1MJ0A

Sank e3_5: an artificial ankyrin repeat protein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLAASNGHLEIVEVLLKNGADVNASDLTGITPLHLAAATGHLEIVEVLLKHGADVNAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed to be stable: Crystal structure of a consensus ankyrin repeat protein
pubmed doi rcsb
molecule keywords SANK E3_5 Protein
molecule tags De novo protein
source organism Designed synthetic gene
total genus 55
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2002-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1mj0A00
3F6QA 4LNUD 4J7WA 4UUCA 1OY3D 2V5QC 3B95A 3Q9UC 1NFIE 3V79K 4TUMA 3EU9A 5ENPD 4G8LA 4YDWA 5EYLA 2KXPC 4B93B 4U96D 1K3ZD 1MX4A 5ITZF 4OAUC 1WDYA 4DX2A 5AQAA 2MYOA 1IXVA 1BU9A 4NIKA 3T9KA 5EIDA 2RFMA 2RFAA 1DCQA 5AQ7A 4BEPA 4J8YA 4A63B 3UTMA 2JABA 5BXUA 4F1PA 4ZFHA 1MX6A 2QC9A 2BKKB 3AAAC 1MYOA 1SVXA 1N11A 2BKGA 4LSZE 3TWWA 4U95D 3V2OA 4BSZB 3J5QB 3TWTA 2ZGDA 5AN8A 2XZDG 1N0QA 5JA4D 3TWVA 4CZ2D 5HS0A 3W9FA 3TWQA 5FINA 2XENA 3B7BA 4HRNA 1SW6A 2B0OE 5EN5D 5ENSD 5AAOA 3TWUA 4BESA 4YDYA 5AQ9A 2DZNA 4QQIA 3TWXA 4F6RD 2F8XK 2ETCA 2V4HC 3SO8A 2XEEA 5CEDB 2J8SD 2ZGGA 5CERB 4U8VD 3TWRA 4DX6D 1K1BA 5CEAA 3DEOA 3Q9NC 3JUEA 4G8KA 1N0RA 4DX7D 1BI8B 2VGEA 3HG0D 3JXJA 4HI8A 4HI9A 3NOGD 4HLLA 1TR4A 3TWSA 5AARA 2F37A 4CYMD 2DVWA 2F8YA 1YCSB 5EIBE 2QYJA 5D66A 5BXOA 3JXIA 3UI2A 3ZKJA 3EHQA 4BERA 1G3NB 4DX5D 2ETAA 2XZTG 3W9GA 1IKND 5FIOA 4ATZD 4JB8P 4GMRA 4QFVA 3ZNGA 2L6BA 5CECB 1QYMA 4K5AB 5EYPF 1AP7A 2Y1LE 3ZUVB 4HNAD 2PNNA 3KEAA 1BI7B 4HQDA 4HB5A 3J5PA 4HRMB 3IXEA 5HRYA 4Z68A 5CBOA 1D9SA 5HKPA 2Y0BG 4DRXE 5ENOD 4O1OA 2ETBA 4BETA 2NYJA 4OAVB 4RLYA 5KNHD 4K5CA 5EILA 4K5BA 4ZHBA 2XEHA 5CBNA 4HBDA 1DC2A 2DZOA 3T8KA 3ZU7B 5ENRD 3V31A 4HRLA 2AJAA 2HE0A 3EHRA 2DWZA 2KBXA 2A5EA 3C5RA 4DUIA 3UXGA 1BLXB 1YYHA 4GPMA 1WG0A 5KNGA 1BD8A 1OT8A 4DX1A 3HRAA 1AWCB 1YMPA 2P2CP 5AQBA 3D9HA 5KBAA 2FO1E 1A5EA 1MJ0A 1MX2A 3AJIA 1K1AA 3LJNA 4U8YD 5ENTD 4O60A 3V30A 5KWDA 3DEPA 3NOCD 4O1PA 5JMND 3V2XA 1S70B 4LG6A 4N5QA 3NBNB 1UOHA 4C48B 5ENQD 1IHBA
chains in the Genus database with same CATH superfamily
3RO2A 1IQRA 2HM8A 2LSUA 1E96B 3MZLB 4FULA 5JJ7A 4JZYA 3O4ZA 3OAWA 3D9LA 4JL0A 3Q75A 2L6JA 4GZDA 2JABA 1FT1A 3CIAA 4ACKA 4CGVA 1S0PA 3FU3A 2DYRE 5CRVA 3LPZA 4EQFA 3L16A 2XENA 4HRNA 1SW6A 5T4YA 2OCCE 5CCLA 3PE4A 1XGWA 1TNUA 1U3DA 3QWVA 2R5SA 1KPSB 4GTMA 4G8KA 3VLDA 3DPDA 3APCA 3JXJA 4XIFA 3ENEA 3L6AA 3CK8A 1FVHA 3ZKJA 4BT9A 4KYOB 1N4PA 4F53A 4GMRA 1JUQA 5BNWA 1OXJA 1TN8A 2P58C 3PE3A 4UWFA 3MYVA 2E2EA 3APDA 4K5BA 4AVXA 1YA0A 3EHRA 1MQSA 2J9QA 1YMPA 5AQBA 2CG3A 4G1TA 4O60A 3RIBA 3OXFA 2XCCA 3B7SA 1UG3A 4YVOA 4PH4B 1HFAA 4AM9A 3JUIA 2R2LA 1H6KA 2KXPC 4GTVA 3CR3A 3CHOA 2LXMA 4DX2A 3QDNA 5BUZA 4GTPA 2EIKE 3AU4A 5B3SE 4RVBA 1MX6A 3MX3A 2BKGA 2X6IA 3QJZA 1UJJA 3ZYKA 4EZLA 1W3BA 3TWVA 3UT4A 3CSTA 4NACA 1JCSA 3CVVA 1XNFA 5EN5D 2GRMA 4FA6A 1IYGA 4XKBA 5CERB 3TWRA 3Q9NC 3NZSA 5KJKA 3HG0D 4HI8A 3ZYLA 3I4RB 4Q69A 2QYUA 3T8MA 4FJYA 3HXDA 2KC7A 4I6GA 2GRRB 4FLBA 1D8EA 4GYWA 3LJ3A 4B0ZA 3CSFA 3FH5A 3J5PA 4XI9A 1UN8A 4G26A 2PZIA 2I9CA 5BV1A 2KATA 1HX8A 5EILA 1UN9A 4IN3B 1OT8A 1HU3A 2WQ6A 2X38A 5A7DB 3C3QA 4I9EA 2FF4A 2IQCA 4GZ5A 3L08A 4N5QA 4C48B 5ENQD 5A6CA 2FBNA 3TL5A 3R9MA 4RG9A 2VSXE 4NQ0A 4JHKA 2VSOE 3LKUA 4HOSA 1HG2A 4Q96A 3Q78A 2QC9A 5KJLA 2GW1A 3LEWA 5JA4D 4CZ2D 2UY1B 4A1GA 2GRQB 3PEUB 3TWUA 1JWGA 4JD2G 3FEYA 2LAIA 1HS6A 3ZIMA 3B7UX 5CEAA 3ZPJA 3LDZA 3RRMB 2J4DA 4HI9A 4FU3A 3S7BA 5FJYA 3UQ3A 3FTSA 3D9KA 1U3CA 3LY9A 4JEHA 3JXIA 2R05A 2E0IA 3CVUA 5FIOA 3Q4AB 3ISMC 3ABLE 4DLQA 1E90A 4HNAD 5FT9A 1Z6TA 3BG1B 3TG5A 2A5UA 2VQ2A 2BEDA 4IYPA 4G23A 2DWZA 4O6FA 4DUIA 4J8FA 1BLXB 4UWGA 5LCWJ 3G2SA 1ZB1A 1N9AA 3DEPA 3NB2A 5DIZA 3U3WA 3T5VA 2ONDA 1IHBA 2PM6A 3GZ2A 2WPVA 3VLFA 