1MJ5A

Linb (haloalkane dehalogenase) from sphingomonas paucimobilis ut26 at atomic resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase
publication title Crystal structure of haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26 at 0.95 A resolution: dynamics of catalytic residues.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 112
structure length 297
sequence length 297
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mj5A00
3IVMA 5CH5A 3BWXA 4RNCA 5AI6A 2OCKA 3C45A 4CG2A 1TAHA 2XLCA 5DTIA 3WWEA 2RHWA 4GHWA 4B0OA 1ZGBA 1XRPA 2ACEA 4DSAA 3K6KA 2CKMA 1BEZA 3QH4A 2VJDA 1YA8A 2E3JA 4C4XA 1ORVA 5AI0A 2V98A 4EY7A 3A6ZA 5LIPA 5ISMA 3L1IA 3PFCA 4CCYB 1CR6A 4BP9A 2OGSA 4H7DA 3H2JA 4E15A 3R0VA 1K5PA 2XUHA 3OOSA 4ARAA 5HKBA 4CCWA 1ZICA 3WL8A 3DL7A 2PU7A 2Z3ZA 4OPMA 4NZZA 5LZ2A 4KRYA 2WTNA 5AKKA 1UK7A 4MEAA 5T4BA 4J0DA 2HL6A 3WA7A 5DNVA 1W76A 4E11A 4NMWA 3HXKA 4W9RA 1EXWA 5C81A 5AI9A 1W4LA 4A23A 2C5FA 1AQLA 3WWCA 4H7IA 1CUUA 2O2GA 2XQJA 3SX4A 3LIPA 5K3AA 2WU4A 2Y1KA 5ALQA 4DLNA 5HCUA 2CB9A 1MX1A 5CXXA 5FRDA 2X76A 1UK9A 3R3UA 2CBGA 5ALWA 3HZOA 2Z3WA 1DT3A 1P0PA 1E8MA 4BRSA 3PDCA 1CV2A 3FSGA 5EIEA 3WK9A 3EQ7A 3MUOA 3BJMA 5FDFA 1SOMA 2CJPA 4GWLA 3VJLA 5LZ8A 3V1NA 3KOOA 1W1IA 1XRMA 2XUDA 1LPNA 4KE6A 4GLBA 3ICVA 3D4LA 5ALHA 2XQIA 2K2QB 4UPDA 1WCYA 5A6VA 3CXUA 1R9NA 3B12A 2JGJA 4BVKA 3H18A 3WIBA 4MYSA 4Y2JA 4W1RA 4HAIA 3V9AA 3WK4A 2OAEA 2YYSA 2JEYA 3EQ9A 1VLQA 1H2XA 5K3DA 4CG1A 4EBBA 3G0IA 5BWCA 4PSDA 2QUAA 3WJ1A 5LLSA 3CCBA 2RHTA 3G8YA 2CUTA 1YA4A 1Z68A 3C5WP 1PFQA 1JT2A 5EIHA 1EB8A 4ZI5A 2YASA 3STWA 4FDMA 1HBJA 1ZJ4A 2QUBA 3PICA 2OLEA 4WDRA 2D5LA 3C8DA 1U65A 1XZLA 4B80A 4TPKA 5ALLA 2XUAA 4H7JA 4KE9A 3PUIA 4DTCA 4AMYA 5ALFA 1EB9A 1GPLA 1XLUA 3AZPA 2C4HA 3C87A 3ESDA 3ZLTA 2J3QA 3LS2A 2IITA 4AX4A 5E4JA 1QGED 1MN6A 2VJBA 2XDWA 2WUFA 3NOXA 3UUFA 5ALRA 5JATA 5JZBA 3HI4A 3TJMA 4XIIA 2DCMA 2JGFA 3N2ZB 1E5TA 4UFNA 4X00A 4BZZA 2WTMA 3WA6A 1B41A 1XRLA 1H23A 1EK2A 5AM5A 3WWDA 5CH3A 4ZV9A 4H0CA 4EY4A 3C43A 4FLMA 2LIPA 2ZYHA 3H2IA 5JADA 4IQ4A 3GROA 5HF5A 4J0JA 2XUKA 4YPVA 5AM0A 4BC0A 4FFWA 5AKIA 5ALPA 3E4DA 4GECA 2VSQA 4HXEB 4BE9A 4P92A 3WKAA 1R50A 1PJAA 1EI9A 1USWA 3C6YA 3JYHA 1WHTA 4INZA 5ALGA 1OCEA 2HU7A 1JKMA 2VTVA 3QYJA 1X2EA 2PSHA 2WILA 4O08A 1N1MA 2G4LA 2HDWA 2G63A 1G42A 4QDTA 1EVEA 4Y2YA 1TQHA 1WM1A 2BGNA 1HL7A 4ZRDA 5K3BA 4HVTA 1JMYA 4OCZA 2VT6A 4BAZA 1XZMA 5IVDA 1QONA 4B0PA 4ITVA 2GZSA 5IVKA 3WK6A 3I6YA 4OYYA 3TEJA 3WWPA 4KAAA 4MJ3A 1QTIA 4DMCA 4H7KA 4KRXA 2XMZA 4K6HA 3EIOA 2WJ6A 1ETHA 4RPCA 4G8DA 4BRZA 5FOQA 4FFVA 3DOIA 3D5EA 3HYSA 3PUHA 3RM3A 1ISPA 2HADA 2PSEA 4W1QA 5EHZA 1GQSA 4Q34A 3ZPXA 4YX9A 4QWWA 4UBNA 3IB3A 3M81A 1XRQA 3DNMA 4KAFA 4N5IX 1JU3A 2XUIA 1IMJA 1EVQA 2WSLA 1WB5A 4J0KA 1THTA 3W04A 1HPLA 4G8BA 1NX9A 5CW2A 4B9AA 5JARA 2WKWA 1XZEA 5C8ZA 3Q8WA 3OM8A 1EA5A 2B4KA 1CQZA 1LZKA 2XUQA 4ZWNA 1AUOA 2JBWA 3QMMA 1ZI6A 3YASA 5AP9A 5FP0A 4B7ZA 3K9BA 5D3KA 5DYTA 5LYYA 1XLWA 4KEAA 4UHBA 1DWOA 4U2BA 4EB0A 2QXUA 2ECFA 1R1DA 3AJAA 2PSFA 4G9EA 1QIEA 4UHFA 2O7VA 1QIJA 1P0QA 3STUA 3A2LA 4UUQA 4IHAA 3O4IA 3VVMA 3BJRA 5JYCA 4OYLA 3I2KA 2O2HA 3WMRA 2WUEA 3IUQA 3STYA 3G0CA 1K4YA 1UKBA 2WIJA 5LZ9A 3B5EA 1IUNA 2GBFA 1H2WA 1MT3A 4UBJA 1BU8A 4Y2SA 2JEZA 1JJBA 5T4FA 1Q84A 2WHPA 3AZOA 3MUNA 3IIIA 3U0VA 5D3ZA 1MU0A 4NS4A 3QBJA 4Q1VA 1SCQA 5FPQA 4OD0A 2WJ3A 4MWSA 4QLOA 1JI3A 1MX5A 1H2ZA 1SFRA 4F21A 4EY8A 1QZ3A 3GBSA 4ETWA 1IVYA 3N0TA 3O4GA 5FPPA 4W1SA 3L1JA 4BB0A 4P93A 4UBOA 4PSUA 2B20A 3R3VA 3WL5A 1GKKA 1YR2A 3R3ZA 2GZRA 4HXFB 2VT7A 3WL6A 1CUDA 2C58A 3M83A 1CUWA 3G9XA 1WPXA 1LPOA 1HKHA 3M82A 4G4JA 1ZGCA 4X85A 5EI5A 3I6ZA 5JAHA 2BCEA 3BE8A 1VZ3A 3I28A 4KE7A 2AJBA 2QRUA 5A7HA 4UBLA 4J0IA 4LYDA 2ZSHA 1N5MA 1TK3A 2XMDA 3QMVA 1A7UA 1XQXA 1MNQA 2HU8A 2XQFA 4HS9A 1LBSA 1LBTA 3QZUA 3H0CA 1LPSA 1D07A 3FYUB 5AKEA 1C4XA 3C6ZA 4UBIA 4G1FA 4F0JA 1CLEA 2GYVA 5A7GA 2RI6A 5E2IA 3CCCA 3G0GA 1A88A 5AM1A 2QOEA 4G9GA 2D0DA 2BAGA 5K3FB 4FLEA 3GELA 1FJ2A 4DNFA 2WJ4A 1QIIA 4OSEA 1JMKC 4X93A 5T4HA 3VJKA 2XI4A 1U4NA 5ALNA 2PL5A 3FLBA 2HRQA 1BROA 3SC2A 2GBGA 4WCVA 3WYDA 4BE4A 4HRYA 1U2EA 3G7NA 4L72A 2OPHA 2R11A 1ZOIA 3PFBA 3OURA 4X6YA 3VKFA 3EBLA 1LGYA 1WHSA 1DU4A 3F98A 4L9AA 3BF8A 1YAHA 5FUMA 1CEXA 5ALXA 2B61A 4Q82A 4KAJA 5BV7A 2G5PA 1PV1A 1L7RA 1HLGA 4G5XA 1EDBA 4GDMA 1TIBA 2CZQA 2C7BA 3WK5A 4ZV7A 4AN0A 3IDAA 3D0KA 4X6UA 2HRRA 4GW3A 1HQDA 4FBMA 4UHEA 4Y2VA 5ALOA 1X2BA 2R8BA 4JUIA 1SCKA 2O2IA 3L1HA 2CMFA 2Y6UA 3STXA 2XMSA 5AOAA 1QFMA 4J0GA 1H2YA 4FNMA 2DHCA 1W75A 1DWQA 2QJRA 5CT9A 4DNOA 2OG1A 4K2AA 1AX9A 3PI6A 3R40A 3HC7A 4G4GA 1CUIA 2PPLA 4JYPA 5DYYA 4UHDA 2QS9A 5AM4A 4BDTA 2AJCA 2C5GA 3AZQA 3F67A 2QT9A 1ODCA 1RWQA 1X70A 2DSNA 3AIMA 3FVTA 4B9EA 1NU6A 1LPMA 1VE6A 4J0CA 3VJMA 2XT0A 1J2EA 1FSSA 2ROQA 4Z49A 4AO6A 1ZIYA 2Z8XA 3GUUA 4W1PA 2BKLA 2ZJ7A 3H1AA 2AJ8A 2XUGA 2AJLI 3OG9A 5EHNA 4X3CA 2YH2A 1ZJ5A 3WWOA 1QTRA 2I03A 2WG1A 5JD5A 3P2MA 1YB7A 1KU0A 2V96A 3F96A 3E1GA 3FBWA 5AK5A 2J4CA 2ZYRA 4QZVA 3WK7A 3KDAA 2JGEA 4X7BA 2XMRA 2BUAA 4Q3OA 4H35A 4BZWA 1RP1A 1A8SA 