1MJ5A

Linb (haloalkane dehalogenase) from sphingomonas paucimobilis ut26 at atomic resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26 at 0.95 A resolution: dynamics of catalytic residues.
pubmed doi rcsb
molecule keywords 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 112
structure length 297
sequence length 297
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mj5A00
1CR6A 2V9ZA 1MN6A 3IBTA 4QDTA 3P2MA 5KWIA 3I1IA 5BV7A 4EUSA 5HKBA 2XDWA 4PW0A 3AIMA 1XQWA 3QMVA 4Q3OA 1K5PA 3H18A 1U4NA 2HDWA 4DMFA 1QONA 2AJBA 3G0IA 4AN0A 4MQMA 5AHXA 2XUOA 3FLBA 3H2HA 1WB4A 2OQIA 1YAJA 1DX6A 5LKAA 1JFRA 2I3ZA 4B6GA 3N0TA 2WIGA 4X71A 5AKIA 4J0GA 3CCBA 1BCRA 2HFKA 3OG9A 3I28A 5LZ4A 2PBLA 4KRYA 1H23A 4EBBA 3K9BA 1AURA 2DHDA 4U2CA 5EFZA 4BVJA 1X2BA 3WK5A 1QJ4A 1ZD5A 4UBIA 4J0CA 3HJUA 2ES4A 5CT8A 3G9XA 4QE3A 2ZYRA 5HF9A 3UMJA 4H7HA 2GYUA 4X6UA 4RPCA 5K3DA 1HPLA 3F98A 5AKGA 3C45A 4EB0A 1LNSA 4BTVA 4AXBA 4AO6A 1OCEA 4L0CA 4K6GA 3VXKA 2GZSA 2WIDA 5C8XA 1MAAA 1CUHA 2WJ6A 1DQZA 3KDAA 4AMZA 1D07A 5LZ8A 4BYMA 2WU3A 4FMPA 4BAUA 3OPMA 4NS4A 4W63A 4BTLA 4U2EA 1FSSA 2PU7A 2PL5A 4U2BA 4B9AA 2DQZA 1EXWA 4Y2YA 2WG2A 2CUTA 3WMRA 1JI3A 2Z3ZA 3ZLVA 4UBKA 4DSAA 2XI4A 5JAPA 1WHTA 1ETHA 4YX9A 3KOOA 1R9NA 5I8PA 4QDZA 2ZJ7A 4X95A 5LP1A 1ODTC 1BRTA 3WA6A 2AJDA 5ALWA 1J2EA 1W75A 2QUAA 3X3HA 4J0HA 4J03A 3I2JA 2G63A 5A2GA 1SFRA 2AXEA 1B6GA 4UHBA 5CURA 4WY5A 5C81A 3AIOA 2YYSA 2Y1KA 1ZJ5A 2OAEA 5ESRA 5LZ7A 2HA3A 1CUAA 3F9CA 2GBIA 4I19A 5ALUA 3VJLA 5A7HA 5JD4A 2DCMA 1XZIA 2WM2A 2WUEA 1DINA 3STTA 1ZJ4A 3CCCA 4IO0A 5AM5A 3Q8WA 1IVYA 1AC5A 5ALMA 5EIHA 3HSSA 1R3DA 3C87A 3WL5A 4IH4A 3WWDA 4H77A 5HFNA 1XLVA 1TCCA 1MJ5A 1NU6A 1AKNA 4WFIA 4UBOA 3O9VA 2CB9A 5AJHA 3MUNA 3ZWQA 1EK2A 5IVHA 4X97A 1CPYA 3DD5A 3O95A 2FX5A 4UBJA 5AKJA 1CUYA 4AN1A 4ZGBA 5AKLA 1VE6A 1H22A 3EIOA 2XUFA 4ETWA 2WQZA 4BCDA 4NVRA 4BZZA 5HQ3B 4Q05A 5I7UA 3FSGD 5A62A 1UKBA 3WI7A 3T52A 1CQZA 1XZCA 3WL7A 1XKTA 3EBLA 4G8CA 4DMHA 1PJAA 3FVRA 1I6WA 2XQIA 2JEZA 2CJPA 3WK6A 5JATA 1DTEA 2BFNA 4BC1A 2WFZA 3TEJA 4XJVA 4A16A 1EK1A 1QFSA 3HYSA 3NWOA 3O4JA 2DHEA 5AKXA 1AMNA 1AGYA 3BF8A 4K6HA 2QTBA 1PFQA 3H2IA 1XRNA 2JGJA 2EDCA 4FLMA 4GBGA 4I4CA 3QZUA 2JGMA 1E3QA 2LIPA 3ZV7A 1CUCA 3DYIA 2XB6A 4Q82A 3E4DA 5KREA 4J7AA 2Y2VA 4LYDA 3DOIA 3IUMA 1A7UA 1QIFA 4YASA 4G9GA 5IVIA 2IITA 1TK3A 1BN6A 1XZMA 1CUWA 3FLAA 3PICA 1VJ5A 5AM1A 2C5FA 1TQHA 1GGVA 5D3KA 4DM7A 2QT9A 2JGEA 5AM3A 4G4GA 1BE0A 2XMDA 3VKFA 3LCRA 3WWOA 1DQYA 5YASA 2BUAA 1HLGA 1JJBA 3G0CA 1P0QA 5JAOA 4OPMA 3BXPA 5E4TA 3I2FA 1DWPA 1XLUA 3CXUA 1OXMA 4GXNA 4FBMA 2R8BA 1ISPA 1Y7IA 4KE9A 4PQEA 2FJPA 2J4FA 1LPSA 1ZGCA 1L7RA 2QXTA 1QIMA 4HRYA 2XUDA 2EEPA 4CCWA 2HA7A 1VZ2A 2VAVA 3F8SA 5JANA 7YASA 5AICA 4Y2VA 4F0JA 4K6KA 4WFKA 4OU4A 1K63A 2ROQA 1TCBA 4KEAA 4DNFA 5FP0A 1FJ2A 2G5PA 1TKRA 3G9ZA 4P92A 1CUVA 4BAZA 3E1GA 4B84A 2QOEA 1EHYA 1ZI9A 2VA9A 1UKCA 5AKZA 5LIPA 2ZYHA 3FCYA 3M81A 1K4YA 1QTIA 5AK5A 4UHEA 4BB0A 4UBMA 3RK4A 4LKOA 5AM0A 3KWJA 3FVTA 2B20A 1ZOIA 2BCEA 5EHNA 4UFNA 3S8YA 1UT6A 2ZYIA 1CUFA 3WKAA 4J0DA 4XIIA 4OD0A 2J3QA 5HF5A 2Z8XA 1SC9A 3C70A 2HU5A 2RONA 2ZJFA 2OGTA 1CUZA 1BN7A 5LZ9A 3O4IA 4EY8A 1BU8A 1EDDA 1XRLA 2VF2A 3WLAA 5IKXA 3QM1A 1XQYA 4QDXA 4UHDA 3VISA 4B9EA 4AO7A 1XZJA 1JMKC 1QIIA 2WUDA 3ED1A 2VTVA 2H7YA 5JIBA 1U65A 1UK8A 2VEOA 1LPOA 4WCVA 4LXGA 2HA2A 5JARA 5K3FB 4GDMA 2PX6A 5AM2A 4HXGA 5JASA 1XRQA 3FYUC 2XUQA 3A2LA 1T4MA 1IUPA 5ALQA 3T4UA 3F96A 5FXMA 1Y37A 1MU0A 1YS1X 2VATA 1T2NA 3JYHA 4W1PA 2WFLA 4Y7DA 4H7KA 4MQLA 3TRDA 5CT9A 3HZOA 4CCYA 3D2CA 5AI6A 4X6XA 4RNCA 5A6VA 2AJCA 4G4IA 4DGQA 3GZJA 4WDQA 3FCXA 1FFBA 3STVA 3IB3A 1J07A 1SCKA 4GEGA 3V1NA 5E2IA 3ANSA 4NMWA 2HRRA 4FNGA 4AZ3A 2JGKA 3F97A 4X7BA 2V98A 5JZ9A 2J4CA 3A2MA 4JNCA 3S2ZA 5DJ5A 3BE8A 2XMGA 3ESBA 2D0DA 1DWQA 2BGRA 2PSJA 5CXXA 2J3DA 4H7FA 1ZIYA 1BEZA 4W1QA 4H7IA 5ALJA 2I3DA 4LYEA 3AIKA 4N8SA 3HEAA 1GQSA 3PFCA 3G0BA 3I2KA 5JYCA 1N5RA 2V97A 3WKCA 3HACA 5IVDA 3C8HA 3FAKA 3R3YA 4MEAA 5CT4A 1LBSA 1EDEA 3HI4A 1E8NA 4LIPD 2XMCA 3GA7A 4FWBA 1LPPA 3OTQA 4HRXA 4KAAA 1ORVA 1FFEA 5HKAA 2WJ3A 1CUIA 3R41A 1QTRA 3AZPA 3STWA 1R9MA 4X93A 2XQFA 3A6ZA 3E0XA 1J1IA 3DKRA 1N8SA 1F8UA 4BVLA 1K6EA 1CUEA 4P9NA 4GECA 4DNQA 2O7VA 3KD2A 3D3NA 1XRMA 3ANTA 3O0DA 3V1LA 2GYVA 4DNPA 1EA5A 3WIOA 4ZI5A 3K2IA 5D3ZA 4M0EA 1DT3A 4FLFA 4FFWA 2JGIA 5AI4A 5FUMA 1QFMA 4QDOA 1ZD4A 4BDSA 4Q1VA 2I03A 3ESDA 5HK8A 4DMKA 2GBGA 4L3WA 4BP8A 3OM8A 4CG1A 5ALLA 1XROA 2E3JA 5CT6A 2XUKA 3L1IA 3LIPA 3W04A 3GUUA 1H2YA 3I6YA 2YH2A 1VOTA 4K2AA 4X91A 3QYJA 3QPDA 3FYUB 1ACJA 2WTMA 4Y2TA 1W52X 1XZDA 4JYMA 4PNZA 1SCIA 2QZPA 4RGYA 3B3QA 4BCCA 1IZ8A 4E14A 5FRDA 2D5LA 1CVLA 1KEZA 4XWGA 5AI0A 4QDUA 2WHPA 5AI5A 1E89A 3V1KA 3VVMA 3HC7A 2OG1A 4MWSA 5ALTA 2JIDA 1DX4A 4BP9A 4KE8A 3DLTA 5AK6A 4OUKX 4UHCA 1XKLA 1YA4A 3DOHA 3AFIA 3IVMA 4PF1A 3H2JA 1LBTA 3U0VA 3SWWA 3A70A 3WWPA 4BZWA 1EB8A 4UPDA 3I2HA 4B80A 2WIKA 2H7CA 4KAFA 5SYMA 4JUIA 3WA7A 2K2QB 4TPKA 2XE4A 2PSEA 2XQJA 4GLBA 2OXEA 4Q34A 2OCKA 1C4XA 3R3ZA 1MNQA 5ALEA 4B7ZA 2DFPA 2VAXA 1UK9A 1UWCA 2PU5A 