1MJ5A

Linb (haloalkane dehalogenase) from sphingomonas paucimobilis ut26 at atomic resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26 at 0.95 A resolution: dynamics of catalytic residues.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
molecule keywords 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase
total genus 112
structure length 297
sequence length 297
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mj5A00
1U8EA 1XZFA 3QH4A 1NU8A 1ZD2P 3F9CA 5AOAA 5JATA 3IVMA 4I19A 1U4NA 1MAAA 4FTWA 2OGTA 4QDZA 3ANSA 3H0CA 1UFOA 3WK7A 3NWOA 1N8SA 4H7EA 4UBJA 5C8XA 3GROA 3E1GA 4MWSA 1U2EA 4IH1A 5CT4A 4E11A 4UFPA 3PFCA 4RE6A 3DL7A 4XVCA 1E8NA 1JU4A 4H7IA 5C8ZA 5FKJA 4DSZA 3D3NA 3H19A 1QFMA 2Z3ZA 2O2HA 4U2FA 4DM7A 1ZJ4A 2OQIA 4J0DA 3STTA 3QITA 1AQLA 4Y2QA 3SK0A 5AM5A 2EDCA 4IQ4A 4U2BA 2QS9A 4LKOA 2CKMA 2I03A 3H2IA 2ZYIA 4CCWA 5ALZA 4X85A 4L9AA 4QNNA 4B83A 1P0PA 2K2QB 1G42A 3AUKA 1XZBA 1W52X 5LZ7A 2HRQA 2I3ZA 2W22A 4CG3A 3HC7A 1AUOA 5AKZA 2XUKA 4LHEA 2WIGA 5CURA 1WHTA 2ZJFA 3R3XA 3I6ZA 5FP0A 2XMQA 4E14A 5A6VA 4ROTA 4BRZA 3B12A 5A62A 5JARA 2HFKA 4BTLA 4QLAA 4PW0A 1ZJ5A 3TRDA 5AI8A 1VE7A 3C6XA 4DMHA 2BFNA 1XLUA 5D6OA 1ODSA 2ONCA 5K3FA 1E89A 1IUNA 3OM8A 2IX9A 4KE7A 2DHDA 2HA3A 3AINA 3WL8A 5E2IA 4W1RA 5HKAA 2VTVA 3IURA 1GZ7A 2XDWA 4FHZA 4KE6A 1EB8A 1HL7A 2WFMA 2RIPA 1DWPA 1ETHA 3DOIA 3WWEA 1K4YA 2WILA 5AOBA 2GYVA 3R3ZA 1AMNA 3M81A 3UMJA 1FSSA 2D0DA 1H22A 4B82A 4TVKA 2XQFA 3W2TA 3WA7A 4BC0A 1VJ5A 1XRMA 2QM0A 3DCNA 3D2AA 5LZ8A 2Y6UA 4YPVA 1N5MA 2WHPA 4FMPA 5DNVA 2FJPA 1O6FA 1XFDA 3WA6A 4C4YA 2J4FA 3N0TA 2VATA 4MYDA 3Q0TA 4OUKX 2QR5A 2WU4A 5CT8A 1BEEA 1K6EA 3HEAA 1LPMA 2AJDA 4Y2YA 4B0OA 1CUHA 4FDMA 4MYSA 2GBFA 1MX1A 2JGKA 2PUHA 2JGEA 4J3JA 2XUQA 4FNMA 2PX6A 3QPDA 3ZWQA 1K63A 2HA2A 2QUAA 5A2GA 1ISPA 3STXA 4UHBA 1QJ4A 5FXMA 4CIBA 3HSSA 4H7FA 4N5HX 1H2XA 3OTQA 4QLOA 4FBMA 4FWBA 4LIPD 1H2WA 1CFJA 4GXNA 3D5EA 1XLVA 1GKKA 2ZSIA 4AQDA 3VKFA 3PUHA 2XMSA 3AIOA 3FCXA 5JAHA 1JT2A 5AI4A 5EHQA 1C7JA 2HIHA 3BJRA 1X70A 5JAUA 4C6HA 2HA7A 1MO2A 1PV1A 4K5QA 1EXWA 4ETWA 3FVTA 2JGFA 1THGA 2Z5GA 4B85A 1E3QA 4GBGA 5AKLA 1QO7A 1Q83A 3EF3A 3ESDA 5ALLA 1TAHA 2XUGA 2OAEA 1DQYA 4ZI5A 2I78A 5HF8A 1EVQA 2XQGA 1BU8A 1ORVA 4H7JA 1R88A 2VT6A 4BVKA 1R50A 3EBLA 5J3JA 4N8DA 4X97A 4Y2VA 4XIIA 3QMMA 3E4DA 4X6XA 5CT9A 4O08A 1M33A 4DMCA 3DOHA 3M83A 3UUEA 4H7HA 4DMKA 3HJUA 5ALQA 4WFJA 4C89A 3QYJA 2YH2A 4W1QA 1EB9A 4Y2PA 5AKEA 5T4FA 1JJIA 2AJLI 5ALVA 2WHPB 3EQ7A 1JJFA 4G1FA 4YASA 1SCQA 5HF6A 4LXGA 5JZ9A 3LIPA 2ECFA 4Q3OA 4NMWA 4AZ3A 1HLGA 2BGNA 3ZPXA 1GPKA 2VJDA 4BCDA 1UK8A 5AM1A 4ZV7A 