1MJ0A

Sank e3_5: an artificial ankyrin repeat protein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLAASNGHLEIVEVLLKNGADVNASDLTGITPLHLAAATGHLEIVEVLLKHGADVNAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed to be stable: Crystal structure of a consensus ankyrin repeat protein
pubmed doi rcsb
source organism Designed synthetic gene
molecule tags De novo protein
molecule keywords SANK E3_5 Protein
total genus 55
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2002-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1mj0A00
3HG0D 4K5AB 4HB5A 3T8KA 4O1PA 1BD8A 2XEHA 3V31A 1K1BA 2ETAA 1YCSB 5EYPF 2V4HC 1SW6A 3KEAA 5KNGA 3HRAA 1MYOA 2V5QC 4B93B 2L6BA 5CECB 3B95A 1BI8B 5ENRD 4ZFHA 4GPMA 5AQBA 5ENSD 1N0RA 5ENQD 5BXOA 4DRXE 1UOHA 1QYMA 4HBDA 4YDWA 3TWRA 5AN8A 1K1AA 2NYJA 1BI7B 2XEEA 3J5QB 3TWTA 1A5EA 3TWWA 5EN5D 1WDYA 4U96D 3D9HA 4LG6A 2Y1LE 2RFMA 2RFAA 2XZDG 5FINA 4HRLA 2XENA 4DX5D 1YMPA 3EHQA 4OAVB 3NOGD 3TWUA 2MYOA 3T9KA 5CERB 4HI8A 4HLLA 2F8XK 2DZNA 4U8VD 1N0QA 5ENPD 4HI9A 2PNNA 4F1PA 3ZNGA 4U8YD 1D9SA 3TWVA 5HS0A 2HE0A 5BXUA 4DX2A 2ZGDA 5D66A 1IHBA 2ETBA 5AARA 2ETCA 5ITZF 2QYJA 4J8YA 4DX6D 2P2CP 2F8YA 4JB8P 3W9FA 1DCQA 4QFVA 1NFIE 5KNHD 3UXGA 3EU9A 4G8KA 1K3ZD 4K5BA 4LSZE 3TWXA 5AQAA 4BEPA 4O60A 5EILA 3W9GA 4CYMD 3SO8A 4C48B 4RLYA 3AAAC 3NOCD 2A5EA 5KWDA 5EIBE 3V2XA 5CBNA 4F6RD 2DZOA 2QC9A 4TUMA 3TWQA 4BETA 5JA4D 1MX6A 4UUCA 4DX1A 3UTMA 3NBNB 5EYLA 2F37A 2KXPC 3AJIA 4LNUD 2XZTG 4QQIA 1MX4A 2KBXA 2BKKB 5AQ7A 4ZHBA 5FIOA 1OY3D 1MX2A 2J8SD 1DC2A 3J5PA 5CBOA 1BLXB 1AWCB 4A63B 5CEAA 2VGEA 4J7WA 3JXJA 1IKND 2ZGGA 3DEOA 2FO1E 1OT8A 3EHRA 2DVWA 4HRMB 4G8LA 5KBAA 3TWSA 1G3NB 2JABA 4HQDA 5JMND 2B0OE 4O1OA 1WG0A 3Q9UC 5ENTD 4BESA 3ZUVB 3JUEA 4DX7D 4HNAD 4K5CA 4U95D 3V2OA 3JXIA 4Z68A 3DEPA 5AQ9A 3Q9NC 3IXEA 3ZU7B 4CZ2D 1MJ0A 3F6QA 1BU9A 1S70B 3ZKJA 1SVXA 2BKGA 3UI2A 1AP7A 1YYHA 4DUIA 2AJAA 5HRYA 1N11A 4YDYA 2Y0BG 5ENOD 5HKPA 5EIDA 4NIKA 4ATZD 1IXVA 4BSZB 5CEDB 4OAUC 3LJNA 4GMRA 3V30A 5AAOA 4HRNA 3C5RA 4N5QA 3V79K 1TR4A 2DWZA 3B7BA 4BERA
chains in the Genus database with same CATH superfamily
1NA3A 4WAFA 4I1AA 1OXJA 5EYPF 1LD8A 3Q73A 4I17A 2UWJG 4K03A 2LAHA 3U4TA 3FUFA 3L22A 3O4ZA 1H6PA 3R9MA 3EHNA 4UQXA 4UI9K 5BV1A 4ILGA 4G23A 3UM1A 3FUIA 4RSYA 2XCCA 3S2AA 1P5QA 3BU8A 4Y6WA 5T8IA 2QYJA 3SQVA 3URZA 4F53A 3FFLA 4RLYA 3ULYA 5EIBE 3E37A 3L54A 4FLBA 1MX6A 3EHMA 3D3MA 5AYWD 3MX3A 4B8AA 3R7QA 1OY3D 2KZTB 1FPPA 2DYRE 4U0UA 2KC7A 3LCAA 1Y8MA 3CHRA 4XE0A 3JUEA 2PM7A 3T5XA 3AU4A 3EU5A 4GCNA 1E7VA 4A1GA 1QNFA 2GRRB 3UIOC 3ZU7B 4CZ2D 1HZ4A 3PDNA 1YYHA 3CK7A 3MKQA 2WPVA 4HRNA 3FU5A 2HM8A 4KT6B 3ZW3A 4HLEA 4I6JA 4E6HA 2NXPA 3HIZA 4FC8A 3ZYLA 3ZIMA 5EDSA 3MV3B 5LCWJ 2XEEA 1PC2A 2EINE 2XZDG 2H6IA 1Z5SC 3FULA 1EYHA 2DCPA 2VYIA 2HE0A 4NURA 3TGOA 1EF1C 3RO3A 4KVMA 1NFIE 4JA7A 4G8KA 1E7UA 3JQ1A 3L9TA 4K0RA 5J08A 4GZCA 3KAEA 3CHSA 1KT0A 3AU5A 5E75A 4HOTA 2LAIA 1MX4A 5T4YA 2FULA 1NZNA 1OCCE 1E8XA 1WM5A 2VJ8A 5CRUA 4HQDA 3LVQE 2I1JA 4J0UA 3UT4A 1RW2A 4LUNU 4B94A 5AQ9A 3LS8A 4HXIA 1S70B 2LXMA 3RKVA 1K8KG 4CDNA 2AJAA 4C9BB 4F1SA 5EIDA 4GZ5A 3JQ0A 4N3AA 2CG2A 4G11A 2WXLA 3SNXA 3UT7A 4HOQA 3VTYA 4ATGA 2ETAA 2J4BA 2EQXA 4Q94A 5AQBA 5LP0A 4V3IA 4C0MA 2XGMA 3DPDA 4UQZA 4MKTA 4YNDA 3FTZA 2XENA 3Q75A 4OVVA 1D8DA 4OAVB 3C3RA 4DLOA 4F1PA 2C0LA 5HS0A 4GA2A 2BTDA 2FF4A 2P9UG 2IF4A 1E96B 1X5BA 4BY6A 3MKRA 3BEEA 4J6IA 5FZSA 2VSNA 3ASDA 4FP7A 4N3BA 3ABKE 2WMOA 4UWKA 2PQRA 3X2QE 1AWCB 3Q7FA 3JXJA 4A3TA 1X81A 1LTXA 4PS3A 2CHWA 4TXPA 3Q9UC 2IOSA 1O1RA 3ZUVB 3PNLB 3TJPA 1IYGA 2EIME 3DEPA 1ELRA 3IBEA 2LXLA 3VLFA 1JWGA 1FT1A 3CQGB 3TXNA 2Q7FA 2XGOA 4WNGA 1HF8A 1KPSB 4JC8A 1S64A 4W9RA 3DSTA 1UJKA 1TYQG 2E2EA 2ILRA 2DYSE 3ZHEB 1H2TC 3E32A 1NA0A 4CDRA 3ASNE 2L6BA 1U2VG 3CVYA 3LDZA 3DSUA 