4J7WA 3CHRA 3MGBA 3FU6A 2VGXB 1NI1A 3D9MA 1MX4A 3URZA 2DYSE 1B89A 3HXBA 4P29A 4A1SA 3E4BA 4FHJA 5T8IA 3D9IA 4UWHA 2OEWA 1O5MA 3PZ1A 4PDXA 4N3AA 2IY0C 2NC9A 4U95D 4N39A 3FWVA 4JXTA 4ILHB 4GTTA 3FEXA 2J07A 3Q7FA 1N54A 5AQ9A 2GGFA 2ZISA 3C72A 4RSYA 5G05J 2ETCA 3SGHA 1ELWA 2I2OA 2WXHA 1E8XA 3FTXA 5DBKA 3KEZA 2WMNA 4B8AA 2XRZA 3WG7E 3SNXA 4E85A 2QFCA 2WXIA 3NAWA 3EHQA 4FHKA 3FUJA 2GRNB 3IXEA 4CCAA 3DSWA 3S2AA 3C3RA 3IV0A 3LS8A 2OEVA 4BETA 2HYZA 4OAVB 3FUHA 4I6EA 5CBNA 3ZRHA 2YHCA 4DLOA 3UINC 4GPMA 4JVSA 3ULYA 3UIOC 3AG4E 5ENTD 2VTBA 5JMND 1EYHA 2R59A 2RG8A 2V0PA 3SF4A 1NP7A 3MKQA 2I6HA 5LOZA 3PZ4A 3Q9UC 2OVFA 1TNOA 5CMWA 4I17A 3D9NA 4CT0A 5AQAA 3FUNA 4MKTA 1H6OA 1RW2A 4CDNA 2XPZA 4ME2A 3JCKC 3AU5A 2RD0A 5BW8C 2NSZA 3PUJA 2IU1A 3MV2B 4WNDA 1JPLA 3UT8A 4LEUA 4Y6WA 4KBQA 5HS0A 4N3CA 3B7BA 1N4RA 2MOWA 5LP0A 2IEJA 2VSYA 1O1SA 2F8XK 2V4HC 3CLJA 3DEOA 4WWNA 5D0QD 4RQIA 1RZ4A 2F37A 2DVWA 2X6JA 3FUMA 5BXOA 1TJCA 4LCTA 3GZSA 3W9GA 4Y6CA 2DIWA 4HRMB 2AXZA 4LNBA 3PS6A 2XGOA 5D2MC 5IY5E 4U7EB 3CHPA 2A5EA 1H19A 4GA1A 1QZ2A 2GROB 1Q2ZA 2FEZA 3HDXA 4TXPA 1X5BA 3NOCD 3PEVB 2F0YA 4J8EA 4CDRA 2L0IA 4XEIG 3O48A 2DBAA 4PS7A 4UUCA 2VJ8A 1HXIA 5FZQA 2PM7A 5FQ6A 1N94A 5CMYA 4HVBA 1H6PA 4R7LA 3TWWA 1FT2A 3S7FA 4CEMA 2MHKA 4GYOA 1TYQG 4DI3A 3FUIA 2MRIA 3FUEA 3UUXA 4F6RD 3ZVVA 3FU0A 4IULA 2KCLA 4BX8A 4JW1A 4N2SA 2RKKA 4YDOA 3CVNA 1N0RA 1BI8B 1NZNA 2AW6A 3OXLA 2H6FA 1G3NB 2WXOA 5E76A 2XZTG 5CRUA 3CGHA 4C0MA 5HRYA 3UT7A 3CK7A 3QWPA 4C0EA 3EIQC 3PUKA 4KVMA 1DC2A 4L9PA 3HVEA 2L9BA 4EZKA 4FLHA 3L13A 3KAEA 3EIJA 5HQ8A 1S64A 3GYZA 1TNZA 3AG2E 4U0ZA 2X6KA 2V5QC 2BUGA 4TUMA 2WXLA 3PVLA 1V54E 3DSUA 2IO2C 4U63A 2P9KG 4NIKA 5JHBA 4MBGA 3T9KA 2EQXA 4ILIA 2KCKA 2GRPB 4GCNA 4KZ0A 3IKOB 4HOQA 1E8WA 3CQCB 5J90A 4U8HA 1O1RA 5G55A 5J08A 4BESA 3FULA 3TJPA 3I4GA 1X81A 5ENNA 2HO1A 2OV8A 2FULA 4X8QA 1TR4A 1JWFA 2J08A 2F8YA 3ZEFA 1QBQA 2Y4UA 3DWLG 3ZW3A 3ZNGA 5CECB 4EZJA 3LY7A 3HHMA 3ABME 5LCWC 3NQPA 4N5CA 1PY1A 4GZ3A 2Y0BG 2JEKA 4MS6A 4OVUA 4RLYA 3FUFA 5C1DA 5ENRD 5CHEE 2AJAA 4HOTA 2X3MA 4DX1A 1YYHA 4AXHA 2P9NG 3ASOE 3AJIA 1KT1A 1TNBA 2WXKA 2AXUA 3MV3B 4WWOA 4G8LA 2XS1A 4XE0A 4GZCA 1WDYA 3D9JA 3ULQA 3BG0B 3FHEA 3MCXA 5FTPA 3LVRE 1SVXA 5G05C 4ANUA 4CRWA 5ANLA 4I1AA 3TWTA 3AG1E 4RG6A 2CG2A 3W9FA 3PH0C 5ENSD 3DXKG 1HZ4A 4GMJA 3P1UA 4BWRA 2J4BA 3R7QA 4HFGA 1K1BA 1HG5A 3D9PA 5ARGA 4UQYA 3CVWA 4DPRA 5D0OD 3FH8A 4G25A 3UI2A 2WQHA 3CHSA 3Q79A 4NRHB 4N2QA 1IKND 3ULEG 1WY6A 3G2UA 1S63A 2J49A 3EUVA 2EILE 4FC8A 1SA5A 5E75A 4G11A 3UM3A 4K5CA 4LUNU 4GU5A 5CCMA 2EIME 1OCZE 1SZ9A 3HYMB 3BUAA 1OCOE 5AYWD 4O1PA 4YDEA 1OY3D 3B95A 2H6IA 3EU9A 3CVXA 4GZ6A 1IHGA 3RO3A 2AXVA 2MYOA 2WQ7A 4FADA 2CFZA 4GTQA 4E6HA 2XEVA 2VYIA 3FTVA 4HOUA 1E7UA 3UKRG 2YNQA 4YNDA 2CHXA 1U2VG 3MKQB 3D9OA 4YDYA 4ACLA 4QQIA 1BPOA 4L7TA 5EX3A 5LFAA 4ANWA 3SQVA 2XGSA 1JCQA 4KZCA 4FJZA 1DNPA 4JEUA 3RAUA 1OCRE 4CYMD 3CHQA 4PUCA 4GTSA 5D66A 3RK6A 2YQ8A 5KCMA 3UMVA 3UIPC 4BSXA 3EU5A 4J8DA 2CHZA 4DX5D 2R03A 1LTXA 4JB8P 3PNLB 2L6BA 1QYMA 1HH8A 2PNNA 1LD7A 2R17C 2V4LA 4J8SA 3L82A 4DI4A 1E8YA 2ETBA 3B7TA 1IQUA 3L54A 2ZXWE 3MA5A 3QC1A 3C5RA 3EJNA 1A5EA 1MX2A 3MKRA 3B7RL 3V2XA 4UWKA 1S70B 3N71A 3APFA 4UI9J 2R02A 1O1TA 3V79K 5ENPD 4YDWA 3K9IA 2EINE 3G2VA 1V55E 2HR2A 5AQ7A 3E34A 4UQZA 3ONKA 3UX4A 2DCPA 3L17A 3V2OA 4GA2A 3D3MA 5AN8A 3I3NA 4G2VA 3ML9A 2AVPA 1HF8A 1LD8A 2WXGA 4DX6D 2VGXA 4TXQA 3SI5A 4ILGA 4NURA 3Q5MA 3RKVA 2VGEA 4UI9K 4HLLA 5AARA 4BTBA 1EPUA 2J09A 3FUKA 3ZHEB 1GW6A 4I9CA 3X2QE 1EF1C 1KLXA 4EBAG 1FPPA 1NA3A 3KEAA 4HQDA 3ZN3A 4GYYA 2NYJA 3DRAA 4HBDA 2DZOA 5BT1A 1PC2A 2IFUA 4I43A 3RJVA 3SD5A 2WM9A 4WNFA 3PRZA 3LJNA 2ILRA 4LNGA 3NBNB 3KS2A 3F6QA 4WUYA 5A23A 3HIZA 2IOLA 2KZTA 3NZUA 2M63A 1NFIE 3Q49B 4I2WA 4U96D 1K3ZD 3LY8A 4GTOA 4WAFA 1BU9A 4G24A 