H 4JM2F 1K4CB 4ZO6A 3SDDC 4UB0H 1P6FA 1NBYA 4Y4HB 5AEAA 5HHVL 2BNRA 4WEMB 3G5YA 5JOEA 2P8PA 1NMAH 5E2TH 4ZNCD 5BV7B 5HYJA 1N0LA 4WCYL 3LDBB 4Q9RL 1JYNA 4I3SH 5J7CC 4JFOB 5TQ2L 4F33A 2DQCL 1ERNA 1IAKA 5I8KH 5ETUA 3KR3L 2X4RB 4R6UA 2X09A 4L9LA 3T3PE 2ZCLL 3LKSB 1KB5B 1H3GA 4K71B 3WLBA 2JK5B 3GIZL 3ZT7A 4BSWA 3TBSA 3FONB 5INDA 3HS0A 4RBPH 3QXAB 4XWOD 3TT1L 3ARBB 1J0JA 2ZSVA 4QRRD 4GBXD 4K8RD 5FO9A 5F7DA 1A6WL 1DEDA 1YY9D 4IRSA 3HE7B 3V5HA 3MLPA 3IDNB 3QO1A 5LXGL 5GGUA 1RULL 3HC3L 3QUMB 4U1MA 4P4KA 4HQQL 2QHRL 2CMRH 1IGFH 1MRCH 4KQ3L 4LHUB 3VFSA 1UJ3C 2ZUXA 3V0WH 5J1SC 4XI5D 4RAVA 5DVKA 4G6KL 3IDYC 1JHKH 4DK3A 3MNWA 4R2GC 2FYYA 2DS4A 4WTXA 3RWJB 1JZ8A 1WIOA 1P7KB 2DQUL 2BNUB 3QRGH 1NFDB 4LLAA 4XPGL 4MB5A 1MPAH 3MRDA 3SDDA 1SJEA 5FAAA 3QUXB 1DDHB 1T7WA 5TGBA 1DTUA 4NRYB 1EVUA 1OL0A 4DCQB 1ETZB 3HRZB 4WHTA 2MOVA 1R5WB 3DV4B 1XIWB 3SDYH 2XICA 4ONHA 1RJYA 4PIRF 4PJAF 3BIBX 3IKKA 2G60L 4I77H 3OKNB 3I6KA 1OSZA 4LSSH 1X5LA 2DQGH 1CE1H 2CDGA 5DJXA 3MBED 1JTOA 3O81A 2AK4A 3D3VE 3O4LD 4KK6C 1WZKA 3U0TA 3FCTA 2R8SH 4UT6H 2XN9A 3V4UH 3PHOB 5L2KD 3MLYH 1T20B 5GSRB 4YHZH 3BGMA 2DIBA 1TVDA 4FP8H 4I0PC 5AWNH 1DP0A 3REVA 5D7SL 4OIIH 1XCTA 4XCEA 1MHPL 1U8LA 1UJ3A 4GW1B 4KHXH 3HMXH 4C83B 5C6TL 4W4OC 3MV8B 3AU1B 5EOCJ 1RUPH 4HZLA 3AS3A 4FQXB 4WIQA 4JN1H 1QYGH 4LLMB 5D7KE 4G8IB 1WIUA 4PJHF 3MUGB 3S3PA 4KROC 3VFOA 1BQLH 2X89D 3HZYB 4NN6C 3W11C 3WMSA 1F2QA 3KPLA 3C8KB 1FIEA 3DUSA 5GHWH 1M7DA 4PJGE 1KLFA 4WWKD 5DHYB 1SYSB 4HJGA 3QUKB 3ZHLA 4NNXA 3VH8B 4NQDD 4XVUC 2GJ6E 5HI5D 1WBYA 1NFIB 2HTKD 3GHEL 2EYSA 2HA1A 4KMTL 3UC0L 4JHZA 4Y5YB 1YEDA 4K7PX 4LU5H 5MENE 4HV8B 4UT7H 4BH7A 4OSUH 4OF5A 2IF7A 4OT1H 4RDQG 2VWEE 4HUXA 1AFVH 4M7KH 2R0ZH 3SE4C 5JPNB 3QB7C 4GLRH 1RFDL 5F96H 2CLVA 1I1AC 2W9EL 5TDNB 1DZBA 4Y19A 3QNXA 4FQ2L 2WIIA 1CXIA 1HCFX 3D9AH 3ZE2F 1NCDL 3LKPB 4I0PA 3T2NL 1Z9MA 4YBQD 3H9ZA 4R90L 1Q9WB 3HAEG 4JAMA 3QUYD 4RX4A 3CDCA 4QXWA 4V2BA 5E2VH 4ZUWB 4B50A 1UXWA 1U3YA 1PZ5B 2HMIC 2UWEA 4W4OA 5IB5B 2EH7L 1RJLB 3OTTA 5IWLC 3UO1H 3TCLB 4M6ML 2ICWB 4AMKL 5F7YC 4U6YA 2R23B 4HCRH 4KRPB 4JDTL 4D0CA 4M7JH 3TZVD 1JI1A 5IB4A 1BM3H 1ZANH 3LKQB 1V7ML 1DQLH 5IB2B 4NQEB 1CT8A 4X4MA 5DUML 4HPYH 2OS7A 3FQWA 2W59A 3HB3C 5CBAB 4FQQB 3QEUB 4D0BB 2DLIA 5HI3D 5C0JA 5EO9B 4A6YH 5DSCA 3LZFL 4XNXH 4LOUC 1INEH 2E9BA 4ODWB 5IOPA 3SO3C 2BJML 3SE4A 3BKCH 4P2YA 5BS0E 1NMBH 3P4NA 4CGTA 3E3QC 4PRIE 3Q6FB 4DAGH 4YAQA 3C6LC 2VSCA 3CFDA 2OTUA 1XGYL 2VC2L 5JR1H 3QJFB 3CK0H 5E8DL 2FHBA 3WBDA 2RGSA 5C70A 2CUMA 3R06A 4L4TB 1IC4H 3QDJA 2DI7A 4B7IA 4DTGH 2ED7A 5D7LD 5FB8B 3RL2A 1F4XH 2IH1B 3GNMH 4Z0BH 3WHE0 1F45A 2JJUA 4IRSD 3U0PA 1PQZA 2P24B 1KTLA 1UKTA 3KPMA 1UKSA 4R4BB 2ATPB 1MWAA 5DVMA 1MREH 5I8EA 2DBLL 3BWAB 4LLWB 4JFFA 4P4KD 4Y4HC 5HHOE 3F65A 2FZ3B 5EH1A 4UQ3B 4MB4A 2VLRE 4O00A 5GS2H 1IGCH 4ZS6C 2V17H 4R7DB 4A6YB 1ZSDA 4UOJA 4HG4K 3AB0B 3HPLB 3N85L 3V6FB 1W72A 2GJZA 4ZUSB 3BRGC 4NNPH 5D9SB 3VJ6A 4KMQA 5SWSA 1KEMH 1N0XH 2DKMA 4KFZC 2WV3A 2ADFH 2QSCL 4QRTA 1JI2A 1TJHL 2H6PB 2VDKL 4PV9B 4ZFOB 3SDDD 1MJUL 5DO2C 5F70A 2G5RA 1LEGA 4IRJB 4KKAC 4MJIA 1AR2A 5I19H 2FJGA 4PV8A 4WI8A 1HWHB 4U1HB 3ARBC 3IRZA 3ZTJG 4UQ2A 1LE9A 1T5WB 1MFAL 4G8GE 3C6LA 2V5MA 5C0RH 3H9HA 3HE7C 1IT9H 1FAIL 5C9JB 3NFPA 1P5UA 3LS5H 3HE6D 4PLJC 2HG5A 3KPSD 2VSDA 3PHQA 2BOCB 3HUJE 1ZK9A 1EBAA 3EDJA 5LGHH 2IANB 4B53A 3DX9A 2NY6C 4WTWA 4H0GA 5IB3A 2D4FA 2X4UB 5L7XH 4LCYA 3MA7A 4TVPE 1EA9C 2V2TB 5D8JL 1NGYA 4FFWC 5TFSH 2XN9D 3MBXL 1WFNA 5E1AA 1E4XH 4RMTA 3PE9A 3O3BA 5H94B 2DL2A 1K4CA 5ACLA 4JG1H 4Y4HA 1BLNB 1I3VA 1F2XK 3BZ4A 5BJTB 4LIQH 4RAUB 2J5LC 1GGBL 3BQUC 1JF1B 4XCCH 4JFOA 4KPHL 4NKIL 4HIEB 4FA8A 1U8MB 4R2GD 3B9AA 5I74B 3QXUA 2X4RA 1AGBA 3J7HA 4I4WB 4S1RL 5EIIB 2FATL 2VDRH 4C4KT 2FECL 