1MJ0A

Sank e3_5: an artificial ankyrin repeat protein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLAASNGHLEIVEVLLKNGADVNASDLTGITPLHLAAATGHLEIVEVLLKHGADVNAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SANK E3_5 Protein
publication title Designed to be stable: Crystal structure of a consensus ankyrin repeat protein
pubmed doi rcsb
source organism Designed synthetic gene
molecule tags De novo protein
total genus 55
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2002-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1mj0A00
2FO1E 3EU9A 1BI7B 4C48B 2DZNA 4U96D 2DWZA 1YCSB 1OT8A 4K5CA 5AQ9A 4GPMA 1N11A 5AQBA 5AARA 4HBDA 5HKPA 4DX1A 1YYHA 5HS0A 4HRNA 2NYJA 3DEPA 1G3NB 2AJAA 2ETBA 3AAAC 2JABA 4O1OA 4G8KA 5HRYA 5CECB 4O1PA 5AQAA 5EN5D 5BXUA 1AP7A 4N5QA 1MYOA 3Q9UC 3V2OA 2P2CP 2XEHA 2Y1LE 3B95A 3V2XA 4A63B 1SW6A 3EHRA 5CBNA 2ZGDA 5KNHD 5EIBE 5JA4D 3EHQA 1SVXA 1K1AA 1N0RA 3D9HA 1IXVA 2ETAA 4ZHBA 3AJIA 4LSZE 1AWCB 5ENSD 2L6BA 5JMND 3ZNGA 3F6QA 5EYLA 2QYJA 3TWUA 4O60A 4K5BA 3V30A 3KEAA 5ENTD 5EILA 5KWDA 3LJNA 5ENOD 4YDWA 4Z68A 4OAVB 3IXEA 1WDYA 1MX6A 3UXGA 2DZOA 4HI8A 5AN8A 2BKGA 4BSZB 3SO8A 2A5EA 3B7BA 4HRMB 4ZFHA 5D66A 1S70B 2KBXA 1K3ZD 3ZKJA 2MYOA 4DUIA 2Y0BG 1N0QA 3NBNB 2J8SD 2F8YA 3T9KA 1DCQA 3HRAA 4CZ2D 2RFAA 4HRLA 4BEPA 2F37A 4LG6A 3TWVA 1K1BA 4UUCA 1D9SA 4ATZD 4GMRA 4HNAD 5KNGA 3TWTA 3C5RA 3JUEA 4J7WA 3Q9NC 4BETA 5ITZF 5EYPF 2KXPC 4DX2A 1YMPA 2DVWA 4F6RD 1IHBA 4CYMD 4TUMA 1OY3D 3NOCD 5ENPD 5FIOA 1MX4A 4K5AB 2XZDG 1BLXB 4BESA 1TR4A 4DX7D 2F8XK 3HG0D 3W9GA 4NIKA 3V79K 3V31A 1A5EA 5CEAA 4RLYA 4U8YD 3TWSA 2QC9A 3NOGD 4HI9A 4U95D 3W9FA 4F1PA 3TWQA 3J5QB 5BXOA 4U8VD 1MX2A 5CEDB 2B0OE 4HLLA 3JXIA 4HQDA 4LNUD 3ZUVB 4J8YA 1DC2A 2HE0A 3UTMA 2BKKB 3T8KA 1UOHA 5KBAA 4BERA 3DEOA 4YDYA 5EIDA 1BD8A 2V4HC 3TWRA 5CERB 2RFMA 1BI8B 3J5PA 3UI2A 4QFVA 5ENRD 2ZGGA 5AAOA 4QQIA 4DX5D 2XENA 2XZTG 1WG0A 2ETCA 2V5QC 3JXJA 2PNNA 1QYMA 2VGEA 3ZU7B 1BU9A 4HB5A 3TWWA 3TWXA 1NFIE 4DRXE 5CBOA 4DX6D 4OAUC 4G8LA 1MJ0A 4B93B 5ENQD 5AQ7A 4JB8P 5FINA 2XEEA 1IKND
chains in the Genus database with same CATH superfamily
3PEVB 2KZTA 1IQRA 3UM2A 5HKPA 4U0SA 5BUZA 3CHMA 4WNEA 3WXXA 5HRYA 2C0LA 1Z3YA 3DXMG 1AP7A 5J08A 2PZIA 4KYOB 5CBNA 1XNFA 1K1AA 4GZ5A 4ZHBA 4GTVA 4BTAA 4L7TA 3FUHA 2L6JA 3FU6A 1FPPA 3CV0A 2XRZA 5FZSA 4I2WA 3FH5A 4UQXA 1N95A 3B7BA 3PREA 2IEJA 1KT1A 2PM6A 2OV8A 4U7EB 2QZAA 4DUIA 2Y0BG 3SFXA 2ZISA 2P58C 3L82A 4J7WA 3Q9NC 4N2SA 3DSXA 2ZU6B 5DIZA 3FDHA 2F8XK 3ML9A 3W9GA 4FHJA 4DLQA 2XGOA 4F1PA 2QC9A 3Q5MA 4U8VD 4HLLA 3JXIA 4AEZC 3UTMA 1UOHA 4Q94A 3UI2A 4HOQA 3C3QA 2HYZA 3LDZA 3URZA 4UWKA 5CBOA 4DRXE 1TNOA 3DSTA 1H2VC 2NXPA 5IY5E 2FO1E 3CHQA 2XHEA 4C48B 3I3NA 2E0IA 2EIME 3FTSA 3P2BA 2ETBA 5KJKA 4O1OA 2VQ2A 3U3WA 2LAHA 1TNYA 4A63B 1E8XA 1MHQA 3D9JA 3PE4A 4G25A 5ENSD 3E33A 2M63A 4AXHA 2HO1A 1WDYA 3QB2A 4JA9A 5KJNA 2KBXA 4I6JA 2MYOA 4AOFA 1JUQA 4WAFA 3LVRE 2BTDA 4HNAD 3FTYA 4KMOA 2R2LA 5A23A 3JYSA 4ILGA 4RG9A 3JQ0A 4B8AA 1BLXB 4NURA 4M7CA 4UWFA 4FC8A 1ZU2A 3RO3A 3ASGA 5CHEE 3LY7A 2XGMA 1O5MA 4Y6WA 4FJYA 4ME2A 1OWPA 3SD5A 5BV0A 2EQXA 2HR2A 3MEKA 1ZBPA 5D2MC 1RW2A 4L1BA 4XEIG 1UG3A 3E34A 3R9MA 3TWWA 4I6EA 4EBAG 4WNDA 4DX6D 3OXGA 3OAWA 4G23A 5FINA 3HHMA 3PEUB 1W3BA 4UWHA 1IHGA 4U07A 1JPLA 4F1SA 1N94A 2NYJA 3ZRHA 2JEKA 3D9LA 3CVVA 3SZ7A 1UN9A 4EZKA 1VDYA 1FVFA 4N3CA 3V2XA 3D9MA 3CKCA 1UJJA 3E4BA 1IXVA 3NQPA 5JHAA 4U04A 4BT8A 4GCOA 4CT4A 4Z68A 5KWDA 4OYSA 1MX6A 2XPZA 5AN8A 2BKGA 4JA7A 3ABKE 1IQUA 1PY1A 5CMWA 4H7XA 3CVPA 3PZ3A 1K1BA 3Q7FA 5EYPF 5BV1A 4K5AB 4BESA 4HFGA 1HO8A 4GU5A 5AJLA 3ABME 3HVEA 2LUHA 4B0ZA 1OWNA 4YDYA 5D0QD 1TJCA 2GRMA 4RQIA 3UT7A 4DI3A 3CVYA 3ZXPA 3JXJA 3AG1E 4ILHB 2VGXB 2VJ8A 2WVIA 3DSWA 2LO6A 3I4GA 5C2YA 3R7QA 3CK7A 3IV0A 2AVPA 3D9PA 1JWFA 