1MIHA

A role for chey glu 89 in chez-mediated dephosphorylation of the e. coli chemotaxis response regulator chey
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWRMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CheZ-mediated dephosphorylation of the Escherichia coli chemotaxis response regulator CheY: role for CheY glutamate 89.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mihA00
1M2EA 3URMA 4OLBA 1DP4A 2LUOA 3NNNA 1P6UA 5CNIA 4RS3A 5FWXA 1TM2A 2WY2D 2A9RA 1D1PA 5JNTA 1D5WA 3KTOA 2ID7A 1DRKA 3EQZA 2FN8A 2FQWA 1SXGA 4OBBA 1S8NA 1Z16A 3Q7RA 1EFAA 3RVRA 1DCMA 1ZESA 5EWLB 1VKRA 1CHNA 1XWWA 3T95A 2P4UA 2JRLA 3HDGA 2GBPA 4RZSA 2WWVD 4EYQA 5KQGA 4S05A 1UDRA 3CNBA 4F06A 3Q41A 1Z26A 4HNRA 2PJUA 4HYEA 2IPMA 3UUGA 5DKFA 3DZDA 4UHJA 2QV0A 2IKSA 3Q9SA 4JA2A 3NHMA 4MQEB 3SAJA 4RKQA 3GT7A 1FFSA 4RSMA 3ROTA 3P9YA 1ZVVA 1A04A 4KQ9A 2KYRA 1RZRD 3M6MD 4KQCA 2E4XA 2WRZA 1FQWA 2PKXA 2E4ZA 1KRXA 3E61A 4Z0NA 4M88A 1YS7A 1LJUA 3H5LA 2A9PA 2PUFA 3JY6A 4MR9A 4NV3A 3H1FA 5TQ2A 3T8YA 5B3JA 5TE9A 4YO7A 2H0AA 4F11A 4YV7A 1XHFA 3LUGA 3QLVC 4P1ZA 5ABPA 1VLZA 2E4WA 3FFWA 1DBPA 3QLUC 3W9SA 2JVIA 1USGA 3ROFA 5JS1A 3A0RB 3I42A 1Z13A 3NNSA 2RDMA 4MS3B 4N0QA 2VK2A 2HPHA 1TLFA 3O2JA 1L5YA 4MYRA 1NXXA 1DG9A 1BDHA 6CHYA 1USIA 4IMIB 5HKOA 1M5TA 4Z4FA 3QLUA 3EDCA 3OLVA 2FW0A 4MS1B 3DLBA 1MVOA 3QEKA 4H3KB 3O1JC 3JVDA 1ABFA 2YHAA 2PE5A 4MS3A 1ZGGA 3DGFC 4OATA 3LFTA 2A9QA 5BQ3A 1ZH4A 1MIHA 2QVGA 2RGYA 4H3HB 3CLKA 5TPWA 4Y9TA 4RU1A 4YRZA 2HSGA 1ZN2A 3QELA 2FN9A 1A0OA 5IEJA 3M9WA 1XHEA 4RY8A 5TQ2B 4EGSA 2LIVA 2NUBA 1ABEA 1FFWA 4XAQA 4Z9BA 2WJWA 3R0JA 2LP4Y 5D2CA 5TQ0A 3MF4A 2PMCA 4Q6BA 4KREA 3D02A 3GWGA 1EWKA 1QNLA 1YIOA 4IILA 5BR1A 4QYWA 2FQXA 1W25A 1PNRA 4EYKA 3HVRA 1QPZA 3H5IA 3FDFA 4MQEA 1QP4A 2B4AA 5CHYA 2E4UA 4E7PA 2AYXA 1FFGA 4MAAA 4MGEA 3JVIA 3LKVA 4MLDA 4LX8A 1L5ZA 1RPJA 3G1WA 4RK5A 3HEBA 1PEAA 1H9CA 4ML3A 1RXIA 2BGGA 3D8UA 2VUIB 3NHZA 1RZRA 1K68A 3A10A 1ZY2A 2L17A 3RVQA 2X7XA 3HM9A 3RQIA 4YCSA 1KRWA 4TMYA 1ZITA 5PNTA 4FE4A 3KLNA 1SXHA 4RDCA 1NTRA 3OQMA 1E2BA 2GX6A 3CHYA 3FFXA 1MAVA 2N9UA 1QO0A 2FMKA 4HNSA 5HM6A 3GBPA 5EWJB 4JB0A 3E3MA 2Q5CA 5GOTA 4EUKA 2PL9A 1QP0A 4NCBA 2B1JA 4WZZA 1U2PA 2IPNA 2TMYA 3IP9A 3IP7A 1Y1LA 4GNRA 4G0YA 1JX6A 1EWTA 3KJXA 3KS9A 4RXMA 4RY0A 4WUTA 4LDZA 1CEYA 2QVCA 4L4UA 4LE0A 3RVNA 4ZJPA 1YMUA 3RVLA 4S04A 3GL9A 2H3HA 4IF4A 1RXEA 3OM0A 4KK3A 2LBPA 5FWYA 4KNYA 2A9OA 1USKA 1D4ZA 3IDOA 1AB6A 3N0RA 4E7OA 4EVRA 1DCFA 4D6XA 1D1QA 2JBAA 2PAFA 3RVKA 4YR7A 1R8JA 4QPJC 4XXHA 4MS4A 2XDYA 4NCAA 2WB4A 3OM1A 3M9XA 3N75A 4KVFA 4LE1A 5JNVA 2JK1A 4RK7A 1C4WA 3CS3A 2RJNA 5TQJA 4LZLA 2E4VA 4G0ZA 3H5TA 4N41A 1NY5A 1TMYA 3CG0A 4MPTA 4N47A 2FVYA 4LE2A 3TD9A 3LUDA 1I3CA 3JTEA 3RVOA 3T6KA 4OLAA 3LOPA 3KG2A 3F73A 2IDMA 5IUNC 4JASB 3EODA 4KK4A 2MSKA 2R4QA 5I4CA 3LUJA 3MIZA 4NICA 3BRSA 3VNAA 3OO1A 1CYEA 5IUJC 4EVSA 2QZJA 1AB5A 1BAPA 1JDPA 1DZ3A 1JFTA 5IBQA 1ZAYA 3H1EA 1QKKA 3H6HA 3QEMB 4RKRA 4XASA 4KMRA 4O1HA 3KCNA 1JWLA 2O20A 5FBKA 2CHFA 3C3WA 4ZMRA 1KGSA 1LJLA 1IIBA 4WT7A 3DBIA 4MR9B 5KWSA 4YS6A 3HV2A 3LKBA 5KC8A 5KQPA 2IYNA 1M5UA 1DC7A 4Z4GA 2FQYA 3FMVA 4LDAA 2MYTA 5T3YA 1FSPA 2RJOA 4EY3A 4MQFB 3H5OA 4MLCA 5HSGA 1QQBA 4RV5A 1A2OA 1HEYA 2MSLA 4FE7A 5B3JC 3RVMA 4NQRA 1GCGA 2FLKA 4O1IA 1SXIA 1Z12A 3QX9A 4TN5A 4LRQA 2NZUG 2PUEA 4RY9A 3LMKA 4F3TA 1BA2A 1DCKA 1PEYA 3B2NA 1VPWA 2QU7A 1DJMA 2OQRA 4RXUA 2L2QA 2VUHB 2GKGA 3EGCA 4MRMB 5JNWA 1ZDMA 1JH9A 4MR8B 4PEVA 3MQ4A 3A0UA 3EJWA 1Z2DA 4MR7B 4ETNA 5EWJA 1M2FA 5DLEA 3SNKA 2HQBA 4TLMB 3G85A 1DBQA 2IPAB 4RK0A 4G86A 5KI6A 5IC5A 4MR7A 3JPYA 5FWXB 4G0XA 4MR8A 3OLWA 1U04A 1B00A 2QR3A 3OMWA 4ETIA 4JB2A 3O1IC 4IRXA 4F8JA 2ID9A 3JS5A 5FBHA 3O21A 1DC8A 1QMPA 2JVJA 4N0PA 3F7NA 4IGAA 2FSPA 1NATA 3IPAA 4RXTA 1E6MA 5CNMA 1TVMA 1NXTA 3LUCA 2QSJA 3CU5A 3N8IA 1VRVA 4KRFA 2MSWA 3IPCA 3OQNA 3KYIB 3BBLA 1P2FA 3K9CA 3SM9A 1LBHA 3TO5A 2I6FA 4IMJB 4ETMA 4DADA 4W5OA 2F8TA 2ZAYA 2E4YA 3IP6A 2FMIA 4XARA 5TQ0B 5IX8A 3LTEA 4DQDA 4Q7EA 4ZYLA 3N53A 2IPLA 1Z18A 3NNDA 4JAVC 1DRJA 3H5VA 1T34A 3H5WA 1GUBA 4EYOA 1EAYA 1SD5A 3QX8A 3QELB 3F6CA 5C5EA 1GCAA 1F4VA 1YK0A 3LUKA 2PUGA 2NT4A 3NBMA 2WMYA 5TPZD 4EYGA 2HQRA 1GUDA 2AYZA 5DCLA 5KQMA 2PLNA 1APBA 1JL3A 5IULC 3UK0A 4KV7A 4FB4A 2PUDA 1OXBB 3KKEA 3O1HB 2WJAA 1GLGA 3O75A 3JPWA 1LK0A 2CD7A 2JVKA 5F64A 3OMXA 6ABPA 4MS1A 2QW1A 2L19A 2NT3A 3CTPA 1NXVA 2FMFA 4D74A 1Z15A 2FEPA 1YTUA 1BDIA 3FFTA 3S99A 2PUAA 5C5CA 1BDJA 4P98A 4Z4EA 3N6VA 1ISSA 3ILYA 3VNBA 1PHRA 3HUTA 5IUKC 4G0PA 4GPAA 8ABPA 4KPYA 2VYCA 3RVJA 3QLTA 4G0MA 1MB3A 4MS4B 2OENG 2CHEA 2R47A 2M98A 4W5TA 4Z9AA 2DRIA 1JLKA 2PL1A 3KHTA 4XFKA 1NXWA 5FWYB 3OLZA 4WWHA 1J56A 1PUXA 3OO0A 3EAFA 4EVQA 3CZCA 1JHZA 1YVUA 3CG4A 4O5AA 5GQSA 5BRAA 3O74A 2M1ZA 2FKAA 5TPZA 7ABPA 2FEWB 1DBWA 2P9HA 3MYYA 3KSMA 3TB6A 3CFYA 2L18A 4UHKA 1KMIY 3BRQA 3DGEC 4G97A 5CNJA 2FMHA 4WXMA 5EWMA 1MB0A 3TX6A 5JNSA 4ZMSA 4F12A 5CNKA 5KC9A 4HNQA 4H60A 3EQ2A 4ZPJA 4W5RA 3Q7SA 1LBIA 1ZGZA 2LPMA 3HO1A 4L85A 3H6GA 4N03A 5HQJA 4XLTA 1U8TA 3F6PA 3DLHA 4PZ0A 5BRJA 1JFSA 