4KRXA 5HK9A 1ZD3A 4Y2QA 5LYYA 3RLIA 1R4ZA 1QIKA 1XZBA 2OLEA 4FBLA 3STXA 1E5TA 1YS2X 2WU4A 1LGYA 4U2GA 1Q0ZA 4BDTA 1QIGA 2WUFA 1CQWA 5AP9A 4BBZA 2BKLA 4BE4A 2H7XA 1QE3A 2XUIA 3EQ8A 5H3HA 5EIAA 2H1IA 4HXEB 1RP1A 2C5GA 3KSRA 3WKBA 3H19A 1G5FA 1N1MA 4F21A 2UZ0A 1KU0A 5AM4A 1PV1A 4N5IX 3G02A 2WILA 1A88A 3A2NA 4AZ0A 4X90A 1Q84A 4DIUA 4TVKA 2DR0A 5DLPA 1VKHA 4ITVA 3C5VA 5DYTA 2NW6A 5CMLA 4GW3A 3UUFA 3QMMA 3R3WA 1JU3A 4EZIA 2XT0A 5DTIA 4KACA 2PSDA 2XLCA 1QZ3A 3DKKA 1GPKA 1E8MA 4V2IA 2RHTA 3H04A 1YA8A 4ZREA 5ALXA 1OILA 1CUUA 4HS9A 3C6ZA 1QOZA 3DDUA 1YCDA 3WYNA 3I6ZA 1MO2A 1P0MA 3D2AA 1F6WA 1GKKA 1VA5A 3V9AA 2YXPX 4OYYA 4CFSA 3C8DA 4PO3X 5KWJA 1G42A 5ALYA 3AILA 3DCNA 2QVBA 5ALGA 3MGAA 4EY4A 4E46A 1GZ7A 2CBGA 3PUIA 2VJAA 4C87A 4N8DA 3SK0A 1WPRA 3ICVA 4KJXA 1VZ3A 3I2GA 3L1JA 2Z3WA 1EDBA 1ODCA 4W1SA 5C7YA 1ZIXA 4C4XA 3B12A 4J3JA 1NU8A 1W6RA 4MEBA 2OGZA 4FHZA 1MNAA 4CIAA 2HFJA 2XMBA 5I9IA 5AI9A 2DHCA 4DMCA 4CI9A 2GBCA 4JYPA 5HF8A 1QIHA 5KBYA 2JEYA 4ZRDA 3WWEA 6YASA 3W05A 3AZOA 3D4LA 3HXKA 1UOPA 5K3CA 5BWBA 2WIJA 3EF3A 4BC0A 1IUNA 3SX4A 1RYYA 4H35A 2WFLB 3WK9A 5EHZA 1W4LA 5BOVA 3C5WP 3VJKA 4YPVA 1TRHA 4H7JA 2X8BA 3M3DA 3H2KA 3AINA 4CCYB 3LS2A 1MT3A 3G0DA 1S8OA 3AZQA 1SCQA 3BL8A 2QJWA 4ARBA 3QMWA 4AMYA 3PDCA 2XMZA 1R50A 5CT5A 2WJ4A 1JMYA 2VJBA 5AIAA 4LXIA 2VT6A 3OURA 4O08A 2HL6A 3K6KA 4GI1A 2ZSIA 4AQDA 3IIIA 5EHXA 1LPAB 3DYVA 2C0QA 3I6MA 1L7QA 4Y2PA 5AK4A 2QS9A 4WFJA 3PUHA 2RIPA 4QNNA 4F60A 5HQ3A 2PUHA 3W9UA 4BATA 2JGLA 2WKWA 3C6BA 4QWMA 4FLEA 4QLAA 2C4HA 4PV7A 4C89A 3ZLTA 2RHWA 4OB8A 3NGMA 5IH7A 3WJ2A 4Y9SA 4U2FA 2XMSA 5ALVA 1VXRA 1CV2A 3E3AA 4CG2A 4K5QA 1VA4A 2AJLI 1UOQA 3MUOA 5JZSA 2O2IA 4J0KA 1VLQA 4ROTA 3NUZA 2V96A 1F0NA 4OYLA 2O2HA 4NZZA 4HAIA 3CN9A 1UKAA 3LIIA 4UBNA 3DEAA 3WQHA 4BVKA 4L9AA 1AX9A 2QMQA 2IIVA 4PSUA 4YK7A 3PE6A 4X6YA 5ALPA 1XLWA 1R88A 4CIBA 1GT6A 1XZFA 3VJMA 4EY7A 1ZICA 2BUBA 1WHSA 2HM7A 4D9JA 5J3JA 4C88A 4OCZA 4UHFA 4M0FA 2ZVDA 3HLKA 2XQKA 4DYHA 5K5EA 1JKMA 1GXSA 4IHAA 5T4BA 2HU7A 4PSDA 3C6YA 1H2WA 1M33A 4UFOA 4OSEA 5AOBA 4ZV7A 1JJFA 4B0OA 2PSHA 3DL7A 3LLCA 4LXHA 1XZLA 3I2IA 1N5MA 4X3CA 2Y6VA 2WHPB 2ONCA 1XFDA 3D5EA 4IH9A 3WK4A 5T4HA 3C43A 1YSCA 4GHWA 1CUSA 2PKYX 3O4HA 4L72A 1THTA 1P0IA 1HKHA 3L1HA 1YB6A 1THGA 5T4EA 5K3BA 2HHAA 4HVTA 4H7EA 1Q0RA 4UUQA 3D7RA 2ACKA 1WOMA 4FDMA 5JAHA 2CKMA 1EI9A 4ZWNA 1LPNA 2EDAA 1LLFA 3Q0TA 2WTNA 4F5ZA 4Q3KA 3BJRA 3G9TA 1CEXA 2I78A 2OCIA 3W06A 4LHEA 3QITA 2ECFA 3PF8A 2OGSA 5ALIA 4X00A 4P93A 5AK3A 3BWXA 5BWCA 5DTJA 5C8VA 3N2ZB 3H2GA 1MX1A 4HTAA 4G8BA 1J06A 4KE6A 1C7JA 1JT2A 3GFFA 4QWWA 3V1MA 4BCBA 2XUJA 2VQ6A 1E66A 5K3AA 4B81A 4QA9A 1CIJA 3ICWA 1G66A 5CH3A 5EGNA 3FWHA 4QLOA 4ZV9A 5FV4A 1QGED 1CRLA 2B61A 4G9EA 4PSCA 2RI6A 3EQ9A 3QPAA 1U8EA 5ALZA 5A7GA 1GPLA 1KU6A 1Q83A 3YASA 1F0PA 1AUOA 2HA5A 1XRPA 1JJIA 1HL7A 2QR5A 5K3FA 2QXUA 3LP5A 2XMQA 1MTZA 2GYWA 4UBLA 4OB6A 1XZKA 1ACLA 1LZKA 4HZGA 3DL4A 4B0PA 5FKJA 1ZD2P 3HABA 2QJRA 4M0MA 5FDFA 2G5TA 5JADA 1BROA 4B82A 4GWLA 3GBSA 5ALFA 2WLSA 3BF7A 3R3VA 4AX4A 5ALDA 2ORYA 5K3EA 3WK8A 1XQXA 1A8UA 1NX9A 3R3UA 4BRZA 2W22A 4WDRA 3PI6A 5ALSA 1IZ7A 2XMRA 1BCSA 3R0VA 5LZ2A 3STYA 1H2ZA 3O4GA 1DWOA 3BJMA 1XZEA 5AIBA 4AB1A 1ZI6A 5CBKA 1GKLA 1UXOA 1K8QA 1MAHA 3WIBA 1XRRA 2DSNA 3JWEA 2OQVA 4I3FA 1GPNA 5ISMA 1W76A 1A8SA 1UZAA 1QIJA 3STUA 5IVKA 1MPXA 5EHQA 4W1RA 2VJDA 2GBFA 1UK6A 3RARA 2QRUA 5ALKA 5LLSA 2CMFA 5EI5A 3DNMA 2HU8A 5FPPA 5AOAA 3UUEA 1EB9A 4EA6A 3ZPXA 1X2EA 1FFAA 1WM1A 1YB7A 1Y7HA 2Z5GA 4KE7A 3WYDA 4Y2SA 1ZI8A 1YR2A 2CEKA 4ZXFA 3WL6A 4BAGA 1XZAA 4DNOA 2Z8ZA 3BDIA 3AUKA 3ILSA 5SYNA 3H17A 4G8DA 5CRIA 2PUJA 5DWDA 2PSFA 1YAHA 2Y2UA 5AO9A 2WSLA 2C58A 2OCLA 2B4KA 2XLBA 3WJ1A 4XX1A 2WG0A 4H0CA 3TGLA 1O6GA 2XQGA 4MJ3A 1B41A 2W6CX 3WKDA 3BIWA 3AJAA 4QZVA 2G4LA 2WHRA 1XZGA 4DSZA 5FPQA 1O6FA 1ODSA 5JALA 3ZLUA 2Y6UA 4MXDA 1CLEA 3ESCA 4KAJA 3WZMA 4QEKA 1L7AA 2XUAA 3M82A 3R3XA 1BS9A 1CUDA 1R1DA 2HA6A 5DYYA 3MVEA 4XVCA 3BDVA 1QO7A 1H2XA 3FYUA 4JH0A 1XQVA 5DNVA 3TJMA 2Q0XA 2B9VA 1VE7A 2JBWA 2QUBA 4Y2RA 2GZRA 1W1IA 5LKRA 4H7DA 4OB7A 5LZ5A 5HZGA 1USWA 1C7IA 3OOSA 4B83A 5FLKA 1BEEA 2XUHA 5E4YA 2OCGA 5HFAA 1P0PA 2X5XA 5A71A 5A7FA 2FUKA 2VT7A 1XZHA 5C8ZA 3V48A 4FNMA 3D59A 1WB5A 2AJ8A 2RAUA 5AOCA 2P8SA 3FOBA 4OU5A 1IMJA 5CXUA 4Y2XA 3WL8A 3WWCA 1MX9A 2ACEA 1Z68A 3PF9A 1DU4A 5HCUA 3DQZA 3RKSA 4N5HX 3CN7A 2YASA 3WKEA 5ALHA 1TIBA 1LZLA 5JD5A 5E4JA 3RM3A 4AO8A 3D0KA 1CUGA 2VSQA 1RWQA 3IURA 4G1FA 3QPCA 5HF6A 1DT5A 3FYTA 4H18A 4C4ZA 1VXOA 3H0CA 1GQRA 3F67A 4IQ4A 2BAGA 1MX5A 4MWTA 2IX9A 3H1AA 2WHQA 3M83A 4C6HA 3SC2A 2DQYA 4BRSA 4Z49A 3KWFA 2OPHA 5AKEA 2H9YA 4INZA 4FFVA 4UHHA 2R11A 3FNBA 3ESAA 4J0JA 1UOOA 4DTCA 2HA0A 3QBJA 4C01A 5CTAA 4P08A 3G9UA 1HDEA 1WCYA 3G7NA 5DNWA 4X85A 3HRHA 3IULA 3D2BA 1G4HA 3VVLA 3BIXA 1WPXA 3PFBA 3G0GA 5EIEA 2O7RA 4E15A 1U2EA 4B85A 4X94A 1CUJA 2RGUA 3R40A 5CH5A 4X92A 5D6OA 4Q3LA 4A23A 1CFJA 5D7BA 4N8EA 1LPMA 4Y2JA 3O9MA 2QM0A 2HRQA 1EH5A 5AH0A 4WJLA 1AQLA 2PVSA 1AZWA 4MYDA 1FFCA 4EY6A 5CH8A 1EINA 2FJ0A 1EX9A 2QKYA 4RE6A 5F4ZA 4KYVA 5JAUA 3DS8A 