1KB5A 3BUTA 1G9NH 4X9GA 2JK5A 3LEYL 5DTFB 3DXAD 1I75A 4UTBL 5ENWB 2IWGA 3QXAA 4X5LA 2VQTA 3ARBA 3DARA 2QHLA 1D3CA 1AGFA 5I1AA 2E7HA 2A6JB 3HE7A 2B1HH 1CXFA 1ZKAA 4DN4L 1MCFA 1S9WB 2E7LC 1I7RA 3IDNA 2Z8VC 4DUVA 1KT2B 2EDLA 4XXCC 4YDKL 5C3TA 1A1MB 1I4FB 4FNLH 5ALBH 1MLCB 4FZEH 1AO7D 5HHQA 1AKJD 1GC1C 4HJJL 5FV1L 5CCKH 1OAXH 4P5TC 4LCUB 3MQIA 3L5XH 5LVEA 4K23L 3QDGB 2Q76B 5I1LB 3CVHH 2BNUA 2MPAL 3P30L 3T2QA 2BVTA 3NPSB 5CZVH 4Q0XH 3CFIC 1IBGH 4X9BA 4TPRH 4PREB 4I0PD 3ULVH 1G7PB 2XG4A 2FJHA 5E2UH 5FHAL 3UMTA 5IMMB 1HXMB 3O2VH 3HRZA 4Z7OF 4HGMA 3BQUA 2CRIA 1MJ7H 2CDEB 1R5WA 3DV4A 4ZG1A 4XBEH 3BP4A 2HP4A 1NCAL 5EOQL 1A47A 4ZXBD 1S7TA 2ZOKA 3X3GL 1BAFL 3IDMB 1MIML 2OMBA 4XBGB 3O3DB 4DUWA 1XF2B 4Y5YC 1DEEA 1ZVSA 3OKNA 4GRLC 1WFOA 2VZ1A 4EEEA 1UH2A 5AD0A 1LO4H 2B4CH 4J3OC 3LIZH 3RRQA 1Q94A 2JCCE 4X8XA 3ROOB 3D3VA 3O6LL 2VWEC 1QQDB 4XNUH 3REWA 4YX2H 1OPGH 2DQHL 5GRZA 2GCYB 2YKLH 4LCWE 4FQCH 2E7LA 1T20A 5GSRA 4JO1L 4LVNB 3FFCD 4EN3B 1NKRA 3TJEL 1JNLL 4LSUH 1S7RB 4XXCA 1EZVX 1NQBA 4X6FA 3SKOA 5CEZE 1DBBL 1OCWL 1IZJA 4XP6L 1EJ6A 3PDDA 4HXBH 4HUNB 1G7MB 1K5NA 2E8ZA 1P53A 4GW1A 4G43A 3CVHB 1QBLL 4P5TA 2A74B 3MJ9L 4PJXE 5FYJE 2EECA 5JMOC 4TNVF 3AU1A 5DJ0B 3EYQC 5MEPB 1WC7B 1N8ZA 1UC6A 3DBXB 3LHPH 2P4AB 1UM4L 1G9MH 2WM0A 1JNHB 2IPUG 1N7ML 2YOCA 1N6VA 1S9VB 3HZYA 4FQ1H 1I9RL 4KRPC 4UDTB 5GJTH 3V5DB 2OR9L 1GL4B 1I3GL 3DROB 1G7LB 2J1KA 4JO2H 5DMGD 4PJGA 3GGWB 3MRNA 2PR4H 4OLXL 1SYSA 4YXLL 2HMID 3OGCB 1H3PH 1A6VH 4XVTL 1BFVH 1XF3B 2R4RH 2GJ6A 1F6FB 5HPMA 4HBQA 5F3HA 2VIRB 4ZUVB 4Y5YA 1NUNB 2FB4H 2VO5A 3F12A 1WEJL 4GRLA 2XWJB 1HIMH 1HHGB 3ARDD 2OTPA 2OK0L 1SVCP 1GC1L 4YHPB 1BX2B 1EO8H 2F54B 3OKOA 3KWWA 4JFFD 2VNCA 3ULUH 4UINH 1EVTC 3UJJL 5E03A 1FL5B 4U3HA 1VDGA 2XQYK 4KGJA 2M2DA 3IDGA 5KSVB 5JPNA 3O6KL 2WUCL 4MDIB 4JFHD 1ZS8A 4QGTA 4X5XB 3HRPA 1MNUH 2JJSC 3IFOA 5CGMA 3L6FB 3L7EA 5IGXH 1U41A 4Y0GA 5DD0H 5SWSD 5FDWB 4LRNL 1Q9WA 4WFHE 1ODAA 3CFJB 1U8NA 4KJPD 5DZNA 4ZUWA 1ZT4A 3NA9L 5IB5A 4RRPG 5KAQF 1WCBB 3P0VL 3DJ9A 1RJLA 1TJGL 1A7QL 2X05A 1F8TL 3TCLA 4ZFZB 3IDXH 1KLGB 2ICWA 2BSED 3T8XB 4X6DF 3KLDA 3GKWL 5KVEH 3VXNB 4Z8FL 2XXCB 3UX9B 4RAHA 2VDNH 3WHE1 3EGSB 3MPCA 1YPZB 3LKQA 3QEGL 5I1HH 5IB2A 4NQEA 1DBKH 5K9QG 1XR9B 3V95A 4FTVD 1CL7L 3STLA 4YNYB 4EDXA 2H3NB 4FG6D 2NY2D 1A7OH 2BVUA 3AB0C 4GAGL 2Q8BH 3I3DA 4E42B 5HYIA 3FN9A 3CVIL 1GGYA 3KS0H 4D0BA 1AXTL 3RI5F 1VCAA 1AQKH 4IDJL 4YH6A 4Y4KB 4CMHB 1A3QA 1DBJH 5EBMA 4XC3H 4IRJC 4ODWA 2V7NA 3GRWL 3K1KC 4PD4K 4QNPF 1N5YH 1AR1C 4F58L 1Y6MR 1AGDA 4NZDA 5ISZB 1VEPA 4ZS6D 2GIYA 3Q6FA 4BKLB 1HKFA 4X7FC 3U9UA 2JJSA 5E00A 5CD5C 3DURA 3QG7H 4UT9L 1J1XH 2UVEA 3QJFA 4HMEA 3U83A 1DUYB 3IXTA 1M71B 1FDLL 3D25B 5FDYA 1TCMA 1Z5LA 5FUZH 5DO2D 1HKLH 1Q0YH 1BP3B 4KKAD 4M48L 2YBRA 5C86A 4PLOB 3UPCA 4AT6A 5H2BB 2DDQH 3U30C 5FB8A 1BZ9B 4UMGA 1FNHA 4ONFH 1F11B 5JTWA 4LLYB 1VKXB 3KJ6L 3MNZB 4DK6A 1PSKH 4I8DA 1A6AB 3VW3L 1U8QA 1CG9A 1GAFH 3QP3A 5MEQB 2YSSA 4PLJD 2E9WA 3OX8A 1VGEH 1A7PL 5HY9A 1H5BC 3WUZA 3L5JA 1DUZB 5J6HA 3BP5A 1LK3L 3DGGA 4UQ3A 3EOAB 2BMKA 2NY6D 3GSRA 2VLRA 4A6YA 3QT2A 1YJDC 3DIFB 3KPQA 1FHGA 3VCLB 2DWDA 3S37H 4ZUSA 1DQDH 1LILA 3MUY1 4FFWD 3P11L 5D9SA 3S36L 2R4SH 4FQLH 3MC0A 3K4DA 2XNAB 1CLOH 2GITB 3C6SA 3MLRL 4NYLA 5CWSA 1YEEL 5TQ0H 4FABL 4PV9A 4X4YB 4ZFOA 1NMCB 3FFDB 3OKKB 3U6RB 2RIKA 1GYAA 3EFFA 3MACL 4OQ1A 4HWUA 4U1HA 5DI8B 3S5LG 3W2DL 1PGRB 1T5WA 3BQUD 4XNQB 3LKNA 4QWWC 4DZBA 4CVWA 4YHMH 5LG1A 2JF1A 1BWWA 5AZ2H 4L8DA 3QHZL 5F1KC 2C3XA 1ZHBB 1N3NB 2BOCA 1BQHG 3DMMD 2FGWH 4P57B 2Y06L 1YMHA 3HUJA 5BZWB 3VG0L 3STZB 2IG2H 5GRUH 3CDGB 3LH2L 5BQ7B 2EXWD 2IANA 5EBGA 2PF6A 3TM6A 4PB9L 4M61A 2RCSL 5DLML 3VWJC 1QVOA 3MRJA 3PWPE 4O58H 1E4JA 1VHPA 4U1LA 2V2TA 3D3VD 3L3JB 3HAEA 1EHNA 