4JD2G 2DYRE 3EU5A 2XS1A 4JXTA 2OVBA 1N52A 3FHEA 2Y1LE 3UKUG 5JA4D 4N3AA 3AJIA 2PL2A 4I9EA 4W9RA 3SY2A 4KVOA 2J09A 2WXOA 4JHRA 1MQSA 4Y6CA 3NB2A 4AV7A 2I6HA 3CHSA 2R03A 4UUCA 5KNGA 3TWTA 2IJGX 4I2ZA 4PH4B 4CEMA 3UT8A 3MKQB 4WWPA 3UIOC 4YDEA 1TJFA 5LX8A 4AIFA 1MX2A 4JPSA 1Z5SC 2RKKA 3FUDA 4HQDA 3Q73A 3RO2A 3C98A 1U3DA 1OCZE 3UINC 3DEOA 2V4LA 2OVFA 1TN6A 1BD8A 5CERB 1NZNA 3D9IA 3PUJA 1V55E 2V0PA 1OCOE 3QWPA 1WG0A 5G04J 3KD7A 1H19A 2WXPA 3QWVA 2NSZA 1Y8MA 1YCSB 2BF0X 4G1TA 4HRNA 5FZRA 4EQFA 3S2AA 1KPSB 4GYWA 5C1DA 3EHRA 3EHQA 3ULQA 3ZFWA 3PVLA 4J8DA 3EHNA 3CGHA 3TXMA 2UY1A 1Y6IA 3L9TA 3V30A 3KSQA 3FUMA 3FP3A 5ENOD 5DBKA 3L16A 1HH8A 4C0EA 3LCAA 3QWWA 3OXFA 4GB9A 4PS3A 1OWMA 2CG3A 5G04C 1N4RA 2R17C 4BEPA 1LF8A 4LG6A 3TWVA 3SBSA 4I1AA 2X38A 3NOCD 1WAO1 2FBNA 3CSFA 5EKQD 2ZIRA 3B7UX 3V79K 3ASFA 4ABNA 4EZJA 4L2YA 1FCHA 1N9AA 5KBAA 4WWNA 1HS6A 3J5PA 3SFYA 3FU5A 4GTOA 5G05J 2WXHA 2FULA 3FUFA 4GA2A 4CCAA 2WXJA 3LS8A 3N71A 3TWXA 1LTXA 3SFZA 5AQ7A 1BPOA 5LFAA 1X5BA 3SHFA 4RSYA 3FUJA 2BUGA 5AQBA 3G2VA 5HS0A 1TN7A 4OVVA 4U0ZA 1G3NB 4FLBA 3BQOA 2XQ0A 5BXUA 2XEHA 3BEEA 3HXBA 2C2LA 1N0RA 5E75A 2KZTB 4K0RA 4PS7A 3UQ3A 2P9NG 5AENA 2YNQA 3HXDA 4PDXA 5G05C 1S70B 2J9QA 1K3ZD 3T9KA 3LVQE 2J4BA 2P9LG 2F37A 4TXRA 3C5RA 2EIKE 3MCXA 4APFA 5CRUA 1JCRA 4NIKA 3CIAA 1S63A 4RLYA 2X3MA 4HI9A 4U95D 3ASDA 3RAUA 5CMYA 2R5SA 4PUCA 2V4HC 2MHKA 2LAIA 4BWRA 1Z6TA 2WMNA 2WB2A 4DX5D 2XZTG 3D9OA 3KEZA 4L9PA 3FEYA 5AIJA 2XEEA 1IKND 4JL0A 1OUVA 3FUNA 2DWZA 4K5CA 3KAEA 2IOLA 2J4DA 4XZ4A 3DEPA 3U66A 4GZ6A 2VSYA 1HXIA 2X6JA 5EN5D 1K8KG 2GGFA 2AW6A 2LXMA 1UW4B 3K9IA 3TAXA 1OCCE 4ILIA 4AY6A 2WXKA 2ETAA 5ANLA 1O1SA 3O4ZA 2WQHA 3L17A 3NZSA 3FWVA 3I4RB 3UMVA 4FP7A 3BUAA 2GRNB 4HI8A 4LUNU 3CVUA 3ZYKA 3E37A 2LNIA 4GTTA 4N39A 4WNGA 3AG4E 4EZLA 4ATZD 4MKTA 1DCEA 3ZYMA 2QY7A 2VGYA 4BETA 4F6RD 3DSSA 4TUMA 5FIOA 2XZDG 1E8ZA 1NA0A 3ULEG 4XIFA 2IF4A 4BT9A 3C3OA 1NP7A 5T8IA 4IYPA 3R7RA 4I9CA 1L5JA 4HOTA 1TNZA 3X2QE 2ETCA 1NI1A 3B7SA 3EIJA 2I1JA 3ESLA 4TXPA 3ZVVA 3KS2A 4R7LA 4B89A 3ONLA 4G24A 3HIZA 4E85A 1OT8A 4P29A 4HBDA 2KC7A 3AAAC 3DPDA 1LD7A 4HLEA 2CG2A 3UPVA 2DIWA 3TG5A 3AS5A 3QKYA 2XCBA 4LEUA 1SA5A 4MLPA 1HG2A 5LCWC 3NZUA 5JMND 1D8EA 2WXRA 3ZHEB 3FY4A 3PZ1A 3PZ4A 3NF1A 3GZ2A 3LJNA 4YDWA 4V3IA 3IXEA 1V54E 3ASHA 2ZXWE 2WXFA 4G11A 4HOUA 4ACKA 4GTQA 2F8YA 3OTNA 2OCCE 3JUEA 3Q75A 5FWQA 3MA5A 2F0YA 3EJNA 5FQ8A 4IN3B 4UQYA 3Q7AA 4L23A 1H2UA 1DC2A 1P5QA 4XKBA 2KCKA 1FT2A 5ENRD 3MV3B 4JW1A 3HVEB 3ZU7B 4CGVA 3GW4A 2H6IA 3RIBA 1E8YA 2LSVA 4U96D 4J0UA 1E7VA 5FZQA 4UWGA 2IO3C 3LXUX 5AARA 2J08A 3D9NA 1QZ2A 3CK8A 3O48A 2IOSA 4CDNA 3Q9UC 2X6FA 1SW6A 3QDNA 4LSZE 4FA6A 1D8DA 3JUIA 5KJLA 3SQVA 3ZNGA 1QQEA 3ZXSA 3F6QA 5EX0A 3TWUA 4KZ0A 1IYGA 2B6CA 4AY5A 3HXEA 4BSZB 3ZKJA 1X81A 1INZA 1OWOA 2P9SG 2XS8A 4D10C 1ELKA 3DPYA 2VSOE 4MS6A 2J07A 1HZ4A 3BG1B 1GW6A 2GRQB 3RRNB 2CFZA 1TR4A 2YINA 3CHRA 3ZYLA 1A5EA 3L08A 3LJ3A 1PC2A 3NOGD 3J5QB 3CQCB 3IHVA 3L6AA 1N4QA 2BKKB 2Y4UA 2CHXA 4WWOA 5A6CA 5ENNA 4QFVA 4G26A 2ZGGA 3JCKC 1WY6A 4LCTA 3SNXA 3Q78A 4QQIA 3AU4A 4GPKA 3ZIMA 1ELWA 2PNNA 3IEGA 4HB5A 3RSEG 2E2EA 3E32A 2XEVA 3PZ2A 4FADA 3EU9A 5ARFA 1H0AA 3WG7E 4A55A 2Y4TA 3ISMC 4B8CB 5ANRA 5BW8C 4YVOA 3QARA 4JHKA 5H7PA 1OCRE 1S0PA 4LNGA 3LYAA 1KZOA 3DSVA 1TEZA 4DI4A 3G2UA 3B13A 1AWCB 2L6BA 2I1KA 2L9BA 2NC9A 4AP2A 3PUKA 5ENTD 3UIPC 3PE3A 3SBTB 2CHWA 4J8EA 4KT6B 3SO8A 3D9KA 3VLDA 2VSXE 3EDTB 4TRQA 2UY1B 1EDUA 2YQ8A 2VTBA 3PS6A 1H6PA 1TNBA 1IHBA 3Q49B 2I9CA 4DX7D 3L13A 4GMLA 3BU8A 2IY0C 1LD8A 4F3VA 5AYWD 3W9FA 4FHKA 2Y3AA 5FTPA 4LNUD 4UI9C 2GW1A 4KBQA 3QAQA 4A1SA 1JWGA 4FJZA 5AAOA 5CRVA 2AWIA 2V5QC 1N54A 2VGEA 3FTUA 3EIQC 3UM1A 1E8WA 1N4SA 3QK0A 4G8LA 4EHMA 4B93B 3CK9A 3CSTA 2DZNA 4U63A 4DX1A 4DK5A 2KCVA 3PRZA 4DLOA 4LRZA 4XI0A 5EDSA 5AQAA 