1E6LA 4DN6A 5EWMB 3RVSA 1F51E 1W9HA 1ZH2A 2CWDA 2JB9A 3HDVA 2HQOA 2R25B 3OLXA 2FLWA 1K66A 3HJFA 3GA5A 4G0QA 5ED4A 3I09A 3QK7A 2PUCA 1U0SY 1YMVA 1P6QA 1ZHHA 2PUBA 1PNTA 4MRMA 3CZ5A 2FXIA 1QO0D 2R48A 3MA0A 5T7BA 3HZHA 3I45A 3BILA 5DTEA 5JNRA 1Z2EA 3UKJA 4B09A 1JBEA 4YLEA 4KZKA 3EULA 3N0XA 3O2SB 3KYJB 1TJYA 5TPWB 3LUHA 2JCGA 2HJ9A 1ISRA 2QXYA 4JP1A 3RVPA 3OQOA 3HK2A 3HS3A 3OLYA 1WETA 4QYMA 1RNLA 4RK4A 5IEBA 4MQFA 3T38A 1D2AA 3C3KA 3RH0A 3IP5A 3SQNA 3GBVA 4Z4IA 3C3MA 1SRRA 2MYUA 3C6QA 4PICA 4YP9A 4PYRA 4YWHA 1BVHA 3L6UA 2J48A 5KQLA 3HXMA 1URPA 3CRNA 1NXSA 1JYFA 2GWRA 3LUFA 4G0OA 5DGCA 1JF8A 3QEMA 5JNUA 3SY8A 3O2QB 4OTZA 3Q7TA 2GI4A 3QLVA 4YGXB 3BREA 3ILHA 1QP7A 4D6YA 4TLLB 5E3JA 3HUUA 2V0NA 1YS6A 3HSYA 1YK1A 4Z4CA 1C0EA 3L49A 1E6KA 1U2QA 4W5NA 3Q15C 2MYNA 1JFVA 3GYBA 3SG0A 4RWEA 4WXEA 1Z25A 3MM4A 4N76A 4Q6WA 2MYPA 4QICA 4W5QA 1P8AA 3KLOA 3MMNA 3K4HA 1NXPA 1JYEA 4PE5B 4OG2A 2W42A 3GRCA 4CBVA 2ZWMA 4RK6A 4RK1A 2F8SA 3GV0A 2JBAB 3HCWA 3TMYA 3LUAA 1EHCA 1NXOA 4Z4HA 1EWVA 3H75A 2IOYA 2FEKA 5JS2A 1QQAA 4KFCA 1JDNA 3A3KA 9ABPA 1Z17A 2YHBA 3H1GA 2NZVG 2FTKE 3C97A 3I5AA 3FGZA 3N0WA 5EWLA 3CKMA 4JOQA 1OXKB 4Z99A
chains in the Genus database with same CATH superfamily
2WAOA 1Z06A 2HUPA 2LUOA 2PNJA 5IYZB 4A0RA 2WQ6A 1OVGA 4FYPA 1S1MA 1CUDA 4OXIA 4IHKA 4KMMA 3UJBA 2EFJA 1LTQA 2G7MC 2D8MA 1SHUX 1WZEA 4YT4A 3WIVA 1IULA 4TZKA 1UXOA 4YRLA 4XWTA 2IYFA 5IWAB 4AO6A 3PENA 1XE3A 4UMVA 1RPNA 4F0JA 3Q7RA 1EX9A 3K70B 4JI7B 1S8AA 1QWSA 2GOYA 3I9MA 4KO3S 3EVEA 3TNLA 1NLMA 4ALLA 1YBMA 3AIMA 2HK6A 1CDEA 2BTQB 3DZFA 4S1VA 3WQSB 1E2QA 2CLKB 4RZSA 3EGOA 1DB3A 2VQFB 4XDZA 1K3UB 4PGGA 4S2UA 4L8WB 2BFBA 3MCVA 1WD7A 3OTHA 1G9XA 4O2AF 4OSOA 4AECA 1YJXA 4X1OA 3G17A 4E12A 4JMLA 5IH3A 2WTUA 2YASA 3RU7A 3UQZA 4ZDIA 3TMAA 4Q18A 3CLUD 4ZOLF 1U0HC 2RHRA 2ZKLA 1X70A 3PJGA 3QQPA 4MPJA 2RK6A 3CR7A 1RSZA 5F9MA 1YS7A 3QG1A 1E0DA 3SHFA 4HNAA 1GY8A 3FAZA 2SCUA 3H3JA 2BFMA 4UMEA 3ES9A 3G59A 2BFAA 1K97A 1R6TA 3FOBA 4K7JA 4M87A 4RQAA 2CLOB 3GA0A 5C46F 1LI4A 2A9VA 3LUGA 4MW9A 4YV7A 5AKXA 4AF8A 4RSHA 2E4WA 3E1SA 1KORA 5CD9A 1U1IA 5F98A 1IMOA 2WZDA 2A9FA 1E5LA 1JAZA 3ANXA 4TGLA 5ALIA 4EGQA 1UWKA 4C4SA 1IH8A 4L3VA 3B3GA 3A1UA 1K0FA 3ELDA 2OV6A 4MUJA 3GOQA 4KQXA 4O8CA 4MRAA 3QU7A 4TWZA 1N1GA 3S8MA 3W6UA 4AY5A 4MYRA 3K94A 4US1R 1DG3A 3CUEF 1JE0A 4EI7A 3E0QA 4JT8A 4ZQFA 5SV2A 1NDQA 4QJBA 3A1NA 4BN0A 4ISCA 4JYCA 2Y1CA 5A05A 1PT5A 1ZUIA 2NZ8A 5DDIP 1SCUB 3HP7A 4H3KB 4CR8A 1M1XB 4AW9A 1ZRHA 2EGHA 3FX2A 2PQ0A 2J08A 1QF6A 2FFQA 2P40A 4OATA 4AU1A 1P2DA 3W5SA 4GP7A 4RNCA 1LXCA 4MW5A 5KYGA 5FOXA 4JLSA 4D4IA 1YL6A 2C88A 2RARA 2Y66A 4D1YA 4RJTA 5I7UA 1FQOA 4MRSA 1GPJA 3SZUA 1PD1A 1P3Y1 4H2DA 2Y76A 5LQMA 4PN7A 3D8BA 1TF7A 4OFWA 4ZODA 1LC3A 3DT9A 2PMDA 5LL6P 1L1QA 2XYGA 5CLIA 1IN6A 1GPH1 1CF2O 4PLZA 4Q19A 2QD2A 2UKDA 3TOVA 2PT6A 1C3XA 4Y8VA 4JWTA 5CJPA 3AHIA 1R6BX 2W6JD 1X8XA 1QPZA 4CLRB 4AQDA 3BVPA 2OK7A 2OSBA 3EWNA 4IFBA 4EW3A 3ROXA 3C7TA 3NETA 3ZGYA 1NQVA 2WJYA 1FFGA 4G4IA 5DU2A 1A7AA 1IN1A 4BKRA 4YMHA 2AZXA 1BHQ1 2FG5A 2F1IA 3TQCA 4TV8F 4AJOA 3DVLA 4LSMA 1RZRA 2PVPA 1ENPA 3OI7A 3PV0A 3AGQA 3VDNB 2IS2A 2X6RA 3I9LA 3ZVMA 2YCLA 4DS3A 5F51A 1GG2A 2GSDA 2YHIA 3PC4A 4TMYA 4OAPA 5FPQA 1AUPA 3CWZA 3MXTA 1R88A 5T5QA 4CUJA 621PA 1NKVA 3MTDA 4AQYB 1MEOA 3DPUA 4QIHA 1YCGA 1TJ5A 1XPJA 3FUWA 4JOCA 3RU3A 4KITB 4V0SA 1WQ3A 1Z62A 4HX2A 4IUCS 5AVYA 3UANA 2XPCA 2FKNA 5H7XA 2DUWA 3M3HA 3BXEA 5ALGA 2I87A 4QQFA 3VNRA 2GK4A 5GOTA 3QKSA 5B6IA 2FA9A 2B8TA 4NCBA 5AKHA 1K27A 4KX5A 3IE0A 4O29A 5IAJA 3VHQA 4HDKB 1Y1LA 4JGBA 4MITA 4MCIA 4TWJA 1OB2A 5I3ZA 3KJXA 1HLFA 3WGKA 4RY0A 3ZQ4A 3A3YA 1FLVA 4WUTA 1V9LA 1VQ1A 4KNVA 4LDZA 5CXUA 2I33A 4RF4A 4JT2A 1MV8A 4HSEA 4KK3A 3G7UA 4UBMA 5EEGA 1ZBQA 3DVRX 4M1TA 1DAGA 3ZV6A 4CXMA 4AXBA 4Y2JA 3AM5A 4YC7A 4MS4A 4IJWA 4CEIA 2EL9A 2H59A 3NBXX 2WB4A 1FRFS 4RZHA 3T9BA 2HJWA 2VZEA 1KA9H 1W36D 1C4WA 1XNJA 1Z6GA 1AKUA 2YC2C 3D7RA 2WD7A 4E1BA 4QKQA 3SDZA 5AW9A 4KIWA 3G9TA 4KYUA 4EHAA 4AP9A 1RHRA 2OGWA 5F5NA 5K3CA 1GZ3A 1XZQA 3N70A 3SJCA 2PEYA 2VHYA 4MI6A 4DLXA 1US8A 1K8QA 1C8LA 4FJ0A 3OTIA 3RVOA 3BKWA 3LOPA 3TI7A 3ZD7A 1HORA 2Q07A 4EMSA 2PWZA 1O97D 4DLTA 5IUNC 4HH3C 2EBWA 2GN1A 3ZBUA 1Q5PA 1Y98A 1NFRA 3LXUX 2DQKA 8ATCA 1IUPA 3Q2KA 4Z7QB 1M6VA 3GCXA 4PV7A 4Q66C 5D00A 1T3GA 3W8DA 4MTLA 1MX1A 2QZJA 4RFSB 5BQ5A 1RRFA 4RFSA 1J21A 1YAHA 3JWJA 1XNHA 2WC1A 3B8EA 1RRKA 2IX3A 1BEZA 4Q4CA 2VYFA 4ZEVA 2WM9B 1HQDA 2IIPA 3F49S 5JJKA 1TXGA 3NLLA 1A2KC 3I92A 1L6RA 3BHNA 3DVAB 3GPIA 3GUUA 4O63O 3DW3X 5BVHB 1BRTA 2PWAA 5KC8A 4WSOA 4UM8B 4ADSG 4NSNA 4XDYA 4QO7A 4KIGA 4N5MA 2G1AA 3DFIA 4MLCA 4QA9A 1QQBA 4OSPA 2H31A 2FJ0A 4Y7CA 1M54A 2PRSA 2D1RA 3BL8A 2RGRA 5REQB 4FKZA 4TZ0A 3KSRA 3QX9A 4ZVTA 3J81A 3VC3A 4Z3OA 4NI5A 5DCYA 4MCJA 5AP9A 4B85A 4RPKA 1P39A 3W4JA 1JQKA 1VI6A 2PTGA 121PA 2ZEJA 1NSFA 2SKDA 3IKJA 3OEHD 4K40A 2I8AA 4Q24A 1KSGA 4F3TA 2HPZA 5B1SA 4ZK2A 3B2NA 5DTIA 4LJ7A 4EGJA 5JADA 2C42A 4PHTA 5GONA 4QGHA 3HMKA 2EYUA 1EWYA 3W2HA 3RANA 4BO7A 2GKGA 4R8MA 2XWSA 3L7DA 4MOWA 5F2OA 3IHTA 5AJYA 1WCV1 4RIFA 