2P9IG 4U0UA 3VTYA 2LO6A 1FCHA 3P2BA 3UTMA 1H2TC 4XKCA 1ZBPA 3AAAC 4A55A 2WXFA 3SY2A 4AY5A 3ASGA 3U64A 4GMLA 4A3VA 2AWIA 2BTDA 4B89A 2XZDG 3FY4A 1N52A 3IEGA 1TJFA 4ATGA 3OXGA 3DSVA 4JHRA 2DZNA 3TWXA 4AV7A 3GZ1A 3BEEA 3QKYA 4K03A 3TG4A 4I6JA 1TNYA 1E7VA 1YCSB 3L9TA 3HXEA 5EIBE 2QYJA 1UW4B 4L2LA 3HXFA 1MHQA 4ATZD 2B6CA 1TN7A 4HLEA 4HB5A 3Q73A 4MLPA 4XI0A 1D9SA 5HKPA 3DSSA 2LSVA 4M3OA 4GB9A 3T5XA 1AP7A 3FDHA 4JA7A 1A17A 3DXMG 2X6FA 2H6HA 3QARA 2FO7A 1NA0A 4AY6A 2OVBA 4U0SA 3ASFA 2WMOA 5ITZF 1K8KG 2XS8A 3JYSA 5G04J 1MZCA 4BEPA 3SHFA 3GW4A 3DPYA 2L0TB 2LUHA 4JHJA 3J5QB 3FTWA 3AS8A 3CKBA 2GRLA 5FQ8A 4BX9A 3SZ7A 4WNEA 4U8VD 2XPIA 2OOEA 4Q94A 1FVFA 5BV0A 3FU5A 5AAOA 1QQEA 2LAHA 3UPVA 4BERA 3MEKA 3ESKA 4FP7A 3BU8A 3EHMA 5FZSA 3VTXA 4M7CA 2Y1LE 3CVQA 4CDMA 1OWOA 1ELRA 3FTZA 5AJLA 5CBOA 4V3IA 5ENOD 5KNHD 4HORA 2X6HA 3IBEA 3UXGA 1WG0A 3QWWA 1BD8A 4N3BA 4UWLA 1Z3YA 2XCBA 5KBAA 4KVOA 3TXNA 4J6IA 1ELKA 2YINA 4F7AA 2Y69E 4BFRA 1N4QA 4EHMA 3Q15A 5FQ7A 2IF4A 2VGYA 4I1MA 3U4TA 3QNKA 4DK5A 4BT8A 4TV3A 3LXUX 2IO3C 4W9RA 2CHWA 3UKUG 3JQ0A 1DCQA 5BXUA 3JQ1A 4J8YA 3VLEA 3L22A 4YVQC 2BKKB 1N11A 4BSZB 1N0QA 1OWMA 1WAO1 3PDNA 4H7XA 1DVPA 3EHNA 5FWQA 3RU0A 3AS4A 5FQ4A 3IHVA 2XEEA 3DSTA 3LVQE 3UM0A 4KXKB 1SQMA 2P9LG 3FUDA 4DX7D 2FI7A 1WM5A 4J0UA 5ARFA 3TGOA 2QY7A 4XZ4A 3ZYMA 3S7DA 2P9PG 4AP2A 1L5JA 4QFVA 4AJWA 4L1BA 3ML8A 3E30A 2YHEA 5JJ6A 2A4ZA 3E33A 3Q47B 2LNIA 2C0MA 1OCCE 1INZA 4HS2A 4AIFA 3ZU7B 4KT6B 4HRLA 4UI9C 2KBXA 4ZFHA 3NF1A 4BTAA 3HRAA 1AWCB 3D9HA 3HXCA 5KJMA 1MJ0A 3SBTB 1KZOA 3QK0A 3TXMA 2WXQA 3V30A 3ASDA 3E32A 4JPSA 2XQ0A 1QNFA 3ASNE 3ASHA 3U9WA 3RRNB 5C2YA 4TRQA 2H6GA 3WXXA 3SFYA 3PREA 1ZU2A 3PZDA 5EYLA 4B93B 1TEZA 1H2UA 1HO8A 1SA4A 3Q7AA 4A63B 3ESLA 3G2WA 3LYAA 2Q7FA 3R7RA 2V5FA 5JJTA 4MRUA 2V8SE 5FINA 3PZ2A 3B13A 2Y4TA 5CEDB 5BPPA 3SFZA 3JUEA 4LRZA 2JLBA 1OUVA 4A3TA 3SFXA 2PQRA 2XGMA 2VTBB 2WXPA 2XPYA 2QZAA 4L2YA 4I2ZA 1EDUA 4WNGA 2PL2A 3ZFWA 3CVLA 4K5AB 5FZRA 5KJNA 3ZXSA 3C3OA 5EDSA 4Z68A 3CVYA 5EKQD 2I1JA 5EX0A 4DRXE 4O1OA 4EPZA 4GPKA 3U66A 4ZHBA 3DSXA 4ANVA 1Y6IA 2WXNA 5H7PA 1Z3XA 1K1AA 4B8CB 2UY1A 4PS8A 3QAQA 5AJDA 1UOHA 2PQNA 1HE8A 4AEZC 2NXPA 2BF0X 2CFUA 4OYSA 5ANRA 2WXMA 4URKA 4LERA 2KM4A 5JHAA 2VSNA 4C9BB 2RFAA 3ONLA 4F1PA 3LCAA 3CVPA 4UQXA 4ABNA 4B94A 4WWPA 2ZGDA 4U04A 4OVVA 4TXRA 3SBSA 1KT0A 1N95A 2B0OE 5AENA 2KZTB 3FH7A 2IJGX 4PS3A 3FTYA 2ZU6B 1Z5SC 4F1SA 3SO8A 2ZGGA 4APOA 3DBSA 3KD7A 3AS5A 4H7YA 3QOUA 3NOGD 3TWSA 2WXJA 3TAXA 4K0RA 3FFLA 2ETAA 2Y3AA 4JA9A 5EYPF 4GAAA 4CGWA 2WB2A 1BI7B 5AIJA 3PNTB 3G2TA 1Y8MA 4ANXA 4GTRA 2C0LA 1E8ZA 2XEHA 2HE0A 5HI7A 5KNGA 2ZIRA 1NL4A 5LX8A 2P2CP 4APFA 3IHYA 4EECA 5KWDA 3UM2A 3ZGQA 4LG6A 5G04C 1TN6A 3I5PA 4CT4A 4LNUD 3E37A 3OTNA 4XX5A 4DJAA 4OAUC 4D10C 1H2VC 1IXVA 2WXRA 1SZAA 3QB2A 3CEQA 5EIDA 2RFMA 3RSEG 3ZXPA 3S7JA 3C98A 4JC8A 1MYOA 4LSZE 2UWJG 2XRYA 3FP3A 2P9SG 2LXLA 3PZ3A 3CHMA 3RRUA 3KSLA 3TWQA 1P5QA 4HXIA 3EDTB 4TUUA 3FTUA 3ABKE 4EBAA 2J8SD 3HVEB 4U07A 4BY6A 2C2LA 4GCOA 5B1AE 3CV0A 3AG3E 3R9AB 4KMOA 2KCVA 1OWLA 2EIJE 1DCEA 1KZPA 3KSQA 4AOFA 1H0AA 2IOSA 2IONA 5B1BE 1LF8A 1PAQA 3UM1A 1N4SA 3ZUVB 1OWNA 3ZYQA 4I1OB 1OWPA 4IRUA 4F3VA 1JCRA 2P9UG 4L23A 3CKCA 1VDYA 4GA0A 2WVIA 3T8KA 3V31A 2I1KA 5M72A 5T3RA 1D8DA 4U8YD 3ZHEA 3CK9A 3CQGB 5G2NA 3BQOA 2FO1E 3MJWA 1UJKA 2XHEA
chains in the Genus database with same CATH topology