1ZGBA 3U1TA 3DJYA 2PM8A 2WIFA 5CW2A 2BGNA 3G8YA 3ZI7A 1QLWA 5ALRA 3I1YA 1HQDA 3IUNA 3IA2A 2ZJ6A 3WZLA 5ALOA 2WUGA 3IDAA 4JEIA 5JD6A 5ALNA 2HIHA 1CUXA 5AKHA 3OC0A 2JF0A 5JZBA 4ARAA 2XUPA 5FOQA 1EVQA 1QIDA 2O2GA 3FLEA 1WB6A 3NOXA 4EHBA 1CUBA 4G4JA 3GROA 1QO9A 4IH1A 4W9RA 2CZQA 2C0PA 2HADA 4BE9A 4E11A 4WY8A 3FSGA 1X70A 5T4FA 4G5XA 4FTWA 3H1BA 3B5EA 3C6XA 4Y2UA 3VDXA 2ZYSA 3W2TA 3W9BA 1UFOA 5DYWA 4RE5A 4U2DA 3WK7A 2BJHA 4MYSA 1LPBB 3GELA 1QIEA 2JGFA 2HA4A 1ORWA 1UK7A 4A5SA 4FKBA 2XUGA 2X76A 4HXFB 2C7BA 5AKYA 1EVEA 1FFDA 1YASA 2WFMA 2OAGA 1E8DA 5DNUA 4S0XA 3QH4A 4CG3A 3FBWA 4DLNA 3QVMA 2WG1A 4TGLA 5AKKA 3KXPA 1IUOA 4J0IA 1SOMA 4C4YA 1HBJA 1JU4A 2BUCA 3EQ7A 1TCAA 1TAHA 4KR0A 4FOLA 3JW8A 2VJCA 1A8QA 4EY5A 3IUJA 5AI8A 2PPLA 3IUQA 2ZSHA 4UFPA
chains in the Genus database with same CATH superfamily
4WEOA 2BOVA 2JBAA 4JODA 1MN6A 3L02A 3T4EA 1ZQ9A 3G8DA 1JG3A 1RM5A 1UODA 1I3OA 1BHQ1 2Q1SA 3I1IA 4ZQBA 2YNMD 4ABYA 2F6RA 4PW0A 4W7SA 3SSMA 3PEYA 2XB9A 4G0ZA 3CB4A 1JEQA 2H29A 3DNPA 2I7CA 4PE5B 1PZEA 3RUHA 1K5PA 1JIXA 3R6TA 4TS1A 1WVMA 4G5RA 3I4FA 3NT2A 1Q92A 2D8MA 4YLGA 2MCFA 4QUHA 2AMLA 5EPEA 4TQ9A 1HYEA 3CR7A 1VHLA 1G8FA 3R20A 4PLYA 1M1UA 1Z0IA 2HDWA 4UE2A 4EPXA 4JLOA 8AT1A 1YVRA 1QONA 3I30X 1H2AS 1I30A 3GZ4A 1YKSA 2H5LA 4NS1A 4O1HA 5F4BA 3UA4A 2PD3A 4WHMA 3WL3A 3NASA 2V6GA 3K09A 4AUMA 5C8YA 4G5YA 2GK7A 4AN0A 4G0VA 4Q3EA 3F7OA 4UE3S 5B1IA 3T9DA 2W2QA 1L5LA 4OQFA 4IQ8A 1RAAA 1WB4A 2ZG6A 3AYXB 4HNHA 4J0QA 1X1AA 2Z57A 3LRPA 5HCIA 5MFZA 1ZW6A 1Q74A 2QWXA 4CKWB 4KWEA 2AOVA 3TD2A 1LC3A 3WG9A 1SUWA 4XD7D 4B6GA 2HDOA 1U5AA 3T6KA 4AP6A 4ZI7F 2VCHA 3F5DA 1PQUA 1V45E 1SVWA 2ZAGA 4M9UA 1B1CA 1RTKA 2PMEA 2SNIE 1NC1A 1U28C 4FYHA 5AKIA 2WDPA 2ZIVB 3NCTA 3CZ4A 1P5JA 3W8NA 4A73A 1AGPA 1OX6A 2RJNA 4KR7A 2JDID 2BI4A 4KYIB 3CPEA 4H31A 2BGUA 2R3SA 4MRSA 4KQMA 1NVGA 1T91A 1BCRA 1Y6RA 2HFKA 4E32A 5KVSA 1OH8A 1XDUA 4F4HA 1ILWA 1P1RA 3WQSB 3GRRA 1JPJA 4M9RA 4OBXA 3IEPA 1GLVA 3IH5A 1JIIA 2FEPA 3LQ2A 3O82A 3W5AA 3ED5A 4KRYA 2BSQA 1LSOA 2HSJA 1CULC 1H23A 1XK6A 4MB6A 5B6IA 2AL7A 2CLOB 5H83A 3W2GA 3K9BA 4U2CA 3RF7A 2F8TA 2O5EA 4AZ0B 4JEHA 4OFZA 1T8UA 3DG9A 4L1KA 4WBNB 1QJ4A 1WBBA 1UJ4A 1UP4A 5TMEA 3K05A 2GUWA 4J0CA 4GPAA 5EYPA 1U1CA 3A11A 5CT8A 5IDQA 5KTOA 2QN6A 1KTIA 3FPBA 1JVSA 3OLZA 1R0WA 4V1CA 4GKVA 4LOJA 1IN5A 2QL6A 5T3YA 4ENTA 4S1VA 4WESB 5LQDA 1NI4A 2A0KA 5J2UA 4TRRA 2XB2A 3SEQA 2ZKIA 3D4IA 1Z63A 4BHTA 2P3LA 3HBFA 2BEWA 3IVXA 5K3DA 1NN1A 3PUZA 2X8JB 3HDYA 4XQGA 3B1KA 2HYIC 1EJ2A 3PSAA 3LV8A 5FEMA 1ADFA 2H85A 5JMOA 1U0GA 3F98A 5KDLA 3QI7A 4IKPA 1Q15A 5DNAA 2QRQA 4FD3A 5FTWA 3VC7A 2HAEA 2GEDA 1PG0A 4AO6A 5BN5A 2WIBA 4RLQA 1QS0A 1AXEA 4L0CA 4DOMA 2GZSA 2WIDA 1B0ZA 1DRWA 1ZX1A 5CVEA 2X0KA 1FUYB 2BP7A 1PLKA 4NOMA 2YJNA 3IB6A 3P32A 2G9ZA 2ZRNA 5LZ8A 5LL6P 3G8CA 4IIHA 4BYMA 4Z7JA 4I3GA 1AU9A 2Q5CA 3CUVA 1J9ZA 2OSBA 3C5EA 4FMPA 1CSEE 3GOHA 4J90A 4BAUA 1ZH4A 4TWJA 1RZRD 5I7RA 2JJ8A 2OGUA 1RRPA 3K35A 2G83A 5TS2A 4JKYA 1H2EA 4JXJA 5JG7A 5B1EA 2D54A 3O93A 4NJOA 4GKAA 4YMLA 1P44A 2ODTX 1JTEA 2K6GA 4MS3A 4EELA 3TZEA 3WMXA 2PU7A 2W2PA 1U3UA 5DXJA 3ZWOA 2CKDA 4X3OA 2VJLA 4RL6A 2Z08A 4U2BA 3FPJA 5F73A 3EUFA 2DQZA 2YV4A 3AR3A 4PLHA 1NP7A 5KOJB 2WG2A 3MFYA 1YOVA 2EKLA 4B09A 4EG6A 3LOUA 3KV1A 2IDMA 3OE5A 4XWAA 4C76A 4UBKA 1H5UA 3QEOA 4I8IA 3PQ4A 4PN3A 1TI7A 1UT5A 1Q1BA 2B8EA 2VDRB 1WHTA 3KPVA 4IIJA 5ARDA 3SHQA 1PGPA 4X6LA 3PFIA 4AJ2A 4JR1A 2B21A 2CMDA 4GLLA 4S12A 4ZU6X 5LP1A 1ODTC 2DLCX 1RAFA 2RGCA 1BXGB 3MS4A 3W1EA 5G1PA 1R6XA 2P11A 2IV7A 5DGDA 3HKCB 2WMOB 1J2EA 1AV6A 2TMKA 1TUBB 1W75A 2QUAA 3OT1A 4HWSA 4P98A 4Z0HO 3LUHA 1NQAO 1W46A 1ND6A 4J03A 2Q5HA 3I2JA 4RPJA 5A4IS 3VOBA 5F7JA 2PKQO 3K9NA 4LRYA 3Q5GA 4ESVA 1I0IA 1RHUA 2F00A 2PRZA 3L40A 1Y3HA 4N6NA 2QG4A 3K0FB 4US1R 3KTDA 1YV9A 4W5RA 3VPFA 1ORDA 3LXRA 3WXBA 3MWFA 1GVNB 4GOOD 2Q41A 3P45A 3HLYA 4AD8A 1HM5A 3ONNA 4CDGA 3ZKWB 4ZIRB 3EXFB 1PG5A 4JI0B 4LOAA 5A0TA 2PQMA 3MPOA 1EQUA 4I55A 4PSKA 1P7VA 2G4CA 4IJKA 4BOYA 4QQKA 1CUAA 1L5VA 4YVFA 5KSYA 4O2AA 1F2UB 3TKLA 4DIOA 1XK7A 2GBIA 1F14A 4IIFA 5FJJA 1N92A 2JJ2A 5I5GA 5JNVA 1DCTA 2H2HA 5JVDF 1PWXA 1P1HA 2NZVG 3TEMA 2H9IA 1H2RS 5FOVA 1IB6A 1NOKA 3NNSA 1SD5A 1TIKA 3SR3A 5HQ3A 2DCMA 3E27A 5T3UA 3UGKA 5FEUA 2GUGA 3K9HA 2A0UA 2AVDA 2HLNA 1C0PA 2I6GA 2QLMA 4PAOA 1DINA 3VPSA 1W5SA 1QYWA 1SVLA 2RGNC 3PZBA 1M1NA 3RODA 3DAOA 1E98A 1U7TA 2NXWA 3EMDA 2IZ7A 4HPWA 4KLZA 2O8EA 2BZSA 4A9AA 4QRIA 3A9VA 3EEFA 4RVCA 1SQSA 4CEJB 4RTNA 3C87A 4OHBA 4UD6A 4KQWA 4XM0A 2HJWA 3LKZA 3BC1A 1FS4A 1OZHA 4RGQA 4KXLA 1M0SA 3IT0A 5HDBB 4G1CA 3UFXB 4YFVA 5AW8A 2AC4A 5KVAA 4QVKA 1XLVA 1B76A 1TCCA 4W7HA 2JZNA 2ZPUA 1NJ5A 2I7XA 3ZYZA 3KLMX 1KQPA 3LYUA 3ILYA 4HGQA 4QYWA 2OECA 3QP9A 2PS0A 2IYTA 4C0AC 3ACDA 4UBOA 3O9VA 2DH5A 3CSUA 3ML1A 1M67A 5AJHA 5EXPA 3STHA 1EK2A 2FEMA 4TYQA 1CZKA 1LX7A 2XTJA 4AYTA 4JI8B 1Q14A 2CXOA 2IXBA 5GONF 3GJ8A 3SVLA 3IS3A 2RBKA 1G4UR 2A14A 1KC3A 2IVZA 4XM1A 1SCJA 3ZBQA 2FX5A 4IAOA 4EYQA 5FPKA 2GHQA 5BQ5A 3TINA 1KI9A 4A82A 4AUNA 5IBRA 3U1VA 5I4CA 3FVWA 4JLNA 4BO1A 2K5UA 2YN4A 3QOYA 