1ZICA 4QEKA 2XMZA 4B0PA 4ZXFA 1SCKA 3BE8A 3H1BA 1A8UA 1UKBA 3DJYA 3M82A 2R11A 2YYSA 1GT6A 4J0CA 2GBIA 5CT5A 4EY7A 5D3ZA 3WKEA 1MJ5A 5ALTA 5AKXA 4CG1A 4B9EA 2WG2A 1CLEA 1X2BA 1IMJA 1MNQA 4JYMA 4G4GA 5K3FB 1Q0RA 1AC5A 3OC0A 1QIMA 4KR0A 1USWA 1DT5A 1TRHA 2VJCA 4YX9A 1QIKA 3ZLTA 4X3CA 3OOSA 3L1HA 2DQYA 4ZRDA 3I2HA 1CR6A 3G9TA 2OCKA 3VVLA 1XKTA 1CUGA 1LGYA 4E15A 3QZUA 4DIUA 1XZEA 4LXIA 1CUUA 5K5EA 1VLQA 5FLKA 1IVYA 5EHXA 1XZAA 3TGLA 3LCRA 3AIKA 1JKMA 1CUAA 1WOMA 3ZLUA 5BOVA 1WPXA 3VXKA 5I7UA 1UZAA 1LNSA 3QMVA 4C87A 4IO0A 2VAVA 1YB6A 4GLBA 4AO7A 1SC9A 1CUVA 4UHFA 4OB8A 5JALA 4BC1A 4F21A 1C7IA 3BWXA 5JD4A 4BE4A 2WTMA 5AK5A 4Q82A 2XQIA 3H17A 3SC2A 1O6GA 4ARBA 1MT3A 4GDMA 4G9EA 1AX9A 2PU5A 2AJCA 2VEOA 4AXBA 4FFWA 5CXUA 3R3UA 4JUIA 3C45A 5CW2A 1UKCA 1QIHA 2WFLB 5ALDA 4QE3A 5LLSA 1DWQA 3AZOA 4WFKA 5T4HA 3KD2A 1W1IA 4F5ZA 5EIAA 2ZVDA 5AM0A 2D5LA 3AZPA 2O2IA 1L7RA 3HACA 3MUNA 1CUBA 4MEBA 5K3DA 2AJBA 2O2GA 3IBTA 3STWA 2OCGA 2XUPA 2FUKA 2UZ0A 5EHNA 1UOOA 4E46A 5K3AA 4X71A 1CUWA 2CEKA 4HRYA 2AXEA 1K5PA 3QVMA 4LYEA 3C8DA 4BVJA 2HU7A 5AKIA 3D7RA 4DNQA 4RGYA 4ARAA 4EY5A 3WL6A 2PVSA 1EDDA 5AJHA 1GXSA 4P92A 4JYPA 2PSJA 3CCCA 3U0VA 3L1IA 4AO8A 1XZHA 2WJ4A 4JH0A 1FJ2A 3WIOA 5DNWA 4EA6A 3F96A 4OB6A 1AZWA 3B5EA 2XLCA 3H18A 2X5XA 3WZLA 3EQ8A 6YASA 1ZI9A 2XMCA 5LKRA 2BAGA 2Y1KA 3DDUA 3R0VA 5FPQA 3WYDA 4BAUA 1X2EA 3O9VA 1KU0A 5IVDA 4ITVA 4GW3A 4J7AA 3G0BA 1L7QA 4GECA 1DQZA 3WWOA 3R3WA 2WKWA 1CUIA 1Q0ZA 4INZA 3BDIA 2PU7A 1BE0A 2C5GA 2XMGA 4CIAA 5CTAA 4DSAA 1ZD3A 2QXTA 3GUUA 4MXDA 5HQ3B 4ZWNA 3WLAA 1CIJA 5ISMA 4HZGA 2BGRA 4OPMA 1XRPA 1YCDA 4DNFA 4BRSA 4MEAA 1SOMA 4DNPA 1QIEA 1BEZA 1ZD4A 4ZV9A 3CN9A 1XZJA 4QDUA 3ANTA 1I6WA 4GEGA 2QJRA 3I28A 1EHYA 3EIOA 4K2AA 2QZPA 1ACLA 5BWCA 1CUYA 3BF7A 2G5PA 4BTVA 3IUMA 2Y2VA 2QOEA 2HRRA 3DL4A 4WFIA 3O0DA 1WB6A 2IIVA 3D59A 3DYVA 4QDTA 2WUDA 5AP9A 4LXHA 3FBWA 4IHAA 4X95A 5AK3A 3F98A 5LYYA 1YS1X 2WIFA 5T4BA 3FNBA 4A16A 4G4IA 4BP8A 4BE9A 1XZGA 3VDXA 4Q3LA 3JW8A 1IUOA 4WY8A 4MQLA 2DCMA 3LP5A 3ED1A 5ALPA 1EDEA 3P2MA 3VJKA 4HXGA 5K3CA 5DJ5A 1PFQA 2JGIA 3WWDA 1CUXA 2PSHA 1Y7HA 4UBOA 4EY6A 5C81A 3I1YA 3BL8A 4QWMA 1PJAA 3R3VA 2C58A 2HA5A 3VISA 3ILSA 2ES4A 2QTBA 1Z68A 5LZ5A 1Y7IA 4BP9A 3PE6A 4J0KA 1VXRA 2H1IA 4QDXA 1ORWA 1UWCA 3KOOA 1F8UA 3G8YA 3STYA 1EVEA 5JAPA 2JGLA 4P93A 1EA5A 1WB5A 2C7BA 1XRQA 2XUFA 4OYYA 1ODCA 3WJ1A 2NW6A 5AHXA 5AM3A 1H2YA 4DGQA 5H3HA 2DHEA 2E3JA 4CCYB 5ESRA 2HL6A 3I2JA 5AH0A 2OPHA 5AI0A 3LIIA 5IVIA 1VA4A 5EFZA 2WHRA 1XZMA 1CV2A 1BRTA 3STUA 1JMKC 5JZBA 2WHQA 5AIAA 3H2KA 3AJAA 3O95A 3R41A 5AK4A 4V2IA 3W04A 4HXFB 4MJ3A 1YSCA 2DFPA 3BIXA 