1MJ0A

Sank e3_5: an artificial ankyrin repeat protein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
b'GSDLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLAASNGHLEIVEVLLKNGADVNASDLTGITPLHLAAATGHLEIVEVLLKHGADVNAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SANK E3_5 Protein
publication title Designed to be stable: Crystal structure of a consensus ankyrin repeat protein
pubmed doi rcsb
source organism Designed synthetic gene
molecule tags De novo protein
total genus 55
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2002-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1mj0A00
1IKND 2MYOA 3W9FA 1NFIE 5D66A 3J5PA 4RLYA 4CYMD 2QC9A 4HRMB 4U8YD 4ZHBA 1WG0A 3TWUA 4BETA 4OAUC 3KEAA 2XZTG 3T9KA 3TWRA 1DC2A 3ZNGA 5CERB 5FINA 5BXOA 1MX6A 1BI7B 1WDYA 1YYHA 2F8YA 3EHRA 4U8VD 2BKGA 4DX2A 1SVXA 2F8XK 1AP7A 1D9SA 1MX4A 4LSZE 3TWXA 1OY3D 4B93B 4O1OA 4YDYA 3AAAC 2ETCA 2A5EA 2DZOA 4GPMA 4F6RD 1G3NB 3DEOA 4J7WA 5EIBE 5CECB 1AWCB 4QFVA 3TWWA 2RFMA 5HKPA 2AJAA 1BD8A 5CEDB 4G8KA 4BEPA 3V30A 4ZFHA 4JB8P 3DEPA 2L6BA 2BKKB 3TWQA 2NYJA 4LNUD 4YDWA 2ETAA 3NOGD 5ENQD 4OAVB 3JUEA 1MJ0A 5HRYA 3UTMA 5EYPF 3EHQA 5KNGA 4HRLA 5AQAA 4CZ2D 4DX1A 1BU9A 2DZNA 5CEAA 3F6QA 5KBAA 5BXUA 3NBNB 1BLXB 1TR4A 2VGEA 3W9GA 4Z68A 4HNAD 4F1PA 1IXVA 4DRXE 1N0RA 2XEEA 2HE0A 5AARA 3TWSA 2Y0BG 1OT8A 5ENSD 4HI9A 5FIOA 3AJIA 4U96D 3TWVA 1SW6A 3HRAA 4UUCA 5AQBA 1YMPA 3C5RA 1MYOA 1IHBA 3ZUVB 5ENRD 2Y1LE 3T8KA 4O1PA 4BESA 4DX7D 5EILA 4O60A 3JXIA 5ENPD 4GMRA 5KWDA 2ZGGA 2F37A 4BERA 4K5AB 4LG6A 1N11A 5EIDA 4HB5A 5AN8A 2XENA 4HLLA 3V2OA 3V2XA 3EU9A 3B95A 4BSZB 4C48B 3Q9UC 5ENTD 1DCQA 3J5QB 2J8SD 5EN5D 3V31A 2B0OE 3HG0D 5KNHD 3D9HA 5AQ7A 2KBXA 4U95D 3JXJA 4QQIA 5JA4D 1K1AA 2P2CP 2JABA 3SO8A 4HQDA 1YCSB 5AAOA 4K5CA 5ENOD 4A63B 2V5QC 5CBOA 5EYLA 1UOHA 5HS0A 2KXPC 3IXEA 4NIKA 1BI8B 1A5EA 2RFAA 2DWZA 5AQ9A 4DUIA 3UXGA 3V79K 4DX5D 2V4HC 4HBDA 2XEHA 1K1BA 4J8YA 5ITZF 4HRNA 1K3ZD 2DVWA 1MX2A 4G8LA 2XZDG 3TWTA 3LJNA 4DX6D 1S70B 4HI8A 4N5QA 2ETBA 3Q9NC 1QYMA 4TUMA 3B7BA 5JMND 3ZKJA 4ATZD 3NOCD 5CBNA 2QYJA 2PNNA 3UI2A 3ZU7B 4K5BA 2ZGDA 2FO1E 1N0QA
chains in the Genus database with same CATH superfamily
2EILE 4G26A 1UJJA 1AP7A 3VLFA 2AXVA 3L17A 1Z6TA 2OEWA 4YDYA 2A5EA 4PH4B 2EIKE 1BPOA 3UT7A 3OXGA 4BEPA 4GTTA 3UPVA 3NOGD 1PC2A 5FZQA 3FTXA 4NRHB 5JJ6A 2IO2C 1E8WA 3Q49B 5JJ7A 3CHRA 2OEVA 4L23A 5HI7A 2JLBA 3B7TA 3MGBA 3FUEA 3UUXA 4B0ZA 4MBGA 5AQBA 3RIBA 2CHXA 4XIFA 2LNIA 4FHKA 5E76A 5KWDA 3IHYA 3V2XA 1SZAA 3R7RA 2J8SD 4Q96A 1RW2A 5FQ6A 1KLXA 3D9HA 2H6IA 4BX9A 3G2TA 2KZTB 5ENOD 5G2NA 3U64A 1FVFA 4GZ5A 4GYOA 2E0IA 3I3NA 4JEUA 2WXKA 3Q78A 1A5EA 3V79K 1TYQG 4J0UA 1K1BA 3HXBA 4HI8A 5HQ8A 4A55A 3Q5MA 3ZHEA 5C2YA 3R9MA 1DVPA 2BF0X 4JD2G 4IULA 4ZHBA 3HYMB 4PS7A 3LCAA 4LRZA 5FINA 2CG2A 3EHNA 3HHMA 3APDA 2V0PA 4G24A 3FTUA 5BT1A 2EQXA 4B89A 1FT1A 2GRLA 1U3CA 5FWQA 1HG5A 4D10C 4BT9A 3QJZA 2C0MA 3LPZA 3RSEG 4FADA 1Y6IA 4KVOA 4ATGA 3FUFA 2YHEA 4I6JA 1OT8A 4GZDA 2LXLA 5KJLA 4HOUA 2X3MA 3CVUA 3G2VA 5T8IA 2EIJE 3BEEA 2CFUA 4RVBA 2XPYA 4FU3A 5DIZA 5EX3A 2VTBA 2IEJA 3PREA 1DCQA 3EIJA 3FP3A 2WVIA 3X2QE 4GTOA 3QAQA 1KZPA 3ZN3A 2RKKA 4DLQA 3IEGA 2XS1A 4JPSA 3QWVA 3Q47B 4JHJA 2IY0C 4GAAA 4B94A 4DPRA 2R03A 2HM8A 1LD7A 3CVPA 4UWHA 4XI0A 3PE4A 2NC9A 2ZXWE 3CHMA 4MRUA 3CVLA 3Q7AA 4JVSA 3VTYA 3GZ2A 2FO1E 3OAWA 1O1TA 3FFLA 1WG0A 3T5XA 3B13A 3B7RL 2JEKA 2DYRE 3DWLG 1OCZE 4G11A 1OY3D 3MKRA 1N4PA 5LCWJ 3AU5A 3ASFA 3DEOA 4TXPA 4APOA 1VDYA 4EECA 3CVVA 1BD8A 3APFA 5ANLA 4G8KA 2LUHA 4B8AA 1FPPA 3V30A 3ZYLA 4LCTA 2IOSA 4TXQA 3EJNA 5G04C 5HRYA 3FUKA 3HVEA 4GTPA 1N4RA 3DSSA 3FH8A 3CK9A 4HOTA 1DNPA 4LERA 2WXFA 1XGWA 2VGYA 4WWPA 3TWVA 5FIOA 5H7PA 3ZFWA 3SF4A 4O60A 2F37A 2X38A 4ACKA 1N11A 1HG2A 2ONDA 4BTAA 5LX8A 2YNQA 2KCKA 4MS6A 2P9KG 