3TJPA 4A1GA 2P9PG 1UJKA 1SZAA 3MZLB 2RD0A 1JCSA 3EUVA 3D9HA 2VSNA 5BNWA 4M3OA 3P1UA 5CCMA 4BX8A 4HXIA 4XKCA 4Q96A 3U9WA 2ONDA 1OXJA 3T5XA 2MRIA 2WMOA 1FVHA 1WM5A 4C9BB 5JHBA 1KLXA 3HYMB 2EILE 1N0QA 3NBNB 4I6GA 2J8SD 3ULYA 1UN8A 4FULA 1YA0A 2IQCA 2YHEA 3ZW3A 3PNTB 4KXKB 2LXLA 1YMPA 3BG0B 3TGOA 3FTVA 1OY3D 5ENPD 2WQ6A 3C72A 3L22A 3TWSA 3TWQA 3RJVA 5CEDB 4ANWA 3ZUVB 3QOUA 5B1BE 2JLBA 3APDA 4YNDA 3TL5A 3TWRA 4YVQC 2DBAA 5G55A 4HOSA 3DXKG 3DSUA 1EF1C 2WXGA 4GAAA 4TV3A 5B3SE 3HXCA 3S7DA 5EYLA 4I1OB 4H7YA 2OEVA 2L0TB 4BSXA 4BFRA 2WXLA 3T5VA 3G2SA 3I5PA 4JZYA 4HS2A 2JABA 3PZDA 4BX9A 3FUEA 2QFCA 3B95A 3Q4AB 2WM9A 3APFA 3L54A 2X6HA 4NACA 4YDOA 4MRUA 2FO7A 3FTXA 3RU0A 2ILRA 4L2LA 3FEXA 1PAQA 4GTSA 4TUUA 2H6GA 3IHYA 3DWLG 2FI7A 2OEWA 3R9AB 2V5FA 1MX4A 2MOWA 3V31A 1MZCA 4BY6A 3S7BA 2WXIA 4KZCA 4F53A 5BXOA 1ZB1A 3PH0C 4A3TA 2P9IG 4J8YA 3FULA 4F7AA 4JEUA 5EIDA 5JJTA 4OVUA 1E96B 3AS4A 1S64A 2XRYA 2VYIA 3FU0A 3SGHA 3CVXA 1BU9A 3E30A 1E90A 4AJWA 4AVXA 5LCWJ 3ASNE 3LY9A 1YYHA 1EPUA 4GZ3A 2WPVA 3CQGB 2WXMA 3RRUA 3CVWA 2IO2C 4O1PA 3TG4A 4I43A 2X6IA 5KNHD 1SVXA 3VLFA 3Q15A 1QNFA 2XPIA 1TYQG 4NRHB 4XX5A 5EILA 4G2VA 2AXUA 2C0MA 2A5UA 5FT9A 5LP0A 1HG5A 1DCQA 3HRAA 5B1AE 4UWLA 2R59A 4GMRA 3LKUA 3AG3E 1HFAA 3AS8A 4CYMD 1ELRA 4BTBA 3FTZA 4Q69A 5BT1A 5CEAA 3MJWA 3UUXA 2B0OE 5D0OD 1Z3XA 1FT1A 4J6IA 4BERA 2H6FA 2RG8A 4A3VA 3SI5A 3ZHEA 2YHCA 4URKA 4PS8A 1HE8A 5T4YA 2EINE 1MJ0A 3ONKA 5ENQD 3VLEA 4GA0A 3Q79A 5AQ9A 4IULA 3UT4A 4GZCA 1XGWA 4WNFA 2AJAA 4GTPA 4J8SA 3FUKA 4N5QA 1MYOA 3V2OA 2R02A 4RG6A 4ACLA 4IRUA 2AXVA 3IKOB 1NL4A 1KZPA 2V8SE 5J90A 1Q2ZA 3B7TA 3KEAA 4GYOA 3GZSA 2P9UG 4OAVB 3D3MA 2J49A 2GRRB 2CHZA 4U0UA 2A5EA 4ZFHA 1H6KA 1SZ9A 5D66A 3S7JA 1U2VG 4JHJA 5T3RA 5ARGA 3FUIA 4HRLA 2KCLA 4GZDA 4X8QA 1D9SA 4FU3A 3KSLA 4APOA 2KXPC 2DVWA 2KM4A 4JEHA 2PQNA 4DJAA 4EECA 1NA3A 4GCNA 3HG0D 3ZGQA 2WXNA 4C0MA 3LPZA 2GROB 3CLJA 3U4TA 4UI9K 4I17A 2VGXA 2HE0A 4XI9A 3T8KA 3G2WA 4NQ0A 5M72A 1U3CA 4GYYA 1BI8B 5JJ6A 5KCMA 3MYVA 4O6FA 2FF4A 2QYUA 4LNBA 4LERA 4B94A 1TN8A 1QYMA 2Q7FA 1NFIE 4OAUC 3LEWA 3UX4A 2PQRA 3RK6A 5HI7A 4JB8P 3OXLA 2X6KA 1E7UA 3ESKA 5JJ7A 1BI7B 1QBQA 4GA1A 1HF8A 1RZ4A 5FJYA 3LY8A 4ANVA 2L0IA 4GTRA 3MX3A 3IBEA 4HVBA 2EIJE 2P2CP 2IONA 4AM9A 2ZGDA 5EIBE 3CHOA 2HM8A 4KVMA 3ZPJA 2IFUA 2Y69E 2XCCA 3ZEFA 3AG2E 3QNKA 3UKRG 3B7RL 3UM3A 2DZOA 1SQMA 4HRMB 3MGBA 1O1TA 3MKQA 4CGWA 5FQ7A 4CZ2D 3DRAA 4UI9J 2H6HA 3FTWA 3PNLB 4CDMA 3GZ1A 1DVPA 3QC1A 4EBAA 2LSUA 3DBSA 4DPRA 3HXFA 5AJDA 3APCA 3NAWA 4N3BA 3FFLA 5HQ8A 5A7DB 4U8YD 3ML8A 4GTMA 2FEZA 2GRPB 5LOZA 3TXNA 2VTBB 3CVNA 3ABLE 3MKRA 4RVBA 5E76A 2IU1A 1N4PA 3S7FA 3UM0A 3VTYA 4CT0A 3ASOE 3QJZA 5FQ6A 2R05A 3HDXA 2WQ7A 2DCPA 4J8FA 4FLHA 3CVQA 1HU3A 5KJMA 3FH7A 2XGSA 4TXQA 4GPMA 1N11A 1KT0A 1HX8A 4U8HA 4G8KA 5CECB 2CFUA 3FH8A 2GRLA 4N5CA 4MBGA 3Q47B 4ANXA 1O1RA 5FQ4A 1DNPA 3T8MA 3ZYQA 4JC8A 2XPYA 2PM7A 5G2NA 4N2QA 1TNUA 4HORA 2QYJA 4O60A 4K5BA 3CVLA 2WXQA 3UXGA 3RRMB 1H6OA 4CDRA 4I1MA 3CHPA 4JVSA 4ANUA 2BEDA 2RFAA 3RKVA 3CR3A 3C3RA 5ITZF 4CRWA 1EYHA 3AU5A 2P9KG 3CKBA 3ZN3A 4DX2A 1JCQA 3VTXA 3G2TA 3GYZA 2KATA 2A4ZA 3U64A 4UQZA 4GMJA 1SA4A 4XE0A 2OOEA 3EHMA 1B89A 3FU3A 3MV2B 4K03A 2RFMA 2I2OA 4WUYA 1A17A 3CEQA 3JQ1A 2XENA 3SF4A 5BPPA 4E6HA 1OWLA 5CCLA 3ENEA 5EX3A 1H2TC 4EPZA 2AXZA 2DYSE 3PDNA 4ATGA 2UWJG
chains in the Genus database with same CATH topology