3F6QA 4LNUD 4J7WA 4UUCA 1OY3D 2V5QC 3B95A 3Q9UC 1NFIE 3V79K 4TUMA 3EU9A 5ENPD 4G8LA 4YDWA 5EYLA 2KXPC 4B93B 4U96D 1K3ZD 1MX4A 5ITZF 4OAUC 1WDYA 4DX2A 5AQAA 2MYOA 1IXVA 1BU9A 4NIKA 3T9KA 5EIDA 2RFMA 2RFAA 1DCQA 5AQ7A 4BEPA 4J8YA 4A63B 3UTMA 2JABA 5BXUA 4F1PA 4ZFHA 1MX6A 2QC9A 2BKKB 3AAAC 1MYOA 1SVXA 1N11A 2BKGA 4LSZE 3TWWA 4U95D 3V2OA 4BSZB 3J5QB 3TWTA 2ZGDA 5AN8A 2XZDG 1N0QA 5JA4D 3TWVA 4CZ2D 5HS0A 3W9FA 3TWQA 5FINA 2XENA 3B7BA 4HRNA 1SW6A 2B0OE 5EN5D 5ENSD 5AAOA 3TWUA 4BESA 4YDYA 5AQ9A 2DZNA 4QQIA 3TWXA 4F6RD 2F8XK 2ETCA 2V4HC 3SO8A 2XEEA 5CEDB 2J8SD 2ZGGA 5CERB 4U8VD 3TWRA 4DX6D 1K1BA 5CEAA 3DEOA 3Q9NC 3JUEA 4G8KA 1N0RA 4DX7D 1BI8B 2VGEA 3HG0D 3JXJA 4HI8A 4HI9A 3NOGD 4HLLA 1TR4A 3TWSA 5AARA 2F37A 4CYMD 2DVWA 2F8YA 1YCSB 5EIBE 2QYJA 5D66A 5BXOA 3JXIA 3UI2A 3ZKJA 3EHQA 4BERA 1G3NB 4DX5D 2ETAA 2XZTG 3W9GA 1IKND 5FIOA 4ATZD 4JB8P 4GMRA 4QFVA 3ZNGA 2L6BA 5CECB 1QYMA 4K5AB 5EYPF 1AP7A 2Y1LE 3ZUVB 4HNAD 2PNNA 3KEAA 1BI7B 4HQDA 4HB5A 3J5PA 4HRMB 3IXEA 5HRYA 4Z68A 5CBOA 1D9SA 5HKPA 2Y0BG 4DRXE 5ENOD 4O1OA 2ETBA 4BETA 2NYJA 4OAVB 4RLYA 5KNHD 4K5CA 5EILA 4K5BA 4ZHBA 2XEHA 5CBNA 4HBDA 1DC2A 2DZOA 3T8KA 3ZU7B 5ENRD 3V31A 4HRLA 2AJAA 2HE0A 3EHRA 2DWZA 2KBXA 2A5EA 3C5RA 4DUIA 3UXGA 1BLXB 1YYHA 4GPMA 1WG0A 5KNGA 1BD8A 1OT8A 4DX1A 3HRAA 1AWCB 1YMPA 2P2CP 5AQBA 3D9HA 5KBAA 2FO1E 1A5EA 1MJ0A 1MX2A 3AJIA 1K1AA 3LJNA 4U8YD 5ENTD 4O60A 3V30A 5KWDA 3DEPA 3NOCD 4O1PA 5JMND 3V2XA 1S70B 4LG6A 4N5QA 3NBNB 1UOHA 4C48B 5ENQD 1IHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F6Q A;  4LNU D;  4J7W A;  4UUC A;  1OY3 D;  2V5Q C;  3B95 A;  3Q9U C;  1NFI E;  3V79 K;  4TUM A;  3EU9 A;  5ENP D;  4G8L A;  4YDW A;  5EYL A;  2KXP C;  4B93 B;  4U96 D;  1K3Z D;  1MX4 A;  5ITZ F;  4OAU C;  1WDY A;  4DX2 A;  5AQA A;  2MYO A;  1IXV A;  1BU9 A;  4NIK A;  3T9K A;  5EID A;  2RFM A;  2RFA A;  1DCQ A;  5AQ7 A;  4BEP A;  4J8Y A;  4A63 B;  3UTM A;  2JAB A;  5BXU A;  4F1P A;  4ZFH A;  1MX6 A;  2QC9 A;  2BKK B;  3AAA C;  1MYO A;  1SVX A;  1N11 A;  2BKG A;  4LSZ E;  3TWW A;  4U95 D;  3V2O A;  4BSZ B;  3J5Q B;  3TWT A;  2ZGD A;  5AN8 A;  2XZD G;  1N0Q A;  5JA4 D;  3TWV A;  4CZ2 D;  5HS0 A;  3W9F A;  3TWQ A;  5FIN A;  2XEN A;  3B7B A;  4HRN A;  1SW6 A;  2B0O E;  5EN5 D;  5ENS D;  5AAO A;  3TWU A;  4BES A;  4YDY A;  5AQ9 A;  2DZN A;  4QQI A;  3TWX A;  4F6R D;  2F8X K;  2ETC A;  2V4H C;  3SO8 A;  2XEE A;  5CED B;  2J8S D;  2ZGG A;  5CER B;  4U8V D;  3TWR A;  4DX6 D;  1K1B A;  5CEA A;  3DEO A;  3Q9N C;  3JUE A;  4G8K A;  1N0R A;  4DX7 D;  1BI8 B;  2VGE A;  3HG0 D;  3JXJ A;  4HI8 A;  4HI9 A;  3NOG D;  4HLL A;  1TR4 A;  3TWS A;  5AAR A;  2F37 A;  4CYM D;  2DVW A;  2F8Y A;  1YCS B;  5EIB E;  2QYJ A;  5D66 A;  5BXO A;  3JXI A;  3UI2 A;  3ZKJ A;  3EHQ A;  4BER A;  1G3N B;  4DX5 D;  2ETA A;  2XZT G;  3W9G A;  1IKN D;  5FIO A;  4ATZ D;  4JB8 P;  4GMR A;  4QFV A;  3ZNG A;  2L6B A;  5CEC B;  1QYM A;  4K5A B;  5EYP F;  1AP7 A;  2Y1L E;  3ZUV B;  4HNA D;  2PNN A;  3KEA A;  1BI7 B;  4HQD A;  4HB5 A;  3J5P A;  4HRM B;  3IXE A;  5HRY A;  4Z68 A;  5CBO A;  1D9S A;  5HKP A;  2Y0B G;  4DRX E;  5ENO D;  4O1O A;  2ETB A;  4BET A;  2NYJ A;  4OAV B;  4RLY A;  5KNH D;  4K5C A;  5EIL A;  4K5B A;  4ZHB A;  2XEH A;  5CBN A;  4HBD A;  1DC2 A;  2DZO A;  3T8K A;  3ZU7 B;  5ENR D;  3V31 A;  4HRL A;  2AJA A;  2HE0 A;  3EHR A;  2DWZ A;  2KBX A;  2A5E A;  3C5R A;  4DUI A;  3UXG A;  1BLX B;  1YYH A;  4GPM A;  1WG0 A;  5KNG A;  1BD8 A;  1OT8 A;  4DX1 A;  3HRA A;  1AWC B;  1YMP A;  2P2C P;  5AQB A;  3D9H A;  5KBA A;  2FO1 E;  1A5E A;  1MJ0 A;  1MX2 A;  3AJI A;  1K1A A;  3LJN A;  4U8Y D;  5ENT D;  4O60 A;  3V30 A;  5KWD A;  3DEP A;  3NOC D;  4O1P A;  5JMN D;  3V2X A;  1S70 B;  4LG6 A;  4N5Q A;  3NBN B;  1UOH A;  4C48 B;  5ENQ D;  1IHB A; 
#chains in the Genus database with same CATH topology