1K1AA 5E75A 3ZYQA 4R7LA 3IXEA 3CVQA 4KZCA 4DX5D 3FHEA 3SFYA 3LEWA 2XZDG 4LNGA 1S70B 3D9IA 3JQ1A 4GA1A 2QYJA 3NF1A 1IKND 5LP0A 1HU3A 3MEKA 4ILHB 4U8YD 3TWRA 3G2UA 1TNUA 4U8VD 4L9PA 2C0LA 3DBSA 1ZU2A 3I4RB 3I4GA 4JHKA 4QFVA 2V5FA 5D0QD 2AJAA 5C1DA 2AWIA 1D8DA 3U9WA 4OAVB 4K0RA 4HRLA 3TAXA 1ELKA 3ZXSA 3QB2A 4GCOA 3URZA 4JA9A 2VGEA 2OOEA 3AG4E 1NL4A 1UN8A 4TRQA 5JHAA 2L0IA 4OVVA 4ILGA 5A6CA 1JWGA 2FO7A 3TXNA 1IHBA 4TV3A 1TEZA 3PEVB 1E90A 4UQZA 2WQ6A 3D9OA 3DRAA 3J5QB 2XGOA 3QDNA 4PS3A 2MRIA 3JXJA 5T4YA 3E32A 2UY1A 1N54A 4AY6A 4CDMA 1OWOA 4FHJA 2I2OA 3LJNA 3CVWA 2RD0A 3L6AA 3ENEA 5EIDA 4FULA 3W9FA 2R2LA 3BU8A 3U3WA 2ZISA 3L08A 5CERB 1YYHA 4DLOA 1SVXA 1YA0A 3DSVA 2GRMA 3DPYA 4GPMA 4I17A 3LVQE 5KJKA 4KXKB 1NA3A 3FUMA 3MX3A 4UI9J 4LNBA 3UT8A 4PDXA 2LO6A 1MZCA 3IV0A 3UM2A 3BUAA 3GYZA 5AJLA 2NXPA 1N4SA 5D0OD 3AG3E 2C2LA 4J8EA 4N3AA 1MYOA 3OTNA 4CDRA 4CDNA 1W3BA 3CSTA 2R05A 3DPDA 3DSTA 3SHFA 3UKUG 2XPZA 3AS4A 3P1UA 2IO3C 2P2CP 3U4TA 3E30A 4A63B 2XQ0A 4W9RA 2RFAA 4DUIA 3CSFA 4J8YA 2WMOA 4BX8A 3MA5A 2OVFA 1IQRA 3ZVVA 3CEQA 3EHMA 4YVQC 3E34A 3NAWA 3NOCD 3SFZA 1E7UA 2PNNA 2WXRA 4YDOA 3LY8A 1N0QA 1N9AA 5D66A 3T8MA 3PUJA 4OAUC 3KEAA 4F53A 3SBSA 5FZSA 3BG0B 2GRNB 2H6FA 1D9SA 1MX4A 5KJNA 4WNDA 4Y6CA 1HS6A 3PEUB 4IRUA 4UQXA 1S0PA 5CECB 1HE8A 4GTSA 1JCRA 4JB8P 2L6BA 4HFGA 3L9TA 1K8KG 5KJMA 2Y69E 4RSYA 3LXUX 4CZ2D 3PUKA 5CHEE 5CRUA 3SGHA 3O4ZA 2WQHA 5J90A 4KYOB 3PRZA 2A5UA 2Y0BG 1SW6A 1N52A 2Y1LE 2GW1A 3ONLA 1O1RA 4P29A 4U63A 3E33A 3FDHA 4AXHA 2CHZA 2MOWA 2VQ2A 3UMVA 3R7QA 2B0OE 4J8FA 2XCBA 5AAOA 4N2QA 3CKCA 4ANUA 2KXPC 3RRUA 3TL5A 2YQ8A 1WAO1 2XCCA 5CMWA 4NQ0A 1E8ZA 2XEHA 4L2YA 3JQ0A 2WXNA 4HRNA 2X6KA 3HXDA 3FUIA 2J49A 3OXFA 4G2VA 3TWTA 3CHOA 2ETBA 1QYMA 1SA4A 4BSXA 5JMND 3L22A 1O1SA 1E8YA 2YINA 1UW4B 2BUGA 3TWUA 3UX4A 1TN7A 5G05J 4F3VA 5BXOA 3C3QA 4HORA 4I6GA 3C3OA 5HKPA 2CFZA 2BKKB 3FULA 3FUHA 4BT8A 3PE3A 3N71A 2X6FA 3KS2A 3JCKC 5AIJA 2XEVA 2IONA 4GA2A 3NBNB 1O5MA 1JUQA 3L82A 1FCHA 2LAIA 2KCVA 3T8KA 3TG4A 1ZBPA 4XI9A 4A3TA 1QZ2A 3ASGA 4XEIG 4GZ3A 3LJ3A 3C72A 1XNFA 4C9BB 3ASNE 4J8SA 3MKQB 3V31A 2IJGX 4QQIA 4AP2A 2WXIA 4JC8A 4UI9K 5LCWC 3ULEG 1HFAA 3FTZA 2P9PG 2WM9A 3VLEA 2IFUA 1S63A 2F0YA 1Q2ZA 3DSWA 1OCCE 1E7VA 5CBNA 3ZU7B 2J4DA 3UT4A 2KCLA 2FF4A 3FTVA 3PDNA 4BETA 4XKBA 3ZEFA 2GGFA 2LSVA 3ZIMA 2PL2A 1WDYA 4NACA 2DBAA 2WXHA 2R02A 3TWXA 4CRWA 1IYGA 1KT0A 4ABNA 4OYSA 3TGOA 3ASHA 3QWWA 1HF8A 2HYZA 1AWCB 4LUNU 4I2ZA 3SBTB 4UWFA 1WM5A 5KNGA 1V54E 2VGXB 4PS8A 3GZSA 1H6OA 5KBAA 1TR4A 3JUIA 4GYYA 4ACLA 3EDTB 4O1PA 4BESA 3Q4AB 4TXRA 4HLEA 2ZGGA 1DCEA 1TNOA 3QC1A 4BFRA 3LY7A 5CRVA 4EZKA 2UWJG 5KCMA 4I1MA 2ILRA 5JA4D 3T5VA 5CBOA 3QOUA 1TN6A 3SQVA 2XGMA 4CGWA 1H2VC 1N94A 4N5QA 3CV0A 3ULYA 4K5BA 2XPIA 2AXUA 4DI3A 4J6IA 3DXMG 3PNLB 4KMOA 1HX8A 3T9KA 4AM9A 1H2TC 1FVHA 3UIOC 1BI7B 4O1OA 2ETCA 3CK8A 5FQ7A 4GTMA 5A7DB 5CCLA 4I2WA 3RKVA 1ELRA 4YDWA 3MYVA 3D9PA 4TUUA 1Z5SC 2V4LA 1QQEA 5J08A 4UWLA 1BU9A 4WNFA 3E4BA 3P2BA 3UIPC 4Y6WA 5G04J 4GPKA 1H2UA 4Q94A 1N0RA 3TWSA 4MKTA 2LAHA 3LVRE 1RZ4A 4JL0A 2I1JA 4DJAA 1NP7A 1S64A 3ZHEB 4LG6A 4KVMA 2GRRB 3EU9A 4M7CA 3WXXA 5AQ7A 3IKOB 5ANRA 5LOZA 2X6HA 1EPUA 1OCRE 4AY5A 4WUYA 3ABKE 3S7DA 2PQNA 5EYLA 5HS0A 4UI9C 3FTSA 3Q73A 5FZRA 3FH5A 4ANWA 3BG1B 2E2EA 3ZPJA 2X6IA 3NQPA 1K3ZD 1P5QA 1TJFA 3L54A 2PM6A 3Q9NC 3G2WA 3B7BA 5FJYA 4U04A 3I5PA 1MHQA 2XGSA 2ZGDA 3C3RA 2MYOA 4FC8A 2OV8A 5FQ8A 2QC9A 2VSYA 3CQGB 4C0EA 2IU1A 3ISMC 3MCXA 4HOSA 2Y4UA 2KZTA 3UKRG 3FUNA 2X6JA 2R59A 2J4BA 3FEXA 3TWWA 2XRZA 5G55A 1SZ9A 3TWQA 2LSUA 2VTBB 1HO8A 1A17A 5EYPF 2KATA 4I6EA 2P9SG 2WXMA 3S7FA 1SA5A 2XRYA 4XE0A 4WWNA 3SY2A 1LD8A 2HE0A 5AARA 2DCPA 3ZRHA 3EUVA 3JYSA 2J09A 2YHCA 3SZ7A 2MHKA 2PQRA 1UG3A 5A23A 4GMRA 2P58C 2KC7A 3Q15A 4CT0A 4RQIA 3TG5A 1H6PA 2XENA 3VLDA 4HLLA 2PM7A 2KBXA 