4RVBA 3TL5A 1HO8A 4I2ZA 2X6JA 1BI7B 1A5EA 1OWLA 2I9CA 2ZIRA 2A4ZA 2WVIA 3D9LA 4ME2A 1H6KA 3CVQA 4CEMA 5D66A 3L08A 4J8YA 2VTBB 3FEYA 2F8YA 4JB8P 1DCQA 5LX8A 2X6KA 3EJNA 3P1UA 4BFRA 3GZSA 3T8MA 2QC9A 3L16A 1HH8A 4FU3A 1HS6A 5AQ7A 2IO2C 2R05A 4EZKA 3QJZA 4FADA 1FVHA 1OCOE 4BTAA 3QARA 3SBSA 1SA5A 2WXGA 3PZ4A 2EILE 4J8FA 2OOEA 3HVEB 4YDEA 4KBQA 4GA1A 3IHYA 2KCKA 2IONA 4GTTA 4EBAA 3Q9NC 1E8WA 1TNYA 3NB2A 3Q5MA 4ILIA 4MS6A 1VDYA 2IY0C 2L0TB 5B1BE 5ARGA 4EZLA 1SW6A 3HXFA 3ZXSA 2OVFA 4J8DA 1PAQA 3HRAA 2L6JA 3LYAA 2OEVA 2A5UA 3UM0A 4AXHA 4GPMA 1TNBA 2VSYA 5KJKA 3S7FA 4LNBA 1JCQA 3LY7A 3TG4A 4UWGA 4DPRA 2Y1LE 4HORA 3UUXA 4G1TA 4IN3B 2MYOA 4AY6A 4CRWA 1V55E 2IEJA 3TWVA 1IHBA 2WXIA 5FWQA 3TWXA 4CT4A 4IRUA 3MA5A 5IY5E 4I9EA 3NZSA 4F6RD 4GYYA 5EYLA 4JXTA 5FQ6A 2GRMA 2UY1A 4I6EA 5CBOA 1JCSA 3RK6A 4WNEA 1Z3YA 2LNIA 2H6HA 3ZRHA 2C0MA 3U3WA 2B0OE 3DSSA 3O48A 2EIKE 1H19A 4Y6CA 3S7JA 2R5SA 2X6IA 1HG5A 3V30A 2I2OA 2XPZA 4LNGA 3DSWA 3LY8A 3Q47B 2V4HC 3KEAA 2OCCE 1EDUA 4CT0A 1E90A 4GMJA 4L2YA 3UMVA 2NC9A 3GZ2A 3RAUA 1K1AA 5G55A 1WAO1 1KT1A 1LD7A 2RFMA 3FDHA 4RQIA 3FH8A 4UI9C 4FLHA 2KZTA 4GTQA 1ELKA 3ZYMA 4HFGA 1D8EA 3DBSA 2WQ6A 1N9AA 4WNDA 3QWPA 3TWQA 5JA4D 3NBNB 3G2VA 4OVUA 1S63A 5B1AE 2AXVA 1DC2A 4L9PA 3SGHA 4A63B 1KZPA 1HE8A 4HOUA 4JHKA 2R17C 1N4SA 4AV7A 3UINC 4PH4B 2HO1A 3APFA 2J9QA 2J4DA 1NI1A 2IOLA 3V2OA 4ABNA 5T3RA 3FP3A 3MEKA 3MYVA 2WXJA 2VSXE 3VLDA 4C0EA 2WXNA 4F3VA 4UWHA 4R7LA 5G05C 4FJZA 4G24A 4AEZC 2QY7A 3ENEA 1LF8A 3OTNA 5D0OD 2AW6A 3LPZA 4U04A 4N3CA 2CG3A 4XI0A 3WXXA 1IQRA 3K9IA 2CHZA 2PZIA 3PS6A 4YDWA 3U9WA 5JHAA 4CCAA 2NYJA 3PNTB 4N39A 3D9HA 3RO2A 4I9CA 5EKQD 3JYSA 4AM9A 4G2VA 3SY2A 4A1SA 4M7CA 2LUHA 5DBKA 4U8YD 3CEQA 3D9OA 4B0ZA 2YHCA 3C72A 3EIQC 3CHQA 4U63A 4K5BA 5H7PA 4BEPA 1UW4B 4Q69A 3HDXA 3BG0B 5KWDA 3CGHA 2C2LA 3FTSA 3ZXPA 4UUCA 2Y4TA 5A6CA 4QQIA 3SFXA 3OAWA 3J5PA 1SQMA 4ACKA 5AJLA 2P9IG 1H0AA 1NL4A 1OT8A 1TJFA 4G8LA 5D2MC 2X6HA 1Z3XA 4PS7A 1MHQA 3CIAA 4O6FA 3JXIA 3FH5A 3FH7A 4J8EA 4TUUA 3ABME 2XHEA 3L82A 3GZ1A 3AS5A 4BX9A 4GA0A 4YDYA 3PEVB 3LJNA 2V8SE 1FVFA 4N2SA 4CDMA 2DWZA 4K5AB 4HB5A 4DLQA 2GRNB 4LRZA 2IFUA 3E33A 5ANRA 2KCVA 1SA4A 1IQUA 3APDA 3E4BA 4GYOA 2HYZA 2RKKA 5G2NA 5BW8C 3HXEA 2XPIA 4JVSA 3TWRA 3FUNA 1WDYA 4U96D 1JCRA 1GW6A 4EHMA 3NOGD 3RU0A 3CLJA 3CVNA 2L9BA 5ENPD 3MKQB 3FUKA 2QFCA 2KCLA 2V5FA 2I6HA 3LJ3A 2ETCA 3Q7AA 2DIWA 4P29A 4GTOA 2MRIA 3EU9A 4JHJA 3RIBA 4YVOA 3DSXA 1QZ2A 1FCHA 1KZOA 2KATA 1Q2ZA 3FTVA 3MJWA 2XEVA 2XCBA 1TNUA 4FULA 3PZ1A 4XI9A 4BETA 3AJIA 4FHKA 2XS8A 4ZHBA 3OXFA 2GROB 3C3QA 4AIFA 4FJYA 2GGFA 4BT9A 3NF1A 4K5CA 3UQ3A 1OUVA 1O5MA 1UG3A 3AG1E 3SFYA 2NSZA 2CFZA 3BG1B 4ATZD 4ANWA 1IXVA 3CVLA 4AVXA 1N54A 3GYZA 3V79K 4E85A 4GU5A 2P9KG 3FUMA 3DRAA 3PRZA 1SZAA 5BPPA 4GTMA 2XGSA 1OCZE 3E30A 3ASOE 3TWTA 4KXKB 4HVBA 4BWRA 5FQ7A 1KLXA 3FTWA 2BUGA 5FJYA 1D9SA 4J8SA 4FA6A 4O60A 2CFUA 1JPLA 1TN6A 4I1OB 1BPOA 3AAAC 3IV0A 3ASFA 4GPKA 2F37A 2X3MA 3FUDA 1A17A 2JLBA 2VGEA 3MZLB 4HRMB 4NQ0A 3AG3E 3HVEA 4O1OA 2YINA 4HNAD 3HYMB 3ULQA 4L2LA 3JUIA 4Q96A 3ML8A 2XRYA 2P9PG 1O1TA 4Z68A 3U66A 4AP2A 1BU9A 3ZKJA 1SVXA 2BKGA 3S7DA 3D9NA 5ENOD 2XS1A 4KVOA 1MZCA 4HS2A 3FUHA 3QAQA 4I43A 4L7TA 4MBGA 4JW1A 1YCSB 2V5QC 1UN9A 5CECB 1BI8B 4JEUA 4XKCA 4RG6A 4ANXA 4EBAG 4U0SA 3ESLA 3TWWA 4LG6A 3TAXA 4PS8A 3SBTB 3C98A 4LCTA 3R7RA 1OWPA 3I5PA 3CK9A 5M72A 4PUCA 4DX6D 2ZXWE 3SD5A 3FTXA 3ZYKA 4UWLA 2VSOE 2WM9A 3VTXA 3SO8A 2AXZA 3UKRG 3DWLG 3QC1A 2A5EA 1W3BA 3G2WA 2VGYA 2J8SD 3I3NA 3CQCB 4LERA 2VQ2A 1N95A 4KMOA 4CGWA 4BESA 4AJWA 5ENNA 4UQYA 3R9AB 2FBNA 1XNFA 3S7BA 3I4RB 3Q15A 2V0PA 3UX4A 3AG4E 4UWFA 4F7AA 3ZYQA 4B8CB 2H6GA 5KJNA 3Q49B 1ZBPA 3PEUB 4KZCA 2PL2A 5HRYA 5HKPA 3C5RA 3T8KA 5C2YA 1XGWA 4G26A 1TNZA 2P9NG 5FQ4A 4GAAA 1N0RA 4EECA 1QYMA 2IQCA 3FU3A 4NACA 