2FO1E 3EU9A 1BI7B 4C48B 2DZNA 4U96D 2DWZA 1YCSB 1OT8A 4K5CA 5AQ9A 4GPMA 1N11A 5AQBA 5AARA 4HBDA 5HKPA 4DX1A 1YYHA 5HS0A 4HRNA 2NYJA 3DEPA 1G3NB 2AJAA 2ETBA 3AAAC 2JABA 4O1OA 4G8KA 5HRYA 5CECB 4O1PA 5AQAA 5EN5D 5BXUA 1AP7A 4N5QA 1MYOA 3Q9UC 3V2OA 2P2CP 2XEHA 2Y1LE 3B95A 3V2XA 4A63B 1SW6A 3EHRA 5CBNA 2ZGDA 5KNHD 5EIBE 5JA4D 3EHQA 1SVXA 1K1AA 1N0RA 3D9HA 1IXVA 2ETAA 4ZHBA 3AJIA 4LSZE 1AWCB 5ENSD 2L6BA 5JMND 3ZNGA 3F6QA 5EYLA 2QYJA 3TWUA 4O60A 4K5BA 3V30A 3KEAA 5ENTD 5EILA 5KWDA 3LJNA 5ENOD 4YDWA 4Z68A 4OAVB 3IXEA 1WDYA 1MX6A 3UXGA 2DZOA 4HI8A 5AN8A 2BKGA 4BSZB 3SO8A 2A5EA 3B7BA 4HRMB 4ZFHA 5D66A 1S70B 2KBXA 1K3ZD 3ZKJA 2MYOA 4DUIA 2Y0BG 1N0QA 3NBNB 2J8SD 2F8YA 3T9KA 1DCQA 3HRAA 4CZ2D 2RFAA 4HRLA 4BEPA 2F37A 4LG6A 3TWVA 1K1BA 4UUCA 1D9SA 4ATZD 4GMRA 4HNAD 5KNGA 3TWTA 3C5RA 3JUEA 4J7WA 3Q9NC 4BETA 5ITZF 5EYPF 2KXPC 4DX2A 1YMPA 2DVWA 4F6RD 1IHBA 4CYMD 4TUMA 1OY3D 3NOCD 5ENPD 5FIOA 1MX4A 4K5AB 2XZDG 1BLXB 4BESA 1TR4A 4DX7D 2F8XK 3HG0D 3W9GA 4NIKA 3V79K 3V31A 1A5EA 5CEAA 4RLYA 4U8YD 3TWSA 2QC9A 3NOGD 4HI9A 4U95D 3W9FA 4F1PA 3TWQA 3J5QB 5BXOA 4U8VD 1MX2A 5CEDB 2B0OE 4HLLA 3JXIA 4HQDA 4LNUD 3ZUVB 4J8YA 1DC2A 2HE0A 3UTMA 2BKKB 3T8KA 1UOHA 5KBAA 4BERA 3DEOA 4YDYA 5EIDA 1BD8A 2V4HC 3TWRA 5CERB 2RFMA 1BI8B 3J5PA 3UI2A 4QFVA 5ENRD 2ZGGA 5AAOA 4QQIA 4DX5D 2XENA 2XZTG 1WG0A 2ETCA 2V5QC 3JXJA 2PNNA 1QYMA 2VGEA 3ZU7B 1BU9A 4HB5A 3TWWA 3TWXA 1NFIE 4DRXE 5CBOA 4DX6D 4OAUC 4G8LA 1MJ0A 4B93B 5ENQD 5AQ7A 4JB8P 5FINA 2XEEA 1IKND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FO1 E;  3EU9 A;  1BI7 B;  4C48 B;  2DZN A;  4U96 D;  2DWZ A;  1YCS B;  1OT8 A;  4K5C A;  5AQ9 A;  4GPM A;  1N11 A;  5AQB A;  5AAR A;  4HBD A;  5HKP A;  4DX1 A;  1YYH A;  5HS0 A;  4HRN A;  2NYJ A;  3DEP A;  1G3N B;  2AJA A;  2ETB A;  3AAA C;  2JAB A;  4O1O A;  4G8K A;  5HRY A;  5CEC B;  4O1P A;  5AQA A;  5EN5 D;  5BXU A;  1AP7 A;  4N5Q A;  1MYO A;  3Q9U C;  3V2O A;  2P2C P;  2XEH A;  2Y1L E;  3B95 A;  3V2X A;  4A63 B;  1SW6 A;  3EHR A;  5CBN A;  2ZGD A;  5KNH D;  5EIB E;  5JA4 D;  3EHQ A;  1SVX A;  1K1A A;  1N0R A;  3D9H A;  1IXV A;  2ETA A;  4ZHB A;  3AJI A;  4LSZ E;  1AWC B;  5ENS D;  2L6B A;  5JMN D;  3ZNG A;  3F6Q A;  5EYL A;  2QYJ A;  3TWU A;  4O60 A;  4K5B A;  3V30 A;  3KEA A;  5ENT D;  5EIL A;  5KWD A;  3LJN A;  5ENO D;  4YDW A;  4Z68 A;  4OAV B;  3IXE A;  1WDY A;  1MX6 A;  3UXG A;  2DZO A;  4HI8 A;  5AN8 A;  2BKG A;  4BSZ B;  3SO8 A;  2A5E A;  3B7B A;  4HRM B;  4ZFH A;  5D66 A;  1S70 B;  2KBX A;  1K3Z D;  3ZKJ A;  2MYO A;  4DUI A;  2Y0B G;  1N0Q A;  3NBN B;  2J8S D;  2F8Y A;  3T9K A;  1DCQ A;  3HRA A;  4CZ2 D;  2RFA A;  4HRL A;  4BEP A;  2F37 A;  4LG6 A;  3TWV A;  1K1B A;  4UUC A;  1D9S A;  4ATZ D;  4GMR A;  4HNA D;  5KNG A;  3TWT A;  3C5R A;  3JUE A;  4J7W A;  3Q9N C;  4BET A;  5ITZ F;  5EYP F;  2KXP C;  4DX2 A;  1YMP A;  2DVW A;  4F6R D;  1IHB A;  4CYM D;  4TUM A;  1OY3 D;  3NOC D;  5ENP D;  5FIO A;  1MX4 A;  4K5A B;  2XZD G;  1BLX B;  4BES A;  1TR4 A;  4DX7 D;  2F8X K;  3HG0 D;  3W9G A;  4NIK A;  3V79 K;  3V31 A;  1A5E A;  5CEA A;  4RLY A;  4U8Y D;  3TWS A;  2QC9 A;  3NOG D;  4HI9 A;  4U95 D;  3W9F A;  4F1P A;  3TWQ A;  3J5Q B;  5BXO A;  4U8V D;  1MX2 A;  5CED B;  2B0O E;  4HLL A;  3JXI A;  4HQD A;  4LNU D;  3ZUV B;  4J8Y A;  1DC2 A;  2HE0 A;  3UTM A;  2BKK B;  3T8K A;  1UOH A;  5KBA A;  4BER A;  3DEO A;  4YDY A;  5EID A;  1BD8 A;  2V4H C;  3TWR A;  5CER B;  2RFM A;  1BI8 B;  3J5P A;  3UI2 A;  4QFV A;  5ENR D;  2ZGG A;  5AAO A;  4QQI A;  4DX5 D;  2XEN A;  2XZT G;  1WG0 A;  2ETC A;  2V5Q C;  3JXJ A;  2PNN A;  1QYM A;  2VGE A;  3ZU7 B;  1BU9 A;  4HB5 A;  3TWW A;  3TWX A;  1NFI E;  4DRX E;  5CBO A;  4DX6 D;  4OAU C;  4G8L A;  1MJ0 A;  4B93 B;  5ENQ D;  5AQ7 A;  4JB8 P;  5FIN A;  2XEE A;  1IKN D; 
#chains in the Genus database with same CATH topology