1TNBA 4U07A 3SO8A 4HQDA 4JW1A 4U0UA 1TN8A 1UOHA 4GU5A 4CEMA 3L16A 3PZ4A 3AS5A 2DWZA 5FT9A 2OVBA 3ZW3A 2WXLA 2HO1A 1E96B 1MX2A 1TJCA 4TUMA 2BEDA 3HVEB 2P9LG 3D3MA 4WNEA 3KAEA 1JCQA 3B7SA 4URKA 4FLHA 2DZOA 1HXIA 4F6RD 4J7WA 1EDUA 3HXEA 2WXPA 4O6FA 5CEDB 3CLJA 3HDXA 5BV1A 5DBKA 1MJ0A 5FTPA 2FBNA 2J08A 2VJ8A 4K03A 3FUDA 4F1PA 2BTDA 2DIWA 3LS8A 4HI9A 4RG9A 4YDEA 4UUCA 1YMPA 3C5RA 3IHVA 1QBQA 4CGVA 2AXZA 4RG6A 3FWVA 4FJZA 1L5JA 5ENPD 4F7AA 3K9IA 2PZIA 2I6HA 3QWPA 2R5SA 1TNZA 3QNKA 5KNHD 5G05C 2V8SE 3B7UX 1JPLA 2Y3AA 4I1OB 4GTRA 5AQ9A 5B1AE 4X8QA 1E8XA 4U8HA 4GA0A 4HXIA 3APCA 3HXCA 3ZKJA 2VSXE 4GCNA 3RO3A 4ATZD 4I1AA 2WXGA 3UI2A 3WG7E 2WQ7A 4HOQA 2J07A 2P9NG 4CYMD 3PH0C 3R9AB 1KT1A 2QFCA 1ELWA 3CK7A 1OWPA 4G25A 3ZYKA 5EIBE 4AVXA 4Q69A 4L7TA 4ZFHA 4XKCA 2AVPA 5ENQD 4EBAA 4HVBA 3NB2A 5AQAA 3PS6A 2L9BA 3F6QA 3AS8A 1ZB1A 2UY1B 2P9UG 4E85A 4WNGA 1LTXA 1IXVA 4N3BA 3AG1E 4DRXE 2XEEA 4GMJA 3CIAA 3FU5A 3FTYA 3BQOA 3S7BA 2VYIA 1OWLA 2WXQA 3FTWA 3CHPA 4AEZC 4DX7D 4BWRA 3IBEA 4C0MA 4EPZA 4BERA 4K5AB 3CVNA 2HR2A 5AN8A 3EIQC 3V2OA 3NZSA 4N3CA 4C48B 5ENTD 1OUVA 3ABME 3HG0D 3ZXPA 2R17C 4J8DA 4U0SA 4ANXA 2DYSE 2CG3A 2L6JA 4L1BA 5AYWD 4YVOA 5ARFA 3ASDA 4E6HA 4GZ6A 3SD5A 5EKQD 4A3VA 4OVUA 5B1BE 3D9JA 1U3DA 3PZ1A 1NFIE 4RLYA 5LFAA 3Q79A 1OWMA 1IQUA 5CCMA 2H6HA 1X5BA 3FY4A 1KZOA 4DI4A 3EHRA 3KD7A 2WMNA 3AAAC 4DK5A 1PAQA 2FI7A 4MLPA 2RFMA 2WB2A 3FU0A 3E37A 4NURA 3TXMA 5AJDA 3U66A 2NSZA 4GMLA 4HS2A 3UTMA 4WAFA 3EHQA 3RJVA 1UJKA 5EX0A 1OCOE 4APFA 4EHMA 2DZNA 3RRNB 4H7YA 4HNAD 4JEHA 3AG2E 3QK0A 4JZYA 3ASOE 2OCCE 5ENSD 4H7XA 4KBQA 3MV3B 4EQFA 5EILA 2IQCA 3ABLE 5AENA 5BNWA 1OXJA 1JCSA 1U2VG 3SNXA 3Q9UC 3ESLA 1KPSB 3PZ2A 3UM0A 4AOFA 3CHSA 2EIME 2JABA 3PZ3A 5BPPA 3UXGA 2AW6A 4G8LA 4UQYA 4GYWA 1INZA 2A4ZA 4GTVA 1MQSA 4HRMB 1LF8A 3AU4A 4FJYA 2XZTG 4F1SA 4N39A 1TNYA 1DC2A 3ZNGA 2KM4A 1B89A 4FLBA 3KEZA 4DX2A 3D9NA 1GW6A 1PY1A 4B93B 3G2SA 2XHEA 1IHGA 5IY5E 4GTQA 4FP7A 3DEPA 4AV7A 3CR3A 4U7EB 2J9QA 2I9CA 3UQ3A 4UWGA 1EF1C 5CEAA 2Q7FA 2LXMA 2H6GA 1BLXB 3ZYMA 4UWKA 4XZ4A 3CVXA 3PVLA 3AJIA 4U96D 3ZUVB 1OWNA 4ANVA 5BW8C 5B3SE 2FEZA 3PNTB 4AJWA 1NI1A 3EU5A 1X81A 4HB5A 3D9LA 4EZJA 3B95A 3SI5A 3MV2B 4ME2A 2GRQB 3LYAA 4K5CA 2VSOE 3FUJA 4NIKA 5EDSA 1BI8B 2XS8A 5M72A 4G23A 3L13A 2V4HC 1FT2A 2WXOA 1H6KA 1QNFA 4WWOA 3HXFA 3HIZA 2VSNA 2Y4TA 2FULA 3ONKA 4DX1A 4A1GA 4JA7A 4I43A 4I9EA 4N5CA 1WY6A 5BUZA 1MX6A 3O48A 3DXKG 2F8YA 2BKGA 2IOLA 3S7JA 4LSZE 3ML8A 4EZLA 1G3NB 4LNUD 4IYPA 3RO2A 3CVYA 2CHWA 4Z68A 2I1KA 4LEUA 4YNDA 1D8EA 3CKBA 3RRMB 4V3IA 3FU3A 3RK6A 3ML9A 4L2LA 5ENRD 1HH8A 4FA6A 4B8CB 3JXIA 4CCAA 3SFXA 3QARA 3PZDA 4JHRA 4JXTA 1N95A 2GRPB 1Z3YA 3LKUA 4BSZB 3OXLA 1V55E 3GZ1A 3CHQA 4U95D 3LY9A 3VTXA 1EYHA 4N2SA 3ESKA 5ENNA 3S2AA 3GW4A 4XX5A 3RAUA 4HBDA 1N4QA 5ITZF 2ZU6B 2DVWA 1Z3XA 1JWFA 3DSXA 3NZUA 2WPVA 2QYUA 3J5PA 2WXJA 2M63A 2B6CA 3MKQA 2QY7A 3UM3A 3FEYA 4KZ0A 2F8XK 4BY6A 3D9MA 3C98A 3KSLA 3UM1A 4M3OA 1NA0A 3QKYA 4AIFA 3UINC 3Q75A 4ILIA 2NYJA 2QZAA 2ETAA 3DSUA 3JUEA 4GZCA 4GB9A 4EBAG 2L0TB 2GROB 3RU0A 3Q7FA 3FU6A 3LDZA 4CT4A 3TJPA 5BXUA 2ZIRA 3W9GA 2RG8A 5ARGA 2P9IG 3HRAA 4KT6B 1HZ4A 3MJWA 5JJTA 2EINE 2IF4A 4I9CA 3MZLB 5BV0A 4A1SA 1NZNA 4U0ZA 5EN5D 3CQCB 5D2MC 3ZGQA 1Y8MA 4G1TA 4PUCA 5JHBA 2VGXA 4BTBA 3ULQA 1YCSB 2V5QC 3FH7A 4IN3B 3CGHA 3KSQA 4DX6D 1H19A 3D9KA 5T3RA 1UN9A 5FQ4A 1H0AA 1SQMA 5CMYA
chains in the Genus database with same CATH topology