1A8SA 4PNZA 1J2EA 1QTRA 3F8SA 1DINA 5SYNA 1YR2A 1F0NA 2QT9A 2VJBA 3ZLVA 3AIMA 2FX5A 3VJMA 3TEJA 2BCEA 5C8VA 4X94A 2DSNA 1QFSA 1XRLA 3SWWA 5CBKA 2H9YA 5A71A 3O4IA 4QZVA 2IITA 3KSRA 4JEIA 2WG0A 4UFOA 1L7AA 2OCIA 4Q05A 2WLSA 3OPMA 1JU3A 1CUEA 2DQZA 2YASA 2QVBA 1TCAA 3FYUC 2ZYRA 2EEPA 5ALMA 1B41A 1F0PA 3ESCA 4KAJA 3FCYA 1BCSA 1CUDA 4L0CA 3ICWA 5HK9A 2C5FA 5E4TA 1XQYA 4EBBA 1CQZA 4KE8A 1IZ8A 2Y6VA 1ZI6A 2WJ6A 2O7VA 4C4ZA 4H35A 4WJLA 1GGVA 4XWGA 1TIBA 2HM7A 3BF8A 3MVEA 4UBKA 4B9AA 2OAGA 1G66A 3FLAA 5ALWA 2Z8ZA 3RLIA 2BKLA 4H0CA 4CFSA 1QIJA 2B4KA 2C0PA 3V1MA 2WIDA 1A88A 1MAHA 4K6HA 3WKAA 1RWQA 3G9ZA 5LKAA 1FFCA 2CB9A 4Y2SA 5DLPA 1E66A 5HCUA 4BDTA 1NX9A 3Q8WA 2V9ZA 3GA7A 5EGNA 1TQHA 5ALRA 1LPPA 3KWFA 3D2BA 1ZD5A 4G8CA 3WK8A 4CG2A 1QIIA 3D4LA 3S8YA 2BJHA 5ALXA 1D07A 3C5VA 1BS9A 3EQ9A 2WTNA 4NZZA 1XRRA 4Y2TA 3H2JA 4KE9A 4UHEA 1W76A 5EIEA 4OSEA 1DX6A 4AMYA 3FWHA 3AFIA 3S2ZA 3WI7A 1WCYA 1BCRA 4U2CA 3WK9A 5IVHA 2H7XA 2RGUA 4KAAA 5CH3A 4J0IA 1GPNA 3HXKA 2OCLA 4GHWA 5ALYA 3VJLA 1U65A 2X8BA 4GWLA 4GI1A 3SX4A 5DTIA 4K6GA 4B80A 4J0GA 1EX9A 1XQVA 1ZIYA 3RKSA 5ALGA 4PSDA 4H7KA 4J0JA 2J3DA 3KDAA 4M0FA 5EI5A 1ZOIA 3TJMA 1JJBA 5JD5A 3MUOA 2PBLA 1E8DA 4I3FA 1A8QA 2B61A 3ESBA 3IB3A 3W9UA 2G4LA 1FFDA 4KACA 4U2DA 3WL7A 1P0MA 1WB4A 5ALKA 3ZV7A 1J1IA 1DU4A 1WPRA 1CUFA 2B9VA 2HFJA 4L3WA 2RONA 3L1JA 1FFEA 1R1DA 3DYIA 4FLEA 3O4HA 3IUNA 4A23A 1T4MA 4X93A 2WUGA 1B6GA 3YASA 1OILA 4Z49A 2EDAA 4AN1A 4QDOA 5K3BA 3V1NA 2JEZA 7YASA 3E3AA 2WJ3A 1GKLA 4CCYA 3PDCA 2CJPA 2QUBA 3A6ZA 4W1SA 4UFNA 3C8HA 1R9NA 2XE4A 1NU6A 4HXEB 4FFVA 4DTCA 1CQWA 2WSLA 1AURA 4WY5A 3WMRA 5ALOA 1QTIA 3HLKA 2WIKA 3E0XA 1QIFA 3F67A 4X00A 1CPYA 1QO9A 5HKBA 4FLFA 1YASA 1ZIXA 3KXPA 2XI4A 5LIPA 5CH5A 1XLWA 3C5WP 2J3QA 1UK9A 2PPLA 4HRXA 3PFBA 4Y2JA 1EK2A 1EK1A 1VKHA 1UOQA 4UBIA 1JMYA 4JNCA 1EINA 1WHSA 2BUAA 3BIWA 4DLNA 2VT7A 3DQZA 5HF5A 3R3YA 3C43A 3FVRA 2XUIA 1N1MA 3V1KA 4KRXA 2XQKA 2H7YA 3B3QA 3V1LA 1VA5A 2Z8XA 1JFRA 1VZ3A 1TCBA 2HA4A 3V48A 2GBGA 4X6UA 3FLBA 4XX1A 5AKYA 5D3KA 5KREA 1FFAA 1EH5A 4OYLA 3IUQA 2BUBA 3WIBA 1QOZA 2XQJA 3JWEA 4OU4A 1CUJA 4WDQA 1C4XA 2QRUA 1H2ZA 2ROQA 3R40A 3AZQA 4P9NA 5EIHA 3OG9A 4BZZA 4UPDA 4DYHA 1GPLA 4U2GA 2OLEA 1WM1A 4UBNA 4C4XA 1VXOA 1LPOA 1HQDA 1MX5A 1IUPA 4G9GA 4D9JA 5CT6A 4NS4A 4PQEA 2XLBA 4PSUA 3C6YA 1R4ZA 3W06A 1LBSA 3PF9A 5CH8A 3PI6A 5HQ3A 1BROA 5ALEA 1IZ7A 3RK4A 2GZRA 2J4CA 1SFRA 4MQMA 4Q3KA 5AO9A 2JEYA 1LPBB 2HDWA 4N8SA 4Y2UA 1GQSA 5CXXA 3NUZA 3WK5A 5AIBA 1ODTC 3O4JA 1P0QA 1CVLA 4S0XA 4BBZA 5FDFA 2QXUA 4A5SA 4QWWA 5LZ4A 2X76A 1QLWA 3I1IA 5JYCA 4BATA 4OCZA 3W05A 1VOTA 2DHCA 4BAGA 5I9IA 