1P4HA 2W11A 5DBHX 4ZOQI 4TZ6A 1ZC4A 5KIAA 3SHVA 1T2DA 1G8PA 4DC1A 4LHXA 2C29D 1DLJA 2CLKB 4S1WA 1V25A 1E9FA 4YJHA 1A7KA 2N0SA 4ZCSA 4YAUA 5C52B 4NOKA 4ZVQA 2IPNA 3MRTA 2FUG6 2FW9A 1XZ8A 4ETWA 5KYUA 1QYDA 1XRJA 2WQZA 4YAKA 3BSSA 3CEMA 4BZZA 4WXYB 2QRKA 5HQ3B 4MPDA 3VR2A 3GDFA 2QRJA 3JRWA 2JIOA 3FSGD 2DX7A 3TQSA 2IRWA 2IODA 4ND6A 5A62A 2B6HA 1NMXA 1XC7A 1I10A 2J5BA 1PT7A 3I92A 1GOTA 5BQFA 1YBAA 3LH5A 3DDSA 3WI7A 2UYOA 3DKPA 5A02A 3KSAC 3N0WA 3OU2A 3AEQB 5E8JA 3T52A 3HDHA 1PZGA 3DZIA 3MSCA 1LNQA 4TMWA 1KORA 4L2IA 5JQGA 3EBLA 5HRUA 2C96A 1Z7EA 1PJAA 1Y9JA 4INJA 2OZLB 1OOEA 3CRQA 2QR2A 4WK0B 1NFRA 3EWAA 4R7ZA 3CEHA 2CNOA 5MN6A 3WK6A 4D4MA 1B8UA 3L0YA 5AXCA 4OM8A 3N59A 1HDZA 1DTEA 5BVHA 3CH7A 4KFSA 3AOGA 1C2YA 3QLJA 5ENDA 1U5CA 1A98A 3CHYA 3QNMA 1GRNA 2YWGA 1QFSA 4QYMA 4Q9AA 4J6EA 2CW5A 5LP6B 3NWOA 3A3OA 2QTWB 3WAJA 2KSQA 1XKXA 2X7XA 4MVCA 4ZO9A 4G3XA 1II0A 1UMDA 1AGYA 2CXUA 3K4HA 3TVTA 3FPAA 2VTBA 1CQPA 1OTHA 1PFQA 1ZK1A 2QTBA 4LCEA 3RUAA 3T3EA 4AMUA 1BS1A 2ZVPX 3OEHD 3BB4A 4G0NA 1N32B 1N2HA 4MPPA 4QUIA 4UD2A 4HT3B 4Q03A 1ZJ6A 2CJXA 4PPFA 2O8BB 2J5QA 4ZJUA 4YDRA 2QZZA 4E6EA 1SAYA 4YT8A 4FYVA 2PKCA 1FYDA 1E6UA 1OQAA 3VKVA 1BMDA 1SWVA 3DXFA 3VZCA 2FCRA 3ENKA 5EJIA 4YRSA 1SKMA 4NBWA 1Q5PA 2IX3A 3GRYA 4LE1A 5GV8A 2ZBPA 3NUGA 2GJKA 2F4NA 3DBHB 2C94A 3K1JA 4MA4A 2WBLC 4OMFG 4CM7A 1O0CA 1GL6A 3C5HA 1SCUA 3N70A 3QU5A 4PEVA 4B8YA 3D8BA 5I7OA 1U3VA 2OYCA 1CUCA 3DYIA 1OU0A 1NW6A 4QXOA 2Q4EA 4I2NA 4WE3A 1UFQA 4F71A 2NIPA 4EHHA 4A27A 3E4DA 1EUDA 3A32A 2PH5A 3E18A 5FL7A 3UOGA 5KREA 4J7AA 2ZWIA 4LYDA 2ZRFA 3DOIA 3QXGA 4IIDA 2EZ8A 3TJZA 1RAEA 2FRDC 4O2LA 3V55A 3A9CA 5K01A 4OBEA 3GA0A 4J8PA 1RRCA 3MWEA 2O14A 4LJ9A 5A05A 4YASA 3HJRA 4IV0A 3TL3A 5ES3A 3TTXA 3UKOA 3Q12A 1FCJA 2GLUA 3S5JA 3ROKA 5FO0A 4XEUA 2GZ1A 2WAMA 4M60A 1VGRA 3LBFA 1KVQA 4XQCA 1GL9B 3GYGA 3RQSA 2HNKA 1X39A 4Y6OA 5A5EA 4KXWA 3KAJA 3U4HA 5AXAA 3FLAA 1MABA 2FDRA 4ZZ1A 4DWVA 4M0CA 5HKKD 2QW0X 2C5FA 1SCAA 3ENQA 3P9SA 3IT3A 4I9UA 1WUTA 3B60A 2E9SA 1MC5A 3AL0C 2X7HA 4DM7A 1OFGA 1UAGA 3B8HA 1I4TD 3FMOB 1NXXA 3U9LA 3HKBB 1G9TA 4GLOA 1UDAA 5TMBA 3TW0A 3CLRC 3ZV6A 1BXRA 2XB4A 1U4SA 1X9IA 2XMDA 3VKFA 3X1KA 1QCCA 4EO9A 4ZZ3A 4HDNB 1L7EA 3I9KA 4EJSC 4YCAA 3RGGA 5LQUA 4E6PA 2FWMX 3WWOA 2KQUA 3S44A 3TLKA 2A94A 2PEZA 1MFPA 1KDTA 1PLLA 4JJ8A 2I91A 2AD5A 2CJFA 4P3OA 4E11A 5FOXA 1JNXX 1KJJA 4MJLA 3ZXUB 4OPMA 3HJCA 2CYBA 1E4OA 1AKUA 3I2FA 3TW4A 3RVPA 4OSPA 1QU2A 4JLDA 2PMBA 3CXUA 4RD6A 4A2PA 2WKRA 1NBMA 1OXMA 1I9GA 5IJZA 2J4FA 4H3HB 3OFSA 1PGNA 1SC1A 1V26A 2H4YA 4DL9A 1XPRA 5G2OA 2UXDB 2G1PA 2C4VA 3C1AA 3OU6A 4E1VA 1U0LA 1ZGCA 3IQIX 5SZKB 2W42A 3C6QA 5KNBH 3I01M 5DI3B 3ZY4A 4DMGA 1ZP6A 2O2EA 1H2BA 3F6RA 1DCMA 1KK1A 4JITA 4UC0A 3VRHA 4A8JB 1QIMA 5IM5A 4HRYA 2XUDA 2YC4C 3CH6A 3DZJA 2DT8A 5FTKA 3L06A 3NVDA 1JDPA 2A5GA 2BHSA 2ZXFA 5FULA 4WN9A 4C6TB 1YDHA 3U13A 1Y1QA 3KYDB 1JHYA 1NJFA 3IAHA 4I81A 3JZDA 5ECDA 1RJGA 3DXYA 1YA6A 4UJ3A 3FRHA 4Y2VA 1E9DA 4NU0A 1AY0A 3TW8B 5C1OA 4K6KA 2EG9A 2YFQA 1FYFA 2ROQA 4HJXA 4DAOA 1NC3A 1NQWA 1Y9ZA 1E64A 2AK2A 3NB0A 3RUPA 3VQTA 4DNFA 1Z5OA 2VCEA 1X7XA 4C4SA 5IVPA 2UU9B 2B0JA 2IHUA 3E81A 3TIIA 1QVWA 3P97A 1M2NA 4GQIA 4O4LB 1Z0AA 1KH2A 5A04A 4R1OA 2WZDA 3E9EA 3IEVA 1QBKC 1R3UA 3KKKA 3ABIA 1YZKA 4D45A 5HWSA 3W5DA 4PC7A 3N5CA 2IYNA 1QHNA 3KKNA 5LIPA 4MA0A 1SC3A 2VR1A 1RKQA 3M81A 5BSRA 1K4YA 4CNBA 3DP9A 2R68A 3CVOA 4KQIA 2GYYA 4UBMA 3RK4A 2WNHA 4M8SA 1AE1A 5LB2A 4LKOA 4B31A 2FZVA 2WUWE 3KWJA 3D4OA 2CLFB 2QUZA 1VCNA 3GLRA 3L7JA 4Z3DA 3F9RA 2MMGA 2FKAA 3FVTA 4RWZA 3VI4B 1NW3A 4DRZA 4F11A 3EVCA 2BYTA 2PWBA 1RQGA 4I4TA 3WKAA 2ZYIA 3SIRA 3X2SA 1CX9B 3WGKA 3GRZA 1XVVA 2BHTA 5ED0A 3WMFA 3VZSA 3E2PA 4O0LA 2J3QA 1J25A 5C4MA 1PR0A 3WGHA 3W5SA 1R2QA 2OK7A 2V7QA 4BKPA 1PQ4A 1AHPA 5J2TB 1A9XA 4Z4QA 2QL5A 5CHYA 1FP4B 1KAOA 3EXHA 5AVSA 4MWGA 2ZYVX 4D46A 2OXIA 2EP5A 5F9MA 1E20A 3JQ8B 1RQXA 3D7NA 1CUZA 1CZNA 4LJRA 4EL5A 2FTKE 3UK0A 4FK8A 1XOIA 3WLAA 4EY8A 1XRLA 1ZUD1 4CLHA 1DJMA 3MAAC 3QM1A 1DRUA 4MQEA 4RY9A 5F3DA 4CLRB 3I8XA 4EM6A 3BMNB 1W93A 1XZJA 2IKSA 5LLTA 1JMKC 1U3FA 1VIYA 1LRJA 4LVOA 1XEXA 5A3SA 2PGNA 2M6LA 2AQIA 4XSGA 3KE8A 3K0SA 1EYZA 2ACWA 2WUDA 3PD0A 4R8VA 4RQUA 4F7DA 5E6SB 2VTVA 4X1IA 2XCLA 4EUKA 3HXOA 1TA9A 4TN1A 4UOEA 2JFQA 1XD8A 1EXNA 4TQUS 3BMOA 2Q2NA 4N03A 3NLLA 1ECJA 1CQXA 1ICIA 5F7ZA 4M6WB 3R0IA 2ISCA 3TSAA 1Z5GA 4MRNA 2O7NA 1CY0A 2ATVA 3I58A 4QU5A 3X1YA 1D4OA 3H9JA 3ZCPA 3P9KA 5L3SA 2OV8A 2W7TA 4WCVA 1BKYA 2DBRA 1AXGA 3BQMB 4ZZ0A 2J4DA 2VSXA 1GIAA 4L6IA 3CS3A 4CUKA 1U5BA 2R1UA 1KSGA 4FYWA 2VK8A 4MV6A 4I1YA 3WHIA 4JXZA 2GN6A 5G1OA 2QF7A 1XRQA 2ZIAA 2AR9A 5BSTA 4BNDB 3A2LA 5EXEA 5B6JA 4R1PA 3PNVA 2D0IA 4M36A 2B3TA 2ZDGA 5EG5A 5BW8A 1Y6GA 3T4UA 2FCAA 1K5DA 1NJGA 3JYOA 2WABA 2ZZNA 1ZAKA 4WLEA 1USUA 3IBSA 2VC2B 4QXRA 1YQXA 3ZE8A 5BT9A 2CEAA 1YJAA 3TR0A 5LFAA 3A3NA 3VUEA 3DJFA 5A3QA 4ETNA 4IY1A 4PZCA 1GDTA 2I0FA 1Q3KA 2VATA 4EI9A 1T2NA 1FUKA 3GW8A 1QKKA 1JILA 2DRIA 3PQ6A 4MGKR 2DLDA 2JGRA 3IKJA 4KV9A 5ILGA 3QF4B 4CW7A 1SMKA 3C6KA 3LWZA 3BMXA 3CX8A 2GXAA 1RMQA 3WLNA 