 3RO2 A;  1IQR A;  2HM8 A;  2LSU A;  1E96 B;  3MZL B;  4FUL A;  5JJ7 A;  4JZY A;  3O4Z A;  3OAW A;  3D9L A;  4JL0 A;  3Q75 A;  2L6J A;  4GZD A;  2JAB A;  1FT1 A;  3CIA A;  4ACK A;  4CGV A;  1S0P A;  3FU3 A;  2DYR E;  5CRV A;  3LPZ A;  4EQF A;  3L16 A;  2XEN A;  4HRN A;  1SW6 A;  5T4Y A;  2OCC E;  5CCL A;  3PE4 A;  1XGW A;  1TNU A;  1U3D A;  3QWV A;  2R5S A;  1KPS B;  4GTM A;  4G8K A;  3VLD A;  3DPD A;  3APC A;  3JXJ A;  4XIF A;  3ENE A;  3L6A A;  3CK8 A;  1FVH A;  3ZKJ A;  4BT9 A;  4KYO B;  1N4P A;  4F53 A;  4GMR A;  1JUQ A;  5BNW A;  1OXJ A;  1TN8 A;  2P58 C;  3PE3 A;  4UWF A;  3MYV A;  2E2E A;  3APD A;  4K5B A;  4AVX A;  1YA0 A;  3EHR A;  1MQS A;  2J9Q A;  1YMP A;  5AQB A;  2CG3 A;  4G1T A;  4O60 A;  3RIB A;  3OXF A;  2XCC A;  3B7S A;  1UG3 A;  4YVO A;  4PH4 B;  1HFA A;  4AM9 A;  3JUI A;  2R2L A;  1H6K A;  2KXP C;  4GTV A;  3CR3 A;  3CHO A;  2LXM A;  4DX2 A;  3QDN A;  5BUZ A;  4GTP A;  2EIK E;  3AU4 A;  5B3S E;  4RVB A;  1MX6 A;  3MX3 A;  2BKG A;  2X6I A;  3QJZ A;  1UJJ A;  3ZYK A;  4EZL A;  1W3B A;  3TWV A;  3UT4 A;  3CST A;  4NAC A;  1JCS A;  3CVV A;  1XNF A;  5EN5 D;  2GRM A;  4FA6 A;  1IYG A;  4XKB A;  5CER B;  3TWR A;  3Q9N C;  3NZS A;  5KJK A;  3HG0 D;  4HI8 A;  3ZYL A;  3I4R B;  4Q69 A;  2QYU A;  3T8M A;  4FJY A;  3HXD A;  2KC7 A;  4I6G A;  2GRR B;  4FLB A;  1D8E A;  4GYW A;  3LJ3 A;  4B0Z A;  3CSF A;  3FH5 A;  3J5P A;  4XI9 A;  1UN8 A;  4G26 A;  2PZI A;  2I9C A;  5BV1 A;  2KAT A;  1HX8 A;  5EIL A;  1UN9 A;  4IN3 B;  1OT8 A;  1HU3 A;  2WQ6 A;  2X38 A;  5A7D B;  3C3Q A;  4I9E A;  2FF4 A;  2IQC A;  4GZ5 A;  3L08 A;  4N5Q A;  4C48 B;  5ENQ D;  5A6C A;  2FBN A;  3TL5 A;  3R9M A;  4RG9 A;  2VSX E;  4NQ0 A;  4JHK A;  2VSO E;  3LKU A;  4HOS A;  1HG2 A;  4Q96 A;  3Q78 A;  2QC9 A;  5KJL A;  2GW1 A;  3LEW A;  5JA4 D;  4CZ2 D;  2UY1 B;  4A1G A;  2GRQ B;  3PEU B;  3TWU A;  1JWG A;  4JD2 G;  3FEY A;  2LAI A;  1HS6 A;  3ZIM A;  3B7U X;  5CEA A;  3ZPJ A;  3LDZ A;  3RRM B;  2J4D A;  4HI9 A;  4FU3 A;  3S7B A;  5FJY A;  3UQ3 A;  3FTS A;  3D9K A;  1U3C A;  3LY9 A;  4JEH A;  3JXI A;  2R05 A;  2E0I A;  3CVU A;  5FIO A;  3Q4A B;  3ISM C;  3ABL E;  4DLQ A;  1E90 A;  4HNA D;  5FT9 A;  1Z6T A;  3BG1 B;  3TG5 A;  2A5U A;  2VQ2 A;  2BED A;  4IYP A;  4G23 A;  2DWZ A;  4O6F A;  4DUI A;  4J8F A;  1BLX B;  4UWG A;  5LCW J;  3G2S A;  1ZB1 A;  1N9A A;  3DEP A;  3NB2 A;  5DIZ A;  3U3W A;  3T5V A;  2OND A;  1IHB A;  2PM6 A;  3GZ2 A;  2WPV A;  3VLF A;  4J7W A;  3CHR A;  3MGB A;  3FU6 A;  2VGX B;  1NI1 A;  3D9M A;  1MX4 A;  3URZ A;  2DYS E;  1B89 A;  3HXB A;  4P29 A;  4A1S A;  3E4B A;  4FHJ A;  5T8I A;  3D9I A;  4UWH A;  2OEW A;  1O5M A;  3PZ1 A;  4PDX A;  4N3A A;  2IY0 C;  2NC9 A;  4U95 D;  4N39 A;  3FWV A;  4JXT A;  4ILH B;  4GTT A;  3FEX A;  2J07 A;  3Q7F A;  1N54 A;  5AQ9 A;  2GGF A;  2ZIS A;  3C72 A;  4RSY A;  5G05 J;  2ETC A;  3SGH A;  1ELW A;  2I2O A;  2WXH A;  1E8X A;  3FTX A;  5DBK A;  3KEZ A;  2WMN A;  4B8A A;  2XRZ A;  3WG7 E;  3SNX A;  4E85 A;  2QFC A;  2WXI A;  3NAW A;  3EHQ A;  4FHK A;  3FUJ A;  2GRN B;  3IXE A;  4CCA A;  3DSW A;  3S2A A;  3C3R A;  3IV0 A;  3LS8 A;  2OEV A;  4BET A;  2HYZ A;  4OAV B;  3FUH A;  4I6E A;  5CBN A;  3ZRH A;  2YHC A;  4DLO A;  3UIN C;  4GPM A;  4JVS A;  3ULY A;  3UIO C;  3AG4 E;  5ENT D;  2VTB A;  5JMN D;  1EYH A;  2R59 A;  2RG8 A;  2V0P A;  3SF4 A;  1NP7 A;  3MKQ A;  2I6H A;  5LOZ A;  3PZ4 A;  3Q9U C;  2OVF A;  1TNO A;  5CMW A;  4I17 A;  3D9N A;  4CT0 A;  5AQA A;  3FUN A;  4MKT A;  1H6O A;  1RW2 A;  4CDN A;  2XPZ A;  4ME2 A;  3JCK C;  3AU5 A;  2RD0 A;  5BW8 C;  2NSZ A;  3PUJ A;  2IU1 A;  3MV2 B;  4WND A;  1JPL A;  3UT8 A;  4LEU A;  4Y6W A;  4KBQ A;  5HS0 A;  4N3C A;  3B7B A;  1N4R A;  2MOW A;  5LP0 A;  2IEJ A;  2VSY A;  1O1S A;  2F8X K;  2V4H C;  3CLJ A;  3DEO A;  4WWN A;  5D0Q D;  4RQI A;  1RZ4 A;  2F37 A;  2DVW A;  2X6J A;  3FUM A;  5BXO A;  1TJC A;  4LCT A;  3GZS A;  3W9G A;  4Y6C A;  2DIW A;  4HRM B;  2AXZ A;  4LNB A;  3PS6 A;  2XGO A;  5D2M C;  5IY5 E;  4U7E B;  3CHP A;  2A5E A;  1H19 A;  4GA1 A;  1QZ2 A;  2GRO B;  1Q2Z A;  2FEZ A;  3HDX A;  4TXP