 3PEV B;  2KZT A;  1IQR A;  3UM2 A;  5HKP A;  4U0S A;  5BUZ A;  3CHM A;  4WNE A;  3WXX A;  5HRY A;  2C0L A;  1Z3Y A;  3DXM G;  1AP7 A;  5J08 A;  2PZI A;  4KYO B;  5CBN A;  1XNF A;  1K1A A;  4GZ5 A;  4ZHB A;  4GTV A;  4BTA A;  4L7T A;  3FUH A;  2L6J A;  3FU6 A;  1FPP A;  3CV0 A;  2XRZ A;  5FZS A;  4I2W A;  3FH5 A;  4UQX A;  1N95 A;  3B7B A;  3PRE A;  2IEJ A;  1KT1 A;  2PM6 A;  2OV8 A;  4U7E B;  2QZA A;  4DUI A;  2Y0B G;  3SFX A;  2ZIS A;  2P58 C;  3L82 A;  4J7W A;  3Q9N C;  4N2S A;  3DSX A;  2ZU6 B;  5DIZ A;  3FDH A;  2F8X K;  3ML9 A;  3W9G A;  4FHJ A;  4DLQ A;  2XGO A;  4F1P A;  2QC9 A;  3Q5M A;  4U8V D;  4HLL A;  3JXI A;  4AEZ C;  3UTM A;  1UOH A;  4Q94 A;  3UI2 A;  4HOQ A;  3C3Q A;  2HYZ A;  3LDZ A;  3URZ A;  4UWK A;  5CBO A;  4DRX E;  1TNO A;  3DST A;  1H2V C;  2NXP A;  5IY5 E;  2FO1 E;  3CHQ A;  2XHE A;  4C48 B;  3I3N A;  2E0I A;  2EIM E;  3FTS A;  3P2B A;  2ETB A;  5KJK A;  4O1O A;  2VQ2 A;  3U3W A;  2LAH A;  1TNY A;  4A63 B;  1E8X A;  1MHQ A;  3D9J A;  3PE4 A;  4G25 A;  5ENS D;  3E33 A;  2M63 A;  4AXH A;  2HO1 A;  1WDY A;  3QB2 A;  4JA9 A;  5KJN A;  2KBX A;  4I6J A;  2MYO A;  4AOF A;  1JUQ A;  4WAF A;  3LVR E;  2BTD A;  4HNA D;  3FTY A;  4KMO A;  2R2L A;  5A23 A;  3JYS A;  4ILG A;  4RG9 A;  3JQ0 A;  4B8A A;  1BLX B;  4NUR A;  4M7C A;  4UWF A;  4FC8 A;  1ZU2 A;  3RO3 A;  3ASG A;  5CHE E;  3LY7 A;  2XGM A;  1O5M A;  4Y6W A;  4FJY A;  4ME2 A;  1OWP A;  3SD5 A;  5BV0 A;  2EQX A;  2HR2 A;  3MEK A;  1ZBP A;  5D2M C;  1RW2 A;  4L1B A;  4XEI G;  1UG3 A;  3E34 A;  3R9M A;  3TWW A;  4I6E A;  4EBA G;  4WND A;  4DX6 D;  3OXG A;  3OAW A;  4G23 A;  5FIN A;  3HHM A;  3PEU B;  1W3B A;  4UWH A;  1IHG A;  4U07 A;  1JPL A;  4F1S A;  1N94 A;  2NYJ A;  3ZRH A;  2JEK A;  3D9L A;  3CVV A;  3SZ7 A;  1UN9 A;  4EZK A;  1VDY A;  1FVF A;  4N3C A;  3V2X A;  3D9M A;  3CKC A;  1UJJ A;  3E4B A;  1IXV A;  3NQP A;  5JHA A;  4U04 A;  4BT8 A;  4GCO A;  4CT4 A;  4Z68 A;  5KWD A;  4OYS A;  1MX6 A;  2XPZ A;  5AN8 A;  2BKG A;  4JA7 A;  3ABK E;  1IQU A;  1PY1 A;  5CMW A;  4H7X A;  3CVP A;  3PZ3 A;  1K1B A;  3Q7F A;  5EYP F;  5BV1 A;  4K5A B;  4BES A;  4HFG A;  1HO8 A;  4GU5 A;  5AJL A;  3ABM E;  3HVE A;  2LUH A;  4B0Z A;  1OWN A;  4YDY A;  5D0Q D;  1TJC A;  2GRM A;  4RQI A;  3UT7 A;  4DI3 A;  3CVY A;  3ZXP A;  3JXJ A;  3AG1 E;  4ILH B;  2VGX B;  2VJ8 A;  2WVI A;  3DSW A;  2LO6 A;  3I4G A;  5C2Y A;  3R7Q A;  3CK7 A;  3IV0 A;  2AVP A;  3D9P A;  1JWF A;  4JD2 G;  2DYR E;  3EU5 A;  2XS1 A;  4JXT A;  2OVB A;  1N52 A;  3FHE A;  2Y1L E;  3UKU G;  5JA4 D;  4N3A A;  3AJI A;  2PL2 A;  4I9E A;  4W9R A;  3SY2 A;  4KVO A;  2J09 A;  2WXO A;  4JHR A;  1MQS A;  4Y6C A;  3NB2 A;  4AV7 A;  2I6H A;  3CHS A;  2R03 A;  4UUC A;  5KNG A;  3TWT A;  2IJG X;  4I2Z A;  4PH4 B;  4CEM A;  3UT8 A;  3MKQ B;  4WWP A;  3UIO C;  4YDE A;  1TJF A;  5LX8 A;  4AIF A;  1MX2 A;  4JPS A;  1Z5S C;  2RKK A;  3FUD A;  4HQD A;  3Q73 A;  3RO2 A;  3C98 A;  1U3D A;  1OCZ E;  3UIN C;  3DEO A;  2V4L A;  2OVF A;  1TN6 A;  1BD8 A;  5CER B;  1NZN A;  3D9I A;  3PUJ A;  1V55 E;  2V0P A;  1OCO E;  3QWP A;  1WG0 A;  5G04 J;  3KD7 A;  1H19 A;  2WXP A;  3QWV A;  2NSZ A;  1Y8M A;  1YCS B;  2BF0 X;  4G1T A;  4HRN A;  5FZR A;  4EQF A;  3S2A A;  1KPS B;  4GYW A;  5C1D A;  3EHR A;  3EHQ A;  3ULQ A;  3ZFW A;  3PVL A;  4J8D A;  3EHN A;  3CGH A;  3TXM A;  2UY1 A;  1Y6I A;  3L9T A;  3V30 A;  3KSQ A;  3FUM A;  3FP3 A;  5ENO D;  5DBK A;  3L16 A;  1HH8 A;  4C0E A;  3LCA A;  3QWW A;  3OXF A;  4GB9 A;  4PS3 A;  1OWM A;  2CG3 A;  5G04 C;  1N4R A;  2R17 C;  4BEP A;  1LF8 A;  4LG6 A;  3TWV A;  3SBS A;  4I1A A;  2X38 A;  3NOC D;  1WAO 1;  2FBN A;  3CSF A;  5EKQ D;  2ZIR A;  3B7U X;  3V79 K;  3ASF A;  4ABN A;  4EZJ A;  4L2Y A;  1FCH A;  1N9A A;  5KBA A;  4WWN A;  1HS6 A;  3J5P A;  3SFY A;  3FU5 A;  4GTO A;  5G05 J;  2WXH A;  2FUL A;  3FUF A;  4GA2 A;  4CCA A;  2WXJ A;  3LS8 A;  3N71 A;  3TWX A;  1LTX A;  3SFZ A;  5AQ7 A;  1BPO A;  5LFA A;  1X5B A;  3SHF A;  4RSY A;  3FUJ A;  2BUG A;  5AQB A;  3G2V A;  5HS0 A;  1TN7 A;  4OVV A;  4U0Z A;  1G3N B;  4FLB A;  3BQO A;  2XQ0 A;  