2Y2UA 2WIGA 5ALMA 4RE6A 4DM7A 5FV4A 1JJFA 5SYMA 3I6MA 1EX9A 2GBIA 4IO0A 4UHCA 4XJVA 1QIHA 5CMLA 4FOLA 2Y2VA 4OB8A 4F60A 4I4CA 1EHYA 1XZDA 3Q0TA 3B3QA 4C89A 4MEBA 1ODSA 4BATA 1E3QA 4E14A 4LHEA 3A2MA 3BF7A 1G66A 1ACLA 3S2ZA 1FFBA 5CT4A 2PX6A 2WU3A 5JD6A 3ZI7A 3DEAA 4F5ZA 2HA2A 1O6GA 4Y9SA 4AZ0A 1BCRA 4QDXA 4G4IA 5AKJA 1QIDA 3AILA 5AI8A 2HM7A 4X6XA 2ONCA 2QVBA 4C01A 1FFAA 4NVRA 3V1LA 5JZ9A 3T4UA 4FTWA 3WZLA 2V97A 2OQVA 1TCBA 4DNPA 5KREA 5HKAA 3ESCA 1BN7A 3FLAA 1XRRA 5CRIA 3RARA 3VXKA 1GQRA 3R3XA 1C7JA 3E0XA 4CIAA 3U1TA 4C87A 5DNWA 4S0XA 3WK8A 4QDUA 1G5FA 3LLCA 1F0NA 2QMQA 3WL7A 1MPXA 3D2AA 3NWOA 1E8NA 5AKHA 1DX4A 1F6WA 3DCNA 4U2EA 3NUZA 4KYVA 4BCCA 2XLBA 3CN9A 3EQ8A 2QM0A 1CUYA 2XQGA 1ORWA 4EA6A 4BVLA 5ALJA 2WFZA 2XUOA 1K63A 4X97A 1F8UA 5AM2A 1LNSA 2WHQA 4H7FA 3S8YA 1TCAA 2EDCA 4JEIA 3G0DA 4AO8A 5HF6A 2ZVDA 5CT8A 1E66A 1EK1A 2WM2A 3OC0A 1XFDA 4WY5A 1EINA 2XUJA 3AINA 5HK9A 1GGVA 3PE6A 5AI5A 3DYIA 3QMWA 4JNCA 5EGNA 3ED1A 3W05A 4KACA 3W2TA 2C0QA 4Y2TA 4N8DA 5T4EA 2Z5GA 3DKKA 1XZBA 2PSJA 1IUOA 3C70A 2BUCA 3QM1A 5EFZA 5HQ3A 2CEKA 1BEEA 5CH8A 2AXEA 2VJCA 5ALSA 4RE5A 4U2CA 5AO9A 1ZD4A 1XZCA 5JANA 3KD2A 1CUJA 5AIBA 1MAHA 4BVJA 4DMKA 4M0FA 1VXOA 2IX9A 3BL8A 1UOOA 5ALYA 1K8QA 3C6XA 4Q05A 1LPBB 2OQIA 1HDEA 4X90A 1BCSA 2PM8A 3H17A 2IIVA 3RKSA 4XVCA 1UKCA 2WUGA 4Y2RA 3JWEA 3KXPA 3SWWA 2VAXA 2XMQA 1VE7A 3HRHA 3HEAA 3GZJA 5ALVA 3O9MA 1ZD2P 1R3DA 5LKAA 3O95A 1AMNA 1IZ7A 2OAGA 5JAUA 5LZ5A 2FUKA 2DQYA 1UFOA 3O4HA 3AIOA 1UK6A 2QR5A 2HA0A 3WQHA 2JGLA 2RGUA 4N8SA 1Y7IA 3BIWA 1F0PA 1QIMA 4BTVA 3FNBA 5I9IA 3I2HA 2HFKA 1N5RA 4JH0A 5FXMA 4BBZA 1QIFA 2DHDA 4WFJA 3WLAA 1YB6A 3BXPA 4B81A 1J1IA 2WIKA 1THGA 1GXSA 2VAVA 2Z8ZA 3WIOA 1A8QA 4HTAA 3H2KA 4QNNA 1R4ZA 3EF3A 4L3WA 1Q0ZA 1CIJA 5CT6A 1GT6A 2WFLB 5KBYA 2JF0A 1M33A 4FHZA 1CUGA 3ZLVA 1LLFA 1IZ8A 4QEKA 4GBGA 4UHHA 4J7AA 3LCRA 2OGTA 3C8HA 1WB6A 1XQYA 1LZLA 2QKYA 1KU6A 4PF1A 3IA2A 5DLPA 3STVA 1DQYA 2PSDA 3UMJA 3HSSA 5HF8A 2OCIA 4EY5A 1VXRA 5E4TA 5C8XA 2H7XA 5IH7A 3QITA 1XZAA 4KJXA 2ZJ6A 4DNQA 3PF9A 1CUAA 4XX1A 3A70A 5JALA 3HACA 5C7YA 1UOQA 2BJHA 3RK4A 3G02A 5AKGA 1YASA 1YS2X 2Q0XA 3F8SA 1UK8A 1EDDA 4DMFA 4DYHA 3AIKA 2OCGA 2RONA 5ALKA 3D2CA 4YASA 4CCYA 1VKHA 4Y7DA 5BWBA 2P8SA 1GPKA 3PF8A 3JW8A 4K6GA 1DQZA 4PNZA 1UOPA 5I7UA 4X92A 5AKZA 3E3AA 2DR0A 3GA7A 5JAPA 2WHPB 6YASA 4W63A 3I2IA 1XZFA 1EH5A 4AO7A 4UFPA 2J3DA 4K6KA 1DX6A 5KWIA 3H04A 2ZJFA 2RIPA 4Y2XA 1YS1X 4P9NA 1XKLA 5AKLA 5CBKA 1FFEA 3FCXA 2VEOA 5JASA 3H2GA 5AK6A 3UUEA 1JFRA 1XRNA 2WG0A 3CN7A 2ORYA 2V9ZA 1FFCA 5LZ4A 3WJ2A 2XUPA 3DJYA 1QIKA 1ZIXA 4I19A 2W22A 4AMZA 1YCDA 2DQZA 5LP1A 4BDSA 5LZ7A 2HU5A 4I3FA 1MO2A 4U2GA 5JD4A 4MQLA 4V2IA 2HA5A 3QPDA 3WKEA 2GYWA 5K3EA 4ZXFA 3DQZA 1UWCA 3F9CA 4PSCA 1AGYA 5HK8A 2X8BA 5LKRA 3DDUA 4P08A 3DOHA 3FSGD 1GZ7A 4M0MA 1KEZA 1C7IA 4IH4A 3FYUC 4BYMA 1AKNA 2BUBA 3QPAA 4B84A 3V1MA 5A7FA 1ODTC 1R88A 4ARBA 2XMBA 4DGQA 3ESBA 2QZPA 2FJ0A 4BP8A 2XB6A 3IBTA 4X95A 4CG3A 1Q83A 4WFKA 2XUFA 5AJHA 4U2DA 5J3JA 1P0IA 5AKXA 3W9BA 1Y7HA 1YSCA 5YASA 1VA5A 4ZGBA 1CUCA 4JYMA 2I3DA 1CUEA 2Y6VA 2H7YA 4B85A 4GEGA 2H7CA 4QDZA 4X91A 3D2BA 4IH1A 4X94A 4YK7A 3FOBA 1CRLA 4OB7A 2DFPA 2O7RA 5ALTA 1JJIA 4RGYA 2QXTA 3G0BA 4H77A 5ALUA 3T52A 3AUKA 1G4HA 2OCLA 2HFJA 1J06A 2G5TA 5D6OA 1W52X 3ANTA 3FWHA 4QLAA 1AURA 1XZGA 5JIBA 3D3NA 3IUJA 3H1BA 2WHRA 1R9MA 3QVMA 3D59A 3ILSA 5CT5A 2JGMA 3I2FA 4K5QA 2WQZA 2ZSIA 3DYVA 3IUMA 2J4FA 4HRXA 2AJDA 4B6GA 1QFSA 4EUSA 5AHXA 2VF2A 5AICA 3RLIA 3VDXA 1UXOA 1BE0A 4KR0A 2OGZA 4BC1A 1WB4A 4AXBA 3W06A 2I3ZA 3R3YA 2UZ0A 3OPMA 1I6WA 4FNGA 3FAKA 3G9TA 4EY6A 4PO3X 3OTQA 3IURA 4BTLA 1WPRA 1FFDA 3M3DA 4B82A 5AIAA 1VJ5A 1EDEA 2ZYIA 5H3HA 2FJPA 1XZIA 2VJAA 3DS8A 1UT6A 3WKBA 4N8EA 2JGIA 3X3HA 4FWBA 1GKLA 1N8SA 3G9UA 4EHBA 2PUJA 4A5SA 1DWPA 2RAUA 1AC5A 5A62A 5ESRA 1XLVA 1XZJA 4G8CA 4MXDA 4CI9A 2XMCA 3BDIA 3MVEA 1QOZA 5CTAA 4FLFA 1P0MA 1QO9A 5EIAA 1H22A 5AK4A 4HZGA 1QJ4A 2PU5A 3WKDA 1XROA 4Q3KA 5AKYA 2H9YA 2VQ6A 5AOBA 4WJLA 2VATA 1BN6A 1RYYA 4LXGA 3O4JA 2FX5A 3LIIA 4LXIA 5SYNA 4AZ3A 2NW6A 3TRDA 5ALIA 3R3WA 5C8VA 5K5EA 1DTEA 3V1KA 3ESAA 2ZYSA 4LYEA 1WOMA 7YASA 1CUHA 5A2GA 1MAAA 2GYUA 3KWJA 1VOTA 5AK3A 1CQWA 4WDQA 2HA7A 3FVRA 3DLTA 5IVHA 5K3CA 4J3JA 3TGLA 3VISA 1IUPA 3F97A 4C6HA 1TKRA 3ANSA 1S8OA 4UBKA 4MQMA 2WLSA 1Y37A 4ZREA 4LIPD 3WYNA 2W6CX 1Q0RA 2WG2A 2B9VA 3DD5A 1ZI9A 3ZWQA 5A71A 2PUHA 2I78A 5DNUA 4MYDA 4MWTA 5IKXA 4BAGA 3ICWA 5EHXA 3O9VA 2HA3A 5HZGA 2QTBA 3BDVA 3AFIA 4KE8A 3FCYA 1GPNA 5ALZA 5IVIA 5AM3A 3H2HA 1TCCA 4E46A 1CFJA 1CUBA 4LXHA 5AI4A 2PBLA 3KSRA 3FLEA 3C6BA 1QLWA 4N5HX 3NGMA 5DYWA 4AQDA 4WY8A 1MNAA 1ACJA 5HFNA 4H18A 4C4ZA 4IH9A 4UBMA 4QE3A 4HXGA 3FYTA 1J07A 1DINA 1QE3A 3V48A 4Q3LA 2EEPA 2XQKA 1SC9A 2HHAA 3D7RA 4QDOA 4FMPA 1MX9A 2WUDA 4FBLA 2WFLA 1CUSA 1MJ5A 3A2NA 2YXPX 1NU8A 4OU5A 1LPPA 1QIGA 4C88A 4DIUA 5E4YA 1XQVA 5JZSA 1BS9A 2HIHA 4BAUA 2QJWA 2BGRA 2WFMA 4PQEA 1UKAA 1LPAB 3K2IA 5D7BA 2WIFA 5HQ3B 1DT5A 1L7QA 4M0EA 3HLKA 4FKBA 4LKOA 5DTJA 4X71A 1XZHA 4L0CA 4BCDA 5AOCA 4C4YA 1CVLA 1ZI8A 4CIBA 1O6FA 3STTA 3BIXA 2H1IA 