4HQKA 1D2NA 4K40A 4ASUD 5JDIC 3PCXA 1EFTA 2H5JA 2WJWA 3C3CA 3M6VA 4ZYVA 2XVXA 3GCDA 4LTNA 2A7XA 4H7KA 4MQLA 4MVWA 4Y7DA 1RI5A 4J4TA 4ZVNA 3WGIA 4V0QA 4O1MA 5EZSA 1NWHA 3VR4D 5I7WA 1BCSB 4CCYA 3OZAA 2A1TR 1QF9A 3D2CA 2JLCA 1D0SA 1R8YA 4H17A 3H9CA 1TLFA 2C2MA 4XEHA 2Z1DA 3GT4A 3ZU5A 4HV4A 5FWYA 1Q3HA 1HSOA 3ZUGA 4M8NE 5A2QA 4EJSB 3DZBA 4A0GA 2AJCA 4DGQA 1TYAE 1YL5A 1XCGB 1E63A 3GZJA 1IDN1 3ST7A 2CFOA 4AWAA 4RMGA 5EGSA 1GN9A 2ERYA 3IP1A 4D5EA 4YHHB 5H70A 5DXFA 2NSLA 3PHBE 1FTYA 3FCUB 1XD2B 3DHEA 1O8BA 1SCKA 2LKCA 2Q4TA 4GEGA 3V1NA 3ZNNA 5LN1A 1RXWA 1JQ3A 2YN0A 4NMWA 4A8HA 1FUUA 2HRRA 4WT7A 2DSTA 3L8MA 1N5IA 1A4RA 5JZ9A 4GX0A 1DKRA 4BNGA 4D42A 3S2ZA 4Q1BA 1NJSA 3JAKA 3IKVA 1U2GA 2C2KA 4FW8A 5DJ5A 5DO9A 2JH3A 1G8HA 4Y9RA 4B33A 1U04A 1V1RB 2JLSA 2GNAA 4RVOA 1BWPA 2GA9A 4XSHA 2IIBA 1MVLA 2Z95A 3JD0A 2PSJA 5M29A 3D5TA 5CXXA 4BGDA 4IL5A 3ZE0B 5B6PA 2HHJA 1HWYA 4ESEA 3W3AH 4Q7KA 5CDUA 2EJVA 3PG5A 4M0LA 2LCFA 3DDCA 4W1QA 4AJ1A 3OO0A 4R6XA 4H7IA 3RC7A 1R74A 1RYMA 1W4ZA 2F1KA 4ZCMA 1JYSA 5TF4A 5DYIA 3SXUB 1U7DA 4AF8A 2YOFA 3RPEA 3AXSA 1FXSA 3N53A 1GQSA 3PFCA 1QLJA 5F5NA 5IASA 3ABOB 3QTLA 1U1IA 4GO1A 5JYCA 5FYDA 2WYUA 3PDIA 4CKBA 3I62A 1BD4A 1DQSA 5CX1B 1IQPA 3UMYA 5BNWA 1UPAA 3FAKA 1EUCB 2EFCB 4MEAA 1I2MA 4L07A 2PA0A 1EDEA 3I52A 3O9ZA 4LQCA 5JXWA 2FAXA 1DBWA 1PJQA 1R0RE 3WLPA 1AK1A 4FWBA 4JLUA 4DREA 1OJ7A 3H2YA 3OMWA 2V7UA 2C5AA 2XJ9A 3D81A 1S02A 4HRXA 2GM4A 2ZQZA 1M2VA 3C3YA 3M7IA 4FN4A 2PZGA 4L8LA 5EMHA 2RIRA 5E7JA 2VWGA 4FONA 4B3SB 3RC2A 3GVIA 1NLZA 3LX6A 3R41A 2ADMA 3C4JA 2OCPA 2FP4A 1ODLA 4FCTA 4Q66C 4WBSA 3STWA 4K88A 3SQLA 1R9MA 4OKNA 1I2BA 1N0IA 1CF9A 4BFTA 3U16A 2VQ3A 4CL2A 2XQFA 3A3PA 2ZWVA 1XVLA 1D1SA 1Y5IA 5JAMA 1NRIA 2LV8A 2NT4A 1J1IA 6LDHA 2P9HA 3CRMA 5JJBA 3JWPA 1NBAA 1FLVA 5TJ9A 3VH3A 3GYBA 4Y9UA 1K6EA 2DPMA 5K8TA 1CUEA 2GJSA 3PD7A 3PVZA 4P9NA 1RIIA 1V43A 4RCZA 3WNBA 4BO8A 5G0VA 5F33A 3TNJA 4HFJA 3HMQA 3VR6D 3L5OA 2QN2A 5J40A 4EMSA 5K99A 3EGOA 1Y4UA 4YALA 1Z07A 3TZBA 4TMTA 4MKZA 3V1LA 3V8NA 1HETA 1M8JA 1VRWA 1PK9A 1Z18A 3GEDA 1KBOA 3DF9A 3M5PA 4DF3A 2JI4A 3MT0A 3OTIA 3K2IA 2R97A 5D3ZA 4D43A 3ADBA 1DT3A 3C15C 3CUSA 3OD1A 4K28A 4FLFA 1WEHA 4MWCA 4F8EA 1EFKA 4CYMA 3DAPA 3NORA 1YC2A 3CZRA 3AVWA 3M4ZA 1Y1TA 1DDIA 4C5CA 4Q93A 2C20A 1S2NA 2PUDA 3KQPA 1Y7LA 5E38A 1JQKA 2HMUA 2JI7A 4F4IA 4Q1VA 2QYSA 3UAWA 3KAQA 3DC2A 2EFYA 1L3IA 2GBGA 3L7DA 1BQ4A 2BMFA 4MO2A 4UAVA 5EEGA 4BP8A 4TM7A 2DWPA 1ZPDA 1KGSA 1X7WA 3OM8A 4CG1A 4EPYA 2V0NA 2XXBA 2A8YA 1H9CA 4ND8A 2BFDB 4N4AA 3VR3A 1Y89A 3A6JA 1DNPA 1E0DA 2AZMA 1WX1A 2I2XB 3SLKA 2ZKLA 3U49A 3W04A 2R6HA 1QR2A 4L73A 5AOVA 4PN7A 5HNKA 2BMAA 3Q9UA 3B1JA 3COPA 4YMUA 5CA1B 1W8DA 3I6YA 2YH2A 3X1DA 1VOTA 2H92A 4K2AA 4QXAA 3GLIB 2G3YA 1ODKA 1KDYA 2W0MA 1JPNA 2WTMA 2A3NA 3D1VA 3QLVC 2CL6X 3PPWA 1S4MA 3QTBA 3SC4A 4L0MA 4CDNA 3GNLA 1D9ZA 1PV4A 2QAGB 3DFUA 2GEFA 1BJRE 1U0JA 2UUOA 5BR4A 4LY6A 1GNQA 3EPRA 4G0MA 4N0EA 1G20A 4R1NA 4E14A 5AI0A 1KEZA 1H93A 5F52A 4MPTA 2WHPA 3OZXA 3CXRA 2OAP1 3IOCA 4KMMA 1OX5A 3ZI4A 1ENPA 3EMVA 4WX2B 3T06B 3BH7A 5JS6A 5CA0A 1H9BA 2Q1WA 4MWDA 2G1AA 2E4UA 4X84A 3V7YA 3ZXYA 4TKVA 2M98A 5D5PA 4AIIA 2JIDA 4EG3A 4CR8A 3WBBA 4KVFA 5L4NA 1J49A 3FZNA 5BR1A 3DLTA 1PJ2A 4QUKA 2XKKA 2HHCA 3QLTA 3U3ZA 4XR4A 2FW7A 2OM2A 4GQBA 2IOHA 2NMVA 4XRGA 4AKHA 4NH4A 3LDFA 2FUCA 1XALA 1YA4A 3EDMA 2WE8A 4CKZA 5DK6A 3IVMA 3HJHA 2O3QA 1RCTE 1AQJA 4DXDA 3BX1A 1QHEA 5KQPA 1EFVB 3UW3A 2O1WA 4U3JA 1MCZA 1O3YA 2PKQP 3OCCA 2IE8A 4LW8A 1VSUA 3L3BA 4P38A 4Q4JB 3VV3A 4EYEA 5J3JA 4CEHA 2GZMA 3HCOA 1F4LA 3I0MA 2B4AA 2FNAA 1VIDA 4MA5A 3WWPA 2ZETA 5BN3B 1S3GA 1QF7A 2VHEA 3PHIA 4TLBA 4WKPA 3W7AA 4DBLE 3TDMA 3I2HA 4B80A 3IO5A 2EBHX 3NG1A 2WF6A 1Y8ZA 1ZMBA 3AMVA 2B8TA 4HPJB 4YIKA 5AW9A 1WXHA 3QUSA 1X9HA 4TPKA 3PQ3A 1NG1A 2JAHA 2XE4A 5HBGA 4YRNA 5K8CA 3RBXA 3K2QA 5FI3A 2XQJA 4RCYA 4PG8A 4KLCA 2GD6A 3AUTA 3WHKA 1P31A 3URKA 2OXEA 1EFDN 2FR8C 2P69A 4G41A 4U7PB 2VJNA 4PX3A 3UJDA 3RS5A 2AFIB 3F2IA 1OHHD 3DVQX 1JTVA 2GN4A 2XTAA 3FMIA 4DR1B 5HMLA 1V4VA 1QU3A 2IHKA 3UXMA 3OU7A 2QSUA 2IH5A 2PU5A 2DPGA 2XWPA 1NKTA 3RUCA 1RJEA 5F51A 1ZD1A 5HK9A 1ZD3A 4N9WA 3OQIB 4AJ9A 2VSYA 1ZCFA 2VN8A 5LA6A 5JRJA 5KJ1A 1DBIA 5BMOA 4TYPA 2D1TA 4C22A 1Q21A 4ER6A 1AHIA 3CVJA 2BC9A 1JEJA 3S2FA 3L07A 1TU4A 3AM4A 4R6WA 2ZE8A 3FOEC 4J91A 1R4ZA 1TADA 3BQ9A 2I8AA 2XMPA 4ED9A 1YS2X 3VR5H 5I01A 3RAEC 2ALJA 2YXNA 5G53C 3LDHA 3SSOA 3RT1A 3DDOA 3NHZA 4ONEA 4OQLA 2VO1A 1YZQA 2GGSA 3A58B 3BIFA 1XHFA 2GEBA 2PPVA 2HSDA 3AUFA 1VMIA 3CUYA 1QIGA 4NJMA 5ICGA 3LUDA 3WV4A 3CZQA 2I8LA 2JAUA 3HVIA 3ZE6A 2XAUA 4BBZA 3KJNA 1NJ2A 4BE4A 5KYYB 2G88A 5EWMB 3IKLA 2WWXA 2AOTB 4M0DA 5CFLA 1NLFA 5DXAA 4MH0R 2EFEB 3U44A 1CDEA 1YIDA 5ILOA 3WL4A 5E8RA 5H3HA 5B3JA 1P2VA 1TA0A 4QSMA 4DY4A 3D9QX 3I9MA 5EIAA 4HXEB 4OK6A 3KSRA 5HJ5A 4IR7A 3D6AA 3ACBA 4ILEA 4L9WA 1G5FA 2YWBA 3ASZA 3JQ9A 4ZEWA 3TO5A 3OX1A 2FN4A 1B43A 2W48A 2AG8A 4ENPA 3MK31 2NPFA 1KK3A 3EGIA 3G2JA 1FUIA 1JHPA 5A3RA 3NIDB 1WF6A 2O3TA 4TVKA 4P3KA 3ZDQA 5L9AA 2DR0A 3B6ZA 1PL8A 1U2RA 2FQWA 1E2NA 1T0BA 4J9VA 3C5VA 2VNHA 