5DQJA 5BRZB 1ORQB 3BE1L 4IEFB 3UYRH 4KTDL 1CTNA 2Z35B 2CLZB 4JR9L 5H94A 5ILTL 3NPSC 2FR4B 1CIDA 1YMMA 2IFFL 5HGAA 2CQVA 1BLNA 1H5BA 2DQJH 3ZTNH 3K74B 5B3NA 1QFWI 5IG7B 3DO7B 4ZO8A 4IOIB 2HKFL 4IMLB 4PGBA 4P5TD 1T3FB 5DD3L 5D1QD 2NXZB 2Y36H 1D5BB 3BT2H 4LBEA 4HIEA 4ZD3L 1JNNL 3B9KC 1U8MA 1X44A 4H20H 1JGDB 4I4WA 5IFJB 5D7KD 3GMNB 4JE4B 3IU4H 5CJ8A 1SBSH 3OKEB 2C9AA 4FZ8H 5ICZB 3INUH 5DTFA 4F8TA 2I9LB 3MCG1 2EDNA 5ENWA 1GHFL 2GI7A 3HI6H 2PTVA 5D1ZC 5AG9A 1KELL 4EZMA 1N6UA 1WZ1L 4TVPL 1H15B 4QGYA 4WV1B 3BVNB 2A6JA 2J8UF 4LAJH 1VSCA 2ZCHL 1D5MA 2KUTA 4LVNC 4FFVC 4GG6E 2GJ6D 2G5BB 3KYKL 4WW1B 5IVXF 5E56A 4PJEA 3WNLA 1I4FA 2BK8A 1I9IL 4GRLD 3B43A 3VXPA 3VWJA 4F37K 2DIAA 5MEND 5KVFL 4PTUB 1W8OA 5CBEA 3I02A 1ZLWH 4X7EC 2W92A 4QRPE 1LO3L 5I1LA 3RWCB 4P3CH 4U1NB 4TOYL 4X7CC 3F58H 3BN9C 1XGQB 4L4VB 5C07B 3VGBA 2W38A 1F3RB 2W65A 2GK0A 3O9WC 1H3VA 4O5LH 5TDOA 1SJHA 5ADPL 3V52L 3GIVA 2DI8A 2YPKA 1XGUB 4NN5B 4XCNA 5SX4I 2CDEA 1ZWIA 3VFGL 4YEEA 2ENSA 3B9KA 3OG4B 2V2XA 6FABH 4ELMB 3IDMA 1OD9A 1OGAE 5TDPB 4BQ9A 4XBGA 3S7GA 4L3EB 5D71H 1K4DB 1MH5B 1W0WB 2GSGB 3DUUB 4XTRC 5CJQH 1E4KC 1BEYL 3DVIA 1AE6H 2YC1B 4RNRB 1ZLVH 1BJ1H 2CRZA 5D1ZA 2K3TA 5IV2B 3FHQA 4QTIH 1FH5L 5I73B 1QQDA 5K9KA 1RURL 4PJ5B 1J1OH 2GCYA 3HZMB 1BVKB 4O02H 2VITB 4LCWA 4XVJL 3RNQB 1Q0XH 4LKCA 2YD2A 3ARUA 1XGRA 4JZJB 3CLEH 1SQ2N 1XCQB 4YZFE 3SBWC 3QYCA 1G7MA 5EZOH 4PJBF 4LSPL 2WZPD 2C3VB 4P46D 5DVNA 2A74A 1R24B 3GZKA 4PJXA 1ZHLA 5FUOH 5BZDA 1WC7A 2VAJA 4U1KB 2QADC 5E99H 3QNZA 1N4XL 3HNVL 3W39B 5BS0D 1JNHA 5JA8B 1QRNE 4NM8L 4ONOA 4UAOB 4R7NB 4UDTA 5FOJA 3N50A 3O9WA 3TN0B 3RTQC 3V5DA 4ODUB 2XKNA 3DROA 1G7LA 3MJGX 2YEZB 5F1NA 4Z78A 3ARSA 4HLJA 3F62A 1OP5K 3A6BL 4KTEH 4NT6A 2MCG1 1ZAGA 1XF3A 3FT3A 5DT1L 4NRXA 5DJDB 2Z8RA 4BFIB 4P3DB 1A0QL 5I1GH 4M1CC 3LOWA 4MVBD 4ZUVA 4HXAL 4PJDE 5CEZL 1QBAA 1DE4A 3P0YL 1E4KA 2XWJA 1HHGA 4KXZI 2HWZL 5MHSE 1B4JL 4CMHC 4MJ4A 2R0KL 4MX7B 1KCSL 5T1DH 5CD3B 5FYJL 1WAAE 2P5EE 4LP5A 4ZPTB 5HHOD 3K80A 5KSVA 4OLZH 4ONGH 2VLRD 4QXTA 4QHLB 1NEZG 2OP4H 4MDIA 1HXYA 5HDQL 1QEWB 3QIUB 2V7HB 1CFTA 3L6FA 4L1HA 4DZ8A 5F9JB 4HUVB 1PX4A 3CH1B 3RUGE 1G6RH 1D5ZA 3HR6A 3SBWA 2R69L 3NGBC 1R3IH 1BBJB 2P42B 3T0DA 2Y5EA 3FOMB 3EFDH 2MQCA 1R5VB 2E3VA 2VLJE 4QO1A 2WP3T 3OF6A 1U9KA 1WCBA 4BQCA 2I60H 4NUJA 5D72L 3FQXB 1KIUA 2BSSB 1I7TA 1PEWA 2P5WB 4NUGL 4G8GD 1UKQA 1GRWA 5EPMA 2I24N 3HG1B 3KVQA 4Q2ZB 1HZHL 2O5ZH 2BFVH 3RTQA 1JV5A 4Z77B 1JUFB 2W9DL 3NCBB 2C1PB 3L9RA 4YNYA 1QLEL 1CYGA 4P0DA 2H3NA 5GGRA 4LLVB 3OXSB 3WD5H 4RQQB 1FVDB 4BH8B 4TVPD 1KCUL 1LMKA 4ODXB 3HI1A 3MLWH 4K9EH 3PQYA 4GW4B 4HIXL 4R0LB 2OR7A 3VMOA 1YUHA 1MCHA 5F88B 1IGIL 5C0AB 4EDWL 4OCXL 1DL7L 4PPTA 2G75A 2A6IA 1NMCC 2ZNXA 3MR9A 3L5WA 4N5ED 2FX9H 4Z7UF 5ICXB 5IW6B 1MJJB 5IBLC 5ISZA 3QZWG 2ICCA 4BKLA 1G6RB 3MO1B 1YEKL 1V3JA 4HIJB 1FLRL 1PW3A 2HTLD 4WI9A 4GMSH 1YYLL 3PP3H 3BFOA 4X99A 1WF5A 4U1IB 1S5HB 1M71A 4UIMB 4O2FB 2ZUSA 4X7TB 1AXIB 3D25A 5HHXL 3U7YH 4LSDA 5L6YL 1NGQH 3X11A 2F8VA 1JYVA 3ZKMC 1YEHH 3P73A 3QWRA 3WFDH 4AG4H 4WO4B 1F11A 4LLYA 5FK9B 3SE8H 1WSST 3RHWK 3UTTE 2MNUA 4QWWD 3GSWB 2P47B 3VDAA 1CR9H 2CIKB 2XZAH 4YEFA 1H8SA 2IC2A 3GSNL 2Z91B 1NFDE 4PJ7E 2IBZX 1LQSR 4KK9C 3SKMA 1YNLL 1NGWB 1DUZA 1RZJH 2NY4B 5KBNC 4OLYL 2X1OA 3VWJD 2DM2A 1O5DT 3C09C 3E2HB 4AEEA 3VGFA 1S7SB 4G7VL 1K2DB 5CSBA 4Z9KB 1JZ2A 2NXZC 3NIDE 3KYNA 2C1OA 4MA8L 3VCLA 2WBJB 3SJVB 3FN0L 2YK1H 4ZFGL 1ES0A 3ZDZF 2D0GA 5C8JB 2XTJE 3B8YA 4X4YA 5DMYA 4MDJB 1EEQA 2VDQL 3TIDA 1CK0L 1D6VH 4HK3J 4OZIF 5EU7C 5GPRA 5DI8A 1JWSB 4Z7VB 3RU8L 3L3HB 1QPPA 4P4RB 4XNQA 4NQUA 3VFNB 4WV1C 43C9A 2HKHH 3B9KD 4PB0H 4LDLB 4FFZH 4N0YH 3LQAH 5BZWA 2VDLH 3S98A 5BQ7A 1IMHC 2PO6C 1MCNA 2UY7A 3QDHA 5I17B 4M8QB 1Y0LB 5D1ZD 1JTTA 4WJ5B 