1IKND 2MYOA 3W9FA 1NFIE 5D66A 3J5PA 4RLYA 4CYMD 2QC9A 4HRMB 4U8YD 4ZHBA 1WG0A 3TWUA 4BETA 4OAUC 3KEAA 2XZTG 3T9KA 3TWRA 1DC2A 3ZNGA 5CERB 5FINA 5BXOA 1MX6A 1BI7B 1WDYA 1YYHA 2F8YA 3EHRA 4U8VD 2BKGA 4DX2A 1SVXA 2F8XK 1AP7A 1D9SA 1MX4A 4LSZE 3TWXA 1OY3D 4B93B 4O1OA 4YDYA 3AAAC 2ETCA 2A5EA 2DZOA 4GPMA 4F6RD 1G3NB 3DEOA 4J7WA 5EIBE 5CECB 1AWCB 4QFVA 3TWWA 2RFMA 5HKPA 2AJAA 1BD8A 5CEDB 4G8KA 4BEPA 3V30A 4ZFHA 4JB8P 3DEPA 2L6BA 2BKKB 3TWQA 2NYJA 4LNUD 4YDWA 2ETAA 3NOGD 5ENQD 4OAVB 3JUEA 1MJ0A 5HRYA 3UTMA 5EYPF 3EHQA 5KNGA 4HRLA 5AQAA 4CZ2D 4DX1A 1BU9A 2DZNA 5CEAA 3F6QA 5KBAA 5BXUA 3NBNB 1BLXB 1TR4A 2VGEA 3W9GA 4Z68A 4HNAD 4F1PA 1IXVA 4DRXE 1N0RA 2XEEA 2HE0A 5AARA 3TWSA 2Y0BG 1OT8A 5ENSD 4HI9A 5FIOA 3AJIA 4U96D 3TWVA 1SW6A 3HRAA 4UUCA 5AQBA 1YMPA 3C5RA 1MYOA 1IHBA 3ZUVB 5ENRD 2Y1LE 3T8KA 4O1PA 4BESA 4DX7D 5EILA 4O60A 3JXIA 5ENPD 4GMRA 5KWDA 2ZGGA 2F37A 4BERA 4K5AB 4LG6A 1N11A 5EIDA 4HB5A 5AN8A 2XENA 4HLLA 3V2OA 3V2XA 3EU9A 3B95A 4BSZB 4C48B 3Q9UC 5ENTD 1DCQA 3J5QB 2J8SD 5EN5D 3V31A 2B0OE 3HG0D 5KNHD 3D9HA 5AQ7A 2KBXA 4U95D 3JXJA 4QQIA 5JA4D 1K1AA 2P2CP 2JABA 3SO8A 4HQDA 1YCSB 5AAOA 4K5CA 5ENOD 4A63B 2V5QC 5CBOA 5EYLA 1UOHA 5HS0A 2KXPC 3IXEA 4NIKA 1BI8B 1A5EA 2RFAA 2DWZA 5AQ9A 4DUIA 3UXGA 3V79K 4DX5D 2V4HC 4HBDA 2XEHA 1K1BA 4J8YA 5ITZF 4HRNA 1K3ZD 2DVWA 1MX2A 4G8LA 2XZDG 3TWTA 3LJNA 4DX6D 1S70B 4HI8A 4N5QA 2ETBA 3Q9NC 1QYMA 4TUMA 3B7BA 5JMND 3ZKJA 4ATZD 3NOCD 5CBNA 2QYJA 2PNNA 3UI2A 3ZU7B 4K5BA 2ZGDA 2FO1E 1N0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKN D;  2MYO A;  3W9F A;  1NFI E;  5D66 A;  3J5P A;  4RLY A;  4CYM D;  2QC9 A;  4HRM B;  4U8Y D;  4ZHB A;  1WG0 A;  3TWU A;  4BET A;  4OAU C;  3KEA A;  2XZT G;  3T9K A;  3TWR A;  1DC2 A;  3ZNG A;  5CER B;  5FIN A;  5BXO A;  1MX6 A;  1BI7 B;  1WDY A;  1YYH A;  2F8Y A;  3EHR A;  4U8V D;  2BKG A;  4DX2 A;  1SVX A;  2F8X K;  1AP7 A;  1D9S A;  1MX4 A;  4LSZ E;  3TWX A;  1OY3 D;  4B93 B;  4O1O A;  4YDY A;  3AAA C;  2ETC A;  2A5E A;  2DZO A;  4GPM A;  4F6R D;  1G3N B;  3DEO A;  4J7W A;  5EIB E;  5CEC B;  1AWC B;  4QFV A;  3TWW A;  2RFM A;  5HKP A;  2AJA A;  1BD8 A;  5CED B;  4G8K A;  4BEP A;  3V30 A;  4ZFH A;  4JB8 P;  3DEP A;  2L6B A;  2BKK B;  3TWQ A;  2NYJ A;  4LNU D;  4YDW A;  2ETA A;  3NOG D;  5ENQ D;  4OAV B;  3JUE A;  1MJ0 A;  5HRY A;  3UTM A;  5EYP F;  3EHQ A;  5KNG A;  4HRL A;  5AQA A;  4CZ2 D;  4DX1 A;  1BU9 A;  2DZN A;  5CEA A;  3F6Q A;  5KBA A;  5BXU A;  3NBN B;  1BLX B;  1TR4 A;  2VGE A;  3W9G A;  4Z68 A;  4HNA D;  4F1P A;  1IXV A;  4DRX E;  1N0R A;  2XEE A;  2HE0 A;  5AAR A;  3TWS A;  2Y0B G;  1OT8 A;  5ENS D;  4HI9 A;  5FIO A;  3AJI A;  4U96 D;  3TWV A;  1SW6 A;  3HRA A;  4UUC A;  5AQB A;  1YMP A;  3C5R A;  1MYO A;  1IHB A;  3ZUV B;  5ENR D;  2Y1L E;  3T8K A;  4O1P A;  4BES A;  4DX7 D;  5EIL A;  4O60 A;  3JXI A;  5ENP D;  4GMR A;  5KWD A;  2ZGG A;  2F37 A;  4BER A;  4K5A B;  4LG6 A;  1N11 A;  5EID A;  4HB5 A;  5AN8 A;  2XEN A;  4HLL A;  3V2O A;  3V2X A;  3EU9 A;  3B95 A;  4BSZ B;  4C48 B;  3Q9U C;  5ENT D;  1DCQ A;  3J5Q B;  2J8S D;  5EN5 D;  3V31 A;  2B0O E;  3HG0 D;  5KNH D;  3D9H A;  5AQ7 A;  2KBX A;  4U95 D;  3JXJ A;  4QQI A;  5JA4 D;  1K1A A;  2P2C P;  2JAB A;  3SO8 A;  4HQD A;  1YCS B;  5AAO A;  4K5C A;  5ENO D;  4A63 B;  2V5Q C;  5CBO A;  5EYL A;  1UOH A;  5HS0 A;  2KXP C;  3IXE A;  4NIK A;  1BI8 B;  1A5E A;  2RFA A;  2DWZ A;  5AQ9 A;  4DUI A;  3UXG A;  3V79 K;  4DX5 D;  2V4H C;  4HBD A;  2XEH A;  1K1B A;  4J8Y A;  5ITZ F;  4HRN A;  1K3Z D;  2DVW A;  1MX2 A;  4G8L A;  2XZD G;  3TWT A;  3LJN A;  4DX6 D;  1S70 B;  4HI8 A;  4N5Q A;  2ETB A;  3Q9N C;  1QYM A;  4TUM A;  3B7B A;  5JMN D;  3ZKJ A;  4ATZ D;  3NOC D;  5CBN A;  2QYJ A;  2PNN A;  3UI2 A;  3ZU7 B;  4K5B A;  2ZGD A;  2FO1 E;  1N0Q A; 
#chains in the Genus database with same CATH topology