4H9GA 1M5RA 4DDMA 2WTBA 1T5HX 1UBGA 3DKVA 2FP4A 2X4LA 4BFTA 2KLHA 2ZQYA 3B12A 4NJMA 4UHCA 4E5PA 3RS2A 1ID1A 1OI3A 1JQ5A 1WPRA 3DEZA 3I72A 4R1OA 5KI6A 5KPDA 3PL5A 1N2CE 2V96A 5FUBA 3SXPA 4P4LA 2ZE6A 1E32A 1IBKB 1R27A 1U04A 3H2IA 1QGUA 4OQLA 5CHEA 3WSWA 5IJWA 3K0AA 2FSVC 2FQQA 4JK3A 2PU5A 1Z88A 2CFCA 1T9GS 2O05A 3S1AB 2XXAB 3O1IC 5BO5A 4UPDA 1Z4NA 2DZDA 2OHHA 3HYSA 3ZCXA 4YT2A 2VSOA 2NSLA 4ENPA 4YI5A 4FYIA 1CR2A 1RRPA 3KYCB 5CEEA 1D09A 1MXFA 4S1NA 3CU5A 1KI6A 4YBRA 2IHJA 1S4MA 2DLNA 2Q3FA 1YRYE 4E31A 4QTZA 3KYIB 1P2FA 1RBYA 2Q0HA 3AKCA 1VKNA 3O8DA 1S7CA 4ZYVA 1UXGA 1L7AA 1O0BA 1GITA 2P35A 1XJ5A 3CH7A 4J3JA 2E4YA 4JEIA 5DOVA 4G1CA 5JUWA 2C3MA 2Z5FA 4FGLA 3OKPA 1J7KA 4AZTA 3SNHA 2XHZA 1IM5A 3B1YA 3KJFA 4J75A 1LW7A 1IEWA 2D1TA 1Y1QA 3QEOA 1GTVA 4JVOA 1BD4A 4L0QA 4X90A 3WGOA 4DOMA 4NNOA 1D04A 2PGDA 5DHFA 1I4OA 1GTG1 4HFNA 1YCDA 3R9IA 2ASVA 1F4VA 3LUKA 3H2SA 1RHUA 2BHNA 4HEJA 1WUIS 1JFLA 1ZM2A 3HRHA 3BH0A 4JZKA 1H6DA 3ZDZB 1AGYA 2W8BB 3EQ9A 2XA2A 4C3ZA 3MTGA 3ROQA 2HA7A 3U3DA 3KO8A 2EDCA 4QECA 3HACA 2O8BB 2CNWD 1Q57A 1PR9A 3E8SA 5IJXA 5BR7A 2VO1A 2X23A 2GBLA 1ADYA 5G3ZA 1RAEA 2E18A 2O06A 3RASA 2Y0DA 1Z0DA 1CW2B 5HIMA 5SYNA 1A5ZA 4F91B 2GS9A 2BN4A 2XMZA 5BWLA 1KY5A 1EVKA 1RYDA 3QFHA 4PRKA 2AW3A 3H8JA 1ZSVA 2BEUA 4LJAA 2IHTA 5CVUA 5IUKC 3UH1A 2J9XB 4DPKA 4L6IA 4LF4B 3VR5H 1GNQA 4BQQA 2FW9A 3KZNA 1P7ZA 1LBEA 2O1SA 4Q3OA 3AF3A 4UBKA 1TX4B 1JHYA 5EJGA 1FXUA 1Z9BA 3MTEA 1SBCA 2C59A 3WGMA 1U7DA 2EZ9A 1PUXA 2PPLA 3O9VA 2J4FA 2RBGA 3UZUA 4TZ6A 3BMOB 2IU0A 1EZZA 3MYYA 3OPYI 4Y9RA 5DVZA 4A1OA 2O2DA 1MB9A 2HMSA 3EZYA 3I1YA 3TEJA 5JFTA 5BUSA 2FRDC 2HJGA 1VYHA 2SBTA 4JUIA 4PLTA 4RLSA 1HOTA 1OLXB 2P62A 3TI9A 2OP1A 1K06A 2PJDA 3AF4A 1EIZA 1PRYA 4W63A 4WXMA 1MB0A 5CNJA 3LHKA 3QPWA 3YASA 5KJCA 1N6IA 1MC1A 2PZGA 4BQIA 3EIOA 2IEZA 4E03A 4GPIB 4ZPJA 2R7NA 4NCHA 3UV6A 3ASVA 2DM6A 3KVYA 5LZ8A 2XT9A 4LFBB 4G5GA 4L9AA 3VR2D 2GZ3A 1CNEA 1G1AA 3G9XA 3O0DA 5J1TB 3IMGA 2Q7OE 5CB4F 2FRDA 3CH5A 3H4VA 4C04A 4N03A 3L05A 4JLAA 1M75A 4MA0A 4FGSA 4I7EA 4MUEA 1U8TA 2CLMB 5IDYA 3E2IA 3T0GA 4M1KA 2PUVA 5CTAA 2HWXA 2PJZA 3O0TA 1W9HA 4PHFA 3RRFA 4YDHB 1LFDB 2X13A 2V4ZA 2AJLI 3OLXA 2FLWA 3T5AA 1G2QA 4DY4A 4K88A 1Q0ZA 4YGYA 5LBUA 2IU3A 2Q5IA 3EK2A 1KXZA 1CDOA 4J76A 4P84A 1HNZB 2WSMA 4MPPA 2ZB7A 1E4YA 5NLLA 2NLOA 2NP6A 3CRQA 4KR3A 1QO0D 5B58C 5AHWA 1QNFA 1MO6A 3WLLA 3BILA 2Y77A 4NJOA 2R8ZA 3I52A 4KLNA 3RKRA 4P53A 1XD2A 1JVNA 1ZI6A 4BGVA 2NQTA 2VHUA 4YLEA 1GDTA 1VL8A 1PS9A 4PPQA 1PLKA 1NVVR 2VDWB 5CLHA 1DARA 1XL1A 4AKTA 4WBNF 2I1LA 2NZ2A 3DR5A 3N6XA 1XLTC 3HXQA 1P91A 3EGXA 4EMBA 1H94A 4RK4A 1W47A 5EE9A 2UZ0A 2W7TA 3A9SA 3E48A 2HQ1A 2NUPB 3HBJA 4LWZA 2AD1A 4PBRA 5K4HA 1O3YA 4CU2A 5JD3A 1P45A 3GEEA 3D6AA 3BDAA 3WDSA 4H1TA 4ARSA 2YDYA 3GJXC 1TQ4A 5KUTA 2QAIA 4TTVA 1U0RA 1UKCA 1YF3A 3Q10A 4U1RA 2KI5A 2WMNB 4YQEA 2ZOSA 5ITZB 1P0FA 3DNPA 3VA7A 4H35A 1HR0B 1XUOA 1VHTA 3I1IA 3CLSC 4WI1A 4E70A 1L4GA 1N78A 1OIVA 3VNVA 5AYVA 3HDYA 3NAZA 5EP4A 5C35A 1OFUX 1ISFA 4X92A 2X9GA 3HCOA 4ZU3A 2GJ9A 1A9QA 1AQ6A 3WIOA 2FPKA 3ILHA 2M6KA 1N5KA 3FGPA 5CK4A 3NMUF 1X7GA 1U90A 2ZT8A 3C7KA 4L4XA 1NURA 4KE7A 4BB0A 1CZKA 2V7XA 3HCFA 1JG6A 1U2QA 4D9BA 2XWQA 3HGMA 1IXZA 1I7PA 1L7RA 5C2JB 2VQ6A 3MRXA 4J1TC 1ATIA 4J4BA 4B87A 4CN8A 3WR5A 1AGPA 4C21A 3UVEA 3AR5A 4P34A 5FOSA 4PFKA 1VPDA 1BQEA 1KJZA 1N57A 3WZ2A 3ZE2B 1CVRA 3ZIDA 2NXWA 4QO8A 1DBIA 2XY4A 4TWRA 3RIMA 5AM5A 5DYYA 4UTXA 3ZGOA 3WGYA 1UPAA 3ZNOA 1IOWA 4W9MC 4UC0A 2RIRA 1U1GA 2JIPA 4GUAA 4OHVA 1IDOA 1QJCA 1D7AA 4CBVA 2JW5A 2NYAA 2FFBA 3MMSA 1ESEA 3QV2A 3SD7A 5FPHA 2C97A 3P9NA 1PBNA 2ECQA 3VTKA 1YB1A 1WDLA 2FWPA 1KZ1A 3OFKA 1EWVA 2XIJA 3KSZO 1HL7A 1O87A 4LHXA 3RHTA 1SCBA 4JLDA 2C04A 3C7CB 1RWXA 1W4ZA 4R8LA 1ZK2A 3W1EA 3A3KA 1JQBA 3OPMA 3M1AA 4JVMA 4AF6A 3U7GA 2OHJA 3JQAD 4HXGA 3SQXA 1NVDA 2PLAA 3K8ZA 4B3XA 5JTTA 3AT1A 1BYUA 3HU1A 1P1HA 1JDUA 2BPOA 1A8UA 1C2YA 1UWVA 2GVZC 1UBRS 4P3OA 2XVAA 2A5GA 4FGZA 2BT4A 3DMTC 4HTFB 4N5IX 1UFQA 4NOMA 2X6TA 4W6QA 1HOXA 1XDZA 4KQKA 1AF7A 3PQ2A 4LV6A 3R5SA 1SBIA 1L0BA 2EX4A 3EQZA 4IGFA 2W6QA 4NU0A 2NGRA 3RAFC 3LG2A 2O3SA 3FCYA 4ZYZA 1E7WA 1LZKA 2PX0A 2XVMA 3LWBA 3RVRA 3WB2A 4B3TB 1UZAA 4WA8A 2AHOA 1ZESA 1G42A 2P9JA 4HGNA 4B45A 3DWEX 5G2OA 2IVZA 3QEAZ 1TYDE 4O2AB 3ZBTA 3T1NA 2WWVD 3U7IA 3Q6NA 4S05A 1TIBA 4L5CA 3EF0A 1G3QA 2ZJ2A 4CVNA 4D3XA 4F06A 2EGGA 4K0KB 4B4OA 4DR6B 3ADPA 3Q5EA 4NECA 1PJZA 5AK3A 3EVZA 2FR0A 3IAXA 4EG1A 4V0ME 2PZAA 1KJWA 3H18A 1QAOA 2HZBA 3R6WA 3A1SA 3Q9SA 2HHCA 5TV2A 4MQEB 1PP4A 1F0PA 4RKQA 4EW2A 5AESA 1KEEA 5C1IA 4IHJF 3IR5A 1ZVVA 4ZU6X 3BF7A 1SBQA 4I1SA 3NHKA 2E4XA 3A31A 3BXPA 1UM8A 4X63A 5JJCA 3QE9Y 3I04M 1IVNA 2DBRA 3MG9A 4PHCA 1II8B 1M34B 2CE7A 2F1KA 2LTAA 3DP7A 3TVYA 1UFVA 1XVVA 4N7MA 4AROA 1KGDA 4ND8B 1DVRA 1ZK3A 3K16A 3VOTA 5J3JA 1ZNZA 3BCSA 4RD2A 3OZFA 1RAIA 3IO3A 1QC5A 4DM7A 2EIXA 4FMBB 1YIAA 1VLZA 2QP4A 3CB2A 3FTEA 1KMNA 2I4OA 2I03A 2BDTA 3RTBA 5C7YA 4BFYA 1GRVA 1FS4A 5FT9A 4E14A 2OILA 1HZZA 2RHBA 3O73A 4NU5A 3FHJA 3ZCVA 3ZD6A 2PUFA 1CRWG 3PHGA 4G5SA 2RGWA 1PLJA 4GP9A 1W73A 1G9SA 