2ZP0T 3AS1A 1RY7B 3B2VH 3L3JA 1WBXA 5TPWH 1X5ZA 3D6GA 4PRDB 5BRZA 1ORQA 1UCBH 2Z35A 4LCWD 1X5XA 1OTSC 4FFVD 2P8MB 4X6CB 3RPKA 4MSWA 4RRPA 3QFJB 4GRMB 2QLVB 4CNIB 5HVFB 4OCSL 1P7QB 5CEZD 4JFDB 3K2UH 4WI6A 3DO7A 4IOIA 3IDIB 4W4NA 5TE4L 3I9GH 2IBGA 2R29L 3KLAB 4CL7A 1RZGB 4WHYG 2VDPH 1U3HB 4M7LH 4AL8H 1P2CB 5IFJA 1QLRB 3GMNA 2F5BL 2PUQT 3MA9L 3T2PA 3ZZ1A 1LEKB 3WL9A 4H25B 1I85C 3O9WD 3EUUA 1I1YA 2UYLB 4XNZC 2R0LH 4I1NB 2XZQH 4F7PB 4WUKL 1MIEL 2C4XA 2O5YH 5I73C 3BDBA 2R56L 2BSRA 1YN7B 3BVNA 5D5MB 4CW1A 1JMZA 3NZ8A 1IE5A 4JGJA 4O2CA 3O3AB 1TVHB 5K9JL 4N9GB 4NCDA 3G6AB 3WO4B 3OHXA 4AJ0A 4JZJC 4GG6A 4CU6A 2AEPH 2ZPKL 4JJHA 4OUOA 1I9JH 1MCQA 1RUKH 4HWBH 3QZWB 4XTRD 4WFGE 1NKOA 2PO6A 3MUHL 3GJFK 5ALCL 1I8KB 1TCRA 2QQLL 3MXWH 5CHNA 1QFWM 3SOBL 1BFTA 4H26A 1UWGH 4M62H 1ZHKB 4PR5B 1JFQH 3DVGB 2DWEB 4L29B 4PJ8C 5I8CB 3BKJL 2V9TA 2I27N 4QRPA 3OL2A 1XGQA 3L3IB 5C3LD 4L4VA 4UAOC 3QHFH 4XMKH 5C09E 5DWUH 1X5YA 1FL3A 4JY4A 3RWEB 2EXYC 3TN0C 4TTGA 3KPNB 4WFHD 4DKFL 1T66D 3TPUB 4TRPH 5I1IH 1T03H 1GZPA 5DC4B 4NQVA 5D70L 2DLGA 3TPKA 5F7UA 2A77L 4BZ1L 4WU7A 1EJOH 1WQVT 5DD5L 3HFML 2QADD 2ZWLT 3BPNB 5IQ7L 4NN7C 1QHOA 4ELMA 3HR5B 1NGPH 3G6JF 5DJAB 5D1XB 3DX7A 4PS4H 4XHJC 4RFEA 2GSGA 4G42B 1I85A 3OAUH 3RTQD 2YD5A 3KAAA 5F7EH 2J8OA 15C8L 3FQRA 4LVEA 5SX5H 1MJ8H 5EBWB 1FL6A 5IV2A 3HNSH 4PJ5A 2MCPH 4BZ2H 1CU4H 3IT8D 1BVKA 1XR8A 3IAPA 5FXCH 1AGEB 3QAZB 2B0SH 4JZJA 3D39B 3UZQA 3PQYD 3VD4A 3S5LA 4R8WL 1SBBA 1R0AL 4NO0A 4GW5B 4EI6B 2C3VA 2I26N 3LQMA 4L4TE 4NKOB 1BQHA 4U1KA 5EOTB 4PJ8A 3UJTH 3W39A 5KZCD 5DK3A 2FO4B 3TNMB 4NHUA 3D48R 4H8WL 3BHBA 3I84A 5DEGB 1NBVL 3X14B 4S0SD 4R7NA 4F3FB 4MQSB 3A67L 4R26H 3ZT6A 1XF4B 3TN0A 4K07A 3BEVB 4ZDHB 4HW6A 2YEZA 3GBNH 5DJCA 2DKSA 4PGZA 4U1JB 4X98B 1EFQA 3BKYL 4NC0B 4JFYB 5TH2B 3QWRD 3T77B 5D7IE 4JQIH 3DVNB 3GSUA 5EUOB 3IETA 5DK2B 1FFNB 3WXVL 1JGUH 1ZA3B 4R0LC 3WDJA 3NPZB 1RD6A 2O5XH 4PJDA 2JTDA 5C6PB 3KXFE 1RIHH 3QCUH 1S9XB 4WUUB 2VE6B 4MX7A 5CD3A 4XPHH 5HPOA 4LSVH 3RL1A 1MCBA 3P4OA 1YNKH 2MKWA 2P5EA 3TNNB 1A1NA 3U9PL 5BVPL 4XP4H 1QFWH 3IKCA 3KLHD 2UZYB 3QH3A 4LF3A 1TZHA 2V7HA 4ZOCA 1U58B 2ESVB 4OBSA 3VXUB 5F9JA 2EIBA 4NQXA 5J56B 1NL0H 5E24E 5DD1L 5J9PA 2HAZA 1KPUB 1NGZB 1FC2D 3H0TB 1BBJA 4Q6IB 5HGHB 5I8OH 3P9LB 3A6CH 4Z0XB 3FOMA 1F6AB 4LCIH 1G1YA 5BXFB 1TNMA 1RZFL 3VMNA 4F7CB 2OZ4H 2AK1L 4JZNB 1ZTXH 4YUEL 1TITA 4WO4C 2UWEF 1BWMA 4MAYB 3LMJL 5DUPH 1P9MC 3UYPA 3VGGA 3HG1A 3RIFF 1KN4L 1TQCC 4XPBH 3BGFC 3QEQE 3QULB 1RZ7L 2WMPA 2VZSA 4UILH 4P23D 4AEHH 1TTGA 4D9LL 2VN7A 4KZDL 2PYEE 4OAWB 4K9EC 3BISA 1N59A 3TO2B 3VFPB 4FXKB 4LLVA 3OJDA 4ODSH 4GKZA 2WQRA 4PFEA 4BH8A 3U36A 4LRIC 1A6ZA 2A1WL 3V0AC 4XRCB 1IQWL 4R0LA 3RVUD 4XC1L 5C0AA 1HEZB 2XTJC 2I5YH 2CKBH 4MS8D 1BQSA 4DEPB 2C5DC 3E6FB 1FO0H 4QKXB 1OAUL 4FXGB 5IW6A 4KK9D 3IRPX 1MJJA 4WGWB 1GPOH 5BO1H 4EBQL 3DNKA 4KQ4H 4ALAH 3GSOB 1MRDL 4P99A 3T0EB 5HI4C 4NWTH 4HIJA 3NN8B 5DMIH 7FABL 5SX4H 1U2CA 5ESQB 1NC4D 1NDMB 1YN6A 3CC5A 2HFEB 4U1IA 4UIMA 5EN2A 5ERWA 2YA1A 2IMNA 4JVPA 2QSQA 1FYTE 1DN2A 1Z3GH 3TIEA 3EYUH 1UACL 1U3ZA 4UTAL 3MXVH 4KZEL 1EHXA 3L5HA 4WO4A 4RCAA 1U8HB 3OSKA 4NWUH 4PJFB 4MJ5A 1P9MA 3BPOB 1TQBB 3EYFA 3V8OA 3MZTA 4ZYKA 3OZ9L 1YEGH 1KENL 3UTTA 3GSWA 2VH5H 1FE8L 4G5ZH 2YRLA 1R3HB 5KN5A 4MA3B 2HJKA 1JPFB 4PJ7A 4HIIA 4ODBD 1NGWA 5LQBH 2F58L 2YXMA 2FLBT 2NW3B 3W82A 3RDTD 3QQNA 3SCMC 4OD2A 3B83A 4BFBD 1RIVH 3K0WA 4LRIA 2CKBB 2JE8A 1GOGA 3C5SA 1WZLA 1DQJB 1FO0B 4V1DE 3RWGB 1NLBL 3O41B 1IGYB 1QOKA 1J5OL 2V2WA 4QRPD 3G04B 5ICYA 2HT3C 4PBWD 1HI6B 2D7OA 4F15B 4KH2A 1OTSD 3BH8A 3EYOA 5D4QA 5JOFB 1ACYH 2FSEB 4JY5H 1LVEA 4Z6AT 4TQEL 4BUGA 3VWKC 5CINH 1C7TA 1MFBH 3L3HA 4D0DB 1EFXB 3OWEA 3LQAC 5F7NC 1PG7W 1K85A 4OZHE 5ESAB 2XRAL 1JVKA 1NAMH 1FORH 