3DKRA 2OXEA 2HA4A 4XWGA 4QA9A 4DMHA 3VVLA 4DSZA 3SK0A 3DL4A 1BRTA 3I1IA 4Y2QA 3C5VA 4J0HA 4Y2PA 4QWMA 3HABA 2XE4A 1ZD3A 3WKCA 5BOVA 3O0DA 4PW0A 5CURA 3ZV7A 1VZ2A 3KWFA 3W9UA 4OU4A 1OXMA 5ALDA 5KWJA 3LP5A 1XZKA 2ACKA 3IULA 1CUVA 3FYUA 4Y2UA 5FKJA 2WIDA 3MGAA 1XKTA 3H19A 3ZLUA 5HFAA 1SCIA 3WZMA 5FLKA 4OB6A 5K3FA 1ZD5A 1VA4A 1CPYA 1OILA 2HA6A 1L7AA 4AB1A 1W6RA 5CXUA 1T2NA 1U8EA 4B83A 1CUXA 1T4MA 1XQWA 4A16A 2JGKA 1B6GA 5HF9A 4WFIA 5F4ZA 5DWDA 2BFNA 4CFSA 1E89A 3G9ZA 1E8DA 2PKYX 5JAOA 2EDAA 4TVKA 5ALEA 3WI7A 1K6EA 2VA9A 3IUNA 4AN1A 4D9JA 1JU4A 5EHQA 3HJUA 4GI1A 4TGLA 3I2JA 4GXNA 3I2GA 2GBCA 5AH0A 2X5XA 1TRHA 4PV7A 4J03A 2ES4A 4ROTA 1CUFA 4H7HA 4BCBA 3I1YA 4H7EA 4OUKX 5I8PA 3R41A 2DHEA 4U2FA 1AZWA 3GFFA 3QPCA 1QO7A 1CUZA 1A8UA 5DJ5A 2C0PA 1MTZA 1YAJA 4UFOA 2JIDA 2PVSA 1UZAA 4EZIA 2XMGA
chains in the Genus database with same CATH superfamily
3IVMA 4LJ9A 3NBXX 4M0CA 3FFXA 3L79A 5EVJA 3B6KA 2XB4A 2E4ZA 3QU4A 3RIGA 4N3GA 3QA9A 1GU7A 3IVGA 4EVSA 1LWOA 2BOVA 1M67A 3CM0A 3OJFA 4C7JA 5AI6A 1AKYA 5L3SA 4D0RA 2OCKA 4PZAA 3VC1A 5KNBD 1BX1A 3IT0A 1BXGB 1RBMA 3R0QA 5B6JA 1SKUA 1Z6XA 1L8AA 2YL2A 3MF4A 3WWEA 8AT1A 4RLFA 2H4WA 4LZJA 4REMA 1OB5A 5DW0A 4MRVA 5LN1A 1KYYA 3NTLA 1B2LA 2QRPA 2DLNA 4NECA 4B0OA 3R8FA 5E6UB 4CEIB 3AT1A 4JJEA 2NVUB 1GCGA 1EJ6A 1NI4A 2ACVA 4XA8A 3GVXA 4AAYA 1JLSA 2GFIA 3ITDA 1IONA 4BNXA 1ZWKA 2CKMA 3S2YA 4UM9B 3UATA 1ZNZA 3A37A 3T34A 1YA8A 5I9NA 2E3JA 4GF5A 1Y1SA 3DKVA 4QQKA 2YJGA 4TZKA 3H6HA 5HBGA 2QJOA 1IM2A 4HN2A 5D86A 4PYRA 4AJEA 2UUBB 5BMVB 1SO8A 3WAGA 4EY7A 3ZHRA 5BN3B 5CDYA 1MC8A 4R81A 1JR6A 3O83A 3AI2A 3RC2A 1CR6A 3QYAA 3SBDA 1UEJA 1JPUA 1P2DA 2A1UB 2OGSA 3DFKA 2I5PO 4DDKA 1DKUA 2UYOA 1XMQB 3C15C 4PRKA 2B99A 2GHTA 2YXDA 4F96A 3CUYA 4E15A 3HN6A 3SQNA 2ICAA 4S0ZA 1WUIS 2P78A 4TT8A 4WGGA 3BTOA 3ZWXA 3W9SA 4CF6A 1ONPA 1WXDA 1DC4A 1BWSA 3NHPA 1RP7A 3ZU3A 1O57A 2HCFA 2HMTA 2B7CA 3H5TA 3ML1A 4RKFA 1P3DA 4DLBA 4KXWA 1YACA 3RFFA 2H0RA 3FUCA 1YFJA 4RL6A 4NSNA 2PU7A 4F7WA 1C1DB 3JSAA 3KQNA 2OD7A 2WTNA 2AQHA 4EPYA 1VL6A 2B1RA 3HXTA 4RSRA 1GCUA 1LDBA 4JQZA 5T4BA 3ZCRA 4TYYA 4PZ9A 1UDRA 3KVNA 4KMRA 1Z39A 2PS1A 4YRNA 3PCRB 2WEKA 4O5OA 3WMWA 5JPDA 3IFSA 2X13A 5BRAA 1NF9A 2GSWA 3HA5A 4YDRA 3F74A 3GJ4A 3P2YA 4E11A 4CTMA 4N48A 5AJXA 1BWPA 3OY7A 3HXKA 4RY9A 3TN7A 3C7DB 3HPQA 4LZZA 4A27A 2IIBA 2VDLB 1MXFA 2VP5A 3ABOB 3C39A 3WFIA 3DE6X 2BPOA 1DXOA 2PUTA 3NEPX 4E5MA 4A23A 4NZYA 4QBFA 5BV8A 3AG5A 3LDUA 4I81A 3HEMA 2ZRFA 1J00A 1IZ0A 1NJGA 1ULBA 2BEWA 4KUHA 4E2ZA 2Q4BA 3L8YA 3SQMA 4ERNA 2FWIA 1ISRA 4CBVA 1J56A 4X20B 3N9IA 4GICA 2XQJA 3OJEA 4FCTA 3F78A 1QLHA 4RH3A 3REOA 4Q18A 3TJZA 1MX1A 5CXXA 2PG3A 2ZIFA 4EKYA 4PG7A 4AY4A 2AYZA 4TV9B 1I4DD 4MVJA 1DIOB 5DTEA 3DBHA 3W2EA 4QVGA 4YRTA 2CBGA 4O6VA 3HZOA 2ECKA 3B3FA 1BDMA 3HP4A 4TSFD 2X58A 5EKTA 1E8MA 2IUUA 2VBIA 5F7JA 4KTTE 3HB5X 3C4JA 4B3GA 1Z2PX 4TZ0A 5BV0A 4YCCA 4JC8A 3N28A 2Q3HA 1TVEA 3FSGA 3W2HA 3WK9A 4PSAA 2UZIR 3U4HA 4YLYA 1AKQA 3AEZA 3QPVA 1PQ4A 1I0IA 5IUKC 5A9TA 4U9HS 2Q1UA 4BXOB 1RI3A 4E5UA 1L2TA 5FDFA 2IKQA 4F1JA 3TJRA 2RG1A 3OOYA 3CX7A 5L3QA 1Y3CE 1BDJA 2PA0A 3PE4A 1U28A 4H6VA 3SSAA 4PZYA 2BI7A 1TVKA 3U7QA 3EG9B 3TQCA 4MRMA 1YVUA 1YJCA 3G2JA 4UPEA 1KP2A 1MB3A 5FWYB 1K0FA 3LRXA 4RWZA 3KOOA 1W1IA 1A27A 2OKGA 3M5CA 3VH2A 3CJRA 3G8AA 1ZL0A 1KBZA 2C2WA 3K0AA 4HDCA 2AOUB 4MV7A 4O25A 3IIMA 4KE6A 2YY7A 5KIAA 2D2VA 1S0UA 1UJ6A 2NWQA 4GLBA 1Y8RB 3SYNA 3I45A 4IHKA 1NW8A 5HRCA 1FRVA 2K2QB 3INNA 3NFYA 1W1UA 1WCYA 1Z4QA 4H27A 4KPYA 3AYZB 4D96A 2XNDA 2RHLA 1UZMA 2QRMA 2X8JB 4JB0A 4HDOB 2LTAA 3FTCA 4I5FA 3LYAA 4LY3A 4JGBA 1QFZA 1E98A 1NMSA 1RYDA 2VBCA 1ADBA 2GBLA 4KVAA 6Q21A 1EP1B 4QBTA 1CTQA 1EXNA 5JO9A 4Y2JA 4Q9KA 1ZM9A 2P2SA 3M1AA 4LZNA 3O8CA 4IVQA 1ST2A 4JGIA 1T4CB 4C7XA 4OGFA 3GD7A 3KLMX 3G2PA 4M9UA 4N47A 5E6SB 2BDEA 5BQFA 2JEYA 4IIHA 4DWJA 1YFLA 1JHVA 5J2UB 1QCCA 1AA9A 1TT7A 3B78A 3DMFA 3WWZA 1NQ5A 3DAFA 3MBOA 4ZOAA 4BPBA 3RODA 1NZFA 3TLGB 4JQCA 1R12A 3I9NA 4MS4A 3TZQA 4I9NA 4Y1RB 6GPBA 3G0IA 5AW0A 1D6NA 3DONA 4EHNA 4HVLA 3DDCA 4PSDA 1P0CA 2XSZA 4DRYA 2JLVA 1D7AA 5LLSA 2JS7A 5K0TA 2RHTA 5D8DA 3QVWA 1GU1A 1H1LB 4Z0NA 3DEKA 3FYSA 3KM0A 4JT9A 3C5WP 4B43A 3EPLA 2YHIB 5AJVB 3L0PA 2CLCX 2OBMA 2UYHA 1PFQA 3B9RA 1RC0A 1RHRA 2Q6LA 3I12A 5EIHA 3JQBC 4BVHA 4IG9A 5KINB 1KJJA 1SUSA 2Z8YA 5FTJA 4BNIA 2PZ8A 2YASA 4JKOA 2JI6A 3K9FC 3AUXA 2MMGA 4ZZ2A 1ZA2A 4YIKA 4W5TA 4C4OA 5K6AC 5I8ZA 2PZFA 4V03A 1L5OA 1ZJ4A 3JWGA 2QUBA 1SXJB 3LPNA 5EWLA 5KNDA 3VNQA 4CLEA 4BYGA 4G25A 5T41A 3RU7A 3TSZA 1H05A 1DAFA 1GRQA 4BLSA 3FUXA 1UMBA 1SHJA 4WJZA 2MYNA 3NC0C 5DT2A 1CBUA 1ZHFA 1FLVA 2P41A 4W9NA 4MR7A 4B80A 1GU0A 1XD2B 4IIFA 2OO7A 3H65A 4J8PA 2NU6B 3ICOA 5FEMA 5C32A 4GYJA 2XA2A 4PPQA 2ZYWX 2YKGA 3EGIA 4LISA 2X3FA 3G1WA 3LCVB 1BQEA 4TKUA 1NMXA 4DTCA 4OHBA 4P0PB 1QANA 1D2MA 3ESZA 3RSZA 4ASUA 4JQYA 1OI3A 1VIAA 1U5AA 2Q3EA 3HU1A 3LFHA 1L6IA 5IW8A 1Z3IX 3N5KA 1KO1A 4MIKA 2I4LA 1Y5MA 5D3QA 3JSXA 4ZAXA 1FDTA 2HKIA 3LS2A 2W6MA 1VJCA 4PPNA 4B6QA 2IITA 4AD8A 5L7TA 2KBEA 5BVGB 3MTJA 1DARA 3D3WB 4EF5A 2W4IA 3HA2A 4NFHA 4GKAA 