5AN8A 5EN5D 5AIJA 5ARFA 2HR2A 4DI3A 3FEXA 3HXBA 3L17A 2OEWA 3IEGA 5C1DA 4BTBA 5CCLA 5FQ8A 5ITZF 2J09A 3W9FA 3ULEG 1Y6IA 5FT9A 4XKBA 3AG2E 2R2LA 2WXFA 1UN8A 3ZEFA 3FTYA 3ABLE 4DX1A 5CMWA 5FZQA 1S0PA 3CHOA 2WXOA 4GTSA 4YDOA 1O1SA 5AENA 2AXUA 3DEOA 2DBAA 2YNQA 3TWSA 3T5VA 1G3NB 3ZPJA 5HI7A 3OXGA 3VLEA 3ZGQA 3GW4A 3UM3A 4CGVA 5ENTD 4IULA 3QWVA 2YHEA 4HOSA 3PUKA 4GTPA 5G04J 3TXMA 4BSXA 3PH0C 1L5JA 2FO7A 2L0IA 5AAOA 5LOZA 3ONLA 4BERA 3CVUA 1INZA 1EPUA 4H7YA 4X8QA 3NZUA 5EX3A 4B93B 4JEHA 4JZYA 2QYUA 3RRMB 3CKCA 4HBDA 4APOA 4U0ZA 1OWNA 4G25A 3EUVA 5FINA 4HRLA 4DX5D 3EHQA 1OCRE 5A7DB 3FY4A 4U8VD 1U3DA 4HI9A 1HXIA 2ETBA 3RSEG 5JHBA 4BX8A 4QFVA 5KNHD 5AQAA 3CSFA 3W9GA 2LSVA 5G04C 2RD0A 3V2XA 5BNWA 5CMYA 4H7XA 4TUMA 2JEKA 3RRNB 2ONDA 3ZHEA 4GB9A 4LEUA 5FIOA 1BLXB 1OWMA 2FO1E 3KEZA 5FZRA 3D9MA 2JABA 3SZ7A 4XIFA 5LCWC 3CSTA 2H6FA 5BV0A 2OV8A 2VGXA 4U95D 4TXQA 2GRPB 1MQSA 3QNKA 1MJ0A 4DK5A 3QB2A 1HG2A 3SHFA 3FTUA 3PVLA 3LXUX 3FU6A 2RG8A 3NQPA 2R59A 1TNOA 3IHVA 2PQNA 5BXOA 3CR3A 3ONKA 4URKA 2IJGX 3NAWA 3OXLA 3KD7A 3UT8A 3J5QB 1ELWA 2WXHA 4B89A 2PNNA 4TRQA 3ZNGA 3APCA 3PE4A 3B7SA 3DSVA 4D10C 1B89A 1K3ZD 4JPSA 4A55A 2R03A 2FI7A 2VGXB 1FT2A 2CHXA 4XZ4A 4GMLA 2P9SG 3G2TA 3CK8A 4OYSA 3RJVA 2KBXA 2BKKB 4IYPA 1MX2A 3FWVA 1H6OA 5ANLA 3UM2A 5CEAA 5JJTA 2E0IA 1IKND 5KBAA 3B7UX 4GZ6A 5JMND 1WG0A 3SFZA 4AY5A 3I4GA 3G2UA 1PY1A 4L1BA 1N94A 4KYOB 3B7RL 3L13A 5E76A 4EZJA 5CCMA 3N71A 5CEDB 1OWOA 3D9KA 4NIKA 4DI4A 3KSQA 5B3SE 2KM4A 3SF4A 1TR4A 4GCOA 5AARA 3HG0D 3B7TA 3CHPA 4RG9A 4L23A 1BD8A 1K1BA 1RZ4A 3QOUA 5KNGA 3Q78A 3IKOB 4ZFHA 5HQ8A 3AS8A 4EPZA 3KS2A 4PDXA 4YVQC 3DXMG 1TJCA 2P9LG 2XPYA 2RFAA 3C3OA 1V54E 1SZ9A 1H2VC 2QZAA 3ISMC 3TWUA 2F8XK 5CERB 2DZNA 3LKUA 2GW1A 1IHGA 4MLPA 3P2BA 2Y69E 2MOWA 2ZGDA 4GZ3A 3D9PA 1QQEA 1HX8A 3UXGA 4LSZE 4DJAA 4GZDA 3PREA 4CYMD 2ZISA 1JWFA 3UIPC 3D9IA 3WG7E 3ZFWA 3CHMA 1ZB1A 4FHJA 4U8HA 4GTVA 3E34A 2KXPC 2XZTG 4A3VA 1Z6TA 3LEWA 2ZU6B 3ASGA 4WUYA 3FUEA 2F0YA 1N4PA 3U64A 1N4RA 3TG5A 2XRZA 3CVVA 4JL0A 5A23A 2X38A 1UJJA 3CVWA 3ZVVA 4TV3A 3IXEA 3ZN3A 3EDTB 3HXDA 5J90A 1E8YA 4JA9A 4ACLA 3QKYA 5D0QD 3BUAA 4OAUC 4U7EB 3PZDA 4MRUA 2IO3C 3HHMA 4O1PA 5BT1A 2J07A 2XEHA 4N5CA 1JUQA 2WB2A 3ASHA 1MYOA 2WQ7A 3B95A 2P58C 4AOFA 5ENSD 1UOHA 3EIJA 4WWOA 1TN7A 2V4LA 2WXMA 3FU0A 1YMPA 4HLLA 2FEZA 2Y3AA 5DIZA 3HXCA 5JJ6A 3MCXA 2YQ8A 5BXUA 4DX2A 2P2CP 4JD2G 4M3OA 3UKUG 5EILA 2OVBA 4WWNA 4ANUA 1DNPA 3B13A 2J49A 3JCKC 4ANVA 5CBNA 2DZOA 3PUJA 2B6CA 3UTMA 4WWPA 4XEIG 4LNUD 3BQOA 3PE3A 3DPYA 1N52A 2BEDA 4J7WA 3RRUA 4I1MA 2ZGGA 3EHRA 2DVWA 3MV2B 3FHEA 5KCMA 3AS4A 4TXRA 1H2UA 3ML9A 3QWWA 2WMNA 4DX7D 2WQHA 1DVPA 5AJDA 2X6FA 3PZ2A 3ESKA 4U07A 3SI5A 4BT8A 1AP7A 3UI2A 2XQ0A 3CKBA 3G2SA 4DUIA 5FTPA 2Y0BG 3DXKG 1YA0A 4BSZB 4EQFA 5LFAA 4N2QA 4GMRA 4N5QA 1TEZA 2GRQB 2R02A 5JJ7A 2AVPA 3D9JA 2UY1B 3V31A 3KSLA 4UI9J 2WXPA 5ENRD 3LY9A 5ENQD 5CRVA 4DRXE 4I6GA 2EIJE 2MHKA 4KZ0A 3QK0A 2GRLA 4JHRA 2J08A 3T9KA 4HI8A 1N0QA 4GTRA 2I1KA 3L6AA 5CHEE 1ZU2A 3Q79A 3QDNA 3UPVA 3FUJA 1HU3A 5BUZA 1TN8A 2WXQA 1QBQA 4C48B 1DCEA 4GYWA 3PZ3A 1U3CA 3NOCD 1E8ZA 1HFAA 3MGBA 3CVXA 4ILHB 3Q4AB 1WY6A 2IU1A 3CV0A 2M63A 2BF0X 4I2WA 4XX5A 4WNFA 3LVRE 2AWIA 3F6QA 2WXRA 4APFA 4NRHB 2LSUA 5G05J 1NP7A 2VTBA 3CVPA 1N4QA 5KJLA 1N11A 2Y4UA 5EX0A 5KJMA 2WXKA 2PM6A 2LO6A 3B7BA
chains in the Genus database with same CATH topology