1IEXA 2MHCA 3DTVA 2W6PA 2PTGA 3FHOA 2NW6A 3EVFA 2ZSBA 2ZE5A 1YDFA 5CMLA 1Z5PA 2FY8A 3PB3A 1EP3B 3VC3A 4PIPA 4F96A 3R3WA 1A1SA 2ZTUA 1JU3A 3TOSA 3TQCA 5TT0A 4DMLA 2VHXA 2P79A 2C4MA 3A6EA 1ONBA 4C0BA 1RRKA 3I72A 1FXWF 4LXYA 1KARA 3RRXA 1YJBA 1D04A 3VR1A 3R74A 4HKTA 2I66A 1GPUA 3H2BA 2OEPA 1Y9AA 1G60A 2WFAA 2Q6TA 4IOMA 4F3RA 2O59A 1GPKA 3F5FA 3H13A 5FNVA 3ZK9A 1E8MA 3RIYA 1AKWA 1QQ5A 4MOWA 4CL0A 5IJXA 1OASA 1WMFA 2YHSA 4JJGA 4I8XA 3H04A 3TBHA 1YBMA 2Z98A 4RKWA 2AFHA 4QQNA 4DXAA 3DMHA 2SBTA 4I6JA 4PTYA 1NE7A 4Z4GA 1C8VB 1RWBA 1YHZA 4FR0A 4PBTA 4CDMA 3FUWA 3CVVA 2FW8A 4N41A 2PT5A 5JH7B 3S1LA 3JARA 2YYYA 3I6ZA 1YRQA 4KR3A 1MO2A 3C0KA 5A9SA 2GT1A 2AOWA 1E99A 1F6WA 1ORIA 4DDTA 3DGFC 5H9WA 3BTUA 2IXGA 3AR8A 3JPYA 3LUBA 3OP4A 2VRWA 4YRMA 4LKRA 2RGBA 4CFSA 3C8DA 4AX8A 3ZJ4A 1JEEA 1TW2A 2YN2A 4AG5A 1Z0ZA 3RSOA 5IRCD 1G42A 2YJ4A 4HQ6A 1NSTA 3AILA 1PR6A 2GRJA 5DF1A 1B2LA 1IUKA 2EJWA 1AZSC 1ISGA 3MGAA 1K4KA 4XTRA 4ZAYA 4MCAA 4E46A 1VJRA 4NYIQ 1QH9A 3D43A 1YCHA 1ZBDA 2DY0A 2R96A 4IZIA 3L9WA 5TGDA 3J7AC 4FEEA 3C3DA 5A5GA 5HIAA 2IS6A 4MGYR 3ICVA 3UANA 4RKYA 1P5HA 4KJXA 5GWXA 3B2QA 4PXYA 2GXSA 1C9YA 2OP0A 4PFSA 3I2GA 5EE9A 2BCGY 3O8QA 1EDBA 5AW5A 2C83A 1WXWA 1SN7A 1ZW1A 3MB5A 4W1SA 4YAEA 4BMCA 2I33A 5BV2P 4G84A 3IVGA 2PMDA 3CPHA 4LBWA 4WFQA 5CVDA 4KPGA 1GNRA 5C7YA 1XDBA 5J47A 3TSWA 3ERCA 1AT1A 1I1HA 5JNTA 2YMPA 2EEZA 1NVVQ 4J3JA 1PF7E 4PYRA 3IAM6 1H6BA 3TL6A 4A8TA 4S04A 3NBMA 1U7WA 2BLNA 1F7VA 3CKYA 2VSNA 1G38A 1JLLB 3OLYA 3GGCA 4PLCA 2RKWA 3WGJA 4ROSA 3P9NA 1AQ6A 1DG1G 1LLUA 2MYNA 3FI0A 4JYPA 3B89A 3VYWA 4DLKA 2BFFB 4G5OA 5C51B 5KBYA 3TM5A 2PK3A 1CD5A 4HY3A 3RRMA 2YRFA 3TMKA 4BN0A 3OJ0A 5BNZA 1PSDA 1VRVA 3KEFA 4XYEA 4OQPA 6YASA 2Y0BA 2WM3A 3GR6A 1PFWA 2VP4A 3AZOA 3A1WA 1UOPA 4TWAA 2CLIB 3T7KA 2BKEA 4G36A 1MQ8B 2WSMA 4JXXA 2ARKA 1OV4A 2WOOA 1U63A 4QU0A 1M7GA 3EF3A 4IMIB 2BBSA 3ZH9B 3DEJA 4G0UA 3ZGLA 2R66A 3OCWA 1OB5A 4FCCA 4FU0A 4F86A 2QX6A 4PBRA 4F85A 2FWNA 2H17A 2WFLB 3DD1A 1IJKA 3WK9A 2X9QA 5KVVA 5CUQA 2Y1LA 1EWQA 3NW9A 4KK3A 5FTNA 1TRHA 1N6IA 1H9AA 4PC6A 4RJIA 1QWSA 1VYVA 1BKSB 3T7TA 2CHQA 2JIRA 3U40A 3KVYA 3W2IA 4EKNB 1AKRA 4R3UC 2ZI4A 2PGDA 4PLZA 4JOBA 3UHFA 2I6FA 1Q1EA 1TVKA 1S8OA 3AY3A 2QDKA 1W0JD 3EEBA 2IXAA 1M1YE 4A0RA 5A6SA 3BL8A 5TMPA 3GUZA 3I04M 4ARBA 3EXEB 2GPWA 3REGA 3V8RA 4WLNA 1M6HA 4AMYA 4HEJA 3PDCA 5KKAA 1MZVA 4UTZA 2XMZA 1PT8A 4KGDA 5H7XA 2DXIA 1JMYA 1KO4A 2VUIB 3W4KA 1B4DA 4RWEA 2HLPA 2PH7A 2YWFA 4EGSA 4LXIA 4XFKA 2VT6A 1ZZEA 1NVMB 2IDJA 3OURA 4R2MA 4RLSA 2HL6A 3K6KA 3JRNA 2FOXA 3NJ8A 3ZIAA 3EZGA 2FMUA 4ZVRA 5A4MS 1W59A 5F1OA 1FS5A 2E87A 1ULUA 3AVOA 3ME5A 2XH8A 3H5NA 4XASA 5EHXA 2XGJA 1KK0A 3FWYA 5CFNA 1PI3A 3BAFA 2ECKA 1OBVA 3AO0B 1U8UA 2C0QA 3DYVA 2JBAB 3KVNA 1DEOA 1Y5MA 2RGYA 4FC6A 4RZQA 3RRZA 4EAQA 4ZKDA 5J4VA 1QH1B 3Q7RA 4TTQA 3SLGA 3LJKA 1YI1A 2Z5FA 2I4NA 5IWCA 1BA3A 1N8KA 1Y42X 2HWKA 2ODPA 3BGIA 3GQBA 3PFHA 4H9GA 3RU9A 3OJFA 1SBZA 4IILA 4LV5B 3M1AA 4MSUA 4ZAZA 1SVNA 1JEQB 3UHJA 2JGLA 1WSBA 3C6BA 4KQ9A 3KR2A 4S1NA 3OY7A 2AN3A 4YUAA 4O4HA 3HM2A 4HGRA 2OV1A 3UWKA 1TO6A 4PV7A 4HUTA 2VI5A 3GH1A 4YJ2A 3ZLTA 2DB3A 2YIVX 3D8TA 2NVUB 1G6KA 1P4GA 3A3KA 4HUQA 3SSAA 2TRSB 2JW5A 2WF9A 4AUEA 4P0QB 1TUGA 1I4EB 3WJ2A 4N1AA 1CZUA 4Y9SA 3WX0A 3V1TC 4L75A 5CU7A 5B30A 3MWDA 2OM6A 2P40A 4YH1A 5B12A 4RPIA 1EXDA 5EY5B 3UV7A 2XMSA 4J2HA 5ALVA 5C8YB 3CRZA 3F6SA 3H5VA 3HYRA 3N0VA 5DSTA 3FGZA 4CM9A 4PCAA 5DSXA 5F2NA 1GUYA 4Z1OA 4EH1A 3THXA 1GAEO 4FFPA 2EKDA 1UXHA 3GEPA 2PLFA 4IFTA 2P35A 1UPXA 2AJLI 5IUKC 3E9ZA 3J80A 4JWKA 3E7FA 1VLQA 3JRXA 3M4NA 3GPCA 4HLNA 4HZIA 3C8UA 3WDKA 1ZCAA 4S0ZA 3UHOA 2R5FA 1NXPA 3ZHOA 5DV9A 3L18A 3USZA 2O07A 4KDFA 5PGMA 4HWTA 2RK3A 4EI8A 3THRA 2CHFA 2JA2A 4DDKA 2MSDB 3F4BA 4UBNA 4BVKA 5KQGA 4HS4A 4EJ2A 5B7QA 1AF7A 5EKSA 1VPTA 4ENSA 1FDOA 5CFMA 1NDQA 3EYAA 3HCPA 4YK7A 4X6YA 4PVCA 1E92A 4YJ3F 3TZ6A 1E0JA 2YJ5A 3G2HA 2O3RA 5DZSA 5A1TA 4UDNA 2Q29A 4IHJA 4JGBA 4RK1A 1N3BA 2FEXA 3HS3A 3TUJC 1CY2A 3ISTA 4D3YA 4KFCA 1ESMA 1P60A 3U3DA 2EF1A 4FYXA 4OXQA 3VJMA 5KS2A 3AI1A 4OH1A 1TKBA 4S35A 3NDRA 3KUUA 4Z0TA 1E4EB 2O2CA 1WHSA 1IOZA 1UADA 1DIAA 1TPZA 2XGGA 2ZT5A 3HKEA 3MJCA 3OZCA 4KL8S 1J22A 1II9A 4M3NA 4C88A 1E32A 4JKOA 4OCZA 5BSUA 1WXDA 2BEWB 4TL8A 3USCS 1DC7A 3FDZA 2PLAA 3ITNA 5CLFA 1SZCA 4K46A 3QENA 3A1DA 3GZTB 1KYYA 4PZ9A 1KDVA 4N7RA 2W6NA 3MTGA 3KQHA 3K32A 4YUWA 3WB0A 4C29A 5A06A 5HYVA 1G6HA 4MUNA 3TQFA 3SQWA 1K2WA 3KZ1E 2JJ2D 1L7OA 4PNPA 1GXSA 2F8MA 4CFZA 4IHAA 5BN5B 1QS0B 3FUXA 5CLIA 4P4NA 4RIIA 1JIKA 5FADA 4CQMA 1DEKA 1ZA1A 1OBHA 4HXYA 4UXHA 1EKXA 5IT5A 1NP3A 1C1HA 2IY7A 1TZBA 1LF5A 3RBAA 1KJ9A 4LK2A 4EPWA 1M33A 3QIVA 4L3OA 4M49A 1L4GA 1L1RA 5DM2A 3WBKA 1I7SB 2BI7A 4OSEA 4Y1GA 1PK8A 1KZ9A 5DHUA 2PUAA 3AF0A 2Z6VA 3FZYA 5H81A 3CH4B 4F93B 4EBFA 1Q20A 1HNZB 1XNGA 2C9ZA 2GI4A 4LXHA 4NE7A 2I6XA 1EWTA 4HEHA 3FHTA 1STOA 1NOIA 1XZLA 3I2IA 3HJNA 5JXIA 1TAQA 1U0RA 4LZZA 1GPWB 4WRRA 4NFSA 4M37A 3R7SA 2R60A 4MR9A 1ZGAA 3P9XA 3A05A 4MS3B 3RC8A 4H6WA 3S68A 3VU0A 1HEYA 3T3IA 2H52A 1SOWA 4ZYWA 4KPUA 4XD2A 1UAAA 1HDCA 