3IIIA 5E4YA 3DKKA 3KWJA 2WM2A 2ZJ7A 5DNUA 3K6KA 3WYNA 3HZOA 3K2IA 3ESAA 3G0IA 4RNCA 5JADA 2WFZA 3CCBA 3FSGA 1MN6A 2ACKA 2OGSA 3WWCA 3FYUB 4WDRA 3LLCA 1Q84A 2HHAA 5AI6A 5ALFA 1ZI8A 5FV4A 4HS9A 5ALHA 1E5TA 1MTZA 2XT0A 1XZDA 2PSDA 3ZI7A 4AX4A 5LP1A 4FKBA 4BYMA 1J06A 3H04A 2P8SA 3WK6A 4EHBA 3FYUA 1DTEA 2WU3A 2VA9A 1LPSA 4KEAA 5EHZA 4C01A 1QIGA 4W1PA 1YB7A 1JI3A 1VZ2A 4QA9A 5A7HA 3MGAA 1RYYA 4I4CA 3GBSA 5AKHA 1XZCA 2GZSA 2XUDA 1G5FA 4M0EA 4AN0A 5JANA 1MU0A 2OG1A 5DYWA 4BB0A 1TK3A 2G63A 3QM1A 2QMQA 3FLEA 4UHDA 2DR0A 2WUFA 2PKYX 4EUSA 4KRYA 4AB1A 4OD0A 3PICA 2W6CX 5DWDA 4YK7A 4OB7A 1E8MA 2H7CA 2PM8A 4X92A 5DTJA 2RI6A 3WK4A 3BJMA 3G0GA 1HPLA 2CZQA 4M0MA 5HF9A 1XQWA 2CMFA 4PSCA 1F6WA 4N5IX 2HADA 2WQZA 4J0HA 2XMRA 5ALNA 2GBCA 5JZSA 2ZYHA 1OXMA 4B6GA 2VSQA 1QIDA 1DWOA 3IDAA 3A2LA 1UOPA 5IKXA 4Y9SA 2HU8A 1TKRA 1LPAB 4FOLA 4W63A 2OQVA 1BN7A 2CUTA 3CN7A 4J03A 4U2EA 3G0CA 4HTAA 3LS2A 2XUAA 3IUJA 4BZWA 5K3EA 1XZKA 5FUMA 3HYSA 1LLFA 5F4ZA 5E4JA 3DLTA 1YAJA 1MX9A 3HRHA 1OCEA 5YASA 2RHWA 5AK6A 5T4EA 4EZIA 4CI9A 1UK6A 4WCVA 5HFAA 3C70A 3FOBA 2GYUA 3G7NA 4XJVA 3PUIA 2ZSHA 1CRLA 1QGED 5KBYA 3C87A 4Y2XA 3M3DA 1K8QA 2XUHA 2V96A 1HBJA 3G0DA 3DKRA 3F97A 2XUJA 1LZLA 1QZ3A 2JGJA 3FYTA 3O4GA 4B84A 3C6ZA 4AO6A 2JBWA 1HDEA 3GZJA 4G8DA 3I6YA 2VQ6A 2CBGA 4H7DA 5AKGA 1CEXA 2Z3WA 2QJWA 4TPKA 1H23A 5AKJA 3K9BA 1QONA 4BDSA 1LPNA 3RARA 3I2IA 1T2NA 1P0IA 3D2CA 4ZREA 2B20A 4EB0A 2I3DA 3AILA 2C4HA 4Y2RA 4AMZA 2HA0A 4NVRA 2O7RA 3FAKA 3GFFA 1W6RA 4L72A 2ACEA 2R8BA 1KEZA 1ACJA 3I2FA 4ZGBA 4OU5A 4MWTA 1J07A 3HABA 5KWJA 1TCCA 2HU5A 2XUOA 5CMLA 5ALJA 3QMWA 4IH9A 3T52A 5BV7A 5A7GA 1THTA 3IULA 4KAFA 2AJ8A 5BWBA 1HKHA 5JD6A 1W4LA 2QKYA 3QPCA 4PF1A 5ALUA 3A2NA 1MPXA 3STVA 3NGMA 1XZIA 3O9MA 3WL5A 5AOCA 3DS8A 5IH7A 5HZGA 2JIDA 5JIBA 1YAHA 3DNMA 4BCCA 3IA2A 5AI5A 2YXPX 4N8EA 1CUSA 4EY4A 1LZKA 1UKAA 5FRDA 1DT3A 3V9AA 1XQXA 2JF0A 3NOXA 4X7BA 2LIPA 4PV7A 1FFBA 4K6KA 1R3DA 4UHCA 3I2GA 1UT6A 5ALIA 2FJ0A 3A2MA 4H77A 4F60A 2WFLA 1AGYA 1W75A 2VAXA 2OGZA 3U1TA 2XB6A 1ZGCA 4DMFA 2WG1A 2ZJ6A 2V98A 5JASA 4Y7DA 1N5RA 5FOQA 1CUCA 1S8OA 3WWPA 4KJXA 2BUCA 4AZ0A 5LZ2A 4Q34A 2JGMA 1MNAA 2RHTA 2XMBA 2V97A 4W9RA 3DD5A 5C7YA 5AI9A 2Y2UA 2G5TA 2VF2A 3D0KA 1RP1A 3BXPA 5JAOA 5FPPA 3RM3A 4P08A 1AKNA 3WJ2A 1XZLA 3GELA 4UUQA 1ZGBA 4X90A 4DNOA 5D7BA 5A7FA 4B81A 2Q0XA 1XRNA 1UK7A 2C0QA 1YS2X 3OURA 5DYYA 5AM2A 3C6BA 5KWIA 1CUZA 3QBJA 4H18A 4LYDA 3H2HA 1LBTA 2GYWA 2ORYA 1DX4A 3WKBA 3G02A 3HI4A 3G9XA 3G9UA 1R9MA 4G5XA 3FSGD 1SCIA 3I6MA 4RPCA 3T4UA 2PUJA 1VE6A 1YA4A 3JYHA 3WQHA 2RAUA 4KYVA 4BVLA 3ICVA 1QE3A 3WKCA 4UBLA 3A70A 4EY8A 4BAZA 