3HG0D 4K5AB 4HB5A 3T8KA 4O1PA 1BD8A 2XEHA 3V31A 1K1BA 2ETAA 1YCSB 5EYPF 2V4HC 1SW6A 3KEAA 5KNGA 3HRAA 1MYOA 2V5QC 4B93B 2L6BA 5CECB 3B95A 1BI8B 5ENRD 4ZFHA 4GPMA 5AQBA 5ENSD 1N0RA 5ENQD 5BXOA 4DRXE 1UOHA 1QYMA 4HBDA 4YDWA 3TWRA 5AN8A 1K1AA 2NYJA 1BI7B 2XEEA 3J5QB 3TWTA 1A5EA 3TWWA 5EN5D 1WDYA 4U96D 3D9HA 4LG6A 2Y1LE 2RFMA 2RFAA 2XZDG 5FINA 4HRLA 2XENA 4DX5D 1YMPA 3EHQA 4OAVB 3NOGD 3TWUA 2MYOA 3T9KA 5CERB 4HI8A 4HLLA 2F8XK 2DZNA 4U8VD 1N0QA 5ENPD 4HI9A 2PNNA 4F1PA 3ZNGA 4U8YD 1D9SA 3TWVA 5HS0A 2HE0A 5BXUA 4DX2A 2ZGDA 5D66A 1IHBA 2ETBA 5AARA 2ETCA 5ITZF 2QYJA 4J8YA 4DX6D 2P2CP 2F8YA 4JB8P 3W9FA 1DCQA 4QFVA 1NFIE 5KNHD 3UXGA 3EU9A 4G8KA 1K3ZD 4K5BA 4LSZE 3TWXA 5AQAA 4BEPA 4O60A 5EILA 3W9GA 4CYMD 3SO8A 4C48B 4RLYA 3AAAC 3NOCD 2A5EA 5KWDA 5EIBE 3V2XA 5CBNA 4F6RD 2DZOA 2QC9A 4TUMA 3TWQA 4BETA 5JA4D 1MX6A 4UUCA 4DX1A 3UTMA 3NBNB 5EYLA 2F37A 2KXPC 3AJIA 4LNUD 2XZTG 4QQIA 1MX4A 2KBXA 2BKKB 5AQ7A 4ZHBA 5FIOA 1OY3D 1MX2A 2J8SD 1DC2A 3J5PA 5CBOA 1BLXB 1AWCB 4A63B 5CEAA 2VGEA 4J7WA 3JXJA 1IKND 2ZGGA 3DEOA 2FO1E 1OT8A 3EHRA 2DVWA 4HRMB 4G8LA 5KBAA 3TWSA 1G3NB 2JABA 4HQDA 5JMND 2B0OE 4O1OA 1WG0A 3Q9UC 5ENTD 4BESA 3ZUVB 3JUEA 4DX7D 4HNAD 4K5CA 4U95D 3V2OA 3JXIA 4Z68A 3DEPA 5AQ9A 3Q9NC 3IXEA 3ZU7B 4CZ2D 1MJ0A 3F6QA 1BU9A 1S70B 3ZKJA 1SVXA 2BKGA 3UI2A 1AP7A 1YYHA 4DUIA 2AJAA 5HRYA 1N11A 4YDYA 2Y0BG 5ENOD 5HKPA 5EIDA 4NIKA 4ATZD 1IXVA 4BSZB 5CEDB 4OAUC 3LJNA 4GMRA 3V30A 5AAOA 4HRNA 3C5RA 4N5QA 3V79K 1TR4A 2DWZA 3B7BA 4BERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HG0 D;  4K5A B;  4HB5 A;  3T8K A;  4O1P A;  1BD8 A;  2XEH A;  3V31 A;  1K1B A;  2ETA A;  1YCS B;  5EYP F;  2V4H C;  1SW6 A;  3KEA A;  5KNG A;  3HRA A;  1MYO A;  2V5Q C;  4B93 B;  2L6B A;  5CEC B;  3B95 A;  1BI8 B;  5ENR D;  4ZFH A;  4GPM A;  5AQB A;  5ENS D;  1N0R A;  5ENQ D;  5BXO A;  4DRX E;  1UOH A;  1QYM A;  4HBD A;  4YDW A;  3TWR A;  5AN8 A;  1K1A A;  2NYJ A;  1BI7 B;  2XEE A;  3J5Q B;  3TWT A;  1A5E A;  3TWW A;  5EN5 D;  1WDY A;  4U96 D;  3D9H A;  4LG6 A;  2Y1L E;  2RFM A;  2RFA A;  2XZD G;  5FIN A;  4HRL A;  2XEN A;  4DX5 D;  1YMP A;  3EHQ A;  4OAV B;  3NOG D;  3TWU A;  2MYO A;  3T9K A;  5CER B;  4HI8 A;  4HLL A;  2F8X K;  2DZN A;  4U8V D;  1N0Q A;  5ENP D;  4HI9 A;  2PNN A;  4F1P A;  3ZNG A;  4U8Y D;  1D9S A;  3TWV A;  5HS0 A;  2HE0 A;  5BXU A;  4DX2 A;  2ZGD A;  5D66 A;  1IHB A;  2ETB A;  5AAR A;  2ETC A;  5ITZ F;  2QYJ A;  4J8Y A;  4DX6 D;  2P2C P;  2F8Y A;  4JB8 P;  3W9F A;  1DCQ A;  4QFV A;  1NFI E;  5KNH D;  3UXG A;  3EU9 A;  4G8K A;  1K3Z D;  4K5B A;  4LSZ E;  3TWX A;  5AQA A;  4BEP A;  4O60 A;  5EIL A;  3W9G A;  4CYM D;  3SO8 A;  4C48 B;  4RLY A;  3AAA C;  3NOC D;  2A5E A;  5KWD A;  5EIB E;  3V2X A;  5CBN A;  4F6R D;  2DZO A;  2QC9 A;  4TUM A;  3TWQ A;  4BET A;  5JA4 D;  1MX6 A;  4UUC A;  4DX1 A;  3UTM A;  3NBN B;  5EYL A;  2F37 A;  2KXP C;  3AJI A;  4LNU D;  2XZT G;  4QQI A;  1MX4 A;  2KBX A;  2BKK B;  5AQ7 A;  4ZHB A;  5FIO A;  1OY3 D;  1MX2 A;  2J8S D;  1DC2 A;  3J5P A;  5CBO A;  1BLX B;  1AWC B;  4A63 B;  5CEA A;  2VGE A;  4J7W A;  3JXJ A;  1IKN D;  2ZGG A;  3DEO A;  2FO1 E;  1OT8 A;  3EHR A;  2DVW A;  4HRM B;  4G8L A;  5KBA A;  3TWS A;  1G3N B;  2JAB A;  4HQD A;  5JMN D;  2B0O E;  4O1O A;  1WG0 A;  3Q9U C;  5ENT D;  4BES A;  3ZUV B;  3JUE A;  4DX7 D;  4HNA D;  4K5C A;  4U95 D;  3V2O A;  3JXI A;  4Z68 A;  3DEP A;  5AQ9 A;  3Q9N C;  3IXE A;  3ZU7 B;  4CZ2 D;  1MJ0 A;  3F6Q A;  1BU9 A;  1S70 B;  3ZKJ A;  1SVX A;  2BKG A;  3UI2 A;  1AP7 A;  1YYH A;  4DUI A;  2AJA A;  5HRY A;  1N11 A;  4YDY A;  2Y0B G;  5ENO D;  5HKP A;  5EID A;  4NIK A;  4ATZ D;  1IXV A;  4BSZ B;  5CED B;  4OAU C;  3LJN A;  4GMR A;  3V30 A;  5AAO A;  4HRN A;  3C5R A;  4N5Q A;  3V79 K;  1TR4 A;  2DWZ A;  3B7B A;  4BER A; 
#chains in the Genus database with same CATH topology