5BXU A;  2XEH A;  3BEE A;  3HXB A;  2C2L A;  1N0R A;  5E75 A;  2KZT B;  4K0R A;  4PS7 A;  3UQ3 A;  2P9N G;  5AEN A;  2YNQ A;  3HXD A;  4PDX A;  5G05 C;  1S70 B;  2J9Q A;  1K3Z D;  3T9K A;  3LVQ E;  2J4B A;  2P9L G;  2F37 A;  4TXR A;  3C5R A;  2EIK E;  3MCX A;  4APF A;  5CRU A;  1JCR A;  4NIK A;  3CIA A;  1S63 A;  4RLY A;  2X3M A;  4HI9 A;  4U95 D;  3ASD A;  3RAU A;  5CMY A;  2R5S A;  4PUC A;  2V4H C;  2MHK A;  2LAI A;  4BWR A;  1Z6T A;  2WMN A;  2WB2 A;  4DX5 D;  2XZT G;  3D9O A;  3KEZ A;  4L9P A;  3FEY A;  5AIJ A;  2XEE A;  1IKN D;  4JL0 A;  1OUV A;  3FUN A;  2DWZ A;  4K5C A;  3KAE A;  2IOL A;  2J4D A;  4XZ4 A;  3DEP A;  3U66 A;  4GZ6 A;  2VSY A;  1HXI A;  2X6J A;  5EN5 D;  1K8K G;  2GGF A;  2AW6 A;  2LXM A;  1UW4 B;  3K9I A;  3TAX A;  1OCC E;  4ILI A;  4AY6 A;  2WXK A;  2ETA A;  5ANL A;  1O1S A;  3O4Z A;  2WQH A;  3L17 A;  3NZS A;  3FWV A;  3I4R B;  3UMV A;  4FP7 A;  3BUA A;  2GRN B;  4HI8 A;  4LUN U;  3CVU A;  3ZYK A;  3E37 A;  2LNI A;  4GTT A;  4N39 A;  4WNG A;  3AG4 E;  4EZL A;  4ATZ D;  4MKT A;  1DCE A;  3ZYM A;  2QY7 A;  2VGY A;  4BET A;  4F6R D;  3DSS A;  4TUM A;  5FIO A;  2XZD G;  1E8Z A;  1NA0 A;  3ULE G;  4XIF A;  2IF4 A;  4BT9 A;  3C3O A;  1NP7 A;  5T8I A;  4IYP A;  3R7R A;  4I9C A;  1L5J A;  4HOT A;  1TNZ A;  3X2Q E;  2ETC A;  1NI1 A;  3B7S A;  3EIJ A;  2I1J A;  3ESL A;  4TXP A;  3ZVV A;  3KS2 A;  4R7L A;  4B89 A;  3ONL A;  4G24 A;  3HIZ A;  4E85 A;  1OT8 A;  4P29 A;  4HBD A;  2KC7 A;  3AAA C;  3DPD A;  1LD7 A;  4HLE A;  2CG2 A;  3UPV A;  2DIW A;  3TG5 A;  3AS5 A;  3QKY A;  2XCB A;  4LEU A;  1SA5 A;  4MLP A;  1HG2 A;  5LCW C;  3NZU A;  5JMN D;  1D8E A;  2WXR A;  3ZHE B;  3FY4 A;  3PZ1 A;  3PZ4 A;  3NF1 A;  3GZ2 A;  3LJN A;  4YDW A;  4V3I A;  3IXE A;  1V54 E;  3ASH A;  2ZXW E;  2WXF A;  4G11 A;  4HOU A;  4ACK A;  4GTQ A;  2F8Y A;  3OTN A;  2OCC E;  3JUE A;  3Q75 A;  5FWQ A;  3MA5 A;  2F0Y A;  3EJN A;  5FQ8 A;  4IN3 B;  4UQY A;  3Q7A A;  4L23 A;  1H2U A;  1DC2 A;  1P5Q A;  4XKB A;  2KCK A;  1FT2 A;  5ENR D;  3MV3 B;  4JW1 A;  3HVE B;  3ZU7 B;  4CGV A;  3GW4 A;  2H6I A;  3RIB A;  1E8Y A;  2LSV A;  4U96 D;  4J0U A;  1E7V A;  5FZQ A;  4UWG A;  2IO3 C;  3LXU X;  5AAR A;  2J08 A;  3D9N A;  1QZ2 A;  3CK8 A;  3O48 A;  2IOS A;  4CDN A;  3Q9U C;  2X6F A;  1SW6 A;  3QDN A;  4LSZ E;  4FA6 A;  1D8D A;  3JUI A;  5KJL A;  3SQV A;  3ZNG A;  1QQE A;  3ZXS A;  3F6Q A;  5EX0 A;  3TWU A;  4KZ0 A;  1IYG A;  2B6C A;  4AY5 A;  3HXE A;  4BSZ B;  3ZKJ A;  1X81 A;  1INZ A;  1OWO A;  2P9S G;  2XS8 A;  4D10 C;  1ELK A;  3DPY A;  2VSO E;  4MS6 A;  2J07 A;  1HZ4 A;  3BG1 B;  1GW6 A;  2GRQ B;  3RRN B;  2CFZ A;  1TR4 A;  2YIN A;  3CHR A;  3ZYL A;  1A5E A;  3L08 A;  3LJ3 A;  1PC2 A;  3NOG D;  3J5Q B;  3CQC B;  3IHV A;  3L6A A;  1N4Q A;  2BKK B;  2Y4U A;  2CHX A;  4WWO A;  5A6C A;  5ENN A;  4QFV A;  4G26 A;  2ZGG A;  3JCK C;  1WY6 A;  4LCT A;  3SNX A;  3Q78 A;  4QQI A;  3AU4 A;  4GPK A;  3ZIM A;  1ELW A;  2PNN A;  3IEG A;  4HB5 A;  3RSE G;  2E2E A;  3E32 A;  2XEV A;  3PZ2 A;  4FAD A;  3EU9 A;  5ARF A;  1H0A A;  3WG7 E;  4A55 A;  2Y4T A;  3ISM C;  4B8C B;  5ANR A;  5BW8 C;  4YVO A;  3QAR A;  4JHK A;  5H7P A;  1OCR E;  1S0P A;  4LNG A;  3LYA A;  1KZO A;  3DSV A;  1TEZ A;  4DI4 A;  3G2U A;  3B13 A;  1AWC B;  2L6B A;  2I1K A;  2L9B A;  2NC9 A;  4AP2 A;  3PUK A;  5ENT D;  3UIP C;  3PE3 A;  3SBT B;  2CHW A;  4J8E A;  4KT6 B;  3SO8 A;  3D9K A;  3VLD A;  2VSX E;  3EDT B;  4TRQ A;  2UY1 B;  1EDU A;  2YQ8 A;  2VTB A;  3PS6 A;  1H6P A;  1TNB A;  1IHB A;  3Q49 B;  2I9C A;  4DX7 D;  3L13 A;  4GML A;  3BU8 A;  2IY0 C;  1LD8 A;  4F3V A;  5AYW D;  3W9F A;  4FHK A;  2Y3A A;  5FTP A;  4LNU D;  4UI9 C;  2GW1 A;  4KBQ A;  3QAQ A;  4A1S A;  1JWG A;  4FJZ A;  5AAO A;  5CRV A;  2AWI A;  