4IH4A 1G4HA 2HA6A 4BCBA 1EI9A 2PSFA 5ALSA 4F0JA 3DEAA 3H1AA 1KU6A 5SYMA 2WIJA 5AICA 4FNGA 1XKLA 4UBMA 2PSEA 5HK8A 3VVMA 3I2KA 4FBLA 3H2GA 3WZMA 3UUFA 3QPAA 2XMDA 1BN6A 2PL5A 4FLMA 5CRIA 3X3HA 4RE5A 2VJAA 3W9BA 1GQRA 5AM4A 5I8PA 4HAIA 5HFNA 4X6YA 5DYTA 1A7UA 1UXOA 4HVTA 3BDVA 4G8BA 1EDBA 4G4JA 4UHHA 2ZYSA 4Q1VA 3WKDA 1XROA 3PF8A 5AKKA 1YA8A 4TGLA 4B7ZA 5LZ9A 4C88A 5IVKA 3N2ZB 2OXEA 2WUEA 3CXUA 4PO3X 4X91A 1Y37A
chains in the Genus database with same CATH superfamily
1U8EA 2JIMA 4Q9NA 4BP1A 1ADBA 1EAYA 1U2GA 3QH4A 1SXJE 5KOIA 1UMCB 1NU8A 2FW6A 1UXKA 2PCLA 3JALA 4PSKA 4Z6KA 4HGQA 2OO7A 1C9KA 2ZUCA 3GJ4A 5CIQA 5JATA 1TT5A 3IVMA 4TXLA 4LOAA 1U4NA 4WADA 1TYDE 3D31A 2D1YA 3UOWA 2VNHA 1OBHA 5F9MA 3IA7A 4CL3A 4QDZA 4KL8S 2BF7A 2Y99A 3GGJA 3WNVA 3H0CA 1IU9A 3AYZB 1VJ1A 5H1YA 1KY2A 1UFOA 3JR3A 3WK7A 1DQSA 3VSBA 4BGEA 2Q1XA 2PLFA 3IJRA 3WDMA 1L3IA 5BRAA 3R9IA 4HLQB 4QYIA 5KYYB 4I9FA 1DCKA 1U6KA 3ZE1B 4CVNA 1VGQA 2IWHA 4MWSA 1I6LA 1NBAA 1U2EA 4IH1A 4KVAA 1QQBA 2XCIA 1EPUA 1C9JA 1QGOA 3BREA 1IRXA 2PZAA 4R71A 5EQTA 1TRKA 2XYVA 3ZWMA 3DL7A 4AKGA 1JU4A 1DKNA 4FDVA 3SYLA 1DPFA 1B0PA 1YBMA 4H7IA 1VBMA 2C5LA 3HA2A 3Q7PA 3OBIA 4CFYA 1O57A 3GEEA 2G1PA 3D4NA 3HE3A 1IBKB 2CNLA 3ELWA 1HT1E 2M6LA 1S8FA 4Z5XA 3AHJA 4MCAA 3JYPA 3I3SR 4JROA 4KSYA 3SHQA 3KAQA 2I55A 3GLUA 1N36B 3H7IA 2CLKB 1RQ2A 1GSAA 1NUAA 2P4QA 2VNAA 2Z3ZA 3SXUA 2C9CA 2HSWA 1T5BA 6REQA 3PWZA 4I3HA 3RYFA 3ZHYA 2OQIA 1UKEA 3PNBA 3GK3A 4J0DA 4OBWA 1KP2A 1F38A 1RHMA 3STTA 2QNRA 4HK4A 1AQLA 3HWRA 5A3VA 1NBHA 1TF5A 5D7NA 2X19A 3KR0A 4CIDA 5A4FS 3CWQA 4EGCB 1DX9A 3ANMA 5AM5A 4ZANA 4HWOA 4C6RA 4AJHA 2AG6A 3ZI0A 4IQ4A 2XSZD 2IUFA 2Y67A 1HFKA 2QS9A 1F0KA 3EFHA 3ESRA 2CKMA 4LKOA 2F7SA 4Q47A 3ZEAA 5ITSA 1EBBA 4PGMA 2FTKE 2YUTA 1GPUA 3EVBA 2WLTA 1XHLA 4JOQA 3K2EA 4I4TB 4KWHA 5EMLA 4IP0A 4D57A 4CL2A 1GTVA 2IIBA 3VOAA 4CEHB 1TQ8A 1QORA 2CNNA 2K2QB 4M8IA 3E8XA 4B83A 5U9CA 1OPXA 3AUKA 5JMPA 2J3LA 3EVAA 4M55A 1HWYA 4DR7B 4L4YA 4C6TB 5LZ7A 3QVLA 4WKOA 2HRQA 2BVNA 4HF7A 4TOIA 1I4TD 2I3ZA 2W22A 2EWWA 4BL5A 3W5VA 3ICQB 4BN5A 2OV6A 3F7NA 4IUDS 2P68A 1M66A 1PEAA 1XEXA 1V1JA 2EX0A 1ZNQO 1Z0ZA 1AUOA 2YWEA 2ZG6A 1Z39A 4LGYA 4EO4A 3L7NA 1GNVA 5BV1A 3KCQA 3TAHA 2O5RA 4LHEA 4Y6QA 4QBFA 3KVOA 5BYAA 1EVZA 1DSSG 1VLVA 4U7GA 1SQFA 2R7NA 2WIGA 3GVCA 4GX1A 4KQCA 2ZJFA 1YJXA 5J63A 2AZDA 3TZKA 1S02A 1EX1A 1HQYE 2GH1A 2NZVG 3GGGA 3KB2A 1H4TA 1MRZA 4YGXB 5FP0A 2MR5A 2XMQA 5UKDA 4DIDA 4F6CA 2YV3A 4BRZA 1RACA 3B12A 3IAHA 4IOMA 5F51A 5EMMA 4ZCSA 3T5BA 3NIGB 4BTLA 2BV3A 4FMDB 4QLAA 4F6RB 1ZJ5A 3WSWA 4NAHA 5DNDA 3RIEA 3SYRA 4RMIA 1S89A 3K8OE 1TZKA 1SVKA 5GONA 