 1NA3 A;  4WAF A;  4I1A A;  1OXJ A;  5EYP F;  1LD8 A;  3Q73 A;  4I17 A;  2UWJ G;  4K03 A;  2LAH A;  3U4T A;  3FUF A;  3L22 A;  3O4Z A;  1H6P A;  3R9M A;  3EHN A;  4UQX A;  4UI9 K;  5BV1 A;  4ILG A;  4G23 A;  3UM1 A;  3FUI A;  4RSY A;  2XCC A;  3S2A A;  1P5Q A;  3BU8 A;  4Y6W A;  5T8I A;  2QYJ A;  3SQV A;  3URZ A;  4F53 A;  3FFL A;  4RLY A;  3ULY A;  5EIB E;  3E37 A;  3L54 A;  4FLB A;  1MX6 A;  3EHM A;  3D3M A;  5AYW D;  3MX3 A;  4B8A A;  3R7Q A;  1OY3 D;  2KZT B;  1FPP A;  2DYR E;  4U0U A;  2KC7 A;  3LCA A;  1Y8M A;  3CHR A;  4XE0 A;  3JUE A;  2PM7 A;  3T5X A;  3AU4 A;  3EU5 A;  4GCN A;  1E7V A;  4A1G A;  1QNF A;  2GRR B;  3UIO C;  3ZU7 B;  4CZ2 D;  1HZ4 A;  3PDN A;  1YYH A;  3CK7 A;  3MKQ A;  2WPV A;  4HRN A;  3FU5 A;  2HM8 A;  4KT6 B;  3ZW3 A;  4HLE A;  4I6J A;  4E6H A;  2NXP A;  3HIZ A;  4FC8 A;  3ZYL A;  3ZIM A;  5EDS A;  3MV3 B;  5LCW J;  2XEE A;  1PC2 A;  2EIN E;  2XZD G;  2H6I A;  1Z5S C;  3FUL A;  1EYH A;  2DCP A;  2VYI A;  2HE0 A;  4NUR A;  3TGO A;  1EF1 C;  3RO3 A;  4KVM A;  1NFI E;  4JA7 A;  4G8K A;  1E7U A;  3JQ1 A;  3L9T A;  4K0R A;  5J08 A;  4GZC A;  3KAE A;  3CHS A;  1KT0 A;  3AU5 A;  5E75 A;  4HOT A;  2LAI A;  1MX4 A;  5T4Y A;  2FUL A;  1NZN A;  1OCC E;  1E8X A;  1WM5 A;  2VJ8 A;  5CRU A;  4HQD A;  3LVQ E;  2I1J A;  4J0U A;  3UT4 A;  1RW2 A;  4LUN U;  4B94 A;  5AQ9 A;  3LS8 A;  4HXI A;  1S70 B;  2LXM A;  3RKV A;  1K8K G;  4CDN A;  2AJA A;  4C9B B;  4F1S A;  5EID A;  4GZ5 A;  3JQ0 A;  4N3A A;  2CG2 A;  4G11 A;  2WXL A;  3SNX A;  3UT7 A;  4HOQ A;  3VTY A;  4ATG A;  2ETA A;  2J4B A;  2EQX A;  4Q94 A;  5AQB A;  5LP0 A;  4V3I A;  4C0M A;  2XGM A;  3DPD A;  4UQZ A;  4MKT A;  4YND A;  3FTZ A;  2XEN A;  3Q75 A;  4OVV A;  1D8D A;  4OAV B;  3C3R A;  4DLO A;  4F1P A;  2C0L A;  5HS0 A;  4GA2 A;  2BTD A;  2FF4 A;  2P9U G;  2IF4 A;  1E96 B;  1X5B A;  4BY6 A;  3MKR A;  3BEE A;  4J6I A;  5FZS A;  2VSN A;  3ASD A;  4FP7 A;  4N3B A;  3ABK E;  2WMO A;  4UWK A;  2PQR A;  3X2Q E;  1AWC B;  3Q7F A;  3JXJ A;  4A3T A;  1X81 A;  1LTX A;  4PS3 A;  2CHW A;  4TXP A;  3Q9U C;  2IOS A;  1O1R A;  3ZUV B;  3PNL B;  3TJP A;  1IYG A;  2EIM E;  3DEP A;  1ELR A;  3IBE A;  2LXL A;  3VLF A;  1JWG A;  1FT1 A;  3CQG B;  3TXN A;  2Q7F A;  2XGO A;  4WNG A;  1HF8 A;  1KPS B;  4JC8 A;  1S64 A;  4W9R A;  3DST A;  1UJK A;  1TYQ G;  2E2E A;  2ILR A;  2DYS E;  3ZHE B;  1H2T C;  3E32 A;  1NA0 A;  4CDR A;  3ASN E;  2L6B A;  1U2V G;  3CVY A;  3LDZ A;  3DSU A;  4RVB A;  3TL5 A;  1HO8 A;  4I2Z A;  2X6J A;  1BI7 B;  1A5E A;  1OWL A;  2I9C A;  2ZIR A;  2A4Z A;  2WVI A;  3D9L A;  4ME2 A;  1H6K A;  3CVQ A;  4CEM A;  5D66 A;  3L08 A;  4J8Y A;  2VTB B;  3FEY A;  2F8Y A;  4JB8 P;  1DCQ A;  5LX8 A;  2X6K A;  3EJN A;  3P1U A;  4BFR A;  3GZS A;  3T8M A;  2QC9 A;  3L16 A;  1HH8 A;  4FU3 A;  1HS6 A;  5AQ7 A;  2IO2 C;  2R05 A;  4EZK A;  3QJZ A;  4FAD A;  1FVH A;  1OCO E;  4BTA A;  3QAR A;  3SBS A;  1SA5 A;  2WXG A;  3PZ4 A;  2EIL E;  4J8F A;  2OOE A;  3HVE B;  4YDE A;  4KBQ A;  4GA1 A;  3IHY A;  2KCK A;  2ION A;  4GTT A;  4EBA A;  3Q9N C;  1E8W A;  1TNY A;  3NB2 A;  3Q5M A;  4ILI A;  4MS6 A;  1VDY A;  2IY0 C;  2L0T B;  5B1B E;  5ARG A;  4EZL A;  1SW6 A;  3HXF A;  3ZXS A;  2OVF A;  4J8D A;  1PAQ A;  3HRA A;  2L6J A;  3LYA A;  2OEV A;  2A5U A;  3UM0 A;  4AXH A;  4GPM A;  1TNB A;  2VSY A;  5KJK A;  3S7F A;  4LNB A;  1JCQ A;  3LY7 A;  3TG4 A;  4UWG A;  4DPR A;  2Y1L E;  4HOR A;  3UUX A;  4G1T A;  4IN3 B;  2MYO A;  4AY6 A;  4CRW A;  1V55 E;  2IEJ A;  3TWV A;  1IHB A;  2WXI A;  5FWQ A;  3TWX A;  4CT4 A;  4IRU A;  3MA5 A;  5IY5 E;  4I9E A;  3NZS A;  4F6R D;  4GYY A;  5EYL A;  4JXT A;  5FQ6 A;  2GRM A;  2UY1 A;  4I6E A;  5CBO A;  1JCS A;  3RK6 A;  4WNE A;  1Z3Y A;  2LNI A;  2H6H A;  3ZRH A;  2C0M A;  3U3W A;  2B0O E;  3DSS A;  3O48 A;  2EIK E;  1H19 A;  4Y6C A;  3S7J A;  2R5S A;  2X6I A;  1HG5 A;  3V30 A;  2I2O A;  2XPZ A;  4LNG A;  3DSW A;  3LY8 A;  3Q47 B;  2V4H C;  3KEA A;  2OCC E;  1EDU A;  4CT0 A;  1E90 A;  4GMJ A;  4L2Y A;  3UMV A;  2NC9 A;  3GZ2 A;  3RAU A;  1K1A A;  5G55 A;  1WAO 1;  1KT1 A;  1LD7 A;  2RFM A;  3FDH