2V5Q C;  1N54 A;  2VGE A;  3FTU A;  3EIQ C;  3UM1 A;  1E8W A;  1N4S A;  3QK0 A;  4G8L A;  4EHM A;  4B93 B;  3CK9 A;  3CST A;  2DZN A;  4U63 A;  4DX1 A;  4DK5 A;  2KCV A;  3PRZ A;  4DLO A;  4LRZ A;  4XI0 A;  5EDS A;  5AQA A;  3TJP A;  4A1G A;  2P9P G;  1UJK A;  1SZA A;  3MZL B;  2RD0 A;  1JCS A;  3EUV A;  3D9H A;  2VSN A;  5BNW A;  4M3O A;  3P1U A;  5CCM A;  4BX8 A;  4HXI A;  4XKC A;  4Q96 A;  3U9W A;  2OND A;  1OXJ A;  3T5X A;  2MRI A;  2WMO A;  1FVH A;  1WM5 A;  4C9B B;  5JHB A;  1KLX A;  3HYM B;  2EIL E;  1N0Q A;  3NBN B;  4I6G A;  2J8S D;  3ULY A;  1UN8 A;  4FUL A;  1YA0 A;  2IQC A;  2YHE A;  3ZW3 A;  3PNT B;  4KXK B;  2LXL A;  1YMP A;  3BG0 B;  3TGO A;  3FTV A;  1OY3 D;  5ENP D;  2WQ6 A;  3C72 A;  3L22 A;  3TWS A;  3TWQ A;  3RJV A;  5CED B;  4ANW A;  3ZUV B;  3QOU A;  5B1B E;  2JLB A;  3APD A;  4YND A;  3TL5 A;  3TWR A;  4YVQ C;  2DBA A;  5G55 A;  4HOS A;  3DXK G;  3DSU A;  1EF1 C;  2WXG A;  4GAA A;  4TV3 A;  5B3S E;  3HXC A;  3S7D A;  5EYL A;  4I1O B;  4H7Y A;  2OEV A;  2L0T B;  4BSX A;  4BFR A;  2WXL A;  3T5V A;  3G2S A;  3I5P A;  4JZY A;  4HS2 A;  2JAB A;  3PZD A;  4BX9 A;  3FUE A;  2QFC A;  3B95 A;  3Q4A B;  2WM9 A;  3APF A;  3L54 A;  2X6H A;  4NAC A;  4YDO A;  4MRU A;  2FO7 A;  3FTX A;  3RU0 A;  2ILR A;  4L2L A;  3FEX A;  1PAQ A;  4GTS A;  4TUU A;  2H6G A;  3IHY A;  3DWL G;  2FI7 A;  2OEW A;  3R9A B;  2V5F A;  1MX4 A;  2MOW A;  3V31 A;  1MZC A;  4BY6 A;  3S7B A;  2WXI A;  4KZC A;  4F53 A;  5BXO A;  1ZB1 A;  3PH0 C;  4A3T A;  2P9I G;  4J8Y A;  3FUL A;  4F7A A;  4JEU A;  5EID A;  5JJT A;  4OVU A;  1E96 B;  3AS4 A;  1S64 A;  2XRY A;  2VYI A;  3FU0 A;  3SGH A;  3CVX A;  1BU9 A;  3E30 A;  1E90 A;  4AJW A;  4AVX A;  5LCW J;  3ASN E;  3LY9 A;  1YYH A;  1EPU A;  4GZ3 A;  2WPV A;  3CQG B;  2WXM A;  3RRU A;  3CVW A;  2IO2 C;  4O1P A;  3TG4 A;  4I43 A;  2X6I A;  5KNH D;  1SVX A;  3VLF A;  3Q15 A;  1QNF A;  2XPI A;  1TYQ G;  4NRH B;  4XX5 A;  5EIL A;  4G2V A;  2AXU A;  2C0M A;  2A5U A;  5FT9 A;  5LP0 A;  1HG5 A;  1DCQ A;  3HRA A;  5B1A E;  4UWL A;  2R59 A;  4GMR A;  3LKU A;  3AG3 E;  1HFA A;  3AS8 A;  4CYM D;  1ELR A;  4BTB A;  3FTZ A;  4Q69 A;  5BT1 A;  5CEA A;  3MJW A;  3UUX A;  2B0O E;  5D0O D;  1Z3X A;  1FT1 A;  4J6I A;  4BER A;  2H6F A;  2RG8 A;  4A3V A;  3SI5 A;  3ZHE A;  2YHC A;  4URK A;  4PS8 A;  1HE8 A;  5T4Y A;  2EIN E;  1MJ0 A;  3ONK A;  5ENQ D;  3VLE A;  4GA0 A;  3Q79 A;  5AQ9 A;  4IUL A;  3UT4 A;  4GZC A;  1XGW A;  4WNF A;  2AJA A;  4GTP A;  4J8S A;  3FUK A;  4N5Q A;  1MYO A;  3V2O A;  2R02 A;  4RG6 A;  4ACL A;  4IRU A;  2AXV A;  3IKO B;  1NL4 A;  1KZP A;  2V8S E;  5J90 A;  1Q2Z A;  3B7T A;  3KEA A;  4GYO A;  3GZS A;  2P9U G;  4OAV B;  3D3M A;  2J49 A;  2GRR B;  2CHZ A;  4U0U A;  2A5E A;  4ZFH A;  1H6K A;  1SZ9 A;  5D66 A;  3S7J A;  1U2V G;  4JHJ A;  5T3R A;  5ARG A;  3FUI A;  4HRL A;  2KCL A;  4GZD A;  4X8Q A;  1D9S A;  4FU3 A;  3KSL A;  4APO A;  2KXP C;  2DVW A;  2KM4 A;  4JEH A;  2PQN A;  4DJA A;  4EEC A;  1NA3 A;  4GCN A;  3HG0 D;  3ZGQ A;  2WXN A;  4C0M A;  3LPZ A;  2GRO B;  3CLJ A;  3U4T A;  4UI9 K;  4I17 A;  2VGX A;  2HE0 A;  4XI9 A;  3T8K A;  3G2W A;  4NQ0 A;  5M72 A;  1U3C A;  4GYY A;  1BI8 B;  5JJ6 A;  5KCM A;  3MYV A;  4O6F A;  2FF4 A;  2QYU A;  4LNB A;  4LER A;  4B94 A;  1TN8 A;  1QYM A;  2Q7F A;  1NFI E;  4OAU C;  3LEW A;  3UX4 A;  2PQR A;  3RK6 A;  5HI7 A;  4JB8 P;  3OXL A;  2X6K A;  1E7U A;  3ESK A;  5JJ7 A;  1BI7 B;  1QBQ A;  4GA1 A;  1HF8 A;  1RZ4 A;  5FJY A;  3LY8 A;  4ANV A;  2L0I A;  4GTR A;  3MX3 A;  3IBE A;  4HVB A;  2EIJ E;  2P2C P;  2ION A;  4AM9 A;  2ZGD A;  5EIB E;  3CHO A;  2HM8 A;  4KVM A;  3ZPJ A;  2IFU A;  2Y69 E;  2XCC A;  3ZEF A;  3AG2 E;  3QNK A;  3UKR G;  3B7R L;  3UM3 A;  2DZO A;  1SQM A;  4HRM B;  