3NALA 4KXUA 1XFDA 3D5EA 1NXVA 5DBFA 1ISRA 4M1OA 2IYZA 4BIIA 3WK4A 1J42A 1YOVB 4RNDB 3LVBA 4Q9IA 3RFVA 4EI7A 4R1LA 5T4HA 2GM3A 4MQBA 1EE2A 4J2TA 2Y9PB 4CV2A 1OR8A 1BVYF 2WDZA 3OJEA 1YSCA 2EX0A 4NZOA 3OBBA 1EJ0A 4Q6BA 4BO6A 1NPTO 1U3DA 3X2FA 1JB9A 3O4HA 1KPHA 3H7IA 4KSYA 3WFIA 1JP7A 1P80A 1G55A 1W5BA 1Z4NA 3B6EA 3GG2A 3LQQA 3MHPA 2BWJA 2JZOA 2XYHA 1WNTA 4PHFA 2WVGA 3GVHA 1P0IA 1QBGA 1HKHA 3NC4A 4G2TA 3DR3A 2JLQA 3JD2A 3PHGA 1AUXA 3OT1B 4BBJA 3NOVA 5I7AA 3LGXA 4B40A 5B57C 1YB6A 4L5BA 3RWOA 3NBUA 1OU4A 1L6IA 4MB0A 5K6AA 1THGA 4Q0MA 5T4EA 3C8ZA 2QTLA 4OHCA 3OC6A 3A31A 2D1QA 4H7EA 1OGIA 1ZRNA 3K20A 4DEXA 2DPHA 3NTLA 5E3HA 1C1DA 2IEYA 4MI3A 1JBEA 4S24A 3QVGA 1NDUA 4D96A 4UUQA 4TLDA 1TCVA 3D7RA 1Q12A 4FDMA 10MHA 1XMQB 2CF6A 1SU7A 5A4AA 2K87A 3WADA 1EI9A 1MC1A 1GFWA 3TZLA 5KMGA 4EG8A 1JN0A 1F8FA 4I55B 5L3RA 3U56A 1GRRA 2OBBA 4GUDA 2N75A 3OJCA 1JDBB 3LQFA 3LT2A 3Q0TA 1NIPA 4JMLA 4O2AB 1DTWA 1VFNA 5SV2A 2BBWA 4AK9A 2WTNA 1QKJA 4F5ZA 4QHSA 5FBRB 1K7CA 4GYKA 1FSFA 3V2UA 1WR8A 3A4MA 4BVEA 2GN2A 2ONKA 3GXBA 2R86A 4MW7A 5FPYA 1OROA 3Q7QA 2B5VA 4HADA 1CEXA 4U6NA 1F2VA 5JD3A 3OIGA 3HB4X 5FA5A 4UVGA 3GJTA 3T34A 1IN6A 3TX2A 2QY6A 2YR0A 3C41J 3GFQA 3TRIA 4OQ4A 2I78A 5T8KA 4NULA 1A27A 2X2PA 4Q4HA 2NQ2C 3TI9A 2AMFA 3T5BA 4ND5A 1UC8A 1WZUA 4PZLA 2FWAA 1RXSA 1Y3AA 2IOFA 3PF8A 2OGSA 3PXXA 5TE9A 2FDXA 3TTYA 2OO3A 4X00A 2ZJBA 2Y1FA 1RABA 2YV3A 2QJOA 4WOBA 3H05A 2OA0A 3N2ZB 1E5XA 1Y3IA 3H2GA 1MX1A 1MJGA 1U8AA 1RHMA 2VYVD 3KTAA 5AXBA 5KPDA 1J06A 4F3TA 1F0KA 3ZLBA 1VMKA 3R7NA 4KE6A 4EG0A 5IFLA 4BCBA 5MN5A 2HQRA 3G89A 2Q9AA 5HE8A 1AUQA 1FNCA 2XUJA 3MMNA 1JALA 1E66A 2FPGB 3L6UA 3SXJA 3ANYB 3CPSA 3ICWA 4QA9A 3T7SA 1ST2A 1IEVA 4FIZA 1O6BA 2WAXA 1VMEA 3O8OA 4QRDA 3IUSA 1YRBA 1X7GA 1SELA 3HA2A 5DHSA 1KYZA 1QZTA 1O95D 2F8LA 3C7TA 1QGED 2OC4A 3JQRA 1RCFA 4G9EA 1BFDA 3EZ9A 4PSCA 4DTIA 3V1UA 1SOAA 2DT5A 3DMPA 2MYUA 2RI6A 2A59A 2Q1YA 2H8GA 1NBIA 1Y34E 1BH2A 1YKGA 2FQYA 3FKQA 1U8EA 3N2NA 4HDRA 4ACAA 2R6CA 5COAA 3PWZA 2XCUA 3LRXA 4E7OA 5KYUB 5JDCC 5FBZA 1RT9A 1OLSA 5DN9A 2X8WA 4RVFA 3VSDA 2YDYA 4WKBA 3ZBUA 1DAIA 4Y1EA 1UAYA 1YL6A 1A9SA 2GRUA 4JJIA 1XRPA 2IUEA 4P4SA 1HL7A 4KJZA 2ZUVA 2PR7A 1H4VB 2XMQA 1KOJA 3NZEA 4NHEA 2EYQA 1L8AA 2OXRA 1EZ4A 3PKZA 1QYCA 1LZKA 3CNHA 3DL4A 3IIKA 3UAGA 4B0PA 1T29A 4K6FA 1KQGA 5IYZA 1LDGA 3HABA 1XWWA 1YFJA 2HMSA 2G5TA 3I9V1 3LY8A 2XVAA 2WWVD 2WY2D 4I7EA 4BV9A 4TS9A 5TVGA 3RS7A 2JLBA 2HMTA 2IYPA 3VOAA 1W34A 4ZTBA 3JZFA 2WLSA 1S2MA 1PT6A 4D9FA 2C7QA 4PAWA 1PFVA 2ZSFA 4AX4A 3BH6A 3PQ2A 1Y4SA 1ACMA 3LQ1A 4R8SA 4WCFC 4YGXB 4BYGA 2J3HA 4UTRA 5A9RA 2J0EA 2ORYA 4QNMA 3ZHVA 621PA 3MHTA 2G8NA 2YX1A 1SVKA 4H1TA 5DWQA 4EVIA 3WK8A 2EZUA 4TROA 1XHLA 1XQXA 1YJQA 4MV5A 3SJZA 2LXNA 2OBLA 3R3UA 2C9CA 1UMDB 3AVTA 5LD2C 4WDRA 2VTBB 1GTJ1 1TLLA 2XZDA 2GR9A 5LYJF 1L7PA 2NX2A 4I1SA 4ARIA 1OA0A 2HUPA 3RC3A 4RXTA 3T1OA 2QRGA 2DWQA 4JUCA 1D2CA 2IBTA 3ZWBA 2D0OB 3HDJA 1EWVA 3BJMA 4IJUA 2ZB8A 5AIBA 3KHTA 4BNFA 4DCGA 5H02A 1P1BA 4HWRA 1W8IA 2I62A 1KAMA 2VIIA 3JR7A 1TE2A 2GOYA 3OMLA 3G7SA 1PJTA 1E79A 1JAIA 4JJKA 4UVDA 5GM2A 4ZU1X 4AZVA 3GP8A 1EX1A 4JUDX 1GKLA 1SCUB 3L6RA 1EE1A 5C53B 3D1JA 4RQAA 5B1YA 4JB2A 4IQGA 3WIBA 3V8BA 4JP8A 2DSNA 2OQVA 1EUDB 1JS1X 4Y2GA 1P72A 2WHEA 5CM9C 1W85A 3F4LA 4UQPA 2IF0A 1J2JA 2PZFA 4LGVA 1YWGO 1R4MA 4DDUA 3OJXA 3T7AA 1WMSA 2IP1A 4GPTA 1SQFA 3STUA 3T9FA 3HVHA 3MWEB 3BORA 3P5SA 3GUCA 1WJGA 1M6WA 4Q12A 1MPXA 4POOA 3RRJA 4GICA 1OLUB 4GMDA 2YJZA 3DCIA 2R8XA 4TTTS 3S3TA 6ABPA 3ZUPA 5KQSA 2VJDA 4DA8A 3E35A 5BVGB 1D6SA 1LD3A 3HZHA 1RM4A 1GGNA 4EP1A 1UK6A 1BX0A 3B1XA 2H16A 3DW1X 3GLVA 3L6CA 3AHGA 4MV0A 5EZYF 2GQ0A 1YCGA 2QRUA 3GHHA 2JARA 3TOZA 5ALKA 5LLSA 1VKJA 3U7JA 3LBYA 1O0SA 5EI5A 1FE8A 4YXWA 4K3UA 2IC5A 3GGDA 3UUEA 2N42A 3OKPA 1Z2AA 3D02A 4I1IA 4BO9A 1I2ZA 2GKOA 3QXCA 1B15A 2M6RA 3BWBA 1Z06A 2COEA 2A67A 5GGYA 1BXRB 2HQOA 2J6BA 5FUBA 4DCTA 3P7MA 2I2CA 1FDTA 1Y7HA 4MV7A 4RMNA 1XSEA 2J41A 4PINA 3T95A 4DIDA 4M7RA 5HKOA 2R2AA 2CV0A 4P58A 1ORRA 1C14A 3C3XA 3QE3A 1U4OA 1YZYA 3U4GA 4KHPB 4M2LA 1COWD 4BAGA 1ENZA 1F60A 1C3VA 1XZAA 1K7YA 1P9RA 1NFQA 3CSSA 4FMDF 4R5MA 2D1YA 1AZTA 3LXXA 3WQBA 4DNOA 2X5OA 4ISCA 2QEQA 1UM9B 4GGMX 2JLYA 3FCCA 4P4UA 4D8UA 3INGA 3MRXA 3A6GA 5BORA 3HYCA 3IODA 2AG6A 2K7FA 5A0VA 2WIAA 1KOLA 1JAHA 2YVQA 3HWWA 3PNLA 1JFSA 1M2GA 3MMPA 2V7XA 1H3EA 1ULTA 1I1OA 1OX4A 2PUJA 4Y9TA 1OAKA 4KPEC 4MDFA 5DWDA 4GL2A 1MOQA 1J0BA 4GVPA 1YAHA 1AHNA 2UYHA 2POCA 1VIMA 2DM6A 3FFBA 4LMBA 3OM0A 3TIXB 2CJYA 2FETA 2PZBA 3BZUA 4C7BA 3HUUA 5IPFA 1TEZA 1J1UA 2H48A 4RKQA 4M46A 3Q41A 1T8WA 2OENG 2QU7A 2AMVA 3MWKA 4JXKA 4R9NA 3H99A 2HR1A 2FE4A 4NONA 3ZHXA 4WN9B 1X8LA 1YC5A 4AKTA 5KKNB 1HNWB 2IYEA 3P4YA 4QELA 4DLPA 2JC3A 2YWEA 2B1RA 3QJ5A 6GPBA 4H0CA 2FFAA 1R6VA 2IT1A 2B34A 2MSNA 2VHWA 5SY6A 4AJLA 1EXVA 3EUWA 4MJ3A 4RSGA 4DRXB 3WB2A 2W6CX 1OJLA 5BSHA 1GTRA 3LCMA 4NAUA 5CNJA 3OEEA 4YT2A 1CHNA 1HYBA 4CTMA 3HMKA 2G4LA 1QQ7A 1X14A 2AZDA 5KHAA 4FDUA 1O0BA 1ODSA 1NOJA 1TTPB 5JALA 2ZRMA 3A4TA 1B6SA 1TGYA 4AKEA 2O19A 4GOND 4KAJA 5J2UF 2IUYA 2HCBA 4R98A 