4R2MA 2B3DA 2K6GA 2V6MA 3T4EA 1GL7A 1MMFB 2VJBA 4OXYA 2XDWA 4KIWA 2JH3A 4BJ5A 4BQOA 5K0NA 5ALRA 2B1IA 4US2R 3Q10A 2RAPA 1YE8A 4M1OA 5TQ2A 5KOYA 4RTPA 3TTYA 2ZOSA 1A76A 1ARZA 4Y8VA 3B48A 2OV2A 1Z06A 2JGFA 2ZCVA 5C3UA 4XRGA 1N78A 1E5TA 1MTOA 5B12A 1V1JA 3VKGA 3WO0A 4Y9UA 4Z7JA 2P9JA 5EVCA 4BX3A 1QP8A 3ROFA 1SCAA 3EA4A 4WQMA 4ZO7A 3T9DA 1N34B 3KALA 4F8YA 3CH7A 1RWMA 1VMAA 2JJ2A 4EB3A 4F5DA 1Q0LA 1XK6A 4IOLA 1U31A 3NIDB 3OKCA 2P5TB 4HYQA 4AS1A 3FHCB 4JI2B 1EK2A 4C21A 5AM5A 1ZQ9A 3ZXXA 1RWVA 4QUDA 5CH3A 1HFEL 3H7AA 3SN6A 4MQ4A 3CRVA 2AFHE 2N9UA 4B17A 3BILA 4EY4A 2BWJA 1JH8A 1OFIA 1LSSA 2LIPA 1AF7A 2PRIA 4FLMA 5E9JA 3BBPA 5JCXA 4DCJA 4XKJA 3S7ZA 1GY8A 2Q2NA 3CUSA 2W2KA 2ISSD 1SA0B 4OOEA 3ZGVA 4DJTA 4QL3A 1NFFA 3JQGA 1E2DA 4B3IA 4BC0A 2ANBA 4X3PA 5ALPA 3OMLA 4OX9B 3K30A 1ECFA 4X84A 1LSOA 4GECA 3EXFA 3D1VA 3WHLA 3KEOA 5GM2A 1RS0A 3AQ4A 4C2BA 2IPMA 1MOZA 1PNOA 4AECA 2CJWA 3WMXA 5KMGA 4FS8A 5FI5A 4XWYA 4JJKA 1KOJA 4O2BF 4CEJB 3T41A 1T3TA 4JU9A 2W2TA 4RENA 3ZK8A 5CLFA 4IDCA 2AMFA 3A9TA 3Q7IA 4QPCA 3EFOA 3Q7PA 1VSVA 4I8IA 5J63A 1X8KA 2JH8A 3HYLA 4R7TA 3OA0A 3S2IA 1J9ZA 1WVGA 2IHTA 1V48A 4NOLA 1Q0TA 1GITA 1PSZA 2VUIB 4QX6A 4D0LB 4D82A 4NCIA 2HU7A 4V02A 5AVQA 2VTVA 2YWDA 1VIVA 3KSDO 3EOBI 2BGUA 4WAUA 3KLNA 4E32A 3L8CA 1OR8A 1NSYA 1Z73A 2O3UA 2OYCA 1Q7TA 5U1PA 4NU0A 3TF5A 2NZ8A 4Y0NA 2B5WA 5DHRA 1AQUA 2ZIXA 4B3FX 1B43A 5AUQA 3PA8A 2VDMB 2Q5JA 1UXJA 1C4WA 2R9VA 2WF5A 4URUR 2GZ1A 2PKXA 1MJNA 1QCDA 2GN2A 2CFCA 2HYDA 4HH0A 2PXAA 4Y2YA 1DJLA 4M0PA 5REQA 1O94A 1EMDA 2GCGA 5H8WA 2Y9MB 4D8UA 5K3BA 3HJAA 1H4TA 1IN4A 1SOUA 1WW2A 3D7KA 4JR1A 1L5GB 2WYWA 2YMLA 1A0OA 3I0MA 4HBZA 1XZMA 3GHYA 4FYWA 5IHXA 1NF2A 1EG7A 3OJXA 1HNNA 4MS1A 2OG2A 4D9HA 3NLLA 2PRKA 4D97A 4W5RA 3IJRA 1I3OA 1PJ3A 1PJSA 3PUZA 4K86A 4TQAA 3RYHB 2Q2QA 4CQMD 3S1AA 2BM8A 3OZRA 2B21A 1GQ2A 1O9HA 2OBYA 4KAAA 4NPAA 2NM0A 4GD3Q 4A0RA 4EHKA 2OESA 3DPUA 4H7KA 4KRXA 3L8FA 3KUDA 5HIJA 5B3JA 5IKPA 1DBRA 1E7WA 3LU1A 4FT2A 2HCTA 1KRXA 1XELA 1ISJA 1IE3A 3JYLA 1BC5A 4PO9A 4E5KA 4RPCA 1GIAA 3OIYA 1ZDMA 3T1TA 2G07A 4ATNA 3BPSA 1RPZA 4S1VA 1L5VA 2J6CA 3QK7A 4DQ0A 3IQIX 4TYMA 5IJ9A 1MZVA 3HYSA 1B73A 3H13A 5BSVA 5I5EA 3VH1A 4RF4A 5EHZA 3AKCA 4LF8B 4TKMA 3RSQA 1O77A 1C7QA 1UDBA 1XP8A 2G09A 2ID9A 2GM9A 1OXBB 1K3TA 3L8ZA 4LKRA 3ZPXA 4QWWA 5F7OA 2BR5A 3A4YA 4UBNA 2IYLD 3IB3A 3HVHA 3DNMA 2NGRA 1QH1A 1KO5A 1PKXA 2PQ2A 4KAFA 5DNDA 3RF7A 2A5YB 1KYQA 4HADA 2FK7A 2F3SA 3SIRA 5KZMB 1MRSA 3EAQA 1M7BA 4BX2A 2C98A 2A86A 4BFZA 4UREA 3HCDA 3N87A 2JI4A 3W04A 4A8JB 1HPLA 3GRKA 1V3QE 3CLTC 3C3KA 2FSVC 2XECA 1SKYB 5CW2A 4P7KA 1FX0A 1RAHA 3BCHA 3TRHA 4AJPA 1DEKA 1TC2A 1P4GA 1WXFA 2HPVA 4LQCA 3KR2A 1VCHA 5GY7A 4BHTA 1SZPA 4PLYA 2OHFA 4HX9A 1XZEA 2BBWA 3V1YA 3CRRA 1KAOA 1ZK2A 3LFTA 5EE0A 1OLUB 3KHSA 4BFTA 1ZOSA 3R8CA 3QUBA 5EJGA 1NBIA 5BNWA 5C8ZA 3V7WA 1EA5A 5B4VA 3W1EA 5BQ3A 3BGDA 1HDCA 2PLFA 3DZBA 3JVEA 4PTLA 1OZGA 2XOKA 4M8IA 5H81A 4HDRA 4ZWNA 3D3JA 3CEMA 2JBWA 5BN4A 5C9ZA 1ABFA 3QMMA 1VL5A 2CNNA 4DLUA 3YASA 1ZJYA 1M2OA 3ZZNA 4MW9A 5FP0A 2IPXA 1T5OA 2R79A 1U1DA 4JJAA 5FPHA 1XEWX 2CFOA 4X62B 1QV6A 4FJ2A 4L3OA 4RA9B 13PKA 2QG4A 3GWZA 4Z4HA 3TZBA 1CQJB 2DBYA 3DZHA 4K03A 2ZB4A 1ADJA 3H8WA 2O5CA 4G1MB 3LF2A 2R00C 1DEAA 1MB0A 1DWOA 1N2CB 1D2RA 3LLSA 3M4YA 3IRUA 4JP2A 2Q1WA 1JG6A 4OHKA 1Q95A 5ADHA 5J4KA 2ECFA 3M1LA 3D2LA 2JZCA 4CLRA 1JPNA 3LY7A 4MQEA 4WZ6A 4UHFA 1QIJA 4LZAA 4L78A 1N6NA 1TKAA 3RIYA 3TZEA 3P9XA 3CX4A 5K4AA 4IJKA 1XTKA 3A2LA 2WWHA 4PLZA 4Y6QA 5GVSA 3QI2A 3UPTA 1GN9A 2HPHA 1QFXA 3T3PB 3BSSA 3DQQA 2QL7A 1KEKA 4DPKA 3H84A 3PE3A 1J22A 3QBEA 1OB2A 3BJRA 2BZGA 4KQJA 2EKPA 3INRA 4R83A 4KFRA 4RTNA 2Q0QA 1EK5A 3I2KA 5DGIA 2ACWA 6PFKA 2PTHA 3O2JA 3WMRA 3FTFA 2FFBA 4NJEA 5E8RA 1K4YA 1OXXK 4XOUA 2L19A 4XDYA 4Q21A 1ZOLA 2C4KA 2X0EA 5C8YA 2GK4A 2WJVA 3SYTA 2C1ZA 2DPLA 4FHEA 1WG8A 3INTA 3W7VA 2ZI5A 3B8HA 3ZU2A 5LZ9A 1EVIA 4NBVA 1T2FA 2BT4A 4FDLA 3W9YA 4EG7A 1H2WA 4V0KA 2E87A 4BBAA 3T9FA 3RAGA 3UMSA 1Y82A 4EHAA 6ABPA 1AD2A 1NBOA 2XNSA 2H1WA 3KIPA 3DUFA 3AR6A 3FPEA 4RD0A 3VPDA 1G7CA 1Q84A 3H1FA 3KUXA 3M6XA 4CM5A 3IIIA 4I1VA 1NPTO 3BBLA 1J33A 4LMPA 3ZZMA 4F06A 5HRUA 4NS4A 3QBJA 4W5HA 1SCQA 3LLUA 4HFRA 4FX5A 4TTQA 5LP6F 3GJYA 1Y8AA 1K5DA 2WVHA 1Q50A 4FEGA 4GM0A 4IL5A 4TUYF 4Y0AA 4DLSA 3KR9A 5A3RA 3IIKA 1KQGA 4A36A 2O59A 3G2LA 3IEVA 1JI3A 4NOKA 3JQ9A 4XGQA 2V5AA 1RJWA 3RG2A 3E8XA 1Q44A 5FTKA 4BFWA 2V3CC 1EA7A 3GGCA 2XAUA 3FCAA 3KYBA 4HC4A 2OZKA 4IUYA 4XI9A 3W0LB 3MN1A 2HUPA 3N0TA 3O4GA 1KDOA 1XN4A 4WINA 1XZNA 5FPPA 4R2XA 1Q17A 1J5PA 4LHVA 4OKIA 1UDWA 3L1JA 3OE1A 2KBFA 4UBOA 4ALMA 1FDOA 4B6RA 1KF0A 2HSGA 4JWTA 5LWHA 1DEOA 2A88A 4FGKA 1JILA 1XDGA 1AUXA 3U5ZB 1KK3A 3WRYA 3QVUA 3R3ZA 4IXMA 2YUIA 3V4RA 3IHKA 2FPKA 2GRUA 2ZS9A 2E4YA 1PQYA 4AJ2A 1UPCA 2GAAA 5D5QA 1OVGA 3H8VA 5KSYA 1JG2A 1M6VA 3BOSA 1BQ3A 1YDGA 1Z6PA 5I9BA 3RU2A 3F1KA 3ZE9A 3WL6A 2BTEA 1B14A 3V2UA 1U2ZA 3WGTA 1HKHA 1JFSA 2QX7A 2KYRA 4DSTA 4HQLA 3JAMA 2QRLA 3HCOA 1ZGCA 4HMQA 4M1YA 5EI5A 2FR0A 1DQSA 1KI6B 1GRNA 2DPGA 3HBFA 3AEUB 4P4LA 5TQ0A 1OOEA 5JAHA 1GILA 3JTEA 3LTNC 