A;  1X5B A;  3NOC D;  3PEV B;  2F0Y A;  4J8E A;  4CDR A;  2L0I A;  4XEI G;  3O48 A;  2DBA A;  4PS7 A;  4UUC A;  2VJ8 A;  1HXI A;  5FZQ A;  2PM7 A;  5FQ6 A;  1N94 A;  5CMY A;  4HVB A;  1H6P A;  4R7L A;  3TWW A;  1FT2 A;  3S7F A;  4CEM A;  2MHK A;  4GYO A;  1TYQ G;  4DI3 A;  3FUI A;  2MRI A;  3FUE A;  3UUX A;  4F6R D;  3ZVV A;  3FU0 A;  4IUL A;  2KCL A;  4BX8 A;  4JW1 A;  4N2S A;  2RKK A;  4YDO A;  3CVN A;  1N0R A;  1BI8 B;  1NZN A;  2AW6 A;  3OXL A;  2H6F A;  1G3N B;  2WXO A;  5E76 A;  2XZT G;  5CRU A;  3CGH A;  4C0M A;  5HRY A;  3UT7 A;  3CK7 A;  3QWP A;  4C0E A;  3EIQ C;  3PUK A;  4KVM A;  1DC2 A;  4L9P A;  3HVE A;  2L9B A;  4EZK A;  4FLH A;  3L13 A;  3KAE A;  3EIJ A;  5HQ8 A;  1S64 A;  3GYZ A;  1TNZ A;  3AG2 E;  4U0Z A;  2X6K A;  2V5Q C;  2BUG A;  4TUM A;  2WXL A;  3PVL A;  1V54 E;  3DSU A;  2IO2 C;  4U63 A;  2P9K G;  4NIK A;  5JHB A;  4MBG A;  3T9K A;  2EQX A;  4ILI A;  2KCK A;  2GRP B;  4GCN A;  4KZ0 A;  3IKO B;  4HOQ A;  1E8W A;  3CQC B;  5J90 A;  4U8H A;  1O1R A;  5G55 A;  5J08 A;  4BES A;  3FUL A;  3TJP A;  3I4G A;  1X81 A;  5ENN A;  2HO1 A;  2OV8 A;  2FUL A;  4X8Q A;  1TR4 A;  1JWF A;  2J08 A;  2F8Y A;  3ZEF A;  1QBQ A;  2Y4U A;  3DWL G;  3ZW3 A;  3ZNG A;  5CEC B;  4EZJ A;  3LY7 A;  3HHM A;  3ABM E;  5LCW C;  3NQP A;  4N5C A;  1PY1 A;  4GZ3 A;  2Y0B G;  2JEK A;  4MS6 A;  4OVU A;  4RLY A;  3FUF A;  5C1D A;  5ENR D;  5CHE E;  2AJA A;  4HOT A;  2X3M A;  4DX1 A;  1YYH A;  4AXH A;  2P9N G;  3ASO E;  3AJI A;  1KT1 A;  1TNB A;  2WXK A;  2AXU A;  3MV3 B;  4WWO A;  4G8L A;  2XS1 A;  4XE0 A;  4GZC A;  1WDY A;  3D9J A;  3ULQ A;  3BG0 B;  3FHE A;  3MCX A;  5FTP A;  3LVR E;  1SVX A;  5G05 C;  4ANU A;  4CRW A;  5ANL A;  4I1A A;  3TWT A;  3AG1 E;  4RG6 A;  2CG2 A;  3W9F A;  3PH0 C;  5ENS D;  3DXK G;  1HZ4 A;  4GMJ A;  3P1U A;  4BWR A;  2J4B A;  3R7Q A;  4HFG A;  1K1B A;  1HG5 A;  3D9P A;  5ARG A;  4UQY A;  3CVW A;  4DPR A;  5D0O D;  3FH8 A;  4G25 A;  3UI2 A;  2WQH A;  3CHS A;  3Q79 A;  4NRH B;  4N2Q A;  1IKN D;  3ULE G;  1WY6 A;  3G2U A;  1S63 A;  2J49 A;  3EUV A;  2EIL E;  4FC8 A;  1SA5 A;  5E75 A;  4G11 A;  3UM3 A;  4K5C A;  4LUN U;  4GU5 A;  5CCM A;  2EIM E;  1OCZ E;  1SZ9 A;  3HYM B;  3BUA A;  1OCO E;  5AYW D;  4O1P A;  4YDE A;  1OY3 D;  3B95 A;  2H6I A;  3EU9 A;  3CVX A;  4GZ6 A;  1IHG A;  3RO3 A;  2AXV A;  2MYO A;  2WQ7 A;  4FAD A;  2CFZ A;  4GTQ A;  4E6H A;  2XEV A;  2VYI A;  3FTV A;  4HOU A;  1E7U A;  3UKR G;  2YNQ A;  4YND A;  2CHX A;  1U2V G;  3MKQ B;  3D9O A;  4YDY A;  4ACL A;  4QQI A;  1BPO A;  4L7T A;  5EX3 A;  5LFA A;  4ANW A;  3SQV A;  2XGS A;  1JCQ A;  4KZC A;  4FJZ A;  1DNP A;  4JEU A;  3RAU A;  1OCR E;  4CYM D;  3CHQ A;  4PUC A;  4GTS A;  5D66 A;  3RK6 A;  2YQ8 A;  5KCM A;  3UMV A;  3UIP C;  4BSX A;  3EU5 A;  4J8D A;  2CHZ A;  4DX5 D;  2R03 A;  1LTX A;  4JB8 P;  3PNL B;  2L6B A;  1QYM A;  1HH8 A;  2PNN A;  1LD7 A;  2R17 C;  2V4L A;  4J8S A;  3L82 A;  4DI4 A;  1E8Y A;  2ETB A;  3B7T A;  1IQU A;  3L54 A;  2ZXW E;  3MA5 A;  3QC1 A;  3C5R A;  3EJN A;  1A5E A;  1MX2 A;  3MKR A;  3B7R L;  3V2X A;  4UWK A;  1S70 B;  3N71 A;  3APF A;  4UI9 J;  2R02 A;  1O1T A;  3V79 K;  5ENP D;  4YDW A;  3K9I A;  2EIN E;  3G2V A;  1V55 E;  2HR2 A;  5AQ7 A;  3E34 A;  4UQZ A;  3ONK A;  3UX4 A;  2DCP A;  3L17 A;  3V2O A;  4GA2 A;  3D3M A;  5AN8 A;  3I3N A;  4G2V A;  3ML9 A;  2AVP A;  1HF8 A;  1LD8 A;  2WXG A;  4DX6 D;  2VGX A;  4TXQ A;  3SI5 A;  4ILG A;  4NUR A;  3Q5M A;  3RKV A;  2VGE A;  4UI9 K;  4HLL A;  5AAR A;  4BTB A;  1EPU A;  2J09 A;  3FUK A;  3ZHE B;  1GW6 A;  4I9C A;  3X2Q E;  1EF1 C;  1KLX A;  4EBA G;  1FPP A;  1NA3 A;  3KEA A;  4HQD A;  3ZN3 A;  4GYY A;  2NYJ A;  3DRA A;  4HBD A;  2DZO A;  5BT1 A;  1PC2 A;  2IFU A;  4I43 A;  3RJV A;  3SD5 A;  