3PTZA 1EVLA 4GOKA 2NAFA 3RV4A 2X0FA 3JR7A 4A2QA 2C77A 2JRCA 4DMHA 1Q3TA 4B4KA 1JQ3A 2PHZA 2WJZB 2BFNA 2J5XA 4QODA 5D6OA 1CCWA 2C3MA 4PSAA 3PCXA 3VA7A 1FDVA 1BDBA 3CRRA 4N7MA 5BOSB 5IZ4A 3B51X 4KE7A 5KDLA 1DV1A 2W4MA 2CD9A 5L3QA 2ZPUA 2DHDA 4WERA 3AINA 3KC2A 3O4VA 4JENA 3B1XA 4XVHA 4YJ2B 3TLCA 2VHVA 3CW8X 2VQFB 1S6YA 2FY8A 1XNGA 3OJFA 3CWCA 5E2IA 2JHFA 3Q5EA 4W1RA 5G4LA 3R9KA 1Y3FE 4Y1EA 1U98A 4E13A 1R12A 4X62B 3PFIA 1V7CA 1GFSA 3IURA 3TLGB 1FRNA 1N1GA 5FWDA 4DSOA 1X7WA 5GGXA 3KE9A 2XDWA 4WESB 5L40A 2XV1A 4NE7A 1LS1A 1GTJ1 1DIBA 3DLPX 1HL7A 3SHTA 3KQMA 2NACA 1RHUA 1YC5A 3QQPA 3TLJA 2E49A 1ETHA 2Q4DA 3IMCA 2COKA 4TV8A 5JQWA 1ZKDA 2NN3C 3SZUA 1SO8A 3FDZB 1K4YA 4TUYA 4ENSA 2ATEA 2JAXA 3BL6A 3RH0A 2X9QA 3BMNA 1E4VA 3M81A 4AUEA 4N5LA 1E3WB 2AC4A 4HUJA 3THXB 1XDBA 3QTBA 1WTAA 4IV8A 1V1RA 4WUTA 4B82A 1UKVY 4XPIA 4TVKA 1E0KA 2XQFA 2WF8A 1UAGA 3RS4A 5D00A 1H8HD 3CGWA 3WWDA 4CF5A 1XRMA 5DN6D 1T5OA 1Z2CA 2PNFA 2MSKA 2VPQA 3AESA 4LK2A 2O50A 2SICE 4X5OA 4CKXA 4MKXA 4Z2AA 3S2FA 3UAYA 3DAFA 4BQNA 3UFBA 3GRKA 2EYUA 3A31A 4O0MA 3LDHA 1YRHA 2IUEA 1EFKA 2A57A 2WA1A 2WHPA 3AMVA 5ITZA 4J1QA 4ZK2A 2GRJA 1QG6A 2X7JA 5K0TA 3EGOA 3VR1A 1DARA 1YS6A 2ECPA 5HFJA 1IM8A 4JC0A 4CLOA 2ZITA 1O6FA 3N1UA 2HIAA 3VHXA 2B2CA 2QTVA 1DTSA 2NNLD 4JKIA 4ER6A 1NW7A 4I8DA 2WTXA 3DNPA 1RLJA 1RBQA 4V38A 4DAEA 4LJSA 3UAZA 3LXMA 1M7GA 1BEEA 1IOVA 4BX9A 4CIYA 5MDHA 2HF2A 4L4SA 4L75A 1T8PA 1G59A 2AJDA 1VE9A 3BKXA 4GRDA 5MN5A 2J7PA 2YIVX 3DQQA 5JZOA 1CUHA 4H1VA 1A2OA 4JD5A 4RFVA 2GT1A 3EN0A 1K7EB 4C6TA 1S2IA 1U11A 1MX1A 4DLKA 5C4GB 2HMAA 2HOQA 3Q0EA 3QVWA 1KKUA 1U0OC 1ZUD1 5A2GA 4IJUA 1B0ZA 5JJIA 1WETA 2JHCA 2VBGA 2VSYA 2BMAA 2YJZA 3BH6A 3HV2A 4H7FA 3N0VA 4GF5A 3HTXA 1R0LA 1D1PA 3HLTA 4FBMA 1L4BA 4IXNA 3VH4A 1CFJA 5KTKA 2ZTVA 3CEAA 2ZAMA 3A1FA 3AJRA 2EERA 1NQAO 2O5VA 3OPVA 2WICA 3KQHA 2QUIA 3F2VA 4XGRA 2F1JA 3X1KA 1XMOB 1GKKA 4P5DA 5B3LA 4UNIA 4AQDA 2XMSA 1H6CA 1E1CB 2PX4A 4JC5A 4UNSA 3RYFB 4EI2A 3OE7D 3UH1A 4E4YA 3HZZA 2Z8YM 1P91A 3L0CA 2UUBB 4N76A 1JT2A 3DDCA 3L0IB 1SC6A 4ED9A 4XYBA 2R751 5EXDA 1X70A 3H05A 1C7EA 2OECA 3HK2A 4LWPA 4AX8A 4XRGA 1JE1A 3Q5DA 1TKCA 5JXIA 3UHFA 3ASVA 3FOZA 2GNOA 1HEIA 3E9DA 4ETWA 2SCUA 121PA 5CXSA 5IAEA 3OFSA 3T9FA 4BMNA 3IDQA 4NV1A 5HMLA 2ISQA 1WWKA 4GBGA 2V6FA 5B7PA 1ZWLA 2Q3MA 2WWXA 4WBSA 1I5OA 3I30X 1U02A 4REOA 1TAHA 5LWQA 1IK4A 1X94A 5FHQA 5AVQA 2YMQA 1DQNA 2G8NA 4KQ9A 3ZDAA 2ZRQA 2OAEA 5LOVF 1DQYA 1TMYA 2YJTD 3PX2A 4ZI5A 3EDRA 2VJPA 4B32A 2Z08A 2XQGA 2RCNA 3GU3A 1N2CE 3MTEA 5L3RA 3WLRA 1YE3A 1RHRA 1T36B 2XEXA 2IS4A 2OCDA 4EX6A 2IU4A 1N5JA 2YVAA 3OQNA 3GLKA 2NU9A 