1W94A 1P1JA 4ZD6A 4J1QA 4BTEA 1KO7A 2W2OA 4Q01A 1PTJA 4L16A 3IAS1 1J6UA 3L18A 2NSJA 4KE8A 4G3XA 1U0BB 3ZXIA 4FBMA 2CMKA 5AICA 3OIDA 2OPBA 4D3ZA 1P0QA 3TAUA 3V3TA 3DO6A 4LXGA 5F2NA 3ICEA 2DCUA 1A69A 1WU7A 4HDQB 1G20E 1XZPA 5CX1B 1CUIA 1YQUA 3FCXA 4TTIA 2MDTA 1KSJA 2OQ2A 3BH6A 4RU1A 3VR6D 4HDMA 5BMOA 1QYIA 3BHIA 3PFNA 4FN5A 5JXGA 1NG1A 4NF2A 1DX4A 3JQFC 4GBED 4WKOA 4ZU1X 2BSQA 3JVVA 1EZ1A 2QSZA 3RFFA 2B7LA 3C6KA 3H05A 3J81k 4DUGA 3FYUC 4GEKA 4X45A 2IELA 3R7WB 2C84A 2LKCA 2G28A 3QFSA 4L0DA 3ADCA 1XYVA 4Q7QA 5B3AA 2RGNA 1N75A 2ZB4A 5JD5A 2XAAA 1N7HA 3K0KA 3QJGA 4LNAA 5DYGA 1WCIB 3K6SA 4PGHA 4Z7JA 2YOGA 2NNWB 3UMVA 3PEFA 4CTOA 4N6NA 2J7KA 1KAMA 1X80B 2QJOA 4MAAA 5FPPA 4COOA 2O14A 1V5GA 1ZJ5A 3MPOA 1PJBA 4IHAA 5EXPA 2ZZMA 1IN4A 4C3UA 3C6BA 4CLDA 5HBRA 1F7UA 3EDYA 3QU2A 5GADl 4M86A 3QMVA 2RJ3A 4LC1A 3NCHA 4BEBA 3QBJA 2FHPA 3ICWA 3KB2A 4KFTA 4AYXA 5INTA 4TM8A 4KAXA 1I1QB 2YIDA 1PZGA 5E1DA 5A7HA 4AICA 1NOKA 4M49A 1F12A 2GPAA 4PYOA 3DBOB 3T9EA 5GZ1A 1HURA 1NNUA 3GBPA 4QUIA 4E5UA 4KYVA 1SBHA 3LS2A 4LJ9A 5DM0A 1WR8A 1LLCA 1LX6A 4PGAA 4BKUA 2J3KA 3SZGA 5FPKA 2H4ZA 2QL6A 2Z8YM 3U7QA 4KIJA 4MVJE 1COWD 2FOLA 3K0EA 3STUA 2C7PA 4ONEA 2QVCA 1QIEA 2BLLA 3H13A 3O5AA 3KTAA 4UVHA 1V2GA 1AK9A 1H4QA 1C0IA 1RJFA 1XMIA 1Z6XA 1X1BA 2YBDA 6Q21A 2NM0A 2EZTA 3RAPR 2C5HA 2JGRA 3IDOA 2JCSA 2R4UA 4KJZA 2FYTA 1D1QA 4F5ZA 2Q5QA 4HOYA 1Q77A 1CY1A 2I2BA 1QHHB 3GIWA 2WSLA 3BWVA 4EW1A 1WXQA 5CMLA 1BFKA 5ICCA 4HDNB 5TQJA 2Q5FA 2RJNA 1NGSA 2XYQA 3QJ5A 1ZZEA 2VN8A 4N3BA 2XMCA 1L7XA 3DZJA 5CFMA 1TMYA 5DPMA 4MPTA 2BFEA 2H51A 5JARA 4LE2A 3I9NA 3SHTA 2LZ0A 2Y05A 1NNLA 1K4KA 3VR6A 2XRFA 4MUIA 2RHDA 4KDRA 4W8HA 4A8JC 4A2PA 5JZ9A 4KJXA 1EJ0A 4ZP1A 2BP7A 5J9FA 3VXKA 3MIZA 1AC5A 2I65A 4FGJA 5J2TB 1UKVY 3RSGA 3JCZA 4L8YA 5JDIC 1O08A 1LGYA 3CZQA 3GRZA 2QM7A 1KO5A 3HXKA 5B7QA 3WA7A 1XLWA 4RVGA 1BAPA 5TARA 3U9TA 1FFEA 2EERA 2VWHA 1K7CA 5IBQA 1KK0A 2LCFA 1W36C 3AERB 2A1UA 3KDAA 4N39A 4QEKA 4F4DA 3OZXA 1EGAA 4KMRA 3HYTA 2ZJFA 3S2EA 1QKIA 5C52B 4KTTE 2P9ZA 1BE0A 1D2MA 3C3WA 1N1DA 3PWTA 1EX6A 2IXTA 4HX9A 1FQJA 1IIBA 2Q0XA 1B8UA 3TAXA 4H1WA 1WSDA 1BE1A 2DPHA 2ID8A 2WQZA 3MGCA 5EIOA 3ICOA 4O1MA 1N2EA 4LW8A 4QXQA 4PU0A 4B3GA 3RAJA 1NC3A 5EIAA 3GMTA 4XD7D 1R7RA 1SUDA 3BXXA 4TRJA 1E5VA 3DD1A 1VG0B 3NOOA 4FE7A 3C41J 5J63A 4EI2A 4P93A 5IKEA 1Z12A 1FU4A 5IVIA 1WUKS 3OFND 4FHZA 2GZ1A 2LIPA 4DRXA 2IHZA 2JBHA 4PIPA 4V39A 3JQRA 4DTIA 3T12A 1H66A 5K6TA 3WC4A 4BNFA 2HXGA 1AA6A 3C3DA 1N2JA 2C8KA 3GGOA 3NH9A 2GKSA 1DJMA 4DLKA 4M0EA 1SVSA 4QJIA 2WUFA 3E8MA 3FKSD 3ITNA 2GN9A 5T4EA 2H16A 4DL9A 1X8KA 1YZYA 3KKPA 5FPTA 5DCWA 3OE7A 2ZATA 3NORA 3HH8A 4ZAXA 1D2HA 3CT6A 4AZSA 5ISMA 3A0UA 4XTRA 1EBFA 4L5YA 1QIGA 5EWJA 2WPNA 1G8PA 4Z2YA 5KYXB 1YVPA 2FR1A 1VLHA 2A0YA 5H3LA 1IHUA 3A9VA 3LDUA 1U0OC 4P7JA 2P5SA 3DR3A 4N3CA 5SZIA 4CLOB 4ZT4A 4QXPA 5KKCA 1I1NA 3TQQA 4MR8A 2XT6A 3USES 5CA0F 1TM5E 3C0KA 1I5OA 2HYDA 3ORFA 3ZDEA 4B6PA 1ZPDA 1MO4A 2BSAA 3ZHTA 3ZWWA 5F9FA 1Q7BA 1RLJA 3V7FA 2IWRA 4JIMA 4IDBA 3CZMA 3ZGVA 2FPGA 1LH0A 3H2YA 4K9LA 4CMEC 2N42A 4H7FA 4OYHA 4JFAA 2QVYX 3UB4A 1XL0A 2COUA 3FZYA 4LOHA 4UTVA 3AF2A 1AUOA 1NUSA 4F21A 4YN3A 1WF3A 2YTZA 3OECA 3UWKA 1VLQA 3TZEA 4MUNA 1TRKA 3BFVA 5CLJA 4MV9A 2F8TA 3MC1A 5AVWA 1DU4A 4XYMA 1Z38A 1L5LA 4DQDA 3I0NA 4QOGA 4ER7A 1A97A 3ANYB 4GOMD 4DCMA 3PHIA 2JHGA 1DRJA 5A5FA 5HRUA 4DR5B 1MV5A 4BX3A 2NUTB 3I9OA 1VLLA 1YZQA 4FSHA 4QYTA 2J9YB 4LOLA 2FX3A 5EJIA 1FVHA 5BV1A 4BKOA 1I2MA 1DV2A 5DTJA 1OXXK 1UFRA 1XJQA 2I3AA 1K5HA 3T7IA 4JEUA 2RHLA 3OESA 4B80A 4D4GA 3W8EA 1CV2A 5HW0A 2C4HA 4US2R 1WEHA 5B2ZA 1KQFA 4ZO8A 2PZMA 5AKKA 2LR0A 2CXTA 3WMGA 3ZY5A 4MS1A 2X0FA 3D4LA 1W88A 4GRIA 3QG5A 2FMFA 3LK6A 1YBFA 4FLFA 2GK6A 4XB6B 2H2FA 2CL5A 3D0QA 3E7XA 1WW8A 4BNVA 2G67A 3QVWA 1NMZA 3EXHC 4PYJA 1QV7A 1E79D 4OLJA 4UUPA 2R1UA 5L3QB 3AKZA 1KEWA 4YCAA 3DV0A 2AZ4A 2PQ2A 5E6UA 5KYVA 1NOJA 4XUEA 4WE3A 3QLTA 4OM7A 2OAGA 3T34A 3TLZA 2J59A 4BZPA 2X86A 1T5BA 4QOHA 2FH5B 1GKYA 5U9CA 1F6DA 3JQBC 4X65B 1KO4A 4XVHA 1XPUA 2FQ1A 4LKOA 1WXDA 4P54A 4RY2A 4F4HA 5IJ9B 4O5AA 2YN2A 3NDBB 4M0DA 2ZRBA 3V1TC 4X60A 2H54A 2HU5A 5K20A 4JODA 3B53X 2P9HA 2XGSA 1T9KA 2OMEA 5LJLA 3EH1A 1Z6ZA 3PS9A 3OSUA 5H1YA 3KKNA 1SG0A 2K7ZA 3E22B 1KARA 1NBMA 3H19A 2ZRGA 3JWEA 4ZANA 1K5DA 1UANA 4E1VA 2FN7A 1DXQA 1O4WA 4KE9A 4Z1MA 3EZ9A 5JLJA 3Q87B 1SUAA 3LLUA 5FTMA 5IAKA 1V71A 4ZEXA 3B6ZA 3Q7SA 2WE8A 3QFTA 4HB3A 3EBOA 2ZYUX 4XLLA 1DQYA 2HO4A 4FYJA 3SZOA 4PC2A 3ZV4A 4Z53A 1QTQA 3AETB 4Y1FA 2ATEA 1J24A 2BCGY 3F6PA 4MW7A 4FSDA 2NW6A 4GI5A 3KHKA 1LQUA 2I6XA 5EWMB 2JB9A 3GRUA 4L4YA 1EUQA 3R5JA 1KYWA 2QUHA 3RGGA 4WEQA 3QK7A 1QIMA 1TTHA 4D9EA 2BRUA 4TYNA 5D5HA 1YMVA 3HJRA 4J3NA 3KCQA 4K28A 3PQ4A 2GM5A 4XJVA 4DSTA 4BWFB 3OF5A 4M8SA 1PR0A 5BOSB 1YHNA 4D8WA 4A27A 2FPWA 4YA6A 2I7TA 1SCQA 4DCOA 1AUQA 3UGJA 1OI2A 1BEUB 4KN6A 4MEBA 3LWNA 2C61A 2MINA 1XDUA 2W2XA 4MP3A 2BH9A 2QMEA 3OE7D 1TJYA 4G8BA 3VOAA 4D0LB 1B8PA 1QZ3A 3C74A 2X8LA 4BATA 4NONA 1RC8A 3P27A 1BVRA 4M2LA 4MVJA 5AXCA 5KKAA 4EB8A 4CCYA 1C7FA 4CTMA 1SRRA 1TD9A 4D7AA 4NC9A 2HO5A 