 2EIL E;  4G26 A;  1UJJ A;  1AP7 A;  3VLF A;  2AXV A;  3L17 A;  1Z6T A;  2OEW A;  4YDY A;  2A5E A;  4PH4 B;  2EIK E;  1BPO A;  3UT7 A;  3OXG A;  4BEP A;  4GTT A;  3UPV A;  3NOG D;  1PC2 A;  5FZQ A;  3FTX A;  4NRH B;  5JJ6 A;  2IO2 C;  1E8W A;  3Q49 B;  5JJ7 A;  3CHR A;  2OEV A;  4L23 A;  5HI7 A;  2JLB A;  3B7T A;  3MGB A;  3FUE A;  3UUX A;  4B0Z A;  4MBG A;  5AQB A;  3RIB A;  2CHX A;  4XIF A;  2LNI A;  4FHK A;  5E76 A;  5KWD A;  3IHY A;  3V2X A;  1SZA A;  3R7R A;  2J8S D;  4Q96 A;  1RW2 A;  5FQ6 A;  1KLX A;  3D9H A;  2H6I A;  4BX9 A;  3G2T A;  2KZT B;  5ENO D;  5G2N A;  3U64 A;  1FVF A;  4GZ5 A;  4GYO A;  2E0I A;  3I3N A;  4JEU A;  2WXK A;  3Q78 A;  1A5E A;  3V79 K;  1TYQ G;  4J0U A;  1K1B A;  3HXB A;  4HI8 A;  5HQ8 A;  4A55 A;  3Q5M A;  3ZHE A;  5C2Y A;  3R9M A;  1DVP A;  2BF0 X;  4JD2 G;  4IUL A;  4ZHB A;  3HYM B;  4PS7 A;  3LCA A;  4LRZ A;  5FIN A;  2CG2 A;  3EHN A;  3HHM A;  3APD A;  2V0P A;  4G24 A;  3FTU A;  5BT1 A;  2EQX A;  4B89 A;  1FT1 A;  2GRL A;  1U3C A;  5FWQ A;  1HG5 A;  4D10 C;  4BT9 A;  3QJZ A;  2C0M A;  3LPZ A;  3RSE G;  4FAD A;  1Y6I A;  4KVO A;  4ATG A;  3FUF A;  2YHE A;  4I6J A;  1OT8 A;  4GZD A;  2LXL A;  5KJL A;  4HOU A;  2X3M A;  3CVU A;  3G2V A;  5T8I A;  2EIJ E;  3BEE A;  2CFU A;  4RVB A;  2XPY A;  4FU3 A;  5DIZ A;  5EX3 A;  2VTB A;  2IEJ A;  3PRE A;  1DCQ A;  3EIJ A;  3FP3 A;  2WVI A;  3X2Q E;  4GTO A;  3QAQ A;  1KZP A;  3ZN3 A;  2RKK A;  4DLQ A;  3IEG A;  2XS1 A;  4JPS A;  3QWV A;  3Q47 B;  4JHJ A;  2IY0 C;  4GAA A;  4B94 A;  4DPR A;  2R03 A;  2HM8 A;  1LD7 A;  3CVP A;  4UWH A;  4XI0 A;  3PE4 A;  2NC9 A;  2ZXW E;  3CHM A;  4MRU A;  3CVL A;  3Q7A A;  4JVS A;  3VTY A;  3GZ2 A;  2FO1 E;  3OAW A;  1O1T A;  3FFL A;  1WG0 A;  3T5X A;  3B13 A;  3B7R L;  2JEK A;  2DYR E;  3DWL G;  1OCZ E;  4G11 A;  1OY3 D;  3MKR A;  1N4P A;  5LCW J;  3AU5 A;  3ASF A;  3DEO A;  4TXP A;  4APO A;  1VDY A;  4EEC A;  3CVV A;  1BD8 A;  3APF A;  5ANL A;  4G8K A;  2LUH A;  4B8A A;  1FPP A;  3V30 A;  3ZYL A;  4LCT A;  2IOS A;  4TXQ A;  3EJN A;  5G04 C;  5HRY A;  3FUK A;  3HVE A;  4GTP A;  1N4R A;  3DSS A;  3FH8 A;  3CK9 A;  4HOT A;  1DNP A;  4LER A;  2WXF A;  1XGW A;  2VGY A;  4WWP A;  3TWV A;  5FIO A;  5H7P A;  3ZFW A;  3SF4 A;  4O60 A;  2F37 A;  2X38 A;  4ACK A;  1N11 A;  1HG2 A;  2OND A;  4BTA A;  5LX8 A;  2YNQ A;  2KCK A;  4MS6 A;  2P9K G;  1K1A A;  5E75 A;  3ZYQ A;  4R7L A;  3IXE A;  3CVQ A;  4KZC A;  4DX5 D;  3FHE A;  3SFY A;  3LEW A;  2XZD G;  4LNG A;  1S70 B;  3D9I A;  3JQ1 A;  4GA1 A;  2QYJ A;  3NF1 A;  1IKN D;  5LP0 A;  1HU3 A;  3MEK A;  4ILH B;  4U8Y D;  3TWR A;  3G2U A;  1TNU A;  4U8V D;  4L9P A;  2C0L A;  3DBS A;  1ZU2 A;  3I4R B;  3I4G A;  4JHK A;  4QFV A;  2V5F A;  5D0Q D;  2AJA A;  5C1D A;  2AWI A;  1D8D A;  3U9W A;  4OAV B;  4K0R A;  4HRL A;  3TAX A;  1ELK A;  3ZXS A;  3QB2 A;  4GCO A;  3URZ A;  4JA9 A;  2VGE A;  2OOE A;  3AG4 E;  1NL4 A;  1UN8 A;  4TRQ A;  5JHA A;  2L0I A;  4OVV A;  4ILG A;  5A6C A;  1JWG A;  2FO7 A;  3TXN A;  1IHB A;  4TV3 A;  1TEZ A;  3PEV B;  1E90 A;  4UQZ A;  2WQ6 A;  3D9O A;  3DRA A;  3J5Q B;  2XGO A;  3QDN A;  4PS3 A;  2MRI A;  3JXJ A;  5T4Y A;  3E32 A;  2UY1 A;  1N54 A;  4AY6 A;  4CDM A;  1OWO A;  4FHJ A;  2I2O A;  3LJN A;  3CVW A;  2RD0 A;  3L6A A;  3ENE A;  5EID A;  4FUL A;  3W9F A;  2R2L A;  3BU8 A;  3U3W A;  2ZIS A;  3L08 A;  5CER B;  1YYH A;  4DLO A;  1SVX A;  1YA0 A;  3DSV A;  2GRM A;  3DPY A;  4GPM A;  4I17 A;  3LVQ E;  5KJK A;  4KXK B;  1NA3 A;  3FUM A;  3MX3 A;  4UI9 J;  4LNB A;  3UT8 A;  4PDX A;  2LO6 A;  1MZC A;  3IV0 A;  3UM2 A;  3BUA A;  3GYZ A;  5AJL A;  2NXP A;  1N4S A;  5D0O D;  3AG3 E;  2C2L A;  4J8E A;  4N3A A;  1MYO A;  3OTN A;  4CDR A;  4CDN A;  1W3B A;  3CST A;  2R05 A;  3DPD A;  3DST A;  3SHF A;  3UKU G;  2XPZ A;  3AS4 A;  3P1U A;  2IO3 C;  2P2C P;  3U4T A;  3E30 A;  4A63 B;  2XQ0 A;  4W9R A;  2RFA A;  4DUI A;  3CSF A;  4J8Y A;  2WMO A;  4BX8 A;  3MA5 A;  2OVF A;  1IQR A;  3ZVV A;  3CEQ A;  3EHM A;  4YVQ C;  3E34 A;  3NAW A;  3NOC D;  3SFZ A;  1E7U A;  2PNN A;  2WXR A;  4YDO A;  3LY8 