A;  4RQI A;  3FH8 A;  4UI9 C;  4FLH A;  2KZT A;  4GTQ A;  1ELK A;  3ZYM A;  4HFG A;  1D8E A;  3DBS A;  2WQ6 A;  1N9A A;  4WND A;  3QWP A;  3TWQ A;  5JA4 D;  3NBN B;  3G2V A;  4OVU A;  1S63 A;  5B1A E;  2AXV A;  1DC2 A;  4L9P A;  3SGH A;  4A63 B;  1KZP A;  1HE8 A;  4HOU A;  4JHK A;  2R17 C;  1N4S A;  4AV7 A;  3UIN C;  4PH4 B;  2HO1 A;  3APF A;  2J9Q A;  2J4D A;  1NI1 A;  2IOL A;  3V2O A;  4ABN A;  5T3R A;  3FP3 A;  3MEK A;  3MYV A;  2WXJ A;  2VSX E;  3VLD A;  4C0E A;  2WXN A;  4F3V A;  4UWH A;  4R7L A;  5G05 C;  4FJZ A;  4G24 A;  4AEZ C;  2QY7 A;  3ENE A;  1LF8 A;  3OTN A;  5D0O D;  2AW6 A;  3LPZ A;  4U04 A;  4N3C A;  2CG3 A;  4XI0 A;  3WXX A;  1IQR A;  3K9I A;  2CHZ A;  2PZI A;  3PS6 A;  4YDW A;  3U9W A;  5JHA A;  4CCA A;  2NYJ A;  3PNT B;  4N39 A;  3D9H A;  3RO2 A;  4I9C A;  5EKQ D;  3JYS A;  4AM9 A;  4G2V A;  3SY2 A;  4A1S A;  4M7C A;  2LUH A;  5DBK A;  4U8Y D;  3CEQ A;  3D9O A;  4B0Z A;  2YHC A;  3C72 A;  3EIQ C;  3CHQ A;  4U63 A;  4K5B A;  5H7P A;  4BEP A;  1UW4 B;  4Q69 A;  3HDX A;  3BG0 B;  5KWD A;  3CGH A;  2C2L A;  3FTS A;  3ZXP A;  4UUC A;  2Y4T A;  5A6C A;  4QQI A;  3SFX A;  3OAW A;  3J5P A;  1SQM A;  4ACK A;  5AJL A;  2P9I G;  1H0A A;  1NL4 A;  1OT8 A;  1TJF A;  4G8L A;  5D2M C;  2X6H A;  1Z3X A;  4PS7 A;  1MHQ A;  3CIA A;  4O6F A;  3JXI A;  3FH5 A;  3FH7 A;  4J8E A;  4TUU A;  3ABM E;  2XHE A;  3L82 A;  3GZ1 A;  3AS5 A;  4BX9 A;  4GA0 A;  4YDY A;  3PEV B;  3LJN A;  2V8S E;  1FVF A;  4N2S A;  4CDM A;  2DWZ A;  4K5A B;  4HB5 A;  4DLQ A;  2GRN B;  4LRZ A;  2IFU A;  3E33 A;  5ANR A;  2KCV A;  1SA4 A;  1IQU A;  3APD A;  3E4B A;  4GYO A;  2HYZ A;  2RKK A;  5G2N A;  5BW8 C;  3HXE A;  2XPI A;  4JVS A;  3TWR A;  3FUN A;  1WDY A;  4U96 D;  1JCR A;  1GW6 A;  4EHM A;  3NOG D;  3RU0 A;  3CLJ A;  3CVN A;  2L9B A;  5ENP D;  3MKQ B;  3FUK A;  2QFC A;  2KCL A;  2V5F A;  2I6H A;  3LJ3 A;  2ETC A;  3Q7A A;  2DIW A;  4P29 A;  4GTO A;  2MRI A;  3EU9 A;  4JHJ A;  3RIB A;  4YVO A;  3DSX A;  1QZ2 A;  1FCH A;  1KZO A;  2KAT A;  1Q2Z A;  3FTV A;  3MJW A;  2XEV A;  2XCB A;  1TNU A;  4FUL A;  3PZ1 A;  4XI9 A;  4BET A;  3AJI A;  4FHK A;  2XS8 A;  4ZHB A;  3OXF A;  2GRO B;  3C3Q A;  4AIF A;  4FJY A;  2GGF A;  4BT9 A;  3NF1 A;  4K5C A;  3UQ3 A;  1OUV A;  1O5M A;  1UG3 A;  3AG1 E;  3SFY A;  2NSZ A;  2CFZ A;  3BG1 B;  4ATZ D;  4ANW A;  1IXV A;  3CVL A;  4AVX A;  1N54 A;  3GYZ A;  3V79 K;  4E85 A;  4GU5 A;  2P9K G;  3FUM A;  3DRA A;  3PRZ A;  1SZA A;  5BPP A;  4GTM A;  2XGS A;  1OCZ E;  3E30 A;  3ASO E;  3TWT A;  4KXK B;  4HVB A;  4BWR A;  5FQ7 A;  1KLX A;  3FTW A;  2BUG A;  5FJY A;  1D9S A;  4J8S A;  4FA6 A;  4O60 A;  2CFU A;  1JPL A;  1TN6 A;  4I1O B;  1BPO A;  3AAA C;  3IV0 A;  3ASF A;  4GPK A;  2F37 A;  2X3M A;  3FUD A;  1A17 A;  2JLB A;  2VGE A;  3MZL B;  4HRM B;  4NQ0 A;  3AG3 E;  3HVE A;  4O1O A;  2YIN A;  4HNA D;  3HYM B;  3ULQ A;  4L2L A;  3JUI A;  4Q96 A;  3ML8 A;  2XRY A;  2P9P G;  1O1T A;  4Z68 A;  3U66 A;  4AP2 A;  1BU9 A;  3ZKJ A;  1SVX A;  2BKG A;  3S7D A;  3D9N A;  5ENO D;  2XS1 A;  4KVO A;  1MZC A;  4HS2 A;  3FUH A;  3QAQ A;  4I43 A;  4L7T A;  4MBG A;  4JW1 A;  1YCS B;  2V5Q C;  1UN9 A;  5CEC B;  1BI8 B;  4JEU A;  4XKC A;  4RG6 A;  4ANX A;  4EBA G;  4U0S A;  3ESL A;  3TWW A;  4LG6 A;  3TAX A;  4PS8 A;  3SBT B;  3C98 A;  4LCT A;  3R7R A;  1OWP A;  3I5P A;  3CK9 A;  5M72 A;  4PUC A;  4DX6 D;  2ZXW E;  3SD5 A;  3FTX A;  3ZYK A;  4UWL A;  2VSO E;  2WM9 A;  3VTX A;  3SO8 A;  2AXZ A;  3UKR G;  3DWL G;  3QC1 A;  2A5E A;  1W3B A;  3G2W A;  2VGY A;  2J8S D;  3I3N A;  3CQC B;  4LER A;  2VQ2 A;  1N95 A;  4KMO A;  4CGW A;  4BES A;  4AJW A;  5ENN A;  4UQY A;  3R9A B;  2FBN A;  1XNF A;  3S7B A;  3I4R B;  3Q15 A;  2V0P A;  3UX4 A;  3AG4 E;  4UWF A;  4F7A A;  