3HCRA 4B6JA 5KAMA 2Q45A 4RHEA 3EASA 2DETA 3OX2A 4HEA1 3LM8A 3QXXA 5ALNA 4CKBB 1U9ZA 1NLFA 4HAYA 1JDBC 4LY6A 3SJUA 1ZD9A 2PR2A 2IT1A 3OFSA 3PGVA 3BFXA 4V24A 4TSRA 4QFDA 4DM3A 2IITA 1LQ2A 2ZW9A 4HRXA 1ESNA 4TLEA 1V0JA 5F2EA 3ZHCA 2VRBA 3TOXA 5LOVB 2J6HA 4LYFA 3KUUA 3RS5A 4QQNA 5LIRA 1VGRA 2Q7DA 2JGDA 3L02A 1S3FA 1IPHA 2GEBA 3GMSA 1NVEA 2HA6A 4PLPA 1GIAA 4R84A 1QLHA 1G21A 3HUUA 1SKUA 5TSDA 4NDAA 2BP7B 3ZE8A 2WAMA 4LY0A 3RWOA 4B2LA 3FMPB 3JAWB 3IP8A 2V98A 4IQ8A 1WB9A 1XEWY 4EDFA 1YT5A 3C6YA 4Z7OB 4Q03A 2QRQA 5K8LA 3IEXA 1FDSA 3CBGA 1PGOA 2P0EA 3LGXA 4G67A 4YMGA 3CVVA 4MV4A 5HOQA 3ZJTA 1VB3A 4GUDA 5EPUA 1GGNA 4EARA 1JG4A 2IKQA 3T7CA 4I1RA 3WYAA 3GZJA 4BAZA 4XWYA 5B2FA 3LUAA 3BAZA 2BONA 5IXYA 1AGRA 3GNTA 3KPJA 3OBBA 1J0DA 1C7QA 2YXDA 1LX7A 1U0GA 2VBCA 2XUKA 1F5NA 1KJNA 3UHJA 4B79A 1OXTA 2ZRJA 1DJLA 4LWQA 2PZBA 4DQUA 1E89A 4ACAA 3JZMA 1JHVA 3ZBQA 3L82B 2FG6C 3WNVA 2SICE 1R4MA 2HU2A 2ACVA 1ZMRA 2F17A 5KWVA 5EA2A 1DTWB 3K2IA 1XKQA 4AT1A 1B42A 1CR1A 4MLZA 2O8CA 4KQ2A 1DRKA 4RPCA 5EHNA 3V7NA 4DUGD 1QU3A 2XUOA 2JCBA 3KWMA 3MQ2A 3JSAA 1NQ5A 4BO0A 2AXNA 4M8LA 2WNSA 3BHMA 3SS8A 6NULA 5AOVA 4JWKA 3WNDA 3WLRA 2QR2A 3IODA 5EWLB 3IEMA 1IEVA 3F3MA 2H1RA 3SHWA 4M99A 5AOCA 1O5OA 2GBPA 3GJZA 4OSEA 4D8YA 3MUEA 2JJMA 3PJRA 2Y92A 1NJ6A 4HGRA 1E9DA 3R0IA 4ME6A 3R7LA 4KSBA 4KUGA 3U49A 4PZPA 3N2EA 4KQFA 5JWHA 2V6GA 4OQYA 4X6XA 1IFXA 3NHMA 1LPBB 4HLQB 2EJUA 3B48A 4HLNA 3SAJA 4OM8A 3UKOA 1FFSA 4ZMBA 5CM9C 1SIBE 4XX0A 3SU8A 1XEWX 2WAYA 2XGGA 4YCMA 3P4UA 1TPYA 4D0SA 5IWCA 2XKJE 2OFOA 1IJEA 1SULA 4XWAA 3TCXB 1PYGA 4MO2A 3Q72A 3F9IA 3Q3VA 4FOSA 2J3MA 5HKBA 1G8YA 1P1FA 1SBZA 3O95A 2XVXA 1GPKA 1AM4D 4NV3A 2JHCA 2V8BA 5CPBA 5DBFA 4RX1A 2RHMA 4ZIRA 3ADKA 3PJEA 5TE9A 4K6FA 3LUBA 4FKBA 2D2VA 3WL6A 1BKDR 3PQ7A 1Y6GA 3L7KA 4R31A 1I0LA 2PGNA 4P1ZA 3BFPA 4TVBA 4ZQGA 4AJ2A 4DXDA 3QLUC 4NHEA 1ZXBA 3K5PA 4O4IF 3UJPA 3W9SA 4DR2B 1XJ0A 2D2IA 3CEJA 2HMTA 4DRYA 4R9RA 3T7RA 5G1NA 1MDBA 1OBOA 2HCFA 2KJQA 3NJ4A 1X13A 2B21A 3CGGA 3F90A 4MK4A 3KT8A 2HPHA 3A2NA 3O2JA 2QX9A 1L5YA 4GC5A 3SLGA 2GZSA 3K1YA 4KFRA 4PHHA 1R0YA 5LB2A 1BDHA 2J0SA 1U2GA 4TVOA 1M2VB 2Q49A 3LYUA 4FR0A 4XYEA 3UAZA 4HDRA 4B35A 2JFWA 5K2MA 2ZSUA 3KSBC 3ADDA 3M49A 5J2TF 3AHDA 1P5JA 2IIQA 2YHAA 1NE7A 3V4FA 1TUEA 3GNSA 2DTEA 5BQ3A 4LGCA 4XSHA 3LHSA 1MIHA 4TQAA 3OT4A 1KI7A 4GWKA 1E1YA 4G5XA 3JAKB 4N5NA 4C22A 3COSA 5TPWA 2AXPA 3PUVA 4YRPA 3B6MA 5L4SA 3MCAA 3W9BA 3RYCA 1Y7LA 2UYOA 3QE0A 1TTQB 1JHUA 1HV8A 2XHEA 3EWIA 2FXVA 1Z08A 4D9MA 6ADHA 3BMCB 5AKJA 5A71A 1V8FA 3VH1A 5HVNA 4PXYA 1A5SB 1YZFA 2WJWA 1G8SA 1U11A 3BL6A 3O4HA 5FFMA 3DUWA 3KE9A 3RG2A 1ZJWA 3F5SA 1UT6A 4E21A 1SCAA 5FPYA 5KIAA 1VJCA 1GZ4A 5AKEA 4FW9A 3VISA 4DA0A 2O8EB 1WX1A 3E05A 2Z09A 4GWGA 1Z0UA 1V3TA 4JS0A 5L53A 2QVBA 2HHLA 1EUCB 4FMDF 1NR1A 1VFNA 3HJBA 2C7VA 2ZB2A 5ER6A 1L1RA 2XECA 1P0IA 3EBLA 4HUJA 1A4IA 4FFLA 5K0GA 2P6PA 3F97A 1KZHA 4X3PA 4WJZA 4KIUA 3TYXA 1KF0A 1IK4A 2OGZA 4ZC1A 2JLBA 4QDOA 1GN8A 4Q12A 1JMKC 2XMSA 4NPHA 1QYWA 2YWFA 3V2HA 4M3NA 2PIDA 1LI5A 4I9NA 2WOOA 1WMSA 1XF1A 1TK3A 3D8TA 1FSFA 4LNUA 5BR4A 1XVTA 3C4JA 1NQUA 3S2GA 4YP7A 5KQRA 1KRWA 4K0RA 4FE4A 5EZQA 1NBME 3MAJA 4EAQA 1P8JA 1AY0A 3V9PA 2R6AA 5B12A 3WL7A 3BQNB 3L40A 2WTMA 1T4BA 1MVLA 5HF5A 5JBIA 1MJFA 2Y1DA 1MT3A 2CGEA 4P3PA 2YWDA 2WHEA 3KD3A 1TD1A 5ITWA 1CKEA 1DFIA 2CBXA 3OBIA 4AY4A 3K8YA 3N28A 2WMOB 2NTNA 5JI2E 1M8JA 2BFPA 2ISQA 5D85A 3GDHA 1JX6A 3LVFO 2VH5R 1ZMTA 4RXMA 1CPYA 4BGEA 4BNDA 1RJDA 4LIPD 4YRAA 1H85A 5BORA 1DRWA 4WCVA 5TY0A 2DUMA 3ITKA 4LE0A 3RSOA 5EXSA 1A1VA 2DWPA 3OM0A 3BXZA 1OX6A 3FN4A 5FWYA 2A9OA 2W0SA 2ZRQA 1W46A 2F43A 4QXMA 1AB6A 2EJVA 4WN3A 5EIXA 1DCFA 4GC9A 1JZSA 5CX4A 3STTA 1C3OB 3PEVA 4E3ZA 4DYHA 2A6PA 2IXDA 2XE6A 1YNOA 3LY7A 5JNVA 4CM9D 4CEJA 2ZIEA 4MX8A 4PSVA 4QOIA 4RK7A 1XPRA 4CMGA 2A35A 2ZRNA 1NY5A 4LFCB 1EM8A 2R8OA 3VZRA 5DEIA 1F6BA 4J0DA 1KVUA 1N6PA 1UUFA 4Q7KA 2PMFA 3LPMA 4OLAA 3DF9A 4MH0R 3KG2A 3CX3A 4PANA 3VR4D 5FOTA 2WG1A 1VCOA 2EKBA 4XVUA 3ROEA 5I4CA 4Q3BA 3LUJA 3PFKA 4EKEA 3DC7A 3WMWA 5C0OE 4OXYA 1J5EB 4HQNA 4MVWA 4A8JB 4D82A 2BHTA 3U0VA 5FEUA 3FWYA 4L8LA 3ZK9A 5KVVA 2D4AA 2X2OA 4TKZA 4UBOA 1XAGA 5F3DA 2JFZA 4HMPA 1ETHA 3VPDA 2O3QA 1YBHA 3LOUA 4KPGA 1ZAYA 1UFKA 1DTSA 2D74A 3QEMB 5B37A 4FFRA 2AFHA 2L42A 5FOQA 1P18A 2VPYA 3KCNA 4L08A 1VKHA 4NFLA 4YP5A 1CEYA 4CMJA 8GPBA 2Q3CA 3PT9A 1SFRA 3HB9A 5DI3A 1EM8B 1GAEO 3PA8A 3VSBA 4WOPA 3MS7A 1MMFB 3RS0A 3E27A 4HADA 4HBGA 5FUQA 2GFHA 4NATA 2CDAA 1KPIA 4LYJA 3GGPA 1KH1A 4CEJB 2GA8A 4UNNA 1IY0A 2M6RA 1H23A 2WJGA 5KJEA 3WB0A 4DEVA 2ACKA 3FI9A 4YV1A 4CETA 4FQ7A 1V6CA 4OXQA 5A4MS 1W5AA 3EVBA 4CM8A 1GU0A 1K9VF 1U4SA 2AOUA 3KZCA 5KAPA 4EJ0A 3I01A 2CZGA 4IS3A 4Q39A 3KDPA 3DEHA 5FI1B 3GLGE 4HGQA 2GXUA 2HN9A 3WBKA 1GPWB 3OHPA 4R6XA 1NLUA 2UZ3A 3ROZA 1EA5A 1ESZA 1TZ2A 1D4FA 2G6TA 1WMBA 2QTVB 1MNQA 3BC1A 4LXXA 4OHBA 4BO3A 2CUTA 3DL4A 5CPFA 3UPUA 4KO8A 5DV9A 4HVLA 1J2RA 4FOOA 1EESA 2PRZA 5CJJA 1IZZA 4P4SA 2AF4C 2P77A 1W2GA 2GESA 4XM2A 1W4BA 3U7RA 2ZYDA 4EHHA 3NOVA 3ZZ1A 4X1YB 2CNKA 4MR7A 3NTXA 3UUWA 3C5CA 5L8VA 