3NHZA 4R1TA 1PCXA 4RZ2A 4Q7LA 2V3WA 1WUTA 2WWXA 1NW5A 4HOYA 5K7SA 1JZTA 2WPNA 1VYHA 1ZCJA 1C3JA 4QYIB 4ZIRB 4UNIA 1TO2E 3NH9A 3NORA 4LYDA 4OO3A 4ZVMA 4WERA 2J9GA 5T3UA 4F8JA 2KS6A 6ADHA 5DHSA 4B3RB 2XMDA 4O4IA 1DV2A 4FT4A 1PFVA 1XQXA 4Q6BA 1MNQA 1RM5A 3HR7A 4WKCA 3AGPA 3SZOA 4PVCA 3H4TA 1HNZB 1H4VB 1OGJA 1X77A 2ARKA 2B35A 3T5GA 1DOHA 3NEJA 1L7VC 2LDBA 5MF6A 1COWA 5FYDA 3NC1C 3NHWA 4OUDA 4FINA 4PINA 2PT7A 1XHEA 1R5NA 2H48A 3QOFA 2XIQA 3KR1A 3KPJA 3HCRA 3IUSA 1X7GA 1T36A 2J30A 3C6ZA 3QJYA 4QUIA 1KJZA 4UBIA 5EJ8A 3WFJA 2V7QA 5I9TA 1NGSA 3JD0A 3MB5A 9LDTA 1KQPA 1JAHA 2V7WA 4GSYA 4LV8B 4U7PB 4ZAFA 5E2IA 4DJDC 4JIGA 4ETMA 2W98A 2A9PA 4MH0R 3H4IA 4P83A 4CMJA 1JQ5A 1Z6ZA 5AM1A 1Q0HA 4DV7B 3BHIA 1CWUA 1GHTA 1Q3KA 1VMDA 3HY4A 2R1TB 2XYRA 3PUKA 4FIDA 2D0DA 2Y1LA 4TN5A 1PS9A 4OHVA 1QJCA 1XB2A 4ZI7B 1DDOA 3PYLA 2F3RA 4YRDA 2F8SA 4MPDA 3MINA 3VTKA 4OH1A 4TQUS 1CXZA 3I01A 3OZIA 4L5IA 4Q3BA 5JSKA 1NVVR 2JIQA 1FOEB 2WJ4A 2VYQA 5L51A 3DG9A 5CA0B 1UFQA 1MZPA 1P2VA 4R7GA 3D8HA 2IFTA 1J1ZA 1R6VA 2C7GA 3K0FB 3K8ZA 1FK8A 3WHPA 5CCBA 3WLPA 1CCWA 3OPVA 4YQZA 3VJKA 4NYJR 2VS1A 4UEJA 3WOHA 4AL4A 1PGOA 3FLBA 4CEHA 1XA0A 4HGOA 2JBHA 2HRQA 1BROA 1CJBA 3A1DA 3SC2A 4PCUA 1OAOC 2VKTA 2HV9A 4PZEA 3KEGA 2GF0A 1SBCA 4BE4A 5J47A 1SRQA 4Q1FA 2HIMA 1AGRA 1P1FA 4A1FA 1E69A 1MG5A 1E2QA 1JXAA 1SVMA 3NH6A 1VCMA 2QP9X 3DMPA 3L05A 2UZ1B 2E5LB 2PZMA 3VPBA 4Z9XA 3H0KA 5FIUA 3T0FA 3AKYA 4GWKA 4AYTA 2VHUA 3OURA 2VG8A 2ZYGA 2CLOB 1ZEJA 2HPZA 1ULUA 3UAZA 1SUCA 1L5RA 1LGYA 1RRVA 2IVZA 1L3CA 2HNKA 1SZDA 2OO5A 2QJTA 2WRZA 2YQZA 4H1VA 2E21A 5I4KA 5JY1A 3D0QA 3SC4A 2ZRBA 4OVKA 3ADCA 2B2CA 2BKXA 4B44A 2P0EA 4YCAA 4WK4B 4NS1A 3U7GA 2C3OA 1XE3A 4G8JA 5E38A 1HLGA 2R6ZA 4JL6A 3PFNA 1M2NA 4G5XA 1ZW6A 4JSYA 4MUYA 4NZMA 2ZUDA 3HLYA 2XCSB 3RIEA 1RM3A 3W5HA 1TEVA 2V7XA 3IUPA 1TIBA 2C7PA 4TL9A 2JFGA 1R10A 2WKSA 4AN0A 4CUJA 1ZO8A 3IOCA 1NLZA 3D0KA 4X6UA 3UT5B 2KI5A 1P6XA 3H2YA 1E2NA 4O2AF 2HRRA 4YUXA 1DHTA 5JD3A 1FRNA 3NB0A 1U3CA 3P5BA 4G85A 4P31A 4UHEA 3NANA 4Y2VA 3PC3A 5T6BA 2ZYTX 2Q5LA 3P2KA 2O8BB 1BFKA 2CMFA 3L1HA 4EO4A 3STXA 2BGMA 4DJAA 4TYNA 4Q4HA 1QH9A 3TVTA 4F12A 1A4IA 1L4YA 3UC5A 4YJ3B 2H0AA 1QFMA 4GUDA 3W78A 5MGBA 1S4MA 1Y8CA 3TQRA 2IJGX 1U8UA 4XVRA 1RYZA 2GD2A 1X1SA 4M7PA 2VCEA 4C0XA 5F3RA 2QTLA 3TNYA 2IEAA 1QQ6A 5EHIA 5L3SB 2VZ0A 4Q1DA 1G8AA 4GMDA 3TFWA 3LH5A 4XWWA 3B20A 3KTOA 1NAHA 3ZJTA 2QJRA 5CT9A 5DEOA 4NYMR 5K4GA 4K2AA 1PE0A 5BVHB 3BE6A 2BCGY 1BHO1 4REQA 4B35A 1DO8A 3PI6A 1NQVA 4U2KA 3HC7A 3A6EA 4R1UA 1DJOA 5FBKA 1IDN1 3ZLBA 3TD2A 2PPLA 2O0MA 2DQKA 3LOQA 5EJIA 1RE0A 2GPJA 3CW9A 3DWEX 3SIXA 4RTSA 4UHDA 3RJ5A 4BDTA 5TE9A 3UOGA 4DEVA 3IPRA 1QK4A 4LFBB 1UWKA 2AJCA 4HWPA 1NN3A 2JFXA 4ZEMA 5TMBA 5JNLA 2J3EA 1K5HA 4X61A 3CEAA 4MQ6A 3FB1A 4RHCA 5G3YA 3A6FA 3SLRA 5FB3A 2FOXA 1K6MA 2VPWA 2YRWA 1SUIA 1MVNA 3TMAA 2GAIA 4AKIA 2GZAA 4QELA 2Z08A 5KNCD 1DIBA 3AIMA 2E4UA 2G25A 4B1FA 3A1TA 2OP0A 1WNFA 1TF7A 5ECGC 3AB8A 5JCJA 1DIGA 4UAUA 2IELA 2AK2A 4XD7A 4IS2A 5I47A 1C14A 3OUZA 4DXDA 4A8PA 3OCZA 3QX9A 3JAWA 1J2EA 2WF7A 2ROQA 2XTZA 5KSZA 1ZCBA 2E48A 1ZIYA 2Z8XA 1ENPA 1QAOA 3GUUA 1V8FA 3CMCO 3EVZA 3FGPA 3MM4A 4H3HB 4KWEA 3V9PA 2XAAA 4BWVA 4DC1A 5L6MB 2AJ8A 1E1LA 4F4JA 1GTVA 2A0WA 1L8XA 3NP7A 3UXHA 2R8YA 2BMEA 3B1VA 1T2CA 5U4XA 2YH2A 3PUVA 4GE3A 3EUFA 5EZQA 2ZRMA 5C8DA 2I03A 3IO5A 2BI8A 1S2LA 3FKQA 4HMOA 2C7QA 1JDJA 1TNDA 3HFGA 4RD2A 4HGQA 3RYCB 3MMZA 1KAHA 1H8ED 2V96A 3DBLB 3E1GA 3EZLA 3FBWA 3QV1A 4MI3A 4RPJA 5ECYA 2ZYRA 4QZVA 1Q92A 2PQMA 2M1XA 1QHGA 1W6UA 3FZEA 3KDAA 2CD7A 4NBNA 2QR3A 4DCVA 4ZQGA 1P18A 1WPQA 3WXMA 2QN6A 5C5CA 4R40A 4E5DA 1WDWB 5DLYA 4DMLA 1C1XA 5AUOB 1ZX1A 2JFUA 1HTBA 1WOYA 4GE0A 4AJJA 5DFAA 3R76A 1R3UA 5JY6A 1ISIA 4BZWA 2FX2A 4RYDA 2AL7A 3B70A 4HB3A 1B4DA 2YRFA 2TMKA 3GB9A 3NXKA 3WX0A 2Y2UA 2M32A 1G60A 2WIGA 1XVUA 3B6JA 4KFUA 1E60A 1YDHA 4B4DA 4DM7A 2C5HA 2IL1A 5B36A 9ABPA 3FZGA 1JJFA 4Q02A 2BEWB 1X1EA 4CZ2A 1EX9A 1PW5A 1NBMA 2GN0A 5JC8A 3ISJA 1N5KA 4IO0A 3PHBE 1YV9A 1V8OA 5J1SB 2BHRA 4UHCA 4XJVA 4I50F 5CMLA 2OA0A 4BY9E 2AUTA 3GEIA 4I9GA 4RESA 4BOYA 4HDQB 2CL0X 1JBEA 3V8EA 1O58A 1ILWA 2A6PA 3R3SA 4NH0A 1Q57A 5B1IA 5HZMA 5I9LA 3C3PA 3DBHB 1NVMB 2YMQA 1SCUB 2CHEA 3IV9A 2R87A 4JZYA 4BATA 4BKPA 1AXGA 1K86A 2ZJYA 4LHEA 421PA 4BZQA 3BF7A 1J1UA 1G66A 5CVTA 2AF3C 1WXWA 4IV8A 3DP7A 4HFMA 4TVBA 3U80A 2WU3A 4C5AA 4Y6RA 3A27A 4HNRA 3SICE 4HAXA 3ZI7A 3ZTYA 1QQBA 4N9WA 4Q1AA 4YJ2F 5DO9A 3VZPA 5AQEA 2VJOA 2B7BA 2NG1A 2PZJA 4IDQA 4Y9SA 3FCSB 4COOA 4GGPA 4AZ0A 5L3QB 1RQ7A 2FCRA 1BCRA 1N2SA 4QOHA 5KHLB 4CUKA 4M8SA 1TVKB 2VYVD 3U7QB 4MRMB 1CP3A 1E6UA 3M7IA 2IS4A 4BV2A 2O2EA 5HILA 4F7DA 1V7QA 5EUMA 5DWQA 1X7WA 1O08A 2ZGVA 3K0AB 4Q6WA 1XK7A 4D1YA 5LXTB 3FNQA 2Y4OA 4BV8A 1H2FA 3LC0A 4YT2A 3S5UA 5K6TA 1XTJA 3KB8A 3NHKA 1W29A 2QVBA 3VR6A 4C01A 1FFAA 3V55A 1IULA 1U3FA 4QHSA 2REQB 1C4OA 1N4DA 1OIVA 1XD9A 3HV0A 4EG5A 4RV5A 4UOQA 3AR2A 1J20A 3BAFA 1Q91A 4FQ7A 5K0ZA 3HKCA 4H1TA 1US8A 3Q7QA 4R3WA 1MW9X 5DBOA 4FOTA 4AMUA 2XBUA 2V45A 4Z5XA 1WMEA 4A15A 1RAAA 1HEIA 3L4JA 1EWVA 4UU7A 1UAYA 4KBYA 3LSTA 4TRRA 