A;  1N0Q A;  1N9A A;  5D66 A;  3T8M A;  3PUJ A;  4OAU C;  3KEA A;  4F53 A;  3SBS A;  5FZS A;  3BG0 B;  2GRN B;  2H6F A;  1D9S A;  1MX4 A;  5KJN A;  4WND A;  4Y6C A;  1HS6 A;  3PEU B;  4IRU A;  4UQX A;  1S0P A;  5CEC B;  1HE8 A;  4GTS A;  1JCR A;  4JB8 P;  2L6B A;  4HFG A;  3L9T A;  1K8K G;  5KJM A;  2Y69 E;  4RSY A;  3LXU X;  4CZ2 D;  3PUK A;  5CHE E;  5CRU A;  3SGH A;  3O4Z A;  2WQH A;  5J90 A;  4KYO B;  3PRZ A;  2A5U A;  2Y0B G;  1SW6 A;  1N52 A;  2Y1L E;  2GW1 A;  3ONL A;  1O1R A;  4P29 A;  4U63 A;  3E33 A;  3FDH A;  4AXH A;  2CHZ A;  2MOW A;  2VQ2 A;  3UMV A;  3R7Q A;  2B0O E;  4J8F A;  2XCB A;  5AAO A;  4N2Q A;  3CKC A;  4ANU A;  2KXP C;  3RRU A;  3TL5 A;  2YQ8 A;  1WAO 1;  2XCC A;  5CMW A;  4NQ0 A;  1E8Z A;  2XEH A;  4L2Y A;  3JQ0 A;  2WXN A;  4HRN A;  2X6K A;  3HXD A;  3FUI A;  2J49 A;  3OXF A;  4G2V A;  3TWT A;  3CHO A;  2ETB A;  1QYM A;  1SA4 A;  4BSX A;  5JMN D;  3L22 A;  1O1S A;  1E8Y A;  2YIN A;  1UW4 B;  2BUG A;  3TWU A;  3UX4 A;  1TN7 A;  5G05 J;  4F3V A;  5BXO A;  3C3Q A;  4HOR A;  4I6G A;  3C3O A;  5HKP A;  2CFZ A;  2BKK B;  3FUL A;  3FUH A;  4BT8 A;  3PE3 A;  3N71 A;  2X6F A;  3KS2 A;  3JCK C;  5AIJ A;  2XEV A;  2ION A;  4GA2 A;  3NBN B;  1O5M A;  1JUQ A;  3L82 A;  1FCH A;  2LAI A;  2KCV A;  3T8K A;  3TG4 A;  1ZBP A;  4XI9 A;  4A3T A;  1QZ2 A;  3ASG A;  4XEI G;  4GZ3 A;  3LJ3 A;  3C72 A;  1XNF A;  4C9B B;  3ASN E;  4J8S A;  3MKQ B;  3V31 A;  2IJG X;  4QQI A;  4AP2 A;  2WXI A;  4JC8 A;  4UI9 K;  5LCW C;  3ULE G;  1HFA A;  3FTZ A;  2P9P G;  2WM9 A;  3VLE A;  2IFU A;  1S63 A;  2F0Y A;  1Q2Z A;  3DSW A;  1OCC E;  1E7V A;  5CBN A;  3ZU7 B;  2J4D A;  3UT4 A;  2KCL A;  2FF4 A;  3FTV A;  3PDN A;  4BET A;  4XKB A;  3ZEF A;  2GGF A;  2LSV A;  3ZIM A;  2PL2 A;  1WDY A;  4NAC A;  2DBA A;  2WXH A;  2R02 A;  3TWX A;  4CRW A;  1IYG A;  1KT0 A;  4ABN A;  4OYS A;  3TGO A;  3ASH A;  3QWW A;  1HF8 A;  2HYZ A;  1AWC B;  4LUN U;  4I2Z A;  3SBT B;  4UWF A;  1WM5 A;  5KNG A;  1V54 E;  2VGX B;  4PS8 A;  3GZS A;  1H6O A;  5KBA A;  1TR4 A;  3JUI A;  4GYY A;  4ACL A;  3EDT B;  4O1P A;  4BES A;  3Q4A B;  4TXR A;  4HLE A;  2ZGG A;  1DCE A;  1TNO A;  3QC1 A;  4BFR A;  3LY7 A;  5CRV A;  4EZK A;  2UWJ G;  5KCM A;  4I1M A;  2ILR A;  5JA4 D;  3T5V A;  5CBO A;  3QOU A;  1TN6 A;  3SQV A;  2XGM A;  4CGW A;  1H2V C;  1N94 A;  4N5Q A;  3CV0 A;  3ULY A;  4K5B A;  2XPI A;  2AXU A;  4DI3 A;  4J6I A;  3DXM G;  3PNL B;  4KMO A;  1HX8 A;  3T9K A;  4AM9 A;  1H2T C;  1FVH A;  3UIO C;  1BI7 B;  4O1O A;  2ETC A;  3CK8 A;  5FQ7 A;  4GTM A;  5A7D B;  5CCL A;  4I2W A;  3RKV A;  1ELR A;  4YDW A;  3MYV A;  3D9P A;  4TUU A;  1Z5S C;  2V4L A;  1QQE A;  5J08 A;  4UWL A;  1BU9 A;  4WNF A;  3E4B A;  3P2B A;  3UIP C;  4Y6W A;  5G04 J;  4GPK A;  1H2U A;  4Q94 A;  1N0R A;  3TWS A;  4MKT A;  2LAH A;  3LVR E;  1RZ4 A;  4JL0 A;  2I1J A;  4DJA A;  1NP7 A;  1S64 A;  3ZHE B;  4LG6 A;  4KVM A;  2GRR B;  3EU9 A;  4M7C A;  3WXX A;  5AQ7 A;  3IKO B;  5ANR A;  5LOZ A;  2X6H A;  1EPU A;  1OCR E;  4AY5 A;  4WUY A;  3ABK E;  3S7D A;  2PQN A;  5EYL A;  5HS0 A;  4UI9 C;  3FTS A;  3Q73 A;  5FZR A;  3FH5 A;  4ANW A;  3BG1 B;  2E2E A;  3ZPJ A;  2X6I A;  3NQP A;  1K3Z D;  1P5Q A;  1TJF A;  3L54 A;  2PM6 A;  3Q9N C;  3G2W A;  3B7B A;  5FJY A;  4U04 A;  3I5P A;  1MHQ A;  2XGS A;  2ZGD A;  3C3R A;  2MYO A;  4FC8 A;  2OV8 A;  5FQ8 A;  2QC9 A;  2VSY A;  3CQG B;  4C0E A;  2IU1 A;  3ISM C;  3MCX A;  4HOS A;  2Y4U A;  2KZT A;  3UKR G;  3FUN A;  2X6J A;  2R59 A;  2J4B A;  3FEX A;  3TWW A;  2XRZ A;  5G55 A;  1SZ9 A;  3TWQ A;  2LSU A;  2VTB B;  1HO8 A;  1A17 A;  5EYP F;  2KAT A;  4I6E A;  2P9S G;  2WXM A;  3S7F A;  1SA5 A;  2XRY A;  4XE0 A;  4WWN A;  3SY2 A;  1LD8 A;  2HE0 A;  5AAR A;  2DCP A;  3ZRH A;  3EUV A;  3JYS A;  2J09 