3HXOA 1V47A 1G3UA 3FI0A 1T43A 2CXHA 4CUZA 5D1NA 1S2NA 1XTBA 1YJ8A 3OLWA 2V1UA 3A36A 4DLSA 2ERCA 4RHXA 1B8NA 2ECFA 5KBYA 1M0SA 1M2KA 2ISSD 3PUJA 1X42A 2CEAA 4FFSA 5CM2Z 4D0GA 4B0PA 2LGJA 1FJHA 1T2UA 5FBHA 2YL2A 4WK4B 1QMPA 4M53A 2WD8A 1FMLA 1Z83A 5GTDA 4BFSA 1TVMA 4LQLA 5AVKA 4URXR 2EKDA 1LV8A 1QHEA 4RDIA 4YP6A 1N2CA 1XYGA 5CDGA 4HH1A 3DOHA 1E4OA 4LYDA 3OQNA 4P33A 3SM9A 4M55A 2G08A 2E7ZA 2Q1UA 2CJWA 3F6EX 4BNZA 4K05A 4NXMB 4UHEA 4KWCA 3TLAA 2IV2X 3IP6A 3BF8A 5D7BA 3UXMA 2RHTA 1E64A 2X8JA 3D4IA 4QTYA 3FNFA 3OOYA 3NIBA 4I3FA 3FCOA 1JLMA 3K35A 3R3ZA 3ENWA 2C77A 4QPDA 4QOFA 1RYEA 3WGVA 3ERCA 1XRLA 1DJQA 2HMVA 1R50A 4D4JA 2NT4A 1J20A 1HUQA 4J03A 1GRQA 1Q3HA 4UM5A 5TPZD 2ZSKA 3BB3A 5DCLA 4W1PA 4KN9S 3D3JA 3UK0A 2PUDA 3FJYA 4IQ4A 3V6MA 3CT4A 2WJAA 4I9GA 5FFFA 3DFKA 3MCTA 3JPWA 1YZNA 2X0NA 4FS8A 4C76A 4CMIA 1X1DA 1QGYA 2B8NA 1G2OA 1Y8RA 1BX3A 1SVOA 3OAAD 2NT3A 3AI2A 4FYWA 1GL6A 3TEMA 1WTCA 4E15A 5A04A 4QVIA 4QDJA 1JB1A 1XMXA 3FTCA 1T9HA 4HFMA 1V4BA 3DE3X 5BWNA 1CUWA 2DHRA 4F5WA 4GGOA 4P98A 4NYMQ 3OZGA 4A9AA 5BSGA 1H4TA 5K03A 3N2KB 3QBEA 4FIZA 1BMTA 1N2IA 3HUTA 3LC0A 4OHMA 2FNAA 2IVFA 3KPVA 3KXKA 3L6BA 3KWJA 3EPHA 4EJ6A 1SHZA 3A9CA 2CUKA 2H1FA 2VYVD 4MP6A 3NAQA 3BCRA 1FW8A 4U7PB 1DE0A 5JZMA 5DLYA 4E07A 1I80A 1KU0A 5SY6A 3TZ6A 5JCPA 3AU8A 1VIDA 4XFKA 3VSCA 4PC1A 4D3SA 5LWQA 2Q41A 1LS6A 1GL9B 5EVCA 1DOZA 5KYUB 4HB2A 1N92A 5IXJA 3MQFA 2E5WA 3B51X 4M8IA 2P7IA 1OH5A 5K0LA 5BRAA 1YQDA 2P0YA 2ECPA 4Y2XA 3HCPA 3MWEA 1FMCA 2BGTA 2MSEB 1KYVA 2GILA 2YMPA 1DKMA 4FNAA 3FLMA 3CFYA 1WAMA 2GD2A 1ORVA 1AQUA 3HNOA 3LCRA 3KETA 1XPOA 2GBCA 5CURA 1FFDA 4L73A 1KMIY 4QREA 4DA7A 3FPLA 1LRJA 3WNZA 3PXGA 1BGWA 4YRCA 4AWXA 1UBUS 1HDOA 5F5XA 3AIIA 1U0FA 3DWIA 2ODTX 4F7WA 5FBQB 1JH8A 4G01B 1EK1A 2W71A 1OLUB 2QTHA 1NVUQ 2V0CA 4OHUA 2XRMA 2BGUA 5LU9A 1KC1A 1PJCA 1YC2A 1LBIA 2D0IA 4D02A 5K3OA 1B1CA 1JSZA 1LPSA 1AA9A 1V6SA 2O2ZA 2XNDA 1R4NB 3RC2A 3IOMA 4X7MA 3EXG1 1D8AA 2IYLD 5H3CA 1RMQA 1UKBA 3D0OA 5JPIA 4C3VA 5IFLA 3GF4A 2O8CB 1N5RA 4BJ6A 4C4RA 4ZV4A 2Q8QA 4FMPA 3SHQA 4MYUA 3V7UA 1WUTA 3S81A 3AVVA 3ACBA 4BKPA 4Y2VA 4GLFA 4QQKA 5I7EA 1B3RA 2Q6VA 1VMEA 3RJZA 4ZJYA 1RCUA 4DR4B 3L6RA 1QG6A 4LF9B 3D2LA 2A4KA 1Q0QA 2VHQA 5T6BA 1PJ4A 5ILGA 3GXOA 5DNDA 2ZTUA 4DA8A 1TADA 4DXAA 1Y1TA 5ALFA 3HZHA 4IO1A 2B83A 3OCVA 1Y1KE 4R1PA 5DNAA 3WWZA 5EE3A 1SG9A 1CERA 3ZWAA 3FPHA 2B4TO 3UKJA 1QR2A 3BSFA 3LUHA 2W6OA 1PDVA 2DT8A 3RLFA 4AJHA 2WKQA 5FL7A 4W9NA 4ZVSA 3W05A 3LLMA 3TNDA 4FD2A 3DUFA 3VDXA 1GVHA 1T8TA 4RORA 3ZVKA 1OTYA 4HH4A 5BSWA 2ZTSA 2VDJA 5LQDA 1JJBA 2FFHA 3T5BA 2BEJA 1DXYA 2OHOA 1BMDA 1NR5A 4MGKR 3C1OA 2FZWA 3CWCA 2GEDA 3MOGA 5FEMA 1RZUA 3FNBA 3BULA 5FB3A 1J09A 4MDEA 4GPTA 5MGNA 3O90A 3G9UA 2P30A 1P1BA 4RYLA 3ROGA 3L1IA 3V5NA 2QRKA 3I37X 4M36A 3HRIA 2H65A 2X0KA 3D6MA 5JAQA 1CK4A 3MYRA 5KYKA 1RCTE 3CUVA 1VKZA 4O4JA 1SBNE 1JIVA 3L7AA 4HN9A 5GJCA 1I14A 3ZCPA 5IANA 4CF4A 4EG8A 3BB1A 4ERXA 1B0ZA 4LFAB 4O8ZA 3WGGA 2NYUA 2Z9BA 4KZPA 1UMCA 3D0KA 1ZVMA 3ZDXB 1QFXA 2BBOA 1US8B 2R6ZA 2O59A 3MM4A 3IQGX 2LWIA 2Y2VA 3AILA 1R66A 3GPLA 1GKUB 5I8ZA 1I94B 4F3RA 1TPZA 4QICA 2NPOA 1RWOA 5EPEA 5FUWA 4GKJB 1B6GA 2P4HX 3KLOA 4MWGA 4OBXA 3T3GA 3KOXA 3LO8A 4FBGA 1AO3A 1CHDA 3K1ZA 3EXHB 4LSZA 2VHXA 3AEQB 3P94A 1MEEA 3AJEA 3TIGA 4EY5A 1JIIA 1QIIA 4RK6A 1I3KA 4WQMA 1EFVA 4OHFA 2XCUA 5CDHA 4P80A 1K7YA 4D3YA 2CL0X 3Q8LA 3BGSA 5AHKA 4M38A 5HMLA 1UJ6A 4RZIA 3HNPA 4Q05A 5D87A 4DILA 3V4LA 4YRIA 1PQYA 3TOZA 3HR8A 1PAUA 4B6RA 1N2OA 3LPDA 1T0PA 5FO1A 5BOSA 2YHBA 4FFOA 1M67A 1T6BY 1DDIA 2VNKA 3M34A 4KR2A 1N32B 2A33A 3G9ZA 3L7IA 4D9IA 4ZCSA 1EJ2A 1M2EA 4DLAA 4PCAA 4Q21A 1F2VA 1H1LB 2PS1A 2QI9F 8MHTA 1YFZA 2UXBB 5LR6A 4WHMA 5ALDA 1QQ6A 2GYYA 3C15C 3IJRA 3OKFA 2OBFA 4NMXB 5AXDA 4DJ5X 4Q3KA 4WD3A 2QW8A 4BFWA 1ZCFA 3PXBA 2QL5A 4OBBA 1MTZA 3QKWA 3A1WA 5A4AA 3OPVA 4MTCA 4Q3EA 3KKKA 4NCXA 3AF5A 2WJ4A 3HHPA 5KQSA 2QZSA 4TL9A 3SHVA 4EYQA 2QAGA 1V7QA 1HDIA 1M1YA 1XYYA 5GONF 1TZMA 4OJNA 3AUSA 5D8DA 1ACMA 4PZEA 3GLHA 4PX9A 4BUJA 4Q3AA 4UHJA 1GUAA 1O1YA 3OOJA 1XOIA 3WP0A 2EZ8A 1OREA 1GXSA 4HGOA 3U1VA 3MB5A 3ZLVA 3H99A 2PRKA 3X43A 4CLRA 1RZRD 2D0OB 1X1QA 4BQFA 3HTXA 3AL2A 1W35A 3LUPA 3MWKA 1LUAA 2H1WA 1QLJA 3W3AH 4E4YA 4CMBA 1Y9ZA 1ILWA 4Z0NA 4ZGWA 1P4SA 2WOJA 3TH5A 4GR5A 4KB5A 4JLNA 4CQLB 3HFGA 3T9CA 5KX5A 2O3RA 5TQ2A 3SQDA 1DG1G 2Z2ZA 3IDSA 4FR2A 4YO7A 4Z54A 1LSUA 1ZINA 1NIPA 2RB5A 1XAIA 3EXG2 2CC2A 3PJFA 4WIAA 1NRJB 5GINE 1JEYB 4WESA 3R7DA 1DBPA 1JVSA 3N74A 5I7FA 2JVIA 5JCJD 3EEOA 1Z73A 3A3NA 3KEGA 3OJCA 3T7KA 4DEXA 1FMFA 1UC4B 1RYNA 4IQ0A 5K9ZA 2ODAA 3L1JA 1ST2A 1YB7A 3E5HA 4HAOA 3NOXA 1T5SA 2OLJA 4JJZA 1B26A 1RYYA 2G80A 4KR0A 2ZVJA 4BNNA 3PKZA 3GW8A 2RGDA 2OM6A 4LHSA 2JGLA 4CG3A 4O3FA 2YX1A 3EDCA 2O5EA 1TCUA 4AKEA 3V46A 3K4PA 4B74A 4H31A 5IT0A 4IGKA 2XTNA 1M2GA 1KP2A 1O96B 3KJNA 1FTWA 5F1YA 4DKXA 4NY1A 4BO9A 2ZWPA 3I28A 4C7BA 1VJ1A 2JIZA 3ETEA 2C94A 1JDJA 3ZR4B 1CCWA 2JGFA 4I4NA 1PV2A 3LW8A 4URVR 3ILSA 3CLKA 3ONDA 1TUBA 2ZULA 4TV8A 3WHLA 1Q50A 3ICPA 1GUZA 4YUVA 3QF4B 1F0NA 5C3UA 4B9AA 2QM3A 1Q2XA 4DJAA 3RSFA 