3WN5C 1A6UH 2LABA 3S4SG 4K2UL 5H35B 2EKSA 4PUBL 4XP5H 4GOSA 3WO4C 5GZOD 4BQBA 2DQFB 1PKQB 3WSQH 4FOMA 2OJZL 5F89A 1A5FH 5EU5B 1OGAD 2DJ4A 1NEZA 5C2BL 2CK0H 4MXWH 1PJ9A 3EOTL 5I17A 4M8QA 4KRNA 4LMQI 4KXZH 3AMLA 4JY6A 2BC4B 4XNYL 3QQ3B 3O8XB 3DX8A 3TLRA 1BREA 3GMRA 1MCLA 4K94C 2P8MA 3DUHA 2X5PA 3ULVE 5D93B 3QFJA 4GRMA 4WDIA 1P7QA 5I6XB 4JFDA 4NO0D 4GAYB 2IAMD 4FQIH 3KYAA 3VU2A 1RIUH 3SCMA 2WUBL 2YD1A 1SMAA 2F74B 2ZUQC 3VFTB 2VXSL 3NFNB 4UV7H 5F1SA 1JPSH 5FCUH 1REIA 3O6FB 1RZGA 1YEIL 4YDLB 3EJYC 1NJ9B 3HLAB 4PJ8D 3Q48A 4I48B 1OM3H 3IS1X 2CMRL 1IGFL 1T22B 1QLRA 2OXHA 4XMPL 3CUPA 3JVGC 1QRND 2W9LA 5C6WH 1EMTH 1JWMA 5KOMC 3D87B 2A38A 2XWBA 4H25A 4JKPH 4KAQH 2RBLA 3VWKA 1NAMB 1ZGLB 2UYLA 3LQZB 1LE5B 4FQPA 2ENYA 1E6JL 5FO7B 1B0RB 5D5MA 2AJ3B 5JHLH 1OAKH 3WN5A 4G7YH 4LARH 4LKXA 5FGCB 3QAZC 4X9HA 1G7HB 5H37G 4K3HA 4B0MM 5ID1A 1R3KB 3IDJA 5HVHB 3GHBH 2AQ3A 1TJIL 3QDME 4HUWB 3CZJA 3CFBB 2VUOA 4GQ9H 5MHSD 1K8DA 3U4EB 5D6DC 3PGDB 2X9YA 1IGJB 4HGKC 3CXHK 4XZUB 3V0VB 2P5ED 3FOLB 2H2SC 1LP9A 4H0IA 4L29A 4DGYH 5I8CA 2IPTL 4E0RB 4JEGB 4NZRH 4JRYE 1ADQH 3UTSE 3M17A 1YYMH 3QWQB 3ZE0E 2IALA 4DGVH 5K9OA 3BRDA 2FDBP 1XH3B 1AQDA 4M6AA 1EGJA 2G9HA 2Z4QA 3IFPB 3DLQR 1U92B 3VXMB 2R8SL 4Y16B 1YPZE 4Z7NE 1Q72L 4Z5RB 3MLYL 1QBMH 2GK2A 4KUCF 5GS1B 4J12A 3BW9A 4HKJB 1F4HA 5T5FH 1AH1A 5DJAA 3JVGA 5HYFA 1MI5B 3MOAL 4KHXL 3MUZ1 3PIQB 3HMXL 3RAJH 5A2JH 3MCLH 5GGSA 4DW2H 2DYPB 2UY6A 5EBWA 2BRRH 5IB1A 2ORBL 3S34H 3CGTA 3BD5A 1CQKA 3VXOA 3TVMB 2CDFB 3V6ZB 2YWZA 2DQEH 2Y07H 3D1MC 3NIGE 1CLYL 4YC2B 1AC0A 1JPGB 5AYUL 4TSCH 3ARZA 2YS4A 3CJJA 5AAWA 3SDAB 1F5WA 3GBLA 1FN4B 1TZGL 1EGJL 3OJVC 4Q6IC 4H1LH 1JN6A 4JO4H 4P2QB 5D6DA 5I1DB 2WANA 2BNQB 2Y72A 3S4SB 4DOHB 3FT2B 4NKOA 3QXDB 1OF2A 1IM3A 4MAYC 3TNMA 4JFEE 5IBUG 5IMOA 3PWUB 3EYSH 5H37H 5FYKU 3I2CL 5DJ2B 4F3FA 4MWFB 4OT1L 3BEVA 4ZDHA 3LPFA 4HGWB 1AFVL 3LPGA 4X98A 4YFEA 1JCKA 4M5ZH 5F1IA 4PJGF 3MZGB 5TH2A 1JL8A 2D4DA 3EOBB 2QV2A 3CLFH 4GXVH 5DK2A 4XMLL 1OAZH 3IJYA 3O11A 2QSTA 3UTTD 4X6EB 3QI9C 5DK0A 1AD0B 3R8QA 2B5IC 3HMWL 2VE6A 4DJMA 5EB9A 4UV4H 4HS3B 4JKMA 2XQBL 5EA0H 4JG0L 1MUJB 2E6QA 3C08L 4O4YH 2QBWA 2ED8A 3MGTA 3F6LA 2BZDA 4U6VH 5I30L 3Q5YA 2MTPA 4XPTL 3T0EC 2Z31A 2B39A 4OCLC 4H1LB 1VADB 1U58A 1MCWW 2XA8L 1LHZA 5GGTH 4M7JL 4QXUL 3W9EB 3IFLH 2ERJC 3GSXB 3DETC 4JANB 1DQLL 1RV6X 5GSVA 1RUQH 4Q6IA 2XTJD 5HGHA 3P9LA 4HPYL 4U2YA 3Q6GL 2X7LA 3O0RL 5BXFA 3LAFA 3LSOB 3E8UH 1Q1JH 3LKRB 4F7CA 1HNFA 4EKXA 5CEXB 1YY8B 3E6HB 4JZNA 4HK0B 4IS6B 1CFSB 4YIQB 4MAYA 1M05B 5E2JA 1TQBC 1S78C 5HI4D 1J11A 3PWVA 1INEL 1JGEA 1KB9J 1A14H 4Z7WE 1CICC 1BVLB 3QULA 4C58B 2NY7H 4MAUH 1J05A 4RWHA 4JPVH 5TF1L 4PY7B 1EDQA 3BKCL 1FPTL 5JORA 4FMFA 5KSBB 1RJCA 4DAGL 4ODHL 3TO2A 3VFPA 4AEIL 1NBQA 5JR1L 3SGKC 2EYRB 5GIRA 1JBJA 3CK0L 1J0ZA 1R5IB 1IAOB 2C26A 1KN2H 3KPRE 2ADIB 3QI9A 3WIIH 1ZT7A 1IC4L 4K3JH 1P4LB 5CJXC 4C56B 5DUBA 3HZKB 1F90L 5A2LH 5JXEC 2GJJA 1PY9A 1XFPA 4GUPA 5K33A 1QNZH 4HX1B 1PG7H 4LGPB 4PRAA 1J8HE 4OM1H 12E8H 5C08E 3SCMD 3T0EA 4OTXH 4OZGE 4OJFH 1P1ZA 3WIHH 1RZIB 1CXLA 1AY1L 5IEKB 5IFHL 1NDMA 2DLTA 4YO0B 2HFEA 3D18A 4KI5E 2OZ4A 1LK2B 1EHLH 2CGRL 4MA7H 3T08A 4QHMB 2NY0B 3NZHH 4HWEL 4YK4C 4OCRH 5IEHB 4U7KA 3VWKD 4RFNB 2VAAB 4LSRH 3RVXC 4RIRA 4NNPL 4MD5B 4PJFA 2ZG2A 2UUDH 1SY6H 1T80A 4RGNB 2J2ZA 3ARPA 3O8XC 1Z9SA 3ZL4L 3W81A 5E6IB 3PV6B 2W0FB 2Q86A 4F80A 3FMGL 4H88H 1MY5A 5D7JB 1INQB 1CICA 3N1GC 2IH3B 4MA3A 4QRUA 2IPKB 1JPFA 4QY8A 4Y5VB 3WFHA 4XP9L 4K3EH 1HQ4B 4MCZA 5LCVH 5I6XC 3LRSB 4NJ9H 4WFGD 5ANMB 4HT1L 2NW3A 3GI8H 5C0RL 4YDJA 4NDMB 1IFHH 3S3JA 5EU6B 4EQ3A 4BQ8A 2A9MH 3M1BA 2X40A 1DSFL 1DQJA 3CX5J 3O6FC 4G9FE 1FO0A 1IAII 2EZ0C 3ARQA 5MEOA 1IGYA 5DEZA 4WFFE 1HI6A 5CJXA 3BO8B 4U31A 1QSEE 2ZG3A 5IT2L 