2WM9 A;  4WNF A;  3PRZ A;  3LJN A;  2ILR A;  4LNG A;  3NBN B;  3KS2 A;  3F6Q A;  4WUY A;  5A23 A;  3HIZ A;  2IOL A;  2KZT A;  3NZU A;  2M63 A;  1NFI E;  3Q49 B;  4I2W A;  4U96 D;  1K3Z D;  3LY8 A;  4GTO A;  4WAF A;  1BU9 A;  4G24 A;  2P9I G;  4U0U A;  3VTY A;  2LO6 A;  1FCH A;  3P2B A;  3UTM A;  1H2T C;  4XKC A;  1ZBP A;  3AAA C;  4A55 A;  2WXF A;  3SY2 A;  4AY5 A;  3ASG A;  3U64 A;  4GML A;  4A3V A;  2AWI A;  2BTD A;  4B89 A;  2XZD G;  3FY4 A;  1N52 A;  3IEG A;  1TJF A;  4ATG A;  3OXG A;  3DSV A;  4JHR A;  2DZN A;  3TWX A;  4AV7 A;  3GZ1 A;  3BEE A;  3QKY A;  4K03 A;  3TG4 A;  4I6J A;  1TNY A;  1E7V A;  1YCS B;  3L9T A;  3HXE A;  5EIB E;  2QYJ A;  1UW4 B;  4L2L A;  3HXF A;  1MHQ A;  4ATZ D;  2B6C A;  1TN7 A;  4HLE A;  4HB5 A;  3Q73 A;  4MLP A;  4XI0 A;  1D9S A;  5HKP A;  3DSS A;  2LSV A;  4M3O A;  4GB9 A;  3T5X A;  1AP7 A;  3FDH A;  4JA7 A;  1A17 A;  3DXM G;  2X6F A;  2H6H A;  3QAR A;  2FO7 A;  1NA0 A;  4AY6 A;  2OVB A;  4U0S A;  3ASF A;  2WMO A;  5ITZ F;  1K8K G;  2XS8 A;  3JYS A;  5G04 J;  1MZC A;  4BEP A;  3SHF A;  3GW4 A;  3DPY A;  2L0T B;  2LUH A;  4JHJ A;  3J5Q B;  3FTW A;  3AS8 A;  3CKB A;  2GRL A;  5FQ8 A;  4BX9 A;  3SZ7 A;  4WNE A;  4U8V D;  2XPI A;  2OOE A;  4Q94 A;  1FVF A;  5BV0 A;  3FU5 A;  5AAO A;  1QQE A;  2LAH A;  3UPV A;  4BER A;  3MEK A;  3ESK A;  4FP7 A;  3BU8 A;  3EHM A;  5FZS A;  3VTX A;  4M7C A;  2Y1L E;  3CVQ A;  4CDM A;  1OWO A;  1ELR A;  3FTZ A;  5AJL A;  5CBO A;  4V3I A;  5ENO D;  5KNH D;  4HOR A;  2X6H A;  3IBE A;  3UXG A;  1WG0 A;  3QWW A;  1BD8 A;  4N3B A;  4UWL A;  1Z3Y A;  2XCB A;  5KBA A;  4KVO A;  3TXN A;  4J6I A;  1ELK A;  2YIN A;  4F7A A;  2Y69 E;  4BFR A;  1N4Q A;  4EHM A;  3Q15 A;  5FQ7 A;  2IF4 A;  2VGY A;  4I1M A;  3U4T A;  3QNK A;  4DK5 A;  4BT8 A;  4TV3 A;  3LXU X;  2IO3 C;  4W9R A;  2CHW A;  3UKU G;  3JQ0 A;  1DCQ A;  5BXU A;  3JQ1 A;  4J8Y A;  3VLE A;  3L22 A;  4YVQ C;  2BKK B;  1N11 A;  4BSZ B;  1N0Q A;  1OWM A;  1WAO 1;  3PDN A;  4H7X A;  1DVP A;  3EHN A;  5FWQ A;  3RU0 A;  3AS4 A;  5FQ4 A;  3IHV A;  2XEE A;  3DST A;  3LVQ E;  3UM0 A;  4KXK B;  1SQM A;  2P9L G;  3FUD A;  4DX7 D;  2FI7 A;  1WM5 A;  4J0U A;  5ARF A;  3TGO A;  2QY7 A;  4XZ4 A;  3ZYM A;  3S7D A;  2P9P G;  4AP2 A;  1L5J A;  4QFV A;  4AJW A;  4L1B A;  3ML8 A;  3E30 A;  2YHE A;  5JJ6 A;  2A4Z A;  3E33 A;  3Q47 B;  2LNI A;  2C0M A;  1OCC E;  1INZ A;  4HS2 A;  4AIF A;  3ZU7 B;  4KT6 B;  4HRL A;  4UI9 C;  2KBX A;  4ZFH A;  3NF1 A;  4BTA A;  3HRA A;  1AWC B;  3D9H A;  3HXC A;  5KJM A;  1MJ0 A;  3SBT B;  1KZO A;  3QK0 A;  3TXM A;  2WXQ A;  3V30 A;  3ASD A;  3E32 A;  4JPS A;  2XQ0 A;  1QNF A;  3ASN E;  3ASH A;  3U9W A;  3RRN B;  5C2Y A;  4TRQ A;  2H6G A;  3WXX A;  3SFY A;  3PRE A;  1ZU2 A;  3PZD A;  5EYL A;  4B93 B;  1TEZ A;  1H2U A;  1HO8 A;  1SA4 A;  3Q7A A;  4A63 B;  3ESL A;  3G2W A;  3LYA A;  2Q7F A;  3R7R A;  2V5F A;  5JJT A;  4MRU A;  2V8S E;  5FIN A;  3PZ2 A;  3B13 A;  2Y4T A;  5CED B;  5BPP A;  3SFZ A;  3JUE A;  4LRZ A;  2JLB A;  1OUV A;  4A3T A;  3SFX A;  2PQR A;  2XGM A;  2VTB B;  2WXP A;  2XPY A;  2QZA A;  4L2Y A;  4I2Z A;  1EDU A;  4WNG A;  2PL2 A;  3ZFW A;  3CVL A;  4K5A B;  5FZR A;  5KJN A;  3ZXS A;  3C3O A;  5EDS A;  4Z68 A;  3CVY A;  5EKQ D;  2I1J A;  5EX0 A;  4DRX E;  4O1O A;  4EPZ A;  4GPK A;  3U66 A;  4ZHB A;  3DSX A;  4ANV A;  1Y6I A;  2WXN A;  5H7P A;  1Z3X A;  1K1A A;  4B8C B;  2UY1 A;  4PS8 A;  3QAQ A;  5AJD A;  1UOH A;  2PQN A;  1HE8 A;  4AEZ C;  2NXP A;  2BF0 X;  2CFU A;  4OYS A;  5ANR A;  2WXM A;  4URK A;  4LER A;  2KM4 A;  5JHA A;  2VSN A;  4C9B B;  2RFA A;  3ONL A;  4F1P A;  3LCA A;  3CVP A;  4UQX A;  4ABN A;  4B94 A;  4WWP A;  2ZGD A;  4U04 A;  4OVV A;  4TXR A;  3SBS A;  1KT0 A;  1N95 A;  2B0O E;  5AEN A;  2KZT B;  