1O89A 4KGXA 4YHBA 5SY9A 1QGDA 3SM3A 4I2VA 5LZ5A 3UKDA 3AR6A 5HQ3B 1KJ8A 1PWZA 2FWNA 3MELA 3QA9A 4RD4A 2W70A 1WJGA 1Y4AE 1Z3CA 3MJTA 1C9MA 2PHZA 3SXUA 2R3SA 3U37A 2XVZA 5K09A 4I46A 1KL7A 5A3JA 2I99A 1JFFB 1RI1A 3K0BA 3L0YA 2P68A 3Q5DA 4KH0A 1EFKA 4RHUA 3TKYA 1FW6A 1CY8A 5ADVA 4AKGA 3A1EA 1GA1A 3KHUA 2XCSB 3CINA 3OZCA 3EYAA 3I01M 4V0RA 1M10A 2G4CA 3T1TA 4FNGA 3DKKA 1DWOA 1UKEA 5JAOA 3G2IA 3AI3A 1T15A 4Q9AA 1Y48E 1YDWA 2ZWIA 4NOJA 5DM1A 3D8UA 3TR0A 5KU1A 3OD5A 3P9ZA 1QAQA 3LOQA 4CIAA 1A9ZA 4FILA 1I4DD 1YXMA 1YQEA 4Y3UA 1PFWA 2L17A 4KXWA 4O59O 1K8ZB 3V8VA 1T5LA 1ZITA 3LIIA 4GG1A 4YT8A 2HIHA 1GP2A 2EYQA 3GFSA 1X1TA 3IERA 4I8DA 3COPA 2FFRA 2WU4A 2B1IA 3HUFA 3MAAC 4QQ8A 4A73A 1PV4A 2IYYA 3EIHA 2AD5A 3FNHA 4FINA 4DWJA 5EUCA 2NSHA 4HAIA 2EBHX 4QBKA 1NQOA 3HCEA 2ZRLA 4UVGA 5KJFA 1E7QA 1RKQA 3FMOB 1U3WA 4S12A 1EVYA 4JJ4A 1SU8A 2NSYA 3FW1A 3LPCA 3QVMA 1TVCA 1ODIA 3KB8A 4YK7A 3UWMA 2VSYA 1YB6A 1V45E 3QXCA 4FCCA 5CH8A 2JAWA 3RVNA 1SQ6A 4B4DA 3G2QA 4R1LA 1T3ZA 1RXEA 5GIPE 2X2PA 2CHUA 3NBAA 4JEHA 4BY9E 4AS2A 1USKA 1D4ZA 2CFSA 2QZPA 1GZUA 4JL8A 1HDXA 4F93B 3EARA 4XXHA 4YCNA 4OGGA 5BT9A 4HYYA 2C2BA 3IP1A 3D6HA 2Q6LA 1YB4A 2W9XA 1U6IA 3M9XA 1F8GA 3EEYA 4YQFA 2QNIA 1A4RA 1J00A 4H4CA 2PR7A 3DPSA 4ZVVA 3JQBA 4TMXA 1M0EA 1L5HB 1JTFA 4CKCA 2GUGA 2Z6AA 2O3TA 3TZCA 1UEIA 3MJ4A 4YJ2B 3RFTA 3G5TA 3WLAA 4EL5A 1VHJA 4KQJA 4UAJA 1SKYE 3ZWYA 4IRMA 1R16A 5BXYA 3OEWA 3SEAA 2FJUA 3VR6H 1GRRA 2YHUA 1M6YA 2QTFA 4Z5XA 3LL7A 3HY3A 3HUDA 4IBOA 1T1JA 2Q3MA 4HNUA 1JDPA 1TJ3A 4G26A 1DZ3A 4HRAA 4KGZA 4DMGA 3INTA 4WNAB 3H1EA 5DHAA 3QU5A 1C1YA 1L8AA 4XASA 2QORA 4ER5A 4W5WA 1DWPA 1L4NA 3KVVA 1F48A 1K9SA 5BW6B 4M0UA 4U2KA 3FWHA 1YU9A 1ECFA 2HYIC 1JQDA 2RGXA 2D2FA 2E85A 2ZKIA 3AV0B 3GUZA 3LKBA 4UDOA 1T9BA 2JFHA 2R4TA 4LDAA 3OZDA 3DOFA 4AP6A 3EPJA 3GRKA 1E2PA 3MD0A 4URFA 4DW8A 5I9NA 3EPRA 2NU6B 4GE3A 4QTUB 1A2OA 3FDXA 1VZ2A 3EVTA 2IBMA 5BN3B 1G6HA 2CVHA 3SK0A 3HM2A 2V6BA 2ORYA 2YN0A 3AHGA 4FQ8A 2R66A 1MHPA 2OHFA 3N3BC 3I83A 3ZXSA 4IIHA 1OYWA 4PFJA 3H8WA 3NEPX 3LBFA 3ZHSA 4POOA 5CD1A 4RC9A 2AW5A 4UDXX 2O1XA 5IDVA 4LXQA 2XBUA 4IMPA 1PFGA 4M9UA 4P83A 1GEEA 1LFAA 1ORIA 3N8DA 3B70A 3WG9A 4LXTA 4U6NA 3W90A 2PGOA 1ULBA 4UNQA 3IL2A 5TS3A 3CCFA 3OWHA 1LSJA 2X5JO 1MQSA 1RM3A 2HT6A 3CEHA 3W6NA 3GZTB 1IHYA 1RJGA 3BZWA 3L7CA 1ML4A 1T3SA 1VXRA 2QZ9A 3OMLA 4MUFA 2OC4A 3VKVA 1DC6A 3GPDG 3NEAA 4BNMA 2EP5A 1WV1A 3QTBA 1QR6A 5A5VA 5CW1A 2IPXA 2IBSA 1J1ZA 4PO9A 1NU8A 1COZA 1V11B 3IBGA 1M6HA 1YR6A 1ZRSA 5D3KA 3BDIA 4DIMA 4EPVA 4UFOA 2MSNA 1ECBA 3JWGA 3PFGA 4GPBA 4OUDA 2ZYVX 2EX1A 4LJ4A 3CUKA 3FZQA 4AULA 2EGUA 1RT9A 3O21A 3AQ4A 3PFBA 2GQ0A 3LZDA 3FCAA 4QPPA 4QATA 2E55A 3S2FA 1F06A 1DT5A 2UVPA 4DAOA 5CB4B 5TRTA 1W87A 4XLZA 4X71A 1CY2A 4BX2A 4IJ6A 1P7CA 2GPYA 4QDXA 4YJFA 5DN6A 5IJ0A 5C8VA 2BMAA 4C4AA 3EW9A 1G20B 4K8OA 4RCZA 3FF1A 4BFVA 3V8NA 3MS2A 1Z0SA 1TYCA 3HKEA 5B36A 3ZVNA 2X1MA 1G6KA 4HLCA 1CIPA 1NQXA 5EGSA 4JHXA 4TLDA 1O4VA 2XUZA 3I5UA 3EZLA 4HNVA 1MOSA 1OJ7A 4KUHA 4XYLA 3FOFC 3EPLA 1YFLA 4Q93A 3R9XA 3ROMA 1QOQB 1U3GA 1TO2E 2FUG1 5MGBA 2A7XA 4LJ5A 3O4JA 1EAYA 1QF9A 1SD5A 3CLHA 4HVAA 3UMGA 3J7AC 4JR1A 4UBIA 3SXJA 1VHQA 2OHGA 3KQLA 4B6GA 3NBMA 3T1QA 1LPNA 4MW1A 2F3QA 5EMMA 4QWWA 4UZSA 2A1TS 5EMHA 3BJIC 4BUZA 3P20A 4A26A 3MPUA 1E0KA 3KUDA 3HU2A 3ONNA 4M0PA 4ND5A 1U6JA 2FWRA 3WYEA 2X4IA 3KXIA 4E11A 4RGQA 2DSTA 2JIQA 1A27A 2JFQA 3E2PA 4RDHA 3DQPA 4RULA 2O2GA 2Z95A 3AJ8A 1TCAA 5CH5A 2PUHA 4QZVA 1OBFO 3WLJA 3W78A 4EGCB 2VAMA 1CUEA 3AM3A 3GFQA 3RYTC 2QQGA 3IPLA 3SEZA 5B4TA 1MO3A 5HP4A 1NJ1A 2BFFB 2NIPA 3IVXA 4OQZA 1G2IA 3M2TA 5JH7F 3V9AA 1R9NA 4HZGA 4JVLA 2B5VA 1L7MA 1P4AA 3M1YA 3PQ5A 1P9RA 2I0FA 1EFRD 3EISA 4TX1A 2RG7A 2QIPA 1OXVA 2AX4A 4C20A 3KHTA 1PX0A 3NDIA 2PBLA 3N76A 2QDXA 2QLJA 5ENZA 4TPKA 3OQPA 2Z3WA 3GYGA 2X5XA 2DHDA 3UWSA 2RH9B 1RYFA 1PL0A 2ZI4A 2NV0A 1YV9A 2OHIA 3EAFA 5IVDA 4B2PA 1M34A 4EVQA 5KREA 4BZZA 3K5HA 4M0FA 4Q4DA 4ZT7A 3C3XA 1QQTA 4C0KA 1G7SA 4AZ0A 4OPMA 4GOKA 1UQRA 4IDDA 3I34X 2G71A 3KJGA 5FJJA 1GYQA 4R7TA 1UMDA 3O8OA 1AZTA 1DO2A 3STHA 4D56A 4EPTA 2P0AA 2YV1A 5J2UA 3S44A 4ED9A 1ECLA 1U4NA 4WUVA 2O5VA 3P0JA 2G7ZA 5JH7A 2FMHA 1GKIA 5I7RA 4G6ZA 2XXJA 2F8MA 4N7BA 4TWIA 1FEZA 4F3YA 4Z1MD 2QVLA 3R3SA 4EH1A 3FR8A 3MMZA 1ORTA 2KBEA 4WZBA 5CTJA 5JY6A 4RTLA 3O7MA 4AN0A 1JG3A 1J7JA 2FEXA 1E3WB 3H8VA 3Q7QA 2XMRA 3OJEA 4YRBA 1MJ5A 1RACA 4DVGA 1SKBA 3U3KA 5F52A 3WV4A 2DUJA 3DLHA 4IH1A 2OB2A 4X1IB 4AZ3A 1S3SA 1AVTA 1O94D 4MWEA 1F51E 2CWDA 3WDKA 4PZLA 4CT0A 4YJ3B 5DW0A 5JMWA 3EDOA 2PY6A 3PRYA 2FETA 2C1XA 5A2QA 3NRCA 5A4IS 3KJZA 4IIUA 5A9SA 1H22A 4NV0A 1B2RA 4LHVA 2ZSDA 5IT5A 3FGOA 1OWLA 4WKNA 4KN5A 1XZIA 3TTWA 1J23A 5JAIA 3PWSA 2F8LA 1PNTA 2PUBA 1YA4A 1E2MA 3CLRC 3UT0A 1GEGA 4I1OA 2W0MA 3HFRA 1C7ZA 1CY4A 1UAYA 2HEIA 4OMUA 4QNNA 1MGPA 4RANA 5DTEA 4DLZA 2PH1A 3VPFA 2ZANA 2BKAA 3DJYA 1GADO 1T5IA 2FU5C 5E1OA 3DONA 3L7YA 3IUQA 2ZUBA 3N0VA 1ETUA 2J3EA 2OTCA 2ZAIA 3BIWA 2DLDA 1OBHA 5CLGA 2DKOA 4AUMA 2RG1A 2VSFA 5K8CA 1Q84A 3UT5A 1MABA 3Q1KA 2BGWA 3OJLA 1QIHA 1Z2AA 1UOPA 4B3JA 1ZO8A 4PZDA 