A;  2YHC A;  3SZ7 A;  2MHK A;  2PQR A;  1UG3 A;  5A23 A;  4GMR A;  2P58 C;  2KC7 A;  3Q15 A;  4CT0 A;  4RQI A;  3TG5 A;  1H6P A;  2XEN A;  3VLD A;  4HLL A;  2PM7 A;  2KBX A;  1TNB A;  4U07 A;  3SO8 A;  4HQD A;  4JW1 A;  4U0U A;  1TN8 A;  1UOH A;  4GU5 A;  4CEM A;  3L16 A;  3PZ4 A;  3AS5 A;  2DWZ A;  5FT9 A;  2OVB A;  3ZW3 A;  2WXL A;  2HO1 A;  1E96 B;  1MX2 A;  1TJC A;  4TUM A;  2BED A;  3HVE B;  2P9L G;  3D3M A;  4WNE A;  3KAE A;  1JCQ A;  3B7S A;  4URK A;  4FLH A;  2DZO A;  1HXI A;  4F6R D;  4J7W A;  1EDU A;  3HXE A;  2WXP A;  4O6F A;  5CED B;  3CLJ A;  3HDX A;  5BV1 A;  5DBK A;  1MJ0 A;  5FTP A;  2FBN A;  2J08 A;  2VJ8 A;  4K03 A;  3FUD A;  4F1P A;  2BTD A;  2DIW A;  3LS8 A;  4HI9 A;  4RG9 A;  4YDE A;  4UUC A;  1YMP A;  3C5R A;  3IHV A;  1QBQ A;  4CGV A;  2AXZ A;  4RG6 A;  3FWV A;  4FJZ A;  1L5J A;  5ENP D;  4F7A A;  3K9I A;  2PZI A;  2I6H A;  3QWP A;  2R5S A;  1TNZ A;  3QNK A;  5KNH D;  5G05 C;  2V8S E;  3B7U X;  1JPL A;  2Y3A A;  4I1O B;  4GTR A;  5AQ9 A;  5B1A E;  4X8Q A;  1E8X A;  4U8H A;  4GA0 A;  4HXI A;  3APC A;  3HXC A;  3ZKJ A;  2VSX E;  4GCN A;  3RO3 A;  4ATZ D;  4I1A A;  2WXG A;  3UI2 A;  3WG7 E;  2WQ7 A;  4HOQ A;  2J07 A;  2P9N G;  4CYM D;  3PH0 C;  3R9A B;  1KT1 A;  2QFC A;  1ELW A;  3CK7 A;  1OWP A;  4G25 A;  3ZYK A;  5EIB E;  4AVX A;  4Q69 A;  4L7T A;  4ZFH A;  4XKC A;  2AVP A;  5ENQ D;  4EBA A;  4HVB A;  3NB2 A;  5AQA A;  3PS6 A;  2L9B A;  3F6Q A;  3AS8 A;  1ZB1 A;  2UY1 B;  2P9U G;  4E85 A;  4WNG A;  1LTX A;  1IXV A;  4N3B A;  3AG1 E;  4DRX E;  2XEE A;  4GMJ A;  3CIA A;  3FU5 A;  3FTY A;  3BQO A;  3S7B A;  2VYI A;  1OWL A;  2WXQ A;  3FTW A;  3CHP A;  4AEZ C;  4DX7 D;  4BWR A;  3IBE A;  4C0M A;  4EPZ A;  4BER A;  4K5A B;  3CVN A;  2HR2 A;  5AN8 A;  3EIQ C;  3V2O A;  3NZS A;  4N3C A;  4C48 B;  5ENT D;  1OUV A;  3ABM E;  3HG0 D;  3ZXP A;  2R17 C;  4J8D A;  4U0S A;  4ANX A;  2DYS E;  2CG3 A;  2L6J A;  4L1B A;  5AYW D;  4YVO A;  5ARF A;  3ASD A;  4E6H A;  4GZ6 A;  3SD5 A;  5EKQ D;  4A3V A;  4OVU A;  5B1B E;  3D9J A;  1U3D A;  3PZ1 A;  1NFI E;  4RLY A;  5LFA A;  3Q79 A;  1OWM A;  1IQU A;  5CCM A;  2H6H A;  1X5B A;  3FY4 A;  1KZO A;  4DI4 A;  3EHR A;  3KD7 A;  2WMN A;  3AAA C;  4DK5 A;  1PAQ A;  2FI7 A;  4MLP A;  2RFM A;  2WB2 A;  3FU0 A;  3E37 A;  4NUR A;  3TXM A;  5AJD A;  3U66 A;  2NSZ A;  4GML A;  4HS2 A;  3UTM A;  4WAF A;  3EHQ A;  3RJV A;  1UJK A;  5EX0 A;  1OCO E;  4APF A;  4EHM A;  2DZN A;  3RRN B;  4H7Y A;  4HNA D;  4JEH A;  3AG2 E;  3QK0 A;  4JZY A;  3ASO E;  2OCC E;  5ENS D;  4H7X A;  4KBQ A;  3MV3 B;  4EQF A;  5EIL A;  2IQC A;  3ABL E;  5AEN A;  5BNW A;  1OXJ A;  1JCS A;  1U2V G;  3SNX A;  3Q9U C;  3ESL A;  1KPS B;  3PZ2 A;  3UM0 A;  4AOF A;  3CHS A;  2EIM E;  2JAB A;  3PZ3 A;  5BPP A;  3UXG A;  2AW6 A;  4G8L A;  4UQY A;  4GYW A;  1INZ A;  2A4Z A;  4GTV A;  1MQS A;  4HRM B;  1LF8 A;  3AU4 A;  4FJY A;  2XZT G;  4F1S A;  4N39 A;  1TNY A;  1DC2 A;  3ZNG A;  2KM4 A;  1B89 A;  4FLB A;  3KEZ A;  4DX2 A;  3D9N A;  1GW6 A;  1PY1 A;  4B93 B;  3G2S A;  2XHE A;  1IHG A;  5IY5 E;  4GTQ A;  4FP7 A;  3DEP A;  4AV7 A;  3CR3 A;  4U7E B;  2J9Q A;  2I9C A;  3UQ3 A;  4UWG A;  1EF1 C;  5CEA A;  2Q7F A;  2LXM A;  2H6G A;  1BLX B;  3ZYM A;  4UWK A;  4XZ4 A;  3CVX A;  3PVL A;  3AJI A;  4U96 D;  3ZUV B;  1OWN A;  4ANV A;  5BW8 C;  5B3S E;  2FEZ A;  3PNT B;  4AJW A;  1NI1 A;  3EU5 A;  1X81 A;  4HB5 A;  3D9L A;  4EZJ A;  3B95 A;  3SI5 A;  3MV2 B;  4ME2 A;  2GRQ B;  3LYA A;  4K5C A;  2VSO E;  3FUJ A;  4NIK A;  5EDS A;  1BI8 B;  2XS8 A;  5M72 A;  4G23 A;  3L13 A;  2V4H C;  1FT2 A;  2WXO A;  1H6K A;  1QNF A;  4WWO A;  3HXF A;  3HIZ A;  2VSN A;  2Y4T A;  2FUL A;  3ONK A;  4DX1 A;  4A1G A;  4JA7 A;  4I43 A;  4I9E A;  4N5C A;  1WY6 A;  5BUZ A;  1MX6 A;  