2O14A 2ZRNA 2EFDB 1AO0A 5I6DA 5JMOA 1K6JA 2FZKA 3L7KA 3RS4A 4P2BA 5HKAA 1YZYA 2AMLA 3S1LA 2V54A 3CURA 3ESCA 2CNLA 3LL4A 3QFSA 4GXQA 4JOBA 4XUCA 1WEKA 2I7TA 3DF9A 3E7XA 5LIRA 5ITSA 2AW5A 5GAJA 3AW9A 1L7EA 4QECA 4HPJB 4N82A 5CYOA 3RARA 3VXKA 4QFDA 4ZXPA 3TLYA 4AZWA 2EP7A 1C7JA 4NXMB 1ZKDA 2VRCA 3Q11A 1L4KA 2E37A 4AI6A 1G9SA 2IPNA 1ZHHA 3B1XA 2DR2A 2GXAA 2P3QA 3SZMA 1Z26A 2WM8A 1M1YE 4RK5A 1AZSC 3RFUA 4MS4B 1UC5B 1Z17A 1ZN7A 4YAIA 2O2ZA 2IUYA 5HFJA 5JROA 4QDUA 2D5IA 3NHSA 1PVOA 1IY2A 1JHDA 4R1MA 2DHRA 4ZCRA 3ZD6A 4R8LA 3QFFA 4P22A 2XMPA 3HO8A 1E8NA 1JHMA 4HNQA 1CZRA 1DX4A 3OAAD 4MWBA 4MKGA 5AKHA 4A0GA 5JLJA 2F8MA 4U2EA 4KPUA 1UBGA 5M7EA 1YZ3A 2ADMA 2Y67A 3GLFE 1SQ0A 3A9CA 4IGIA 2QDKA 2FDRA 3BRWD 1RQPA 2HRCA 1TGVA 1E9BA 4QOSA 5M5BA 1ZEMA 2QM0A 2WU0A 4HK4A 4MNTA 4OOFA 3RHFA 4W7IA 3K94A 5CIYA 1CUYA 4WVLA 4L6IA 4LOAA 1IEQA 3GMTA 2C92A 3W6ZA 2HHJA 4ZPJA 5EWLB 3Q2OA 5KX5A 2FMHA 2BN4A 3ZQJA 3BERA 4DR7B 1EZ4A 3R9KA 4G2NA 4GI7A 1K63A 4IRMA 4LECA 3P9ZA 4ALIA 3PNMA 1UMBB 4CMEA 1LNSA 5DX8A 2BONA 1ST3A 4OMFG 2EDCA 5FL7D 4JEIA 5A3QA 1SXJC 1TIKA 1IDOA 3QUSA 2NTEA 4KKXB 4MR7B 5FO1A 2IXEA 5TDHA 3V1TC 5HF6A 5CT8A 3B6IA 5JISA 1V16A 1E66A 3E3NA 1P3JA 3ROGA 1PGNA 1VB5A 4XLLA 2AX4A 2VPTA 3TECE 4TKUB 5KWSA 1P62B 4BLVA 4CTNA 4WUTA 2HO5A 2QW0X 4JUBA 1EIWA 3DLPX 4QRDA 4F6LA 3CKMA 2AFIE 1B74A 4NPCA 4PHCA 3DYIA 2M6RA 4INAA 3QMWA 4JNCA 5DXAA 1KS2A 1R4NA 5EGNA 4IMIB 4KACA 4IDFA 1R8QA 3BWDD 2C0QA 3TQQA 5AW2A 2RB4A 2CFSA 4Y2TA 3VPHA 5BORA 1R8SA 1W88A 5T4EA 1YZQA 5BYKA 2OZLA 2ZE5A 5EEHA 4UDNA 2C88A 4CFZA 2X8AA 3O03A 2NSYA 5DCYA 1Y6RA 3NGXA 5ADVA 2FETA 4YMSA 1CERA 2WA2A 3FNRA 3N0WA 4F4IA 5KTMA 4UAJA 2O3RA 4RDHA 1YZLA 3MIZA 2JAXA 2Y1WA 4EF4A 2A9JA 1WXXA 2Y0PA 5EFZA 2CEKA 4B45A 3ADOA 4MHOA 5CH8A 3KVOA 3LGXA 3KQVA 3PQ3A 2E9SA 3D8NA 1DIRA 1P4RA 4KVFA 2YV3A 1U0OC 3L46A 2DE0X 4V3CA 2J0UA 5ALSA 3HBMA 5J9FA 1KYXA 1JSXA 1DKNA 3DUWA 1LSUA 1SOVA 5AO9A 3DBOB 1AQYA 2ECOA 4TXJA 1X1RA 2IP4A 5I7EA 2P35A 3ON5A 5JJ5A 5EQJB 3NEAA 4ZOLB 4WNYA 3KD2A 3RUCA 5JANA 1EP9A 1V1RA 3IDSA 1JAXA 3QFHA 3WAKA 2VDKB 3A4IA 3KRTA 2L2QA 1LXCA 1TRKA 4QOIA 2VNAA 1K8YB 1VXOA 2BGTA 2W2KB 2O57A 4DM3A 1ECGA 1E1KA 1HZZC 2P9GA 5ALYA 2RB5A 2WWWA 5GGYA 1QU2A 4IIJF 3C6XA 3JQGB 4KQHA 5DN6D 5KO2A 4BO8A 3A6PC 2YMPA 4FMDF 2YOFA 4XAQA 2CLFB 1GSHA 2WIAA 4HZUA 3ZZ0A 3CZ4A 3H17A 5JQGF 5BNFA 3RBVA 4ZDKA 2O8DA 4DAEA 1MIHA 1ZCFA 3FPBA 1UIMA 4K87A 4IIUA 2WUGA 2CJWB 4I4NA 3SQDA 5KMGB 3T1YB 4QXAA 3LXRA 1IG0A 2JGNA 2O2DA 4B3HA 4XJTA 3KS9A 3I8SA 2CXTA 2IUFA 1ATZA 1OZAA 1XNGA 3FFWA 3ZIAD 3LUKA 4LZWA 3EFOB 1AA6A 2X0DA 1IRIA 1OASA 1XQ9A 1W0KD 4F45A 1Q0PA 3GZJA 3CZCA 3H7IA 3K0CC 4D3SA 4D74A 3O9MA 5AW4A 1BXZA 2ZJ8A 4X66B 4PAOA 1I7NA 4MUGA 5IANA 1AXEA 4UEKA 2QTRA 4Y6LA 4BEWA 2O2CA 1J8MF 3C48A 2F1RA 3NVKI 1AMNA 2ZM6B 3GRRA 2WOOA 3KJHA 3PIRA 2QW8A 2OAGA 5LZ5A 1N8NA 2M9MA 4LHXA 2ZIXB 1RD4A 2G08A 2ZI9A 5KQGA 3WLMA 4GSLA 4FB4A 3F2IA 2X6TA 3G2NA 2VZ9A 3WL3A 4MPRA 3KQTA 4DLAA 2DQSA 3FOWA 2ERCA 3KQMA 3HVIA 4LOIA 2QR5A 1PT6A 3MOGA 1TL7C 3GBVA 2HA0A 2V59A 5LA6F 4YRLA 5HWSA 3U0BA 3WQHA 3JQPA 5JJLA 5IXYA 2Q3CA 3BH6A 2EL7A 3EGVA 4JROA 1YR3A 4N8SA 2GLUA 2PL3A 1RM4A 3O9ZA 5IASA 1ORTA 1P29A 1X19A 2XD4A 5ENZA 4DBLC 2VNHA 1YNSA 5DN6A 4YCDA 4N01A 1ZJJA 1F4PA 3S1AB 3NAMA 4FKMA 4HEQA 4O2BA 4PFQA 4M1KA 5I9IA 1UODA 1A2OA 3M6AA 5TIIA 5GZ6A 5LD2C 3RH0A 1V26A 3K1TA 3MAGA 3R5SA 4MJLA 5TPWA 3T38A 5AQ1A 1GP2A 4TLCA 1Z6TA 2DWCA 2M1ZA 3WNDA 4HN4B 5MN6A 4BBZA 1QIFA 2DR3A 4QVKA 5KCMA 4DWOA 1AGNA 3OM1A 2IU0A 1RCTE 4ZQEA 5C4IA 3IE1A 2BISA 5IJ9B 1S5PA 1DFIA 4QAQA 3G49A 4JENA 2UYQA 3CNEA 3PEWA 3REGA 2FVXA 2QRHA 4OHCA 1XVVA 2QLNA 2GEFA 2FN7A 4ND5A 2V6IA 4KO8A 1NT2A 3T1HB 2C9OA 1ORRA 3VOAA 2PH3A 3CY6A 1NRXA 1QE5A 2WIKA 4C0LA 3S1SA 2O05A 3HS3A 3NBKA 1GXSA 2BMVA 2VAVA 2WABA 1QH1B 4HTAA 3SEAA 4QNNA 1R4ZA 1OWMA 2HK8A 3L49A 3UTCA 5I3ZA 4JZKA 3T9AA 1CIJA 3A6KA 3GOQA 2IGTA 3BGVA 4U3JA 4D7AA 1XLTA 3PQEA 1KYTA 5EIFA 5AXAA 5KBYA 2H1OA 3ZDXB 3ZLVA 1FX0B 4Z7OB 2GVDC 4A2WA 1QTNA 3QX3A 2PBRA 1FP7A 3FDXA 1EM6A 1W581 1Z5WA 4MUBA 1ZUHA 4DAOA 4UHHA 5K8IA 4HDMA 4C7OA 1KSHA 4A8JC 4E3ZA 2EGUA 3CB4A 4N39A 2OGTA 4HNVA 5KDOA 3ICEA 2IU3A 5FFFA 3ND6A 2PMFA 1WCV1 1W36B 1IPFA 1P72A 2D5BA 2G9QA 4TV8F 1C2TA 1KU6A 4PF1A 2XDAA 1JIVA 3BN3A 3IA2A 1UM8A 3LI2A 4RYLA 2FFHA 4UE6A 1DQYA 2CDNA 2PSDA 1VMKA 3IP9A 3NYWA 3RRYA 4HDRB 2RD2A 5HDQA 5BN4B 1U7TA 4WKPA 4JJIA 3O5AA 2NPFA 3UWDA 3H5RA 4CI0B 1NUUA 3HSSA 3PRJA 2H1HA 5HMMA 4CKXA 1H2AS 4E5VA 3QYFA 2R97A 3HUEA 1M2OB 2HB6A 1VXRA 4RK6A 4BJ1A 1OU0A 4E31A 5C8XA 1L4EA 5CB8A 1TYDE 4A73A 5DBEX 2R5WA 1J2YA 3PU6A 1T24A 4QBGB 3DH0A 1V9SA 4KQIA 3ABZA 1EAMA 3EGCA 5KAPA 2E18A 4KJXA 3UGQA 3WLLA 2QAGB 5IXSA 3F6YA 3EX7C 1OH5A 4RCVA 1C80A 4OLJA 4DSUA 3PF9A 2ODEA 4URVR 4GU5A 5BUCA 2GPWA 3AHJA 3OHMA 4FFNA 2HQSA 1D5WA 1UBKS 2DT8A 3A70A 2EJUA 1ZSNA 4LAFA 5FULA 5BW8A 3HACA 2F3PA 2YZGA 4QHYA 5FT9A 3BD9A 3ZWDA 5JC1A 3PD0A 2BELA 1AUVA 3G02A 1PQUA 4OGWA 1QYRA 4GO1A 2XODA 4KI7A 1K97A 4RDIA 5F12A 3OF5A 1BFDA 1EJ2A 2Q6OA 3K2EA 3F8SA 3ZW8A 1DRUA 4GSKA 4FDVA 2R8OA 2G82A 1EDDA 4JUAA 