4ARBA 3K9QO 1DBRA 2GJKA 4C6SA 2W58A 5TLSA 2D2EA 3B3FA 5EUBA 5M34A 3KQUA 1X1EA 1KEPA 2C9ZA 3G5LA 4ODIA 2IYZA 4TS4A 5HS4A 3HXPA 1YASA 1P1IA 2PVCA 3K1AA 3L43A 1NXSA 4UTZA 3AMVA 1A7KA 2RHOA 4O4HB 7REQB 2ZR8A 3E5RA 5COAA 5HOEA 2RAVA 4FEYA 4LXYA 4OKSA 4M0MA 4V3BA 4LVOA 1VMDA 1FP6A 4ZOAA 4EJMA 1FMTA 1B41A 1DLJA 1YRQA 2DBQA 4O33A 3TKAA 5LN1A 2HV8A 3WKEA 3H9UA 1BOOA 4FW8A 5G3YA 1MQ8B 4FDVA 4DBLC 4MAFA 1SCIA 4LDNA 4DJFC 1YZKA 1GAWA 1RFGE 3DLAA 2XDQA 4JY7A 2B4KA 1OUMA 1C0EA 1KVQA 4JYPA 1GNTA 4OH7A 4X85A 5AJWA 5K1ZA 3RS9A 3SC6A 5C5DA 2BMJA 5ITZA 4W5NA 1TQ6A 4RH1A 2JAUA 1K88A 2ICAA 4B84A 3IKTA 4EWLA 1E9EA 1KEUA 1C3JA 4BPRA 3VGJA 1CQIA 1F0KA 2HDOA 3MINB 3GDGA 3QW2A 4DWVA 3FTNA 3QUBA 1TYEB 4HWKA 3PUWA 1Q7GA 2B6HA 2RGCA 4LRTB 5ALYA 4AG6A 3I0MA 4JBGA 2YV3A 4BP8A 4C89A 1G38A 4WCFA 5IAOA 4QE3A 1QCYA 4HDSB 1QZUA 2AI3A 2WHPA 3HABA 3TNFA 2RFLA 5E7QA 1WY5A 4JLWA 1L7DA 2JBAB 3JATA 5IHPA 1TYBE 3R7NA 3QUSA 2RAPA 4REOA 4U2FA 1DV1A 3QSYA 3IS3A 1HDYA 3GLIE 3BT7A 5JS2A 2JH8A 5AW7A 3H1GA 2QD4A 2VP0A 4CT4B 1VBKA 3TFWA 2YVUA 3NALA 1FPQA 1GTJ1 4O4HF 1NUQA 4REQB 4JOQA 1PL7A 5AI9A 3TZLA 3EGDA 4CCSA 5C18A 4CM8B 1DP4A 1EGHA 3TR6A 5M7EA 3SR0A 4CV0A 2A67A 2A9RA 4E33A 3TTSA 1D1PA 4HWGA 3RYHB 1D5WA 1E9RA 2NU8B 3E15A 2Y0CA 3MCZA 3P2IA 2D1YA 3P97A 5ARBA 3M0EA 5FYQA 3AL3A 4ZZIA 1WTAA 4LSGA 4EAAA 4P0QB 1HDRA 4ARAA 2HSZA 4DY6A 2C2XA 1T1IA 3UB2A 3FYCA 1CYDA 1WF6A 2OORC 3N2NA 3U7HB 1Z33A 4ALMA 2XUJA 4HHEA 2CJFA 1ZIXA 3N7UA 3H83A 1BU8A 4EUEA 2Z43A 1P0MA 1E5TA 1U5AA 3BQ9A 2V7BA 4XIYA 5A1JA 2X3YA 3CPSA 1HZJA 1E61A 2QV0A 2J6BA 3II6X 4HGZA 4XOIA 2Q0SA 4V02A 3C1TA 3VI3B 2JGMA 4A0QA 3E9ZA 3P9YA 5JECA 3TECE 4RA9B 2A9KA 1WHTA 2R8RA 4KQCA 4CFYA 5L4LA 3SIWA 1Y8AA 3EDRA 3ZN2A 2DX7A 4U02A 2E4ZA 3GELA 1KAOA 3AG6A 3H11A 5B7NA 1VL1A 2QY9A 4DHWA 4MR9A 5LP6A 2CNDA 1X7XB 3FBTA 1CRQA 2VJDA 2VQDA 3EEFA 4BNTA 1TM7E 1XTVA 4OHPA 1JR3D 1FDRA 5CT6A 4EFLA 3C16C 1VHWA 2B0JA 2QUAA 3JSXA 1H4VB 3QVOA 4GI3A 1KH3A 4RMJA 3ZHBA 1DRUA 1NI4B 4G4JA 4A16A 1Y6ZA 2ES4A 3NV9A 3I9KA 3B9RA 2R11A 3W3AD 2YWXA 1W1UA 2RDMA 2HDHA 1QIFA 1S2IA 4MS3B 4RHFA 4N5LA 4MMYB 2P6NA 5D1HA 3QBTA 1EB8A 2NSDA 3AW9A 2YXEA 3WRXC 1JAHA 4W9RA 1FP4B 3DOOA 4GFDA 1FXSA 4BIMA 4C1NA 1JKJA 4IMIB 4ZAVA 5DFAA 4FCTA 3TGPA 3ACCA 3NHWA 2D5IA 4YIHA 3EVGA 1KTIA 3EZGA 3I6MA 4RSRA 3A6KA 1RE1A 3O1JC 1FRNA 3NVKI 5LQNA 1HA3A 3B7GA 5LA6F 3RHZA 1N2SA 1XZCA 3O03A 5IARA 2GEFA 3U3OA 1CJUC 2VAXA 4BVAA 4ZVKA 2NV2B 4RGVA 5LMZA 4EJSC 1DHRA 2RGYA 4H3HB 1JSLA 1GCUA 2DH6A 1IM8A 3D3WB 2QE6A 4DKJA 1P61B 1CSEE 1T0HB 4L74A 4BE9A 2IOHA 1NAIA 1VGVA 5IEJA 2JIRA 1ZA1A 1OQAA 1TEXA 4RY8A 1TU4A 2J0EA 3LDHA 4OU4A 2JHFA 1ENOA 1OTHA 4BQEA 2LP4Y 2Y3IA 1OT3A 1EWKA 2CXNA 4FONA 3OM9A 4N1AA 1V35A 3DG9A 1KMMA 2XW6A 4BLTA 2B4RO 3OZBA 1X9HA 3TL6A 4WVFA 1D5CA 2D5AA 2LRHA 4L4SA 4Y6GB 1UPTA 4C0XA 4YMTA 4I1YA 3HXTA 3OQHA 2HSDA 1J0EA 3UFBA 3HVJA 2QMHA 3AR7A 3LCCA 3PU6A 2HMYB 2PCJA 3G7SA 1E7SA 4OJMX 5KHAA 5A4FS 3G0IA 3M5PA 1VC2A 2VAPA 2XZTA 1LQTA 1X14A 3BKXA 3BL5A 4AMYA 5AIAA 5IZCA 4E5DA 2IOQA 2WWGA 2ZJOA 3TGLA 2QPAA 1PEAA 2B7BA 1ZJ4A 2WYIA 4KLRA 3FD8A 3CUWA 4RE6A 4WNIA 2XE7A 1ONNA 1YI1A 4QYIB 2ZXEA 4D8XA 2PWBA 2IEAA 3CXUA 1QGUB 3K5IA 4HLUC 4B6EA 1HGXA 5PNTA 4N48A 5IMBA 1C4KA 4PAQA 3UK7A 3WHIA 4JQCA 3ANLA 3THOA 1SUCA 3H1BA 2HU8A 3FFXA 1L5KA 2OYCA 4WZ6A 4BVLA 4PN3A 1C14A 3F7MA 2AA3A 2GYVA 3QVJA 4X84A 3S28A 2II6A 3OSZA 3ZDBA 5SYAA 5CXSA 2BHLA 3EPKA 2IXGA 3ZDFA 5G0VA 3EB9A 4LAFA 3UW1A 1QZXA 4CNQA 5K0ZA 2TMYA 1MC5A 3CF4A 2ONYA 3IXMA 3O4RA 3TLXA 1T8WA 1Z5OA 3VI4B 4DQVA 3LYAA 3IKMB 5EKUA 2ZBQA 5AW3A 4XZ3A 1YZUA 2ATXA 1HDZA 2XQVA 4QARA 4ZJPA 2JLVA 2F3PA 3F9RA 2PAAA 5BVGA 4YMUA 3GJ5A 3CIOA 4OQNA 1AKTA 4A10A 1W6RA 2BGRA 5EJAA 1Z6PA 4ICIA 4O4JF 3TJMA 4RA6B 2I2AA 1OH8A 4ZOQI 1IL0A 1I13A 4XDHA 2Q2OA 3EW7A 1Z8NA 1J0AA 1ZK4A 2TYSB 4G0NA 5FBRB 4LZLA 5AVSA 3ZXYA 2M2IA 3H5TA 3FTDA 2B0CA 2GM3A 2V03A 3HKCB 2HF2A 4D9KA 4MUYA 5E8RA 2FVYA 4GX2A 1SJ9A 4TT8A 2E2WA 3BXHA 1QH1B 2FRXA 1U8UA 3CEMA 4ITRC 3NASA 4KBYA 1Z82A 3N0TA 4IWXA 3DMGA 3WICA 1VL2A 5EJ2A 2F9FA 2XTMA 2Z8XA 1FP4A 3LGAA 2ZT7A 4UNIA 3QX3A 1K5GA 5M04A 5FA8A 3A28A 2AKYA 5FNZA 1YH3A 2VLBA 4FZJA 4Y2YA 4QOJA 4UQPA 2KE5A 2ADOA 3CYFA 1HLPA 4XCQA 4B8ZA 3VYVA 4ER0A 4PSDA 3HKBB 4IWYA 3V8PA 3H1PA 3UK1A 4TXHA 1LSSA 3QPAA 3OKAA 1RD4A 1Z68A 1Y6QA 4JEMA 2ETVA 4LQDA 3K15A 2O20A 1IHXA 4KBFA 1RQ7A 2WHXA 1EVEA 2VP3A 3HV2A 3QA3E 1AZWA 1BOFA 3D8HA 1ZNYA 4NENA 4Q9HA 3DAGA 3JQ8B 4DQ0A 3U39A 1N7JA 2QMQA 3DAHA 4J6EA 5T3YA 2LCQA 3RBAA 1XTIA 4MQFB 1T2VA 2A5FA 1Z74A 1MF7A 1XZBA 3OOHA 1B7GO 3UC9A 3WMFA 1PZXA 3ML1A 2BV3A 4V0KA 4F9FA 1TCCA 4D0NA 3FVQA 1L3BA 4MWBA 1FDIA 2UUBB 2IY7A 3C14C 1VI2A 5HM8A 5CXXA 2PUEA 1JAIA 3RB8A 2UYYA 3DEIA 3VO9A 1ZX1A 2BF4A 4NRDA 2YFKA 4XM1A 3TBFA 2UUAB 4LBWA 4HG2A 2VXCA 5IAEA 1CUJA 1KY3A 3ZU4A 5AH0A 3OP1A 4UVDA 1MO2A 1A8HA 1XVAA 1D2RA 1MJNA 3QVVA 4OH1A 3AY6A 2YJ3A 2QD1A 4MVCA 3NU1A 4OCZA 2V7TA 4RV9A 4UOQA 1QV6A 1H6AA 1NMYA 4XYGA 3BDVA 2JGNA 5IKPA 4TT3D 1PJ2A 3W7BA 2NYRA 4JROA 3MQ4A 1CVLA 3TPCA 5JSYA 3B20A 4Q4HB 1YDHA 4ZQIA 4C30A 3SBDA 1KP9A 4FHEA