3PGJA 5ENZA 1XU7A 2OCXA 2HGZA 4FYJA 1PR2A 1R9GA 1R1DA 3ZWKA 1E3WB 2XNCA 4NAHA 4XVCA 2B25A 2P4HX 1NT4A 1RTTA 1J09A 2A84A 1XTIA 2NZXA 4P7GA 3U62A 3BDVA 1DJLA 3I8SA 3UCXA 1KJYA 4C1NA 3FYUA 5BYKA 5JPDA 1YGPA 2NQ8A 2PLRA 5DNVA 1GCOA 5DWVA 3L1VA 4JGIA 4RHYA 1KETA 2V7WA 1VE7A 4R9UC 3EOAI 3AXTA 5F1YA 5EJ7A 3AQ4A 5KQRA 1WKCA 1JZTA 5AW1A 1QYRA 1VECA 4GE3A 5B5SA 1JDTA 4YYEA 1E6MA 5IAEA 4KMSA 2CT8A 1EBFA 4QPNA 3ZNOA 1JVNA 2G1JA 2VA8A 1A9XB 1XCMA 4YAWA 2NU8B 4NCXA 2WWIA 3WFJA 3MTDA 2C3PA 5HZGA 5IG2A 1C7IA 2Y0DA 3EC7A 2NAPA 3VNAA 5FLKA 1NM5A 3ZCVA 3ER6A 1BEEA 2RHMA 3MW8A 4RSHA 2OCGA 1L2TA 2J09A 5HFAA 1N2XA 1MORA 1XRSB 2CDCA 2E48A 1DDGA 3OQJA 5CD1A 5AYVA 4O2BF 3SNKA 2FUKA 4AJJA 1GZDA 2INGX 2GK6A 4W5QA 3I83A 2JIBA 4MQEB 1XTPA 4Q4CA 2JKYA 4NQRA 3Q3HA 4PSVA 1ECFA 2GLXA 3JQFC 3DBRA 2GZ3A 5BV1A 4PFQA 2P30A 2GEVA 3P9YA 1ZGGA 3LC2O 5CNMA 4C4OA 1M2EA 1T3SA 3E8SA 3UWDA 4AFNA 1LU9A 3D59A 3AJ9A 1PGQA 2J0UB 2QPLA 2PR2A 2RAUA 4YO8A 4PFJA 1E5DA 1IU9A 4XE5A 2P8SA 1TM5E 2GVDC 2ZRGA 3OPQA 2H2DA 5KOYA 1NX6A 3FOBA 4OU5A 1IMJA 5FFFA 1I7NA 2YQZA 3RH0A 5CXUA 1FMCA 1M74A 1T1EA 3MOGA 1PBNA 3TTSA 4IIJF 2ACEA 4A2WA 3N8HA 3M0EA 2L82A 4FINA 4PLVA 2CFTA 3DOFA 5DH9A 2EQBA 1UBSB 3FCEA 1SHUX 4LXXA 3I3SR 3DQZA 3CLKA 2FZEA 5AVRA 4N5HX 2YFKA 2ODNA 4RQBA 5KYTA 3CN7A 1XJCA 5ALHA 4C5AA 4H0NA 3WP0A 3VNRA 2H0RA 2X77A 5JD5A 5GPBA 5E4JA 3Q8XB 2VSQA 3PRHA 1RWQA 2ISSD 3O2QB 4PYQA 3U7IA 3DLHA 4JJFA 3RC9A 4IQ0A 2PJZA 5BSVA 1H1TA 2AN4A 3H0CA 1OXUA 3CRW1 1P77A 3PRJA 4IQ4A 3OIYA 4JC8A 2PXCA 4OMDA 4WXEA 1E2KA 1KP2A 4MWTA 1JE1A 4AU1A 5IKEA 2DWOA 3V1YA 3IAS6 1F1JA 3OAAA 4EEXA 1HDIA 4DZRA 3HDGA 2HV9A 2P4UA 4DZTA 1TTTA 4UHJA 5BXQC 1P8JA 4IF4A 3ND6A 3IXLA 2ZDQA 4I1RA 3L7NA 1YMVA 1V16A 2VPYA 4EVQA 5C1PA 3NX4A 4ZOLA 4RA9A 1NVEA 3SC2A 3VTKA 4BRSA 2R85A 5LPNA 5HQTA 1HE1C 5G41A 7GPBA 1F8YA 2AEMA 3PWTA 3L7CA 1D6MA 2GVZC 1R4AA 4GPBA 5AKEA 4BWVA 3CBGA 4JHXA 2H9YA 4INZA 4DM3A 3UKDA 4UHHA 4HX2A 1N2SA 1ZMRA 2P7HA 4IIVA 5FWYB 4JVNA 5K05A 1TF5A 3IV9A 4EARA 1ZNZA 1MJNA 1Z37A 1I5OA 1PNVA 1VE5A 2WWRA 1Q95A 1ZXXA 1QRAA 4YONB 3V4VB 3LC0A 4MW6A 4G0QA 2X1HA 3B7PA 3QBJA 4UDYX 4C14A 2A30A 3DR5A 5EUMA 4EMBA 1AUPA 2R4TA 4HVCA 3G9UA 3S7ZA 2E1RA 4JBHA 1NBOA 2A0XA 2Q5LA 2ZAYA 4U39A 5DNWA 1ML4A 1U28A 1W49A 4E3WA 1GITA 3FMGA 4HHEA 5EIBD 5I7VA 1SA0A 3GJ6A 1RBZA 1U0BB 4Y6GB 4YAJA 3ZCSA 4IKEA 1FSPA 5C4IA 4CG0A 3BIXA 3DM9B 4BNKA 3JAKB 2CE7A 2O7RA 3L0IB 1UPTA 2Y93A 1U2EA 4GWKA 5F3RA 2AZTA 1Q1AA 4B85A 1RHQA 4X94A 4PYJA 1Z28A 5KJFA 2R1TA 5FFMA 4NMXB 1RC8A 1CUJA 2RHBA 3LCUA 3ZY6A 2CV1A 1N2CA 4MPRA 2VPZA 3KLOA 5CH5A 5KNCA 5J4KA 4X92A 2O3UA 5D6OA 3ADCA 2P6PA 4ME6A 1Z3IX 4Q3LA 3LT0A 2A9KA 2B9EA 4MRVA 1U3GA 1YS9A 3VR0A 2AI1A 4A0FA 3C48A 4KK4A 5C5EA 4OQDA 3AEKA 3QK7A 5JFTA 3WZ2A 3B51X 3N7AA 1OAAA 3IGFA 4I50F 4YMVA 5LQRA 2QM0A 2PFKA 3D0RA 4KG7A 4OREX 5HS4A 3K9FC 1Q57A 2P75A 3VR3D 5CDGA 2NTEA 5CDHA 2A3RA 3KZKA 3N2KA 4MMYB 5AH0A 1DIOB 3OOEA 5LIRA 1D4FA 2W6IA 2X19A 4X8MA 1JZSA 4YY3B 2PVSA 4XYGA 4ZJYA 1T2EA 3PDIB 1N7JA 2OXCA 1UKZA 1AZWA 3LC7O 2I67A 4C21A 2WYVA 4LRSB 4EIWA 2E5FA 4ZANA 1DC8A 3Q3EA 5LXTF 4MKRA 3E8XA 2WR8A 1MBZA 3BL5A 5F4ZA 3FWZA 3GO4A 4HN2A 4KYVA 1QRTA 4EK9A 1IM5A 1T2VA 4MVJD 5DYGA 4D9MA 1XJWA 1HSZA 3GFOA 4AJEA 4OXXA 3KQVA 2RKBA 1ZGBA 4CTJA 2PM8A 1B1AA 2PRIA 1Q2XA 3CX3A 4GBED 1ARZA 3GN2A 5K6TA 4HFMA 2IXTA 4AXXA 3T7CA 1WPGA 3ANXA 3SOZA 2W90A 1N34B 1V7CA 4HYYA 3UCFA 4QUGA 4ZI7A 1RKVA 1VPVA 3FOAA 2BGNA 4H4EA 1QLWA 5ALRA 1C7QA 5MHTA 1OW3B 4IJ6A 3RO7A 2G08A 4B4VA 4DJJA 3C7KA 2A5LA 4RY2A 1GCGA 1M8PA 3I1YA 3ZNPA 1XIVA 5IT0A 3MQFA 4LXQA 4AJKA 4MVJI 1WNFA 4S3MA 4EITA 3AR6A 1YVPA 2YVUA 2WUGA 5D3MA 5TQ0A 3G2NA 3TZCA 1E1RA 2JIZD 1QLHA 1DAOA 2DR2A 2JAPA 3IDAA 5D1HA 4ZO4A 1SEVA 4B3RB 4OX9Y 1LQUA 4ITUA 4B2YA 1C7FA 2D7CA 5EXXA 2CXNA 3OEWA 2HIHA 1I13A 3ANNA 1X92A 5AKHA 4FPXA 2BFPA 2C00A 1VE3A 2V6IA 3LA6A 2IHJA 2E4VA 1DI0A 2R7MA 3GDGA 3ROMA 2RH9B 3R9IA 3TZQA 4FSDA 2JF0A 1Q16A 5IZCC 2NZJA 4WZZA 5EE0A 1P91A 1Z2EA 4E22A 4QJ5A 1LVHA 1WCV1 1U7XA 2C7VA 4C2BA 3CF4A 3GRUA 1A4UA 1T15A 2H57A 3OLXA 4G0PA 4GC5A 1C7ZA 2WYIA 1QXSA 2FHPA 4NYIR 4RHXA 5IC5A 4ZTUB 4EB3A 2AI2A 4LSGA 4BUJA 5HTOA 1DBRA 1IY8A 1BWRA 1TZKA 1NN5A 1VL6A 1WVGA 3NOXA 4NPAA 1R9JA 4B4KA 4DFDA 2E5LB 4Z53A 3D1LA 3ABQB 4M89A 4FI3F 3T3DA 4OP2A 5ELXA 3CISA 1HZZC 1U9ZA 3GROA 4IO1A 3LD9A 2YNMC 4UTVA 5AVTA 4MCJA 4UNNA 2BEVA 3O91A 1MO6A 2HADA 4U7HA 4ZAGA 1UBRS 4BE9A 4PYIA 5DEIA 2W2LA 5G0TA 1I4WA 3DE5X 2HEGA 2IPAB 4X8HA 2ZRDA 3HVUA 2C5SA 2FX2A 4P2GA 3HRIA 2WKQA 5JZVA 1NT2A 2FHSA 1NVVR 4Z5XA 4OL9A 1PWEA 1XVIA 5DM60 3ONVA 2CUNA 4PCLA 5G3YA 3CTPA 2OT3B 5KNDH 4JD5A 1UFOA 3IHLA 3A10A 1G16A 1RZVA 2ZRPA 4DT1A 2QVGA 1NMSA 4M99A 1SU6A 5EJMA 3WK7A 2PDAA 4NPCA 4ARVA 2BJHA 3F6EX 1LPBB 3DFFA 3LQYA 5B2ZA 1MA0A 1QIEA 2QD4A 2JGFA 3K9GA 3L8GA 3O2NA 3OI7A 4RV9A 4ZCLA 5BMVF 1ORWA 3ZEIA 1BDIA 1HR0B 4TRMA 3T9AA 4FSHA 5A4DA 4YI5A 1G64A 2IBMA 2VK2A 3H9BA 2X76A 4HXFB 4WVFA 2ZBUA 2YZGA 3BAZA 3K0AA 1G8GA 4OK5A 4BWGA 2H18A 1A8PA 1FFDA 3EA0A 2LZ0A 1NSFA 3IP8A 3UB4A 3V6LA 3VOTA 1GTVA 2ZJ1A 3W5IA 4F5YA 1LBHA 1CERA