1E27B 5JXEA 3ARGC 5C09D 1I8IA 2BDNL 3OB0K 3KS0J 4S1QH 3WJLC 2D7TL 5GGVY 4F7TA 4JO3L 1IC7H 4XWGH 1NCBH 5DYOA 5ITBL 2PW1A 4OGYL 2FBJL 5TFSL 3DGCR 4X8JB 4LDEB 1EFXA 3HPJB 4LAQH 3G08B 4NZUH 4YXKH 4K8RH 1ITBB 4OZHA 4LASH 2DI9A 3C60B 5C92A 2R1XB 1VGKA 3CSYA 3ZKNC 4JG1L 5I0DA 4JFPB 5LAXB 2H26A 1MEXH 1PKQA 1TIUA 4Y1AE 4WTZG 3TBVB 3K8LA 3BN3B 5EU5A 4JPIB 4FFYL 4RDQF 3LY6A 4OLWH 4HWZB 5CILH 3FB8A 4XCCL 2F53B 3HA0A 5GISL 1VFMA 5SV3A 4EVNB 2ZJSL 1D5XA 2P8LA 3VD3A 3GM0A 2BC4A 3QIBB 3RY5A 5FYLE 1L0YA 4M3JA 3O8XA 4YLQT 1VFBA 1NPUA 4D2NA 2IJ0C 1S5IH 1U93A 5ID0A 1G9NL 2WNGA 1ED3A 4LLQB 4JPKH 4OQTH 4HFUH 1OQXA 3RI5K 3CSBA 4QTHB 2R9HC 4Y16C 4K7FB 4I0CC 5E4EB 2F74A 3DYPA 4L4TD 1L9MA 1BECA 2PXYD 4ZNEE 2H2SD 3HLAA 2A6KB 4I48A 1T22A 4FZEL 2BXZA 5J06A 3C8DA 1CWVA 4UNUA 3O3UN 3ARGA 3IGAA 2X4PA 4GBXB 3WJLA 1ZGLA 1EV2E 2J4WL 3L5XL 5TJWK 3LQZA 3P4MB 1MHEB 4PGCB 1LE5A 5IFAL 1TPXC 4UIKH 5FO7A 1PX3A 2AJ3A 2FX7L 4PRBA 3ARVA 4K7PY 1CDJA 4LNVA 3LB6C 2YA0A 3WFCL 4YC2C 4WY7H 3ZYZA 1IGML 3ULVL 5I15L 4TUOB 4MGXA 5E2UL 3SDAC 5T1KB 1UA6H 4HUWA 3TFKD 3QDMA 4PJEF 3CFBA 3KXFD 3ORJA 3L1OH 2XOTA 4YHOH 2X4NB 3GUTB 3FJTA 3PXHA 3ZDYF 3BPCA 4GQPH 4XZUA 3FRUB 3V0VA 2O93L 2AKRA 2ATKA 1RSFA 4OBRA 3RX7A 4E0RA 1ULVA 2NY3D 2Q1EA 4OCYL 25C8L 2IEPA 2Z31D 4JRYA 4OM0H 2VZ3A 4RWYL 1MAMH 5FHBH 3V6BR 4E9LA 3EBAA 3LIZL 1XH3A 1KLUB 1AHWB 3MRFA 5DFVC 3IFPA 5EO0A 4Y5XC 1U92A 4XNUL 3VXMA 5F6HJ 4Y16A 4HBCL 4HPOH 2H8PA 4RISH 2Q6WB 4HIHB 1AI1L 1ZLUK 1Z9OA 1A7RL 2YMXH 3M8OH 5BW7C 3FT4B 5HD8D 4P5KB 3BSZH 5IVZB 4HXBL 3SQOL 3WJJC 1JK8B 4TNWF 4QXGL 4Z95H 4JVUA 3MBEB 5MI0C 3O4LB 4HS6B 2JKXA 3PNWB 3QEQD 3AS0A 3HNTL 4J23A 4M1DH 1KFAL 5L2KB 2PYED 2NTFB 1GVIA 1GZQB 3TA3C 5SWQB 1OOAA 3RVTD 2CDFA 3V6ZA 3W0WE 3JWOH 5HYSG 1T0NB 1SM3L 3DSFL 2Z0BA 5JW4Q 1JPGA 4RMUA 3CCHA 1BGXH 4NO2A 3SDAA 3WFEL 3LN4A 1FN4A 2PR4L 3QI9D 2EE9A 1UZ6F 5B38A 2NYYD 4P2QA 5TE6L 5I1DA 1H3PL 4LSQL 1C5CH 2BNQA 2AEQL 2E27L 1ADQA 3AMKA 1FNSH 3FT2A 2X1XR 1FBIH 1FVCA 3QXDA 2G2RB 2YUZA 2ZOLA 4PJXF 2J6EL 4N0FA 1EPFA 2EIEA 3B5HA 1M6OA 5I66B 4JFEA 4LLUB 2FEEL 3NCFB 4WCYH 3ZKXC 4Q9RH 1AXSB 4X7SH 3B3IA 4WWKB 5TQ2H 3D85D 2DQCH 1UZ8A 2R1YB 2A83B 3KR3H 2NNAB 3K8MA 4Y5XA 4NSKB 1FYTD 3IJSA 5A3ID 4NQDB 1B0GA 2ZCLH 4OGZA 3LD8C 2EDKA 5CJBA 2YA2A 2XY1A 2DRUA 3H7BB 3EOBA 1AIFA 5BW7A 3SPVA 2FCBA 3IAQA 2X42A 1A6WH 3ARWA 3GMLA 4PJCB 2GEEA 2EDWA 3WJJA 4O2EA 3JUYA 4KK8C 1CICD 3RGVD 5INCB 1KJ2A 5GZNC 2Z92A 5LXGH 4G80A 4LVHB 1RULH 1U2HA 3HC3H 4X4ZA 3UTZB 3OGOE 3QPXL 4L8SC 1MQKH 1CL7I 4HQQH 2QHRH 5KJRH 4HKBB 3PWJB 2HVKA 3TA3A 4KQ3H 1BJ1J 4MCYA 3D0LA 1OT1A 5KVEL 3IAGC 1VADA 4PJAE 4OZIB 5B4MC 3UCRA 3QUYB 5FEBA 4G6KH 3AY4A 3W9EA 5DQDL 5J8OA 1KPVB 3GSXA 1V3KA 4R97C 4V1DD 4I2XE 5I1HL 5IJVB 4WEBH 2DQUH 3QFDB 3DRQA 3QNYB 3UDWC 4XPGH 5A2KH 5JXED 2Q8BL 3LKRA 4RFNC 5CEXA 3E6HA 1J87A 3GSQB 1NGXB 1M05A 4WHCA 4DWHA 2ZCKL 3TZVB 1JMXA 1RK0B 3RFZC 4XC3L 5GRYA 3P4LA 3OAZH 4Z7WA 1KJ2L 4PY7A 5L9DL 2FL5A 4PP1C 4P5MB 5KSBA 3MJ8A 3QG6A 3EJZD 5HYQB 1EUTA 3NH7L 4JCMA 1W8NA 3RVXD 1C5DA 4TULL 3TH2T 3VFVA 2DMCA 2A0LD 1QR4A 2A6DB 2DTSA 3VXQA 4YDIH 4OFPA 4PJHE 3NIFE 3L3KA 3QBTB 3K46A 2YD3A 4AIZA 5FUZL 1UB5B 1P4LA 3QJHA 3G5YB 3ULVD 3RA7L 2DDQL 2P8PB 1KCLA 3HI5L 2VLLA 2C3WA 4L8SA 1LO5A 2VDML 5GGTA 4NHCL 1PSKL 3ILPB 3MNVB 2NX5E 1J8HA 4M93B 1IAKB 1MHPH 3LEVL 2Y4SA 5ETUB 5C08A 4QOKA 4OZGA 5IEKA 5C6TH 4YO0A 3CZFB 3WLBB 4LL9A 3ARRA 5KS9B 3VDBA 5I71B 1QTYT 1ZXQA 1YZZA 1CGUA 5L8KB 5D7LB 3TBSB 2RAMA 5INDB 4QHMA 3HS0B 4NC1E 3UDWA 3ARGD 2ZSVB 4PTTB 3WDIA 5F7DB 5HYSB 1ONQA 4IRSB 3GMMA 3U46A 3CPLA 4PP2A 4Z18A 3QIBC 3QO1B 4XX1E 5GGUB 3PP4L 5TQ0L 4U1MB 4P4KB 2WK2A 1ZHNB 3ZKND 2YXFA 3UYOD 1FNGB 3AVEA 1WLHA 4PJ9C 1MFEL 3VFSB 1GGCH 3SKNA 3GHEH 4RAVB 4KMTH 3QDMD 5ANMA 5D2NE 