3ZYQ A;  4B8C B;  2H6G A;  5KJN A;  3Q49 B;  1ZBP A;  3PEU B;  4KZC A;  2PL2 A;  5HRY A;  5HKP A;  3C5R A;  3T8K A;  5C2Y A;  1XGW A;  4G26 A;  1TNZ A;  2P9N G;  5FQ4 A;  4GAA A;  1N0R A;  4EEC A;  1QYM A;  2IQC A;  3FU3 A;  4NAC A;  5AN8 A;  5EN5 D;  5AIJ A;  5ARF A;  2HR2 A;  4DI3 A;  3FEX A;  3HXB A;  3L17 A;  2OEW A;  3IEG A;  5C1D A;  4BTB A;  5CCL A;  5FQ8 A;  5ITZ F;  2J09 A;  3W9F A;  3ULE G;  1Y6I A;  5FT9 A;  4XKB A;  3AG2 E;  2R2L A;  2WXF A;  1UN8 A;  3ZEF A;  3FTY A;  3ABL E;  4DX1 A;  5CMW A;  5FZQ A;  1S0P A;  3CHO A;  2WXO A;  4GTS A;  4YDO A;  1O1S A;  5AEN A;  2AXU A;  3DEO A;  2DBA A;  2YNQ A;  3TWS A;  3T5V A;  1G3N B;  3ZPJ A;  5HI7 A;  3OXG A;  3VLE A;  3ZGQ A;  3GW4 A;  3UM3 A;  4CGV A;  5ENT D;  4IUL A;  3QWV A;  2YHE A;  4HOS A;  3PUK A;  4GTP A;  5G04 J;  3TXM A;  4BSX A;  3PH0 C;  1L5J A;  2FO7 A;  2L0I A;  5AAO A;  5LOZ A;  3ONL A;  4BER A;  3CVU A;  1INZ A;  1EPU A;  4H7Y A;  4X8Q A;  3NZU A;  5EX3 A;  4B93 B;  4JEH A;  4JZY A;  2QYU A;  3RRM B;  3CKC A;  4HBD A;  4APO A;  4U0Z A;  1OWN A;  4G25 A;  3EUV A;  5FIN A;  4HRL A;  4DX5 D;  3EHQ A;  1OCR E;  5A7D B;  3FY4 A;  4U8V D;  1U3D A;  4HI9 A;  1HXI A;  2ETB A;  3RSE G;  5JHB A;  4BX8 A;  4QFV A;  5KNH D;  5AQA A;  3CSF A;  3W9G A;  2LSV A;  5G04 C;  2RD0 A;  3V2X A;  5BNW A;  5CMY A;  4H7X A;  4TUM A;  2JEK A;  3RRN B;  2OND A;  3ZHE A;  4GB9 A;  4LEU A;  5FIO A;  1BLX B;  1OWM A;  2FO1 E;  3KEZ A;  5FZR A;  3D9M A;  2JAB A;  3SZ7 A;  4XIF A;  5LCW C;  3CST A;  2H6F A;  5BV0 A;  2OV8 A;  2VGX A;  4U95 D;  4TXQ A;  2GRP B;  1MQS A;  3QNK A;  1MJ0 A;  4DK5 A;  3QB2 A;  1HG2 A;  3SHF A;  3FTU A;  3PVL A;  3LXU X;  3FU6 A;  2RG8 A;  3NQP A;  2R59 A;  1TNO A;  3IHV A;  2PQN A;  5BXO A;  3CR3 A;  3ONK A;  4URK A;  2IJG X;  3NAW A;  3OXL A;  3KD7 A;  3UT8 A;  3J5Q B;  1ELW A;  2WXH A;  4B89 A;  2PNN A;  4TRQ A;  3ZNG A;  3APC A;  3PE4 A;  3B7S A;  3DSV A;  4D10 C;  1B89 A;  1K3Z D;  4JPS A;  4A55 A;  2R03 A;  2FI7 A;  2VGX B;  1FT2 A;  2CHX A;  4XZ4 A;  4GML A;  2P9S G;  3G2T A;  3CK8 A;  4OYS A;  3RJV A;  2KBX A;  2BKK B;  4IYP A;  1MX2 A;  3FWV A;  1H6O A;  5ANL A;  3UM2 A;  5CEA A;  5JJT A;  2E0I A;  1IKN D;  5KBA A;  3B7U X;  4GZ6 A;  5JMN D;  1WG0 A;  3SFZ A;  4AY5 A;  3I4G A;  3G2U A;  1PY1 A;  4L1B A;  1N94 A;  4KYO B;  3B7R L;  3L13 A;  5E76 A;  4EZJ A;  5CCM A;  3N71 A;  5CED B;  1OWO A;  3D9K A;  4NIK A;  4DI4 A;  3KSQ A;  5B3S E;  2KM4 A;  3SF4 A;  1TR4 A;  4GCO A;  5AAR A;  3HG0 D;  3B7T A;  3CHP A;  4RG9 A;  4L23 A;  1BD8 A;  1K1B A;  1RZ4 A;  3QOU A;  5KNG A;  3Q78 A;  3IKO B;  4ZFH A;  5HQ8 A;  3AS8 A;  4EPZ A;  3KS2 A;  4PDX A;  4YVQ C;  3DXM G;  1TJC A;  2P9L G;  2XPY A;  2RFA A;  3C3O A;  1V54 E;  1SZ9 A;  1H2V C;  2QZA A;  3ISM C;  3TWU A;  2F8X K;  5CER B;  2DZN A;  3LKU A;  2GW1 A;  1IHG A;  4MLP A;  3P2B A;  2Y69 E;  2MOW A;  2ZGD A;  4GZ3 A;  3D9P A;  1QQE A;  1HX8 A;  3UXG A;  4LSZ E;  4DJA A;  4GZD A;  3PRE A;  4CYM D;  2ZIS A;  1JWF A;  3UIP C;  3D9I A;  3WG7 E;  3ZFW A;  3CHM A;  1ZB1 A;  4FHJ A;  4U8H A;  4GTV A;  3E34 A;  2KXP C;  2XZT G;  4A3V A;  1Z6T A;  3LEW A;  2ZU6 B;  3ASG A;  4WUY A;  3FUE A;  2F0Y A;  1N4P A;  3U64 A;  1N4R A;  3TG5 A;  2XRZ A;  3CVV A;  4JL0 A;  5A23 A;  2X38 A;  1UJJ A;  3CVW A;  3ZVV A;  4TV3 A;  3IXE A;  3ZN3 A;  3EDT B;  3HXD A;  5J90 A;  1E8Y A;  4JA9 A;  4ACL A;  3QKY A;  5D0Q D;  3BUA A;  4OAU C;  4U7E B;  3PZD A;  4MRU A;  2IO3 C;  3HHM A;  4O1P A;  5BT1 A;  2J07 A;  2XEH A;  4N5C A;  1JUQ A;  2WB2 A;  3ASH A;  1MYO A;  2WQ7 A;  3B95 A;  2P58 C;  4AOF A;  5ENS D;  1UOH A;  3EIJ A;  4WWO A;  1TN7 A;  2V4L A;  2WXM A;  3FU0 A;  1YMP A;  4HLL A;  2FEZ A;  2Y3A A;  5DIZ A;  3HXC A;  5JJ6 A;  3MCX A;  2YQ8 A;  