3O48 A;  3DXK G;  2F8Y A;  2BKG A;  2IOL A;  3S7J A;  4LSZ E;  3ML8 A;  4EZL A;  1G3N B;  4LNU D;  4IYP A;  3RO2 A;  3CVY A;  2CHW A;  4Z68 A;  2I1K A;  4LEU A;  4YND A;  1D8E A;  3CKB A;  3RRM B;  4V3I A;  3FU3 A;  3RK6 A;  3ML9 A;  4L2L A;  5ENR D;  1HH8 A;  4FA6 A;  4B8C B;  3JXI A;  4CCA A;  3SFX A;  3QAR A;  3PZD A;  4JHR A;  4JXT A;  1N95 A;  2GRP B;  1Z3Y A;  3LKU A;  4BSZ B;  3OXL A;  1V55 E;  3GZ1 A;  3CHQ A;  4U95 D;  3LY9 A;  3VTX A;  1EYH A;  4N2S A;  3ESK A;  5ENN A;  3S2A A;  3GW4 A;  4XX5 A;  3RAU A;  4HBD A;  1N4Q A;  5ITZ F;  2ZU6 B;  2DVW A;  1Z3X A;  1JWF A;  3DSX A;  3NZU A;  2WPV A;  2QYU A;  3J5P A;  2WXJ A;  2M63 A;  2B6C A;  3MKQ A;  2QY7 A;  3UM3 A;  3FEY A;  4KZ0 A;  2F8X K;  4BY6 A;  3D9M A;  3C98 A;  3KSL A;  3UM1 A;  4M3O A;  1NA0 A;  3QKY A;  4AIF A;  3UIN C;  3Q75 A;  4ILI A;  2NYJ A;  2QZA A;  2ETA A;  3DSU A;  3JUE A;  4GZC A;  4GB9 A;  4EBA G;  2L0T B;  2GRO B;  3RU0 A;  3Q7F A;  3FU6 A;  3LDZ A;  4CT4 A;  3TJP A;  5BXU A;  2ZIR A;  3W9G A;  2RG8 A;  5ARG A;  2P9I G;  3HRA A;  4KT6 B;  1HZ4 A;  3MJW A;  5JJT A;  2EIN E;  2IF4 A;  4I9C A;  3MZL B;  5BV0 A;  4A1S A;  1NZN A;  4U0Z A;  5EN5 D;  3CQC B;  5D2M C;  3ZGQ A;  1Y8M A;  4G1T A;  4PUC A;  5JHB A;  2VGX A;  4BTB A;  3ULQ A;  1YCS B;  2V5Q C;  3FH7 A;  4IN3 B;  3CGH A;  3KSQ A;  4DX6 D;  1H19 A;  3D9K A;  5T3R A;  1UN9 A;  5FQ4 A;  1H0A A;  1SQM A;  5CMY A; 
#chains in the Genus database with same CATH homology
 1IKN D;  2MYO A;  3W9F A;  1NFI E;  5D66 A;  3J5P A;  4RLY A;  4CYM D;  2QC9 A;  4HRM B;  4U8Y D;  4ZHB A;  1WG0 A;  3TWU A;  4BET A;  4OAU C;  3KEA A;  2XZT G;  3T9K A;  3TWR A;  1DC2 A;  3ZNG A;  5CER B;  5FIN A;  5BXO A;  1MX6 A;  1BI7 B;  1WDY A;  1YYH A;  2F8Y A;  3EHR A;  4U8V D;  2BKG A;  4DX2 A;  1SVX A;  2F8X K;  1AP7 A;  1D9S A;  1MX4 A;  4LSZ E;  3TWX A;  1OY3 D;  4B93 B;  4O1O A;  4YDY A;  3AAA C;  2ETC A;  2A5E A;  2DZO A;  4GPM A;  4F6R D;  1G3N B;  3DEO A;  4J7W A;  5EIB E;  5CEC B;  1AWC B;  4QFV A;  3TWW A;  2RFM A;  5HKP A;  2AJA A;  1BD8 A;  5CED B;  4G8K A;  4BEP A;  3V30 A;  4ZFH A;  4JB8 P;  3DEP A;  2L6B A;  2BKK B;  3TWQ A;  2NYJ A;  4LNU D;  4YDW A;  2ETA A;  3NOG D;  5ENQ D;  4OAV B;  3JUE A;  1MJ0 A;  5HRY A;  3UTM A;  5EYP F;  3EHQ A;  5KNG A;  4HRL A;  5AQA A;  4CZ2 D;  4DX1 A;  1BU9 A;  2DZN A;  5CEA A;  3F6Q A;  5KBA A;  5BXU A;  3NBN B;  1BLX B;  1TR4 A;  2VGE A;  3W9G A;  4Z68 A;  4HNA D;  4F1P A;  1IXV A;  4DRX E;  1N0R A;  2XEE A;  2HE0 A;  5AAR A;  3TWS A;  2Y0B G;  1OT8 A;  5ENS D;  4HI9 A;  5FIO A;  3AJI A;  4U96 D;  3TWV A;  1SW6 A;  3HRA A;  4UUC A;  5AQB A;  1YMP A;  3C5R A;  1MYO A;  1IHB A;  3ZUV B;  5ENR D;  2Y1L E;  3T8K A;  4O1P A;  4BES A;  4DX7 D;  5EIL A;  4O60 A;  3JXI A;  5ENP D;  4GMR A;  5KWD A;  2ZGG A;  2F37 A;  4BER A;  4K5A B;  4LG6 A;  1N11 A;  5EID A;  4HB5 A;  5AN8 A;  2XEN A;  4HLL A;  3V2O A;  3V2X A;  3EU9 A;  3B95 A;  4BSZ B;  4C48 B;  3Q9U C;  5ENT D;  1DCQ A;  3J5Q B;  2J8S D;  5EN5 D;  3V31 A;  2B0O E;  3HG0 D;  5KNH D;  3D9H A;  5AQ7 A;  2KBX A;  4U95 D;  3JXJ A;  4QQI A;  5JA4 D;  1K1A A;  2P2C P;  2JAB A;  3SO8 A;  4HQD A;  1YCS B;  5AAO A;  4K5C A;  5ENO D;  4A63 B;  2V5Q C;  5CBO A;  5EYL A;  1UOH A;  5HS0 A;  2KXP C;  3IXE A;  4NIK A;  1BI8 B;  1A5E A;  2RFA A;  2DWZ A;  5AQ9 A;  4DUI A;  3UXG A;  3V79 K;  4DX5 D;  2V4H C;  4HBD A;  2XEH A;  1K1B A;  4J8Y A;  5ITZ F;  4HRN A;  1K3Z D;  2DVW A;  1MX2 A;  4G8L A;  2XZD G;  3TWT A;  3LJN A;  4DX6 D;  1S70 B;  4HI8 A;  4N5Q A;  2ETB A;  3Q9N C;  1QYM A;  4TUM A;  3B7B A;  5JMN D;  3ZKJ A;  4ATZ D;  3NOC D;  5CBN A;  2QYJ A;  2PNN A;  3UI2 A;  3ZU7 B;  4K5B A;  2ZGD A;  2FO1 E;  1N0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...