3UC0H 5D2LE 5DJ6B 5ITFB 4GXUN 1Q8MA 5E4EC 2FYYB 2AP2A 2VDOL 1C08A 1B3JA 1JP5A 5J11B 4B41A 4X9FA 3RWHB 4IRZL 3KG5A 1VA9A 2OL3A 3MRDB 4XVSH 3SDDB 1SJEB 1U91B 5TGBB 3QCTL 1KCRL 4JRYD 4M7ZC 1RFDH 4OCWL 3UTSD 2W9EH 1QSEA 2D03H 4FQ2H 4GBXC 4WHTB 3NACH 3WIHA 1HSBB 5DA0B 1NCDH 4O58L 4RMVA 5GRVK 5CP3A 3T2NH 2H41A 4R90H 1OARL 4X8JA 1HHHA 3DX6A 3HPJA 4ONHB 5L88H 3HE6B 3KPSB 1RJYB 1JHLL 3MJ7A 2AJYH 1CE6A 3WLWC 2OMNA 4A2MA 4UDUA 2EH7H 2DQDL 3IJHA 3H9SE 3ET9F 2ICEA 1OSZB 1BD2E 1H3XA 4CVZB 2CDGB 2DF3A 4AMKH 4YXHL 2EDFA 1MCCA 1BZ7A 4XI5C 4N90E 2Y36L 3BT2L 1T7XA 4JDTH 4EVNA 2XN9B 5JIHA 1KC5L 4JGMA 1MFDH 3TCXA 3QIBA 1EZVY 1V7MH 5DUMH 3BGMB 3SGJC 2OL3L 3ETBF 3IU4L 5KSAC 5FYKE 4YHKL 3REVB 3INUL 1XCTB 1IAIM 4PJ9A 4XCEB 1CLZL 3WHXA 5A43C 1U8LB 1UJ3B 1KIRB 2GUOA 1AHWC 5AAMA 3VDCA 1T4KA 2EDHA 3IDYB 3LZFH 5E9DE 1OWRM 4HZLB 4R2GB 3C5ZC 4QEGA 5HHMB 4FMKA 5F9OL 3CD4A 2BJMH 4G9DB 2X1PA 4ZNEA 3VFOB 3SDXA 4D8PA 3GJFA 4JFED 3DXAB 1PDKA 3ZHDA 1M7DB 3QXTA 2VC2H 4QRRA 4GBXA 4OD3L 4DQOH 5E8DH 2WWKT 4NNXB 4PGCA 4WUUE 1FC1A 4X7DC 3WNMA 3TESA 3CMGA 1FZKA 4NIKB 3WUWG 5FYLL 1WBYB 3I75A 5HGGS 5FECA 2DB8A 1JF6A 1CFQB 2EYSB 1U3JA 2NCMA 1YEDB 1AO7B 1AKJB 4TUOA 4BH7B 5FFLA 3F7PC 4GG6F 1I8LC 2XWTB 4KMLB 2Y7QB 4AK1A 2X4NA 4UNVA 5GS0L 5FM8A 2EEAA 1J0IA 2CLVB 4Y19B 3QNXB 2WIIB 4I0PB 5KSAA 1CD9B 3D2UD 3N85H 3QCVL 4G8FB 1TDQA 4KV5F 4WWKC 1P4IL 1KLUA 1AHWA 5C0BE 1CBVL 1GGIH 1IC5L 4MD0A 2UWEB 2QSCH 4R3SB 4ZXBB 1TJHH 1J1OL 2VDKH 3C5ZA 8FABA 2Q6WA 3TO4D 1MJUH 5HI5C 4U33A 1RZKC 1Q0XL 3Q0HA 1MLBA 4U6YB 2YD6A 4V2CB 3TYGL 1D9KD 2VRAA 3FT4A 1RK1A 4JLRB 1MFAH 5CZKA 3CNKA 4ELMF 1C12A 4MNQE 3ZYIA 3O4LA 3LEXA 4HS6A 1CT8B 5F7FA 1LNUA 1G7IB 1G1CA 5EC2B 3FQWB 1YQVL 4LVHC 3JWOC 1FGNL 3D0VA 5L2KA 1N5AB 3FFCB 3P9MA 5IMLA 5CMAB 3F7YA 4CVUA 5C0JB 1T0NA 4LCCB 1IC1A 5DSCB 4ZTPL 3QUYC 4YWGL 1W72H 2WLZA 5FV2A 3QO0A 3V4VL 1QP1A 5D8JH 4PJIE 3KPRD 1I8LA 1IAIH 5IOPB 3MBXH 4KK8D 2LV4A 4YZFF 1QUNA 3CDFA 3P4NB 3RWIA 4YAQB 3JZ7A 2OTUB 1H3UA 1J8HD 4WTZA 2P49B 3D69B 4ZUTB 1YC8A 5EU3A 5C08D 1CCZA 3ZKSD 5I18L 1GGBH 3PABB 1CFVL 4YGAB 4LLUA 3TZVC 4LEOB 4WWKA 2VJXA 4KPHH 4NKIH 3R06B 2HH0L 4J3VA 3PF2A 4R4FL 4Z76A 1EERB 4KI5D 4ZAKD 3O2DA 3NVQA 2NNAA 3SE9L 5FYJU 5GJSL 2XACC 4OLZL 4ONGL 3RL2B 2FATH 3EO9L 4PRHE 5EORL 3O2WL 3H7BA 3LEYH 1UH4A 3KHOA 1L0XA 3U0PB 3L7FB 1PQZB 2WSKA 4UTBH 1DLFL 1KTLB 2PETA 4MNGE 3KJ4B 4PJCA 1R3IL 3TC9A 4JRWA 4JFFB 3UXFA 5C0FB 2PTTB 4DN4H 3UPAA 5INCA 4U2ZA 3OJMB 3Q2CA 2I60L 3MTRA 4Y2DD 2XTLA 3PUCA 3UTZA 4Z7OE 3RNKA 4PP1D 3CMOL 1HOCA 1ZSDB 2XYCA 1W72B 3VI3F 3T0XA 4YQXL 2AXGB 3MOBL 3PWJA 2W60A 4W6YB 4M93C 3NCYP 1UWXH 2E7MA 3QWOA 4HJJH 1CLCA 4GKNB 5SWSB 1EEZB 4B5EA 4PJAA 5HHPA 4G9FD 4YPGB 4ZSOE 4I2XA 4L3AA 4WFFD 3GSVB 3O2DL 3SO3B 3C5JA 2FJGB 5C0ND 3WUWB 1QSED 4LPUA 4NC1C 2EDXA 3R8BB 3WD5L 1LE9B 1RZKL 3X17A 4DGIH 3C6LB 1FFRA 4M6OL 1KJ3L 1N64L 5FHAH 3NFPB 1OAQL 5EG6C 1QZ1A 4J7RA 3PHQB 3TZVA 1JZ6A 1F13A 2OCFD 1NCAH 1U6AL 5EOQH 4X4XB 2YD8A 3MROA 3X3GH 1BAFH 3BDYL 1EAPA 4Y1AD 3VFMA 5IB3B 1MIMH 4JFQA 1NLDL 3MA7B 3ESVF 3SY0B 2I07B 1MRFL 1NGYB 3VI4F 2FEDD 4P3WA 3VXRE 1YEJL 1D6EB 2OSLB 3O3BB 1DBAL 1DJSA 5J11C 2A6DA 2DLHA 2O26U 1EK3A 5FYLD 5J57B 4U3CA 1WBZB 3U7YL 1EX0A 4CU7A 1UB5A 3BZ4B 3TYFB 4JO1H 4PJ9D 1HCVA 3TJEH 1YECL 1JNLH 5IESH 2X44D 1DBBH 3TJHC 1OCWH 3FN3A 3ILPA 3MNVA 5HVGB 2NX5A 3HE6C 1ZVHA 1Q9KB 4XGZA 5GS0D 2XZAL 3MJ9H 3QRFM 3MYJA 1AGBB 4MQXD 3CZFA 1ZA6A 5KS9A 2QEJA 5E8EB 1UM4H 4G8EA 5T5NG 2CUIA 2DM3A 5D7LA 1ZOXA 2OYPA 2GAZB 1N7MH 4PTTA 5K59F 5JUEL 5HYSA 3TH3T 4ZOEA 1AGFB 5I1AB 1NFKA 2YPLE 1I3GH 4TVSa 1FZMA 4HULB 1BMGA 1GCFA 1I7RB 2AXJA 4OLXH 4YXLH 4LVOC 2RR3A 1RVFL 4GAJL 3WLWD 3BPLC 4YBLB 1ZHNA 4NM4L 1FNGA 1MCPL 5F7LB 3MFFB 5HHQB 2NY6B 2KBGA 2EH8H 3EO1A 4M1GL 