5BXU A;  4DX2 A;  2P2C P;  4JD2 G;  4M3O A;  3UKU G;  5EIL A;  2OVB A;  4WWN A;  4ANU A;  1DNP A;  3B13 A;  2J49 A;  3JCK C;  4ANV A;  5CBN A;  2DZO A;  3PUJ A;  2B6C A;  3UTM A;  4WWP A;  4XEI G;  4LNU D;  3BQO A;  3PE3 A;  3DPY A;  1N52 A;  2BED A;  4J7W A;  3RRU A;  4I1M A;  2ZGG A;  3EHR A;  2DVW A;  3MV2 B;  3FHE A;  5KCM A;  3AS4 A;  4TXR A;  1H2U A;  3ML9 A;  3QWW A;  2WMN A;  4DX7 D;  2WQH A;  1DVP A;  5AJD A;  2X6F A;  3PZ2 A;  3ESK A;  4U07 A;  3SI5 A;  4BT8 A;  1AP7 A;  3UI2 A;  2XQ0 A;  3CKB A;  3G2S A;  4DUI A;  5FTP A;  2Y0B G;  3DXK G;  1YA0 A;  4BSZ B;  4EQF A;  5LFA A;  4N2Q A;  4GMR A;  4N5Q A;  1TEZ A;  2GRQ B;  2R02 A;  5JJ7 A;  2AVP A;  3D9J A;  2UY1 B;  3V31 A;  3KSL A;  4UI9 J;  2WXP A;  5ENR D;  3LY9 A;  5ENQ D;  5CRV A;  4DRX E;  4I6G A;  2EIJ E;  2MHK A;  4KZ0 A;  3QK0 A;  2GRL A;  4JHR A;  2J08 A;  3T9K A;  4HI8 A;  1N0Q A;  4GTR A;  2I1K A;  3L6A A;  5CHE E;  1ZU2 A;  3Q79 A;  3QDN A;  3UPV A;  3FUJ A;  1HU3 A;  5BUZ A;  1TN8 A;  2WXQ A;  1QBQ A;  4C48 B;  1DCE A;  4GYW A;  3PZ3 A;  1U3C A;  3NOC D;  1E8Z A;  1HFA A;  3MGB A;  3CVX A;  4ILH B;  3Q4A B;  1WY6 A;  2IU1 A;  3CV0 A;  2M63 A;  2BF0 X;  4I2W A;  4XX5 A;  4WNF A;  3LVR E;  2AWI A;  3F6Q A;  2WXR A;  4APF A;  4NRH B;  2LSU A;  5G05 J;  1NP7 A;  2VTB A;  3CVP A;  1N4Q A;  5KJL A;  1N11 A;  2Y4U A;  5EX0 A;  5KJM A;  2WXK A;  2PM6 A;  2LO6 A;  3B7B A; 
#chains in the Genus database with same CATH homology
 3HG0 D;  4K5A B;  4HB5 A;  3T8K A;  4O1P A;  1BD8 A;  2XEH A;  3V31 A;  1K1B A;  2ETA A;  1YCS B;  5EYP F;  2V4H C;  1SW6 A;  3KEA A;  5KNG A;  3HRA A;  1MYO A;  2V5Q C;  4B93 B;  2L6B A;  5CEC B;  3B95 A;  1BI8 B;  5ENR D;  4ZFH A;  4GPM A;  5AQB A;  5ENS D;  1N0R A;  5ENQ D;  5BXO A;  4DRX E;  1UOH A;  1QYM A;  4HBD A;  4YDW A;  3TWR A;  5AN8 A;  1K1A A;  2NYJ A;  1BI7 B;  2XEE A;  3J5Q B;  3TWT A;  1A5E A;  3TWW A;  5EN5 D;  1WDY A;  4U96 D;  3D9H A;  4LG6 A;  2Y1L E;  2RFM A;  2RFA A;  2XZD G;  5FIN A;  4HRL A;  2XEN A;  4DX5 D;  1YMP A;  3EHQ A;  4OAV B;  3NOG D;  3TWU A;  2MYO A;  3T9K A;  5CER B;  4HI8 A;  4HLL A;  2F8X K;  2DZN A;  4U8V D;  1N0Q A;  5ENP D;  4HI9 A;  2PNN A;  4F1P A;  3ZNG A;  4U8Y D;  1D9S A;  3TWV A;  5HS0 A;  2HE0 A;  5BXU A;  4DX2 A;  2ZGD A;  5D66 A;  1IHB A;  2ETB A;  5AAR A;  2ETC A;  5ITZ F;  2QYJ A;  4J8Y A;  4DX6 D;  2P2C P;  2F8Y A;  4JB8 P;  3W9F A;  1DCQ A;  4QFV A;  1NFI E;  5KNH D;  3UXG A;  3EU9 A;  4G8K A;  1K3Z D;  4K5B A;  4LSZ E;  3TWX A;  5AQA A;  4BEP A;  4O60 A;  5EIL A;  3W9G A;  4CYM D;  3SO8 A;  4C48 B;  4RLY A;  3AAA C;  3NOC D;  2A5E A;  5KWD A;  5EIB E;  3V2X A;  5CBN A;  4F6R D;  2DZO A;  2QC9 A;  4TUM A;  3TWQ A;  4BET A;  5JA4 D;  1MX6 A;  4UUC A;  4DX1 A;  3UTM A;  3NBN B;  5EYL A;  2F37 A;  2KXP C;  3AJI A;  4LNU D;  2XZT G;  4QQI A;  1MX4 A;  2KBX A;  2BKK B;  5AQ7 A;  4ZHB A;  5FIO A;  1OY3 D;  1MX2 A;  2J8S D;  1DC2 A;  3J5P A;  5CBO A;  1BLX B;  1AWC B;  4A63 B;  5CEA A;  2VGE A;  4J7W A;  3JXJ A;  1IKN D;  2ZGG A;  3DEO A;  2FO1 E;  1OT8 A;  3EHR A;  2DVW A;  4HRM B;  4G8L A;  5KBA A;  3TWS A;  1G3N B;  2JAB A;  4HQD A;  5JMN D;  2B0O E;  4O1O A;  1WG0 A;  3Q9U C;  5ENT D;  4BES A;  3ZUV B;  3JUE A;  4DX7 D;  4HNA D;  4K5C A;  4U95 D;  3V2O A;  3JXI A;  4Z68 A;  3DEP A;  5AQ9 A;  3Q9N C;  3IXE A;  3ZU7 B;  4CZ2 D;  1MJ0 A;  3F6Q A;  1BU9 A;  1S70 B;  3ZKJ A;  1SVX A;  2BKG A;  3UI2 A;  1AP7 A;  1YYH A;  4DUI A;  2AJA A;  5HRY A;  1N11 A;  4YDY A;  2Y0B G;  5ENO D;  5HKP A;  5EID A;  4NIK A;  4ATZ D;  1IXV A;  4BSZ B;  5CED B;  4OAU C;  3LJN A;  4GMR A;  3V30 A;  5AAO A;  4HRN A;  3C5R A;  4N5Q A;  3V79 K;  1TR4 A;  2DWZ A;  3B7B A;  4BER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...