3MGB A;  1O1T A;  3MKQ A;  4CGW A;  5FQ7 A;  4CZ2 D;  3DRA A;  4UI9 J;  2H6H A;  3FTW A;  3PNL B;  4CDM A;  3GZ1 A;  1DVP A;  3QC1 A;  4EBA A;  2LSU A;  3DBS A;  4DPR A;  3HXF A;  5AJD A;  3APC A;  3NAW A;  4N3B A;  3FFL A;  5HQ8 A;  5A7D B;  4U8Y D;  3ML8 A;  4GTM A;  2FEZ A;  2GRP B;  5LOZ A;  3TXN A;  2VTB B;  3CVN A;  3ABL E;  3MKR A;  4RVB A;  5E76 A;  2IU1 A;  1N4P A;  3S7F A;  3UM0 A;  3VTY A;  4CT0 A;  3ASO E;  3QJZ A;  5FQ6 A;  2R05 A;  3HDX A;  2WQ7 A;  2DCP A;  4J8F A;  4FLH A;  3CVQ A;  1HU3 A;  5KJM A;  3FH7 A;  2XGS A;  4TXQ A;  4GPM A;  1N11 A;  1KT0 A;  1HX8 A;  4U8H A;  4G8K A;  5CEC B;  2CFU A;  3FH8 A;  2GRL A;  4N5C A;  4MBG A;  3Q47 B;  4ANX A;  1O1R A;  5FQ4 A;  1DNP A;  3T8M A;  3ZYQ A;  4JC8 A;  2XPY A;  2PM7 A;  5G2N A;  4N2Q A;  1TNU A;  4HOR A;  2QYJ A;  4O60 A;  4K5B A;  3CVL A;  2WXQ A;  3UXG A;  3RRM B;  1H6O A;  4CDR A;  4I1M A;  3CHP A;  4JVS A;  4ANU A;  2BED A;  2RFA A;  3RKV A;  3CR3 A;  3C3R A;  5ITZ F;  4CRW A;  1EYH A;  3AU5 A;  2P9K G;  3CKB A;  3ZN3 A;  4DX2 A;  1JCQ A;  3VTX A;  3G2T A;  3GYZ A;  2KAT A;  2A4Z A;  3U64 A;  4UQZ A;  4GMJ A;  1SA4 A;  4XE0 A;  2OOE A;  3EHM A;  1B89 A;  3FU3 A;  3MV2 B;  4K03 A;  2RFM A;  2I2O A;  4WUY A;  1A17 A;  3CEQ A;  3JQ1 A;  2XEN A;  3SF4 A;  5BPP A;  4E6H A;  1OWL A;  5CCL A;  3ENE A;  5EX3 A;  1H2T C;  4EPZ A;  2AXZ A;  2DYS E;  3PDN A;  4ATG A;  2UWJ G; 
#chains in the Genus database with same CATH homology
 2FO1 E;  3EU9 A;  1BI7 B;  4C48 B;  2DZN A;  4U96 D;  2DWZ A;  1YCS B;  1OT8 A;  4K5C A;  5AQ9 A;  4GPM A;  1N11 A;  5AQB A;  5AAR A;  4HBD A;  5HKP A;  4DX1 A;  1YYH A;  5HS0 A;  4HRN A;  2NYJ A;  3DEP A;  1G3N B;  2AJA A;  2ETB A;  3AAA C;  2JAB A;  4O1O A;  4G8K A;  5HRY A;  5CEC B;  4O1P A;  5AQA A;  5EN5 D;  5BXU A;  1AP7 A;  4N5Q A;  1MYO A;  3Q9U C;  3V2O A;  2P2C P;  2XEH A;  2Y1L E;  3B95 A;  3V2X A;  4A63 B;  1SW6 A;  3EHR A;  5CBN A;  2ZGD A;  5KNH D;  5EIB E;  5JA4 D;  3EHQ A;  1SVX A;  1K1A A;  1N0R A;  3D9H A;  1IXV A;  2ETA A;  4ZHB A;  3AJI A;  4LSZ E;  1AWC B;  5ENS D;  2L6B A;  5JMN D;  3ZNG A;  3F6Q A;  5EYL A;  2QYJ A;  3TWU A;  4O60 A;  4K5B A;  3V30 A;  3KEA A;  5ENT D;  5EIL A;  5KWD A;  3LJN A;  5ENO D;  4YDW A;  4Z68 A;  4OAV B;  3IXE A;  1WDY A;  1MX6 A;  3UXG A;  2DZO A;  4HI8 A;  5AN8 A;  2BKG A;  4BSZ B;  3SO8 A;  2A5E A;  3B7B A;  4HRM B;  4ZFH A;  5D66 A;  1S70 B;  2KBX A;  1K3Z D;  3ZKJ A;  2MYO A;  4DUI A;  2Y0B G;  1N0Q A;  3NBN B;  2J8S D;  2F8Y A;  3T9K A;  1DCQ A;  3HRA A;  4CZ2 D;  2RFA A;  4HRL A;  4BEP A;  2F37 A;  4LG6 A;  3TWV A;  1K1B A;  4UUC A;  1D9S A;  4ATZ D;  4GMR A;  4HNA D;  5KNG A;  3TWT A;  3C5R A;  3JUE A;  4J7W A;  3Q9N C;  4BET A;  5ITZ F;  5EYP F;  2KXP C;  4DX2 A;  1YMP A;  2DVW A;  4F6R D;  1IHB A;  4CYM D;  4TUM A;  1OY3 D;  3NOC D;  5ENP D;  5FIO A;  1MX4 A;  4K5A B;  2XZD G;  1BLX B;  4BES A;  1TR4 A;  4DX7 D;  2F8X K;  3HG0 D;  3W9G A;  4NIK A;  3V79 K;  3V31 A;  1A5E A;  5CEA A;  4RLY A;  4U8Y D;  3TWS A;  2QC9 A;  3NOG D;  4HI9 A;  4U95 D;  3W9F A;  4F1P A;  3TWQ A;  3J5Q B;  5BXO A;  4U8V D;  1MX2 A;  5CED B;  2B0O E;  4HLL A;  3JXI A;  4HQD A;  4LNU D;  3ZUV B;  4J8Y A;  1DC2 A;  2HE0 A;  3UTM A;  2BKK B;  3T8K A;  1UOH A;  5KBA A;  4BER A;  3DEO A;  4YDY A;  5EID A;  1BD8 A;  2V4H C;  3TWR A;  5CER B;  2RFM A;  1BI8 B;  3J5P A;  3UI2 A;  4QFV A;  5ENR D;  2ZGG A;  5AAO A;  4QQI A;  4DX5 D;  2XEN A;  2XZT G;  1WG0 A;  2ETC A;  2V5Q C;  3JXJ A;  2PNN A;  1QYM A;  2VGE A;  3ZU7 B;  1BU9 A;  4HB5 A;  3TWW A;  3TWX A;  1NFI E;  4DRX E;  5CBO A;  4DX6 D;  4OAU C;  4G8L A;  1MJ0 A;  4B93 B;  5ENQ D;  5AQ7 A;  4JB8 P;  5FIN A;  2XEE A;  1IKN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...