5B8CC 5DRXB 5DJ6A 5ITFA 4HD9A 5D2LA 2CIIB 4S2SA 4ZPVA 2HKHL 2OK0H 1GC1H 1A3RL 5H8DA 2XPGA 5KANI 3AAZB 4X6DE 2ADGA 3RWHA 3UJJH 1DBML 1I1FA 2VDLL 3MRGA 1U91A 2WUCH 2GTZA 4S1DD 5KSAD 3U48A 2EEDA 5JNYB 1NSNL 2FJHB 3WYRA 2J5LB 1IEBB 3BQUB 1J1PL 1HSBA 3B2VL 3BP4B 4LRNH 2C3HA 1MCDA 1S7TB 3C5ZD 2ZOKB 1A9BB 3HE6A 1GGTA 4QHUB 1T04A 4Z7VF 2KQNA 3KPSA 3DMMB 3NA9H 3BZFA 4A2LA 5DR5L 1L7IH 1AD9A 3P0VH 3MSPA 1TJGH 1DEEB 1A7QH 2APVA 1ZVSB 3OAYH 3H9SA 1F8TH 2YHGA 4CVZA 2WW8A 5AD0B 4JM2D 3DTXA 3PGFL 2GYSA 2BVEA 4QNPE 3I85A 3GKWH 2X4QA 3MV7E 1Q94B 2VR4A 5A2IH 4PGJA 3D3VB 1LO2L 4Z8FH 3REWB 1IKFH 4J2XA 2R15A 4KHTH 4O51A 3QEGH 1C8PA 2EEBA 1JTPA 1CL7H 2Q3ZA 4X6FB 3SKOB 1CFNA 5J1AB 3O4OC 4NZTL 3IU3A 3W0WD 2JELH 4GAGH 4P2RE 4PG2C 5F7KC 4I0KA 3DOSA 1K5NB 1T0PB 3ILQC 4MQ7A 4X6CF 1K9TA 1KIRA 4G43B 4P5TB 5B8CA 1AXTH 2H1PL 5D1QB 3FO2A 1RMFL 3BI9X 1KF9B 4ZXBC 1N8ZB 4KKCD 4IDJH 1M1SA 2V5RA 3GRWH 1QHPA 1GGUA 4G9DA 2UZXB 4F58H 2GT9A 5K9QI 3MRIA 4X5WA 3DXAA 3VFRA 1G9EA 4PJGB 4NQSA 3MRNB 3QUZC 2JIXA 4UT9H 3UJIL 2BOBA 1TVBB 4M62L 5DRWB 4LQ1A 3P0GB 4Q6YA 1X6NA 4BSJA 5T3ZD 1IL1B 2GJ6B 3O45B 5A1AA 4M48H 2ZKHL 32C2A 5HPMB 1BOYA 1CFQA 3QHFL 5F3HB 1DLHA 4XMKL 5D5MF 4LCCC 2YUXA 3F12B 4GRLB 5FYKL 1AO7A 1AKJA 3KJ6H 1MCKA 5MENB 3OKOB 3KWWB 1J0HA 4M5YL 5I16B 3VW3H 1J8KA 2XWTA 3H8NA 1T21B 2Y7QA 4CUCA 4JDVA 5IP4A 3IDGB 2LU3A 1A7PH 1ZS8B 4U7MA 3VRJB 3IFOB 4NOBA 3L7EB 2IMMA 2AABL 1LK3H 4JM4L 2EKJA 3ZLQC 1L7TL 1NC2A 1LP9F 1U95B 5IKCA 1Z2KA 4G8FA 1CTOA 4PG2A 2QQKH 1U8NB 3UEZA 3V8CA 5DMGC 3C9NA 1ZT4B 3S36H 5C0BA 2R1WB 1J7VR 2ZUYA 2IQAA 5C0GA 1FG9C 3MRKA 4L3CA 3HNSL 4R3SA 4ZXBA 2VYRE 4YHYB 1YEEH 4FABH 1T7YA 4HHAA 1SEQL 4IBLT 1VFOA 1KNOA 3T0WA 3WFZA 5FKPA 5DGRA 5SWZE 1ND0B 5L0QC 3ARDC 3W2DH 5JW4N 4JLRA 3KJ4C 4EIGB 2RFXB 5JQHC 4GG8A 3JWNC 1RUAL 1UFUA 4S1SL 3QUZA 3STLB 1G7IA 5EC2A 4EDXB 3BKML 1RZ8A 3PWNB 1U8IA 1N5AA 3UJTL 2COQA 3VG0H 4GFTB 3FFCA 5CMAA 5E6ZA 5GRWA 1DFBL 2ZG1A 4PB9H 2RCSH 4HJ0C 5DLMH 4LCCA 3QQ4B 4HEME 4J3UA 4ODTL 2FNBA 4KJPC 4M4RA 4XPAL 4P46B 5EBMB 2QQNL 1UG9A 4PJIA 2CLRB 2V7NB 3BE1H 4OFVA 4PLNC 1EAJA 4KTDH 4JR9H 1AGDB 1SVZA 1ZV5A 2IFFH 5C0EB 5BS0B 1FFPA 4L5FL 3U9UB 5A2FA 5E00B 4HAGA 2J8UE 3D69A 4ZUTA 2NX5D 3DURB 2HKFH 3JV0A 4JRXE 3PABA 3IXTB 5IVXE 4F7MB 4AIXA 2ILLA 3I6GB 3QCUL 4LEOA 4RGNE 4N8CL 2Q87A 1JF5A 1Q9OA 3MREA 1T1WA 2EDBA 4ZD3H 1JNNH 1Z5LB 5T33L 2AV7B 4G6JL 4LSVL 4Q7DA 2YBRB 1YNKL 1P4BL 4FG6C 2NY2C 5EWIL 4AT6B 1TXKA 3PGCA 4XP4L 4N68A 4PRHA 4U4BA 1QACA 3V6OE 3S35L 2R2BB 3L7FA 1T2QH 2VTFA 3LRHA 3MX0A 1GHFH 1U8QB 1CG9B 4RGOL 5EU6E 5GRXG 5IM7A 1KELH 3U0WL 3ARDA 2IBZY 2YSSB 5EUOF 3OX8B 1WZ1H 4TVPH 3O6ML 5I8OL 3BD3A 3HAEH 5HY9B 5C0FA 1CZ8L 2PTTA 2C3GA 3K8KA 3IS0X 2ZCHH 5J6HB 3MLZL 5HHOB 3BP5B 1VFAA 3DGGB 3VE0A 2F5AH 3GSRB 2BMKB 2F8OA 2VLRB 3KYKH 4F57H 3KPQB 4CJ1A 1ACZA 1JPTL 2DWDB 2AXGA 1I9IH 3RWFB 4M43L 4GKNA 3PL6D 3F7QA 4N0UE 4BJLA 3T3ME 5KVFH 1EEZA 2ZUTA 1YJDH 5CWSB 3C6SB 4NYLB 4YPGA 5F6IC 2RQ8A 1PLGL 2HFGL 4XXDA 1HH6A 1MVFA 4W68A 3GSVA 4J8RA 3TBYB 5KVGL 4EXPX 3EFFB 3WUWA 1UCTA 1HSAB 5D1XD 5GGQL 1J0YA 3LKNB 1DQQA 3Q5OA 3G5VB 4G8GB 3TJHD 4DZBB 5T3XE 3PWLA 3QXWA 4L8DB 3S97C 3MGAA 3VFGH 1YMHB 3HUJB 4YBLC 4CDHA 1JRHL 4FTVA 4K3DL 4X4XA 3H9SD 3MRHA 5F9AC 4PJBE 4M61B 1BD2D 5LJYH 3U30B 4JGUA 1QVOB 3MRJB 3RPIA 1KOAA 1TETL 1FIGL 4RBPK 3SY0A 1T1XA 4U1LB 2I07A 4N90D 3FO1B 1BEYH 3HAEB 5DQJB 5I2IA 1D6EA 8CGTA 2OSLA 2HFFA 1YMMB 1WBZA 2FWOA 5HGAB 3EIFA 5CJOH 1L6XA 4JHWH 1H5BB 5HSFA 2VXUL 4OCNC 1TENA 5FYKD 3TYFA 1FLTX 4PGBB 4NWUL 1UQSB 3PDGA 4LBEB 1K8IA 5E9DD 3NFSL 5DURB 3X12A 4LSPH 1Z0NA 1OTTC 1Q9KA 5EOCL 3RZCD 3DMMC 4JHAL 1U8JB 4CN4A 3FQUA 2JB6A 1CI5A 5C0CE 5B39G 2EXWC 5E8EA 1N4XH 1WJ3A 5LQBL 5JW5A 3CU7A 3T2OA 1AJ7L 4R96A 2GAZA 4NM8H 2JIXD