4RPJA 1LI7A 3GG2A 3GRYA 4O2BA 5CM2Z 4CPDA 4LNUB 1DBIA 4H7JA 2VT6A 4KIGA 5IKPA 1R50A 3EBLA 4JVLA 2O8EB 1H8EA 4NWIA 4N8DA 5J3JA 3NHFA 1R0BA 3V1UA 1J0EA 2NYAA 3FY4A 1EGQA 4FSDA 3H8VA 4WXHA 2ILVA 1V5FA 4MB0A 4KMSA 3LGSA 4DCTA 1L9XA 1Q19A 4L5IA 1SXJC 2DKFA 1U8TA 2OXIA 3VI3B 5IFKA 2H06A 2AWNA 3QMMA 1G2OA 3E4DA 4W5HA 1D8AA 4KJZA 5C4MA 1RPZA 4UCFA 2B98A 2H0AA 4BGIA 1I8TA 1ABFA 2PGXA 2FWMX 2GN6A 3KM0A 4YPOA 1K7FB 3K20A 4G4SP 4UHJA 5IMBA 1TVKB 3UUEA 2OC4A 1ESMA 2AUTA 1INLA 1NKSA 4LDJA 2GM5A 4OBBA 1Z5NA 1HOTA 3FFTA 3WIOA 4YYEA 1T9BA 1XAGA 1UXJA 3MHPA 3QXGA 1SD1A 4AROA 3A1CA 3K30A 2K87A 4RM3A 5I5EA 2ZYUX 4C89A 2H17A 1O4WA 2IYVA 3RUAA 1TVKA 4M1SA 3ZCVA 4M53A 4YQZA 2PGLA 1OIXA 4G25A 3Q4GA 4FXOA 1C1YA 2BELA 3FX2A 4ONEA 3T7DA 4OSOA 3CNEA 1TCUA 4G1FA 3GCDA 2H1RA 2I7CA 4FILA 5TQ0B 3VYWA 3WX0A 4CRWB 4BY9E 1P9WA 1PJ3A 2V1XA 5B58T 2I65A 4RTKA 1G6Q1 5CFZA 2HLHA 2EKDA 3HU5A 1AHIA 5E6SA 2J08A 4K9RA 3OF3A 4C5AA 4FB5A 4OEHA 4P4TA 5JZ9A 5DM2A 5P8WA 1CJCA 1TZ2A 4Q1DA 2J33A 3CISA 2DOKA 3QFHA 5FR2A 4GMGA 4AZ3A 4Y1GA 4B46A 4EMTA 1MEEA 1N1EA 3DE4X 1XHFA 2BGNA 3C2QA 4UD2A 5FOSA 3DULA 3W9SA 1SD5A 2IHVA 2EX1A 2F3PA 2KB0A 3SOZA 1GPKA 1Q7RA 2W98A 4U63A 4UVEA 3TXYA 4AYTA 1OI3A 4UM8B 4ZYXA 3ADDA 1Y3CE 4J1SA 2Y0EA 3DAOA 4MW2A 5LLDA 4ZV7A 4IHJA 3NAQA 4OQNA 3RVPA 1Z74A 3D54D 4K8RB 3W5IA 3STHA 2BFCB 3KXIA 1DOAA 5K3OA 4Q0MA 4MR7B 1KO5A 1LLDA 2Z9CA 1DLJA 2P2ZA 4TV8B 3RYCA 2LXNA 5FBVB 3BE8A 3HCFA 2R8OA 5LYJB 3P97A 3C0KA 5A5FA 4BNNA 1V2HE 3BD7A 3PYLA 2C2OA 4DRXA 1GT6A 5BV0A 2EWVA 3IERA 3FFXA 3TZCA 1PS9A 4ZXPA 1N9GA 3C7DB 2JS7A 4GQIA 2PTGA 3R7NA 1E3SA 5CAEA 2X8JA 4CLEA 3FIUA 4KC0A 4ZT4A 4XWKA 1M7HA 8GPBA 1KDOA 4ZHQB 4BQPA 1A1VA 2M6SA 2DPYA 2XRMA 2YHSA 1W44A 3F5SA 2GUWA 1GU0A 2ZJ3A 3D02A 4FNOA 3QXJA 2WG2A 5DULA 5I8PA 5JJLA 3QE4A 2FPPA 2Y71A 3PEUA 2OEPA 3CO0S 5M2QA 3IP1A 1AMUA 2ON6A 3GJ6A 2REOA 3I6QA 2RDMA 5BOSA 1TUBA 2D8MA 5K3FB 2OR3A 1KC1A 2ZUTA 4A8TA 1GQ2A 3HPRA 2D4AA 3G6KA 4BLPA 3L8CA 4R2WA 5DM70 1P7CA 1Q1NA 1GGMA 3TL3A 1SD2A 5FL7D 4BE7B 4GEKA 5AT1A 2MYTA 1XU4A 2VJCA 3GZTB 3E53A 4YX9A 1RRPA 4TKMA 4X3CA 4JEMA 4M21A 5TF0A 4EJ0A 5KX5B 4BECA 1G9XA 2PZ8A 3KQSA 3GGPA 3KPWA 4MVJG 4PSVA 3SJBA 2B6HA 4RVOA 5B6IA 3GAZA 4DEYA 1WS6A 2C54A 4QUBA 4IQFA 4ZYVA 2OUIA 3IHLA 1IBMB 3AM3A 3DEYX 3L49A 4RMGA 2DUJA 2CK3A 3BK2A 1LGYA 4G0MA 4BO7A 3QZUA 1Y6FA 1VGRA 1OVGA 2C7GA 1WSWA 3OVMA 5FTJA 1CUUA 1KKLA 3AYXB 3UIEA 3RB8A 1NW5A 3HLYA 3R5FA 5F76A 3S8MA 3H4TA 3ZV5A 3D5TA 3L0OA 4D8YA 3G8DA 4EPXA 5LYJF 3D9QX 1HQKA 4PGFA 1PNQA 2Z30A 1OBCA 2R6ZA 4R8MA 3RFVA 4BNFA 1JHPA 3DT6A 4WKGA 1E3TA 1UBLS 1VMAA 3HRIA 4PGAA 5EQJB 1JJAA 2Q5OA 