2PBFA 1B15A 4YJHA 1TJPB 1H65A 2E4AA 1G41A 2XGSA 2Q9CA 2RONA 4R9SA 1QHFA 3HR8A 4NU6A 3EZNA 1M8PA 3Q3VA 1W30A 3CYFA 4L3VA 1HFJA 4Y2GA 1JBKA 4QPDA 1ZM3A 4RY2A 1VKHA 1ZVKA 2QMOA 2GR9A 3DULA 4FZJA 4EX6A 5C8YB 2NQTA 1J49A 1Z2OX 3NETA 4LI3X 3N0XA 5HJ2A 4I1UA 2X22A 4ML3A 1CYEA 1GPKA 1J70A 5IC6A 3I9OA 1JYSA 2MIIA 3PWTA 1XGKA 2HJHA 1FNCA 2VNKA 2JRLA 4PNZA 4EI2A 4X92A 1WQ4A 4E03A 5CJJA 1NPYA 1C2YA 2FSGA 5AKZA 4B34A 2DPXA 4MULA 1NVEA 3E3AA 1KQOA 4Y7CA 2H51A 1EVJA 4ZARA 5EWMA 4QLBA 4BMXA 1TX4B 3DUFB 1QHYA 5EERA 3J7AC 5JAPA 1GFWA 2ZTHA 1NXVA 4YT4A 2ZRLA 1TLLA 2ZBQA 4W63A 3SBOA 4M76B 1HYEA 3MG9A 3GDHA 2VRBA 1B1CA 3LWDA 1DG3A 1T0HB 1G5IA 5CJPA 4NE2A 4K6KA 2WT8A 3D6TB 3H04A 2J7PD 5LVAA 2W6ZA 2NUTA 2ZJFA 3RUAA 1E63A 3UH0A 1C3VA 3RVKA 4B73A 1YS1X 1BJTA 1XKLA 2HNAA 4GPAA 5CBKA 4N18A 3DOUA 2JAHA 2VEOA 2W93A 1M0TA 5JASA 3A14A 5KPDA 2P9TA 4H1WA 4MP3A 5AK6A 3HVKA 1JEAA 4S1TA 1E0JA 1P2FA 1GA6A 2GX6A 1EX6A 2I6SA 4IDHA 4MW5A 1SK8A 4N5MA 1U7UA 4BZXA 4MRAA 1JFRA 3HDGA 4EJ0A 1Y5IA 4U7DA 4MIEA 2JLUA 3RTEA 5HM6A 1F4VA 3S5JA 3AH8A 1XIVA 1JG7A 2FEXA 4MRSA 4UQPA 4Y1FA 3B5JA 1DPGA 1KI3A 4UM5A 2H1FA 1FFCA 4RK1A 1AK1A 4RXUA 2JFNA 1LTHR 4ZDWA 1Y9DA 4D4HA 4G4SO 1M6VB 1C8VB 2R7KA 1H5UA 4YJDA 2G71A 2FHPA 3UHPA 1REQA 5G53C 1I3LA 1Z82A 3PNQA 4DPLA 4J4BA 1JSRA 2I9PA 5HS4A 1I80A 3F6CA 3AX6A 1RLJA 3JZIA 4MA5A 4PX2A 4RFSA 4Z0TA 2Q8NA 4MV6A 3NNDA 1NWHA 5KAMA 2QSUA 3GVIA 4FMCF 3S4YA 4B2YA 1X3SA 2COEA 1EIZA 1BH2A 4N9QA 1POXA 2X7XA 4TL7A 3BXZA 1FUIA 1RRMA 4BDSA 5LP6A 2B1GA 1YFKA 4YRAA 5JD4A 3BZBA 1AUQA 2QZJA 2VJMA 5IZ4A 4TUYA 4N3AA 5FLYA 5HMLA 4EG3A 1VIYA 4ZVLA 4LXQA 3UNXA 3B1WA 2F8LA 3QPDA 4DTIA 3T3IA 2JATA 1JWAB 5CVDA 4DLLA 3HMKA 2GYWA 4O4IB 1MPTA 1J2UA 3T1VA 4DMUB 5K3EA 2RGEA 2E6UX 4KW7A 1E58A 1LLUA 5IG2A 2G9ZA 1AGYA 3EDRA 2L69A 3ILHA 5CIQA 3QXHA 2HMYB 5EQTA 5GPBA 4OUDB 1RRPA 2R1UA 3COPA 3W5VA 3SC6A 2W6PA 2CF6A 4ZYXA 1VP3A 4P3YA 5IABA 3OFVA 1T36B 4L8FA 4MGHA 4X41A 4M0MA 4WH0A 1Z0FA 1PK7A 5PNTA 1C7IA 3PNOA 1T34A 2RH9B 2ZIZA 3CNNA 3HKBA 3OVMA 5GVRA 2G1JA 3QLUA 3BZWA 1L5QA 2YZNA 1VLMA 2QTAA 3VNRA 4NMXB 3JZAA 1EDZA 3RUIA 3SS8A 2JFHA 4BYMA 3ZGXA 2EW1A 4LFAB 2BUBA 3H1GA 4B84A 4S24A 1XTQA 2IIPA 1BD3A 1DLIA 2DLDA 4AURA 2X77A 1KOFA 1TIPA 3MINB 4L16A 1B3RA 2R4UA 1VLLA 2XMBA 3AB7A 5GADl 1BZYA 4RACA 4OXKA 4CETA 3SOPA 2IYOA 1T6BY 2B34A 5THQA 4Q9IA 2O8BA 2QZPA 3SCZA 2FJ0A 2H52A 1K3UB 1KC3A 1GPH1 3WV5A 4AN4A 5IU6A 1NW9B 1RSZA 3IBTA 1J8VA 1ZBQA 1Q12A 1W1WA 2V4ZA 2ZITA 3M0EA 3C1OA 1Q20A 4OHXA 3UK6A 3RI3A 2OCDA 1V8ZA 3SC2B 3G82C 3AONB 4IICA 2I7DA 5EPOA 4JI7B 4IIDA 4Q12A 1GG5A 1Y7HA 1LK0A 3FCOA 3LUJA 2W9XA 3EW7A 1OBHA 3E15A 2XE8A 4NCJA 4EB8A 2PUDA 3NPMA 3ZWCA 1Q0QA 2C78A 1UZUA 1XV5A 4FE4A 5HEKA 3RTGA 3SHVA 5C52B 2KHZA 5BMOA 2Z1DA 4ZQBA 1ZUD1 4JEHA 4JHLA 3EQ2A 5GJBA 1JIJA 3TMYA 4B85A 1EHCA 2IIQA 2BFDA 2JHAA 5GIPE 5B4TA 2PLWA 3BFVA 4XYGA 5LLDA 2ZI6A 4DV2B 4QYSA 2V7VA 3DAYA 3NIGB 4GBED 3SYKA 4Q3DA 2NSDA 1XMVA 1Y9JA 4PNEA 4A1OA 4WV3A 3HJHA 1KETA 4IH1A 4B74A 2PIDA 2FWMX 1OT3A 4L8YA 3QUCA 3EXIA 2A9VA 2I6XA 1CZLA 1P3Y1 2UV8A 3GHHA 3C6MA 4FN4A 5FH9A 3QY0A 3UG7A 3OTIA 2RGNA 1D1QA 2DFPA 1PWEA 2O7RA 2VJYA 2VWPA 3JYNA 3KJXA 2C84A 3PX2A 2XE7A 3Q5GA 4H3VA 4WZBE 5HE8A 3S27A 3W2FA 5IBRA 4UMDA 3OZBA 4M0KA 5J5CA 1FTNA 1LFAA 1LNZA 1UBSB 2I76A 3MTDA 3SNKA 3T52A 4EFNA 4BS9A 2QD2A 4D0NA 1P1JA 3DZGA 4EH1A 2HFJA 1DCFA 5JI3E 2J67A 4NH4A 1IBCA 3W7AA 1ZPDA 3CZAA 2CUZA 2ODWA 2Q62A 2W0SA 4M87A 2GPTA 3ANMA 3DOFA 5EIXA 2C4MA 5EJ2A 4L5CA 4WUVA 3VV3A 3PVCA 3KUCA 1CU1A 3PFHA 4RSMA 4DEYA 2CV0A 2O2JA 4PM4A 1PL6A 1DIAA 4FBGA 5B1SA 4HH3C 4A82A 1TF5A 3ILSA 1MOSA 3PGVA 2ZI3A 4MKZA 1RPJA 2HGSA 5CEEA 2EU8A 2C9MA 3HU3A 4GYYA 1TUBB 3I2FA 3ORHA 3CW8X 4PLPA 4D92A 2OZPA 5IH3A 3EYWA 2WWVD 3OQBA 3W4KA 1HYHA 2IU6A 3C5EA 4KQ2A 4GP6A 4HUQA 4NX2A 3VVCA 4ZYZA 5DCUA 1AG9A 2OVFA 3OQNA 1T25A 1QRSA 3G8BA 2AJDA 2HAEA 4B6GA 4X3OA 5LXTA 4EUSA 2C8KA 3T3NA 1TB4A 4ER0A 5AICA 1WF6A 3RLIA 3WDLA 1UXOA 1W0JA 2ASEA 2YHUA 3H16A 4XDHA 1U3VA 3EOAI 4KR0A 3VYUB 1EGHA 3FZQA 5FUYA 1ULZA 2JLZA 2QTVA 3FMFA 3PNKA 3V8NA 2VK4A 3R3YA 4IJVA 3OPMA 4YLEA 2H4JA 4IIYA 1N1DA 4FNGA 1ZITA 3FAKA 1RJFA 2ZROA 1WCWA 3G9TA 3FYHA 3VR4D 4EY6A 3A1UA 4BTLA 4Z1MA 1PG5A 3DKPA 3ISVA 4R05A 4O2AA 4V0NA 1RYFA 3L7NA 1XX6A 5FAXA 1AQJA 1KMIY 3L7YA 3PGMA 5AHOA 1T8YA 4RTRA 2ID4A 2FN4A 4DJJA 3VNUA 2HSJA 1B23P 2ZYIA 3HE3A 1CD5A 4OATA 5H3HA 4RVOA 1BW9A 1JP7A 1IL0A 3NPAA 2BY4A 4Q4JA 4UUNA 3CGGA 5FYQA 3ZVKA 2BC9A 3JAWB 3G1UA 3ZDFA 3H4VA 5IF9A 1CY6A 4NK5A 1TKBA 2CK3D 4BVEA 1XTBA 1BHJA 1IB6A 2RHMA 3I62A 2ZZMA 4Q4LA 1R6DA 2Q45A 3VKVA 3ZV6A 1G16A 2D2FA 4XM0A 1RYMA 1SHUX 4OLFA 3ZNQA 4NFSA 1IQUA 1F06A 1N8SA 2VLBA 4BKMA 5IT5A 2VXBA 4D4MA 3G9UA 1LJ8A 5E1BA 2B2NA 2OXRA 2XB2A 2GEBA 3QUTA 4JXXA 4EGSA 1KRWA 3NR2A 2YVQA 4MA0A 3JQEA 1WD5A 1PSDA 2BGLA 3DR3A 4A5SA 2AIRA 1SAYA 2CGEA 1IN1A 1RXIA 3IMGA 1XA4A 2A0UA 1XLVA 1XZJA 1B8VA 4L5YA 2JHGA 5FOTA 1R0WA 5FNZA 3PJFA 5F76A 1JYFA 3PUXA 4O4LF 1QOZA 5TVKA 5EJAA 3A4TA 4PYMA 2I8AA 3SXUA 3WLNA 5FTMA 3ZHUA 3VU9A 4BLTA 4PZUA 1YC2A 1U7PA 1LNQA 2JASA 4RMNA 1FVXA 2H57A 3JRNA 