3FH7 A;  2IJG X;  4PS3 A;  3FTY A;  2ZU6 B;  1Z5S C;  4F1S A;  3SO8 A;  2ZGG A;  4APO A;  3DBS A;  3KD7 A;  3AS5 A;  4H7Y A;  3QOU A;  3NOG D;  3TWS A;  2WXJ A;  3TAX A;  4K0R A;  3FFL A;  2ETA A;  2Y3A A;  4JA9 A;  5EYP F;  4GAA A;  4CGW A;  2WB2 A;  1BI7 B;  5AIJ A;  3PNT B;  3G2T A;  1Y8M A;  4ANX A;  4GTR A;  2C0L A;  1E8Z A;  2XEH A;  2HE0 A;  5HI7 A;  5KNG A;  2ZIR A;  1NL4 A;  5LX8 A;  2P2C P;  4APF A;  3IHY A;  4EEC A;  5KWD A;  3UM2 A;  3ZGQ A;  4LG6 A;  5G04 C;  1TN6 A;  3I5P A;  4CT4 A;  4LNU D;  3E37 A;  3OTN A;  4XX5 A;  4DJA A;  4OAU C;  4D10 C;  1H2V C;  1IXV A;  2WXR A;  1SZA A;  3QB2 A;  3CEQ A;  5EID A;  2RFM A;  3RSE G;  3ZXP A;  3S7J A;  3C98 A;  4JC8 A;  1MYO A;  4LSZ E;  2UWJ G;  2XRY A;  3FP3 A;  2P9S G;  2LXL A;  3PZ3 A;  3CHM A;  3RRU A;  3KSL A;  3TWQ A;  1P5Q A;  4HXI A;  3EDT B;  4TUU A;  3FTU A;  3ABK E;  4EBA A;  2J8S D;  3HVE B;  4U07 A;  4BY6 A;  2C2L A;  4GCO A;  5B1A E;  3CV0 A;  3AG3 E;  3R9A B;  4KMO A;  2KCV A;  1OWL A;  2EIJ E;  1DCE A;  1KZP A;  3KSQ A;  4AOF A;  1H0A A;  2IOS A;  2ION A;  5B1B E;  1LF8 A;  1PAQ A;  3UM1 A;  1N4S A;  3ZUV B;  1OWN A;  3ZYQ A;  4I1O B;  1OWP A;  4IRU A;  4F3V A;  1JCR A;  2P9U G;  4L23 A;  3CKC A;  1VDY A;  4GA0 A;  2WVI A;  3T8K A;  3V31 A;  2I1K A;  5M72 A;  5T3R A;  1D8D A;  4U8Y D;  3ZHE A;  3CK9 A;  3CQG B;  5G2N A;  3BQO A;  2FO1 E;  3MJW A;  1UJK A;  2XHE A; 
#chains in the Genus database with same CATH homology
 3F6Q A;  4LNU D;  4J7W A;  4UUC A;  1OY3 D;  2V5Q C;  3B95 A;  3Q9U C;  1NFI E;  3V79 K;  4TUM A;  3EU9 A;  5ENP D;  4G8L A;  4YDW A;  5EYL A;  2KXP C;  4B93 B;  4U96 D;  1K3Z D;  1MX4 A;  5ITZ F;  4OAU C;  1WDY A;  4DX2 A;  5AQA A;  2MYO A;  1IXV A;  1BU9 A;  4NIK A;  3T9K A;  5EID A;  2RFM A;  2RFA A;  1DCQ A;  5AQ7 A;  4BEP A;  4J8Y A;  4A63 B;  3UTM A;  2JAB A;  5BXU A;  4F1P A;  4ZFH A;  1MX6 A;  2QC9 A;  2BKK B;  3AAA C;  1MYO A;  1SVX A;  1N11 A;  2BKG A;  4LSZ E;  3TWW A;  4U95 D;  3V2O A;  4BSZ B;  3J5Q B;  3TWT A;  2ZGD A;  5AN8 A;  2XZD G;  1N0Q A;  5JA4 D;  3TWV A;  4CZ2 D;  5HS0 A;  3W9F A;  3TWQ A;  5FIN A;  2XEN A;  3B7B A;  4HRN A;  1SW6 A;  2B0O E;  5EN5 D;  5ENS D;  5AAO A;  3TWU A;  4BES A;  4YDY A;  5AQ9 A;  2DZN A;  4QQI A;  3TWX A;  4F6R D;  2F8X K;  2ETC A;  2V4H C;  3SO8 A;  2XEE A;  5CED B;  2J8S D;  2ZGG A;  5CER B;  4U8V D;  3TWR A;  4DX6 D;  1K1B A;  5CEA A;  3DEO A;  3Q9N C;  3JUE A;  4G8K A;  1N0R A;  4DX7 D;  1BI8 B;  2VGE A;  3HG0 D;  3JXJ A;  4HI8 A;  4HI9 A;  3NOG D;  4HLL A;  1TR4 A;  3TWS A;  5AAR A;  2F37 A;  4CYM D;  2DVW A;  2F8Y A;  1YCS B;  5EIB E;  2QYJ A;  5D66 A;  5BXO A;  3JXI A;  3UI2 A;  3ZKJ A;  3EHQ A;  4BER A;  1G3N B;  4DX5 D;  2ETA A;  2XZT G;  3W9G A;  1IKN D;  5FIO A;  4ATZ D;  4JB8 P;  4GMR A;  4QFV A;  3ZNG A;  2L6B A;  5CEC B;  1QYM A;  4K5A B;  5EYP F;  1AP7 A;  2Y1L E;  3ZUV B;  4HNA D;  2PNN A;  3KEA A;  1BI7 B;  4HQD A;  4HB5 A;  3J5P A;  4HRM B;  3IXE A;  5HRY A;  4Z68 A;  5CBO A;  1D9S A;  5HKP A;  2Y0B G;  4DRX E;  5ENO D;  4O1O A;  2ETB A;  4BET A;  2NYJ A;  4OAV B;  4RLY A;  5KNH D;  4K5C A;  5EIL A;  4K5B A;  4ZHB A;  2XEH A;  5CBN A;  4HBD A;  1DC2 A;  2DZO A;  3T8K A;  3ZU7 B;  5ENR D;  3V31 A;  4HRL A;  2AJA A;  2HE0 A;  3EHR A;  2DWZ A;  2KBX A;  2A5E A;  3C5R A;  4DUI A;  3UXG A;  1BLX B;  1YYH A;  4GPM A;  1WG0 A;  5KNG A;  1BD8 A;  1OT8 A;  4DX1 A;  3HRA A;  1AWC B;  1YMP A;  2P2C P;  5AQB A;  3D9H A;  5KBA A;  2FO1 E;  1A5E A;  1MJ0 A;  1MX2 A;  3AJI A;  1K1A A;  3LJN A;  4U8Y D;  5ENT D;  4O60 A;  3V30 A;  5KWD A;  3DEP A;  3NOC D;  4O1P A;  5JMN D;  3V2X A;  1S70 B;  4LG6 A;  4N5Q A;  3NBN B;  1UOH A;  4C48 B;  5ENQ D;  1IHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...