4RK0A 5KQMA 3UYKA 1H22A 4FYIA 5AK4A 5GZ1A 1L3BA 2WYVA 4WLVA 4CMGA 3DDWA 3EAFA 2H8KA 3GP8A 4D9IA 4WXYB 5AOBA 4OHMA 1O96B 1U11A 5SYAA 5MDHA 1IN7A 3W5BA 1PJRA 2ZAMA 1VL0A 2X2PA 1WSWA 4A6XA 3FMOB 1DQNA 4C7MA 4DMRA 1PFWA 4CMBA 1ATIA 1OFGA 2EKLA 5JFGA 2XB9A 4DE5A 2W6JA 4LJ8A 5JMWA 2DAPA 4QU8A 3O4JA 2FX5A 4G0WA 4G09A 1P5FA 4TKZA 4Y30A 4MCIA 1I2DA 2NW6A 2XGOA 4J16A 4EA8A 2QMYA 3HA7A 1O4WA 4LA4A 1Z2EA 5DLQC 4DKJA 5F2KA 4K6MA 6NULA 3ENZA 5K5EA 1NJ6A 2JIZD 5LFAA 1DTEA 1T3GA 4RPHA 1T9CA 4WCFA 1UP4A 2G1KA 3ESAA 1KRHA 2FW7A 2ZYSA 4INOA 5CAEA 3WQRA 1X8XA 2VFAA 4FQ8A 5LOVF 1YR7A 2Q4OA 3B9QA 4IUCS 3PNSA 5SZIA 2PY6A 3A0UA 1C9NA 3ANNA 3K2QA 4EABA 3RWBA 5A2GA 4MYHA 3AHIA 1PBNA 2GYUA 1QO0A 3KWJA 4A03A 3BFXA 2QE6A 3NRBA 3DMHA 2CDCA 4WDQA 1JHQA 1NT4A 2VT2A 1QGAA 1GGEA 1FL9A 221PA 4Y9RA 4RTMA 1GPMA 3DLTA 2O3SA 2K7FA 2RGCA 1F14A 1FDVA 1QX3A 2OSVA 2HDHA 2ZLBA 3CF6R 4JBWA 4ETIA 4J3JA 5J4HA 3ACBA 3F0TA 1XTIA 3N53A 3BCSA 2PV7A 4PGAA 1E2JA 2CC2A 4ZMSA 3BMOB 1N6HA 1NR1A 1FLNA 4FCCA 4JJFA 2PYDA 5K8UA 3ANSA 1S8OA 2WNIA 3E9RA 1L9KA 1U28C 1ZISA 1ND5A 3FGNA 3PCXA 3STVA 1TU4A 3CW2A 4UVDA 4MQMA 1NNI1 2HJRA 2CF5A 3BK2A 4DV4B 1QQ5A 1LS1A 3MYRA 2M98A 2WV7A 4QU0A 4LIPD 4JB3A 1JEYA 1XBTA 4I50A 2W6CX 4PGHA 1JA0A 1MH1A 2QPLA 3RSGA 2HZ7A 3OIGA 3HKCB 3QXJA 3GJ0A 1US8B 2QYOA 4P38A 1NXOA 2G70A 3K0EA 2WPDA 4RHEA 2O23A 5A71A 1IZYA 3L0SA 3AFGA 5FOVA 3DE3X 2ZETA 3F3SA 1GUYA 2Q4DA 3BORA 3O8BA 5TF4A 1ZAYA 1TTTA 4L0MA 3LVRE 3OSUA 3FPGA 4BAGA 2Q5FA 5J43A 5EHXA 2K7ZA 5LMCA 1PBTA 1T1RA 1GL9B 2HA3A 2EZTA 2QRGA 5K8CA 1YJBA 3MA0A 4LDZA 5HZGA 1UBUS 1Y4UA 3MNFA 4OI2A 4GM4A 2FZLA 3IVAA 2GBLC 1T3SA 3AFIA 1ODFA 1SB8A 4XFDA 1S3GA 1AKVA 1CNEA 1N92A 1EFHA 2J6HA 3FCYA 4KN8A 5DI9A 4YJ2A 3BGOS 3ZE0B 4Q9NA 2WTBA 4MV0A 1G6HA 3N39C 3PYMA 4K9LA 1TCCA 4AJ9A 1JFFA 1CFJA 2BZ0A 2TMGA 2ZBVA 4U8HA 1CUBA 2OLJA 2MSKA 5FA5A 3HV2A 3SF8B 2EQAA 2G9NA 4YN3A 1FLAA 1Y7LA 5DLDA 2R6HA 3VHLB 3EPJA 1H6DA 1JWLA 1YBFA 3A3KA 1QBGA 3C2QA 4WNCA 2IF2A 3LVQE 4B40A 5DNCA 1XAJA 3TTVA 2J5QA 4K05A 2NTJA 1V9LA 5E7QA 3K0HA 3IC5A 1TQ8A 1DRVA 2B1QA 3KTAA 1LRLA 4PTYA 4EJ2A 3C6BA 2DFTA 2H1VA 1DDGA 1QLWA 1L9XA 1QH8A 2F17A 2O4UX 3FI0A 3GG9A 4UARA 4R2JA 3WR5A 1E94E 3NVDA 4YECA 2R68A 2RKWA 5DYWA 2B5OA 1YHYA 1RC8A 3C3XA 4URXR 4Z4IA 2AZDA 2VF8A 1ZGAA 4HT3B 1MNAA 1XI2A 5HPYB 4DF3A 3AOEA 3PDJA 5DX1A 3GLGE 2C2KA 4P4GA 4IXDA 3A6HA 4GI3A 4TTVA 4XB1A 1UP7A 4CKCA 3N3BC 3HR4A 4M7OA 1SGWA 3OECA 3DZ8A 5KX5B 1JX6A 1TZCA 4R0NA 4UBMA 4R2IA 4L76A 4NNPA 3RHSA 4ZMBA 1HOXA 2PX0A 1JR3E 5KYVA 1MAVA 4HXGA 2MYPA 5E9WA 2G40A 3OHPA 2QJFA 3AJ8A 5EJ9A 5IHPA 4HAWA 4X1YA 1Z34A 3PXBA 4YP1A 1DC5A 4BJHB 4HL6A 4ZT3A 1ULSA 2EEPA 2XQKA 3IEIA 1UBOS 4A26A 1V16B 2FQ1A 4HO1X 3GNSA 3RHTA 3ROTA 1OYWA 2OCBA 3D7RA 4QDOA 2A78A 3CUKA 2GK6A 2VWHA 4EYSA 2GCOB 4O1HA 1YQ9A 1RPAA 2WUDA 3LC7O 4W9NC 3ZHCA 3S8EA 1CR2A 3F3YA 2WFLA 3PLNA 2XUZA 2OE2A 2RK6A 3A2NA 1CDOA 1XCLA 3D8TA 4K1XA 3LUGA 4GWGA 4G1CA 1HLFA 4K9SA 1R4NB 1U8TA 3JYPA 3NQ41 3TAUA 1NATA 1KEPA 3AKEA 1KI7A 5LQSA 1WXEA 1KEVA 1KI1A 4DIUA 5IKEA 2HT1A 4KFSA 4U9IS 3NTRA 3QX7A 4UUPA 2HIHA 2ZAGA 3GRUA 2OZLB 4OQMA 4E0BA 4DJEC 2IEZA 1FUEA 3OQHA 2Z4RA 3K5PA 1BJRE 2GESA 2XF8A 1C8BA 2ATIA 4PZ0A 3S2EA 3TSYA 3OEED 2HMVA 2JA2A 4RKWA 4J2HA 1ES9A 5B2ZA 3A05A 5LUAA 5D7BA 3HYCA 3NDBB 2GA8A 3DEHA 3L93A 4XQEA 5DVZA 2X0FA 2E0IA 4F97A 2O06A 4DCGA 3U6KA 3DZJA 1E6CA 2E4WA 2X5KO 3ILXA 1U4SA 3LBFA 1XDBA 4M0EA 3HLKA 4KQEA 1PEAA 2A57A 5LB2A 5IWAB 3E3LA 1CJTC 3AY7A 3AB3A 2EX0A 4JXJA 2J0UB 5E95A 2FF5A 3OZTA 2ODBA 5THXA 4C05A 2YN4A 4BCDA 5ADWA 4CJXA 1FF9A 2UAGA 3FPFA 5AOCA 3I9FA 1A5TA 2JD1A 1IWPB 5DXJA 4CW7A 4HB2A 3JXEA 4QUJA 1V1RB 4BVAA 4CIBA 2JFVA 1ADYA 1O6FA 4K0RA 2XRYA 4J0EA 4LSMA 2OBFA 4GOXA 1KY5A 3STTA 2FUEA 3EN0A 4HQOA 2QLJA 3DKRA 3L7CA 3PQDA 4FDTA 1JJVA 1JECA 2RJNA 4YVFA 3RTAA 4DY6A 2YXBA 4F9FA 1LTQA 2O50A 3D6JA 3U2QA 4YRKA 4L85A 1PAUA 4DMHA 2PGNA 1W4AA 1VSUA 4HZUB 4CDRA 4DSZA 5A5VA 4E12A 3NU1A 5L6LB 1XPOA 4IEIA 3GIWA 2O8DB 7MHTA 5D00A 2VOJA 2XY4A 1DB3A 4RPGA 1HSZA 1U0HC 1Q1AA 3HDTA 3AY0A 1NVFA 3Q9NA 4W5WA 3SMQA 3PHHA 3F5FA 4QWMA 3T6KA 2XWJI 1UAGA 3DZKA 3VR5H 5D51S 4RIIA 3P94A 1OYVA 2C5AA 2IDMA 3EIQA 3UWPA 3KVVA 2WU8A 5EMMA 2WZDA 1E2GA 2IYEA 2KJQA 1VZ2A 4L9RA 2PH1A 5GV7A 3LBYA 2I1LA 3VPGA 4CT5A 1E9AA 5ALDA 5FAKA 3FWPA 3LP5A 1WDLA 3PS9A 2ACKA 4TV9F 4YV0A 1M66A 3CBGA 3FYUA 2QV0A 3M3HA 3NI2A 1LV8A 2Y0DA 4Y2UA 5EYPA 3S6JA 1UJMA 1OZHA 3KKKA 1DBWA 2V65A 4AP5A 3EYAA 5FQOA 4D9MA 1EYZA 1N0WA 1Z5OA 2Z04A 2Y76A 4MUMA 3IQZA 3PNYA 1E3SA 1T2DA 2Y68A 3KAJA 1TXGA 4N5DA 5TJ9A 3MUEA 2O8FA 3SQWA 4L5JA 1VG8A 4O4JF 4HNHA 1AK9A 1JR4A 1R66A 2CHUA 2FRDA 5EMHA 5HFAA 3A1EA 1XPUA 4OB6A 4IEEA 2WDPA 1EGAA 2PUWA 2G72A 4I4IA 4IIJA 1VECA 3ZNNA 2X1LA 3G5LA 1D4FA 4R8SA 4DCMA 4RUKA 4H16A 3RS7A 4EZBA 1DMSA 3ZN2A 5CXUA 3TX6A 4OXRA 2R8PA 2ZT8A 3DO5A 1KXZA 4KQ6A 4R8VA 3VR0A 3RSHA 3VYSB 2NZVG 4N3NA 2GK7A 1MGPA 2C97A 2ZPUA 3OLXA 4A16A 2EBWA 1O94C 4B48A 1C7EA 1T13A 2A5FA 2JB9A 2ZKIA 3FUVA 5DWDA 4CFSA 9ATCA 4FHCA 3MJFA 3EXEA 4M83A 3KXIA 2OD2A 3OICA 3QWIA 3G9ZA 4FHFA 4R31A 3SKXA 1LBQA 3OBIA