4OYRA 3BQNB 4QGGA 1LFAA 5JDIC 2XA2A 4MUYA 4XW2A 3TDNA 1WF6A 3MJ4A 4O59O 3W8DA 1JKMA 2E2WA 1XMXA 4DPLA 2V7TA 5F7ZA 1CB7A 1G8SA 2WU8A 2YWDA 3A04A 3AESB 4PY2A 4DQKA 3G85A 4U6SA 1I7NA 3M4NA 1U1DA 3N8HA 3DG9A 1VI6A 1FPMA 1SC9A 3CH6A 1YA6A 2BHTA 3UHAA 3ESXA 1NONA 2H1WA 5FUWA 4BC1A 2PG3A 3R0IA 3ZE6A 1S3SA 2PTHA 4R6XA 3T9EA 2ZZKA 1HE1C 1CE8A 3BWXA 4G84A 2O2ZA 4G09A 1VE1A 5JD4A 3FWNA 2WSMA 1L8OA 1ZIOA 4BE4A 2D3WA 4C7JA 4F86A 2O2DA 3L4BC 3SC2A 1GA6A 3KNZA 1O6GA 2DPXA 3AEQA 4ZTUB 3SZRA 5FFFA 2CY0A 4GDMA 1C29B 2PU5A 4ITRC 4AP9A 4FFWA 5AVRA 3GDHA 2BH2A 2NADA 2QX7A 2W71A 1R8QA 3MS7A 3QLUC 4LRYA 4AURA 4AL4A 1SIOA 1QX3A 4JUIA 4HBGA 5IK2A 5B4UA 3TGPA 2WSBA 1P1RA 3K09C 2IPOA 2JBHA 1UKCA 2GA9A 2GSDA 1XDGA 5K0SA 3TLKA 1YB1A 2AYXA 4AF6A 1NVXQ 1BVHA 3HCDA 3V5NA 4LK3A 3NHRA 1KYZA 3NIDB 1DWQA 4ALIA 3AZOA 4TM7A 4WFKA 5HIIA 2YRXA 2EG9A 5T4HA 4M22A 2B94A 4CDRA 1X7HA 1OU0A 3EW9A 3I83A 3TLAA 2HNBA 4W5TA 5AM0A 2D5LA 2RHDA 2O20A 3HG7A 1A5BB 3M4XA 3KKZA 4WNAB 5DIFA 2ACVA 2QPLA 3SPXA 1AD2A 3H99A 3MMNA 2ZBEA 5K2MA 3AK4A 1CXZA 3K8QA 3LBFA 4EABA 4TT8A 3B9RA 2B9EA 1BQEA 2VDNB 4PG6A 4WNCA 4AMGA 2UDPA 2V8OA 3THRA 2YXDA 3BE4A 3IEMA 5JSZB 2QG4A 3BEOA 1VHQA 2VI5A 3O38A 3TSYA 3OIDA 3MUNA 1UQRA 4NLLA 4YLEA 4D3YA 4H31A 4YJHA 2ICAA 4KO1S 3STWA 2OCGA 1Y34E 4DKJA 3IQZA 1R9JA 2NUPA 2FUKA 2JLAA 3MA0A 4OP1A 4RQTA 2QQEA 3UV3A 4MWOA 4F3YA 5CFOA 1YULA 4E30A 1DEOA 4NOMA 4X71A 1L5ZA 3ZYCA 7GPBA 2KWIA 2CEKA 5AXAA 5KNDH 3P52A 4PPQA 4BJ6A 1PJ8A 2P30A 1KDTA 3UXHA 3GLFB 1G8FA 1PR5A 4GMKA 4TYQA 4AG5A 4EL0A 3ZVNA 1L5SA 2J3EA 5AXCA 1EEHA 2NO6A 3K2BA 2HU7A 3TEMA 4UTNA 5JSQA 1ZVMA 4W9NC 2GBLC 2Q2VA 5EC8A 4PLZA 3WL6A 4EHAA 4B4WA 2WZBA 2G67A 1VPLA 3FZNA 4F85A 2ET6A 1OXVA 2GMWA 2YMMA 3CCCA 3KHKA 5H68A 3WLLA 5JNWA 1BVYF 2F3RA 4AO8A 1SXGA 5U4XA 1W6UA 1K0FA 1SN7A 1QPGA 2HMTA 1CF4A 1T0UA 4JH0A 4FW9A 2I29A 2YNMC 1XDWA 2PGOA 3TZ6A 3X2EA 1Y1LA 1MO3A 3TFWA 2VPWA 2G0AA 1LI5A 4G0NA 4OB6A 3U3XA 1T1GA 1SVSA 3NTRA 5LBUA 2Z4RA 2ZBVA 1IY1A 1V45E 3ZCRA 2X5XA 3WBKA 4AYXA 1GU7A 1TYEB 2QV7A 3IEUA 4BLQA 4DNXA 1NE7A 5CXQA 1ZK3A 2VJNA 3HDYA 1JG6A 3TINA 3TJZA 1A77A 4QVIA 3NTLA 4HDOB 2ATXA 3TM4A 1A8IA 4KNYA 4ZOLA 1S2OA 4EB6B 3CUVA 3DVRX 1G8JA 1OZHA 1UFRA 1T9HA 1T8WA 4GE3A 5GY7A 4BX0A 1K8XB 5HOQA 4N3BA 1EU1A 2XEDA 3L93A 4EG5A 3O3CA 4KYIB 1YKSA 3HCBA 4JNKA 4P83A 2HBRA 1GCUA 4ZO8A 4GOND 2PT5A 1HUQA 3L7OA 1CD5A 4ITVA 1GA4A 2IF2A 1S96A 4J7AA 4OM8A 4Q7EA 3G0BA 5IKOA 2BGUA 1L7QA 2ASEA 3S28A 2WT4A 5KTRA 1DQZA 1N4DA 5D1HA 4AC9A 3MGBA 4FCCA 2B5OA 2D59A 1V43A 5FF9A 3WGHA 4ZDIA 1UPBA 2CNOA 1SXHA 2IPLA 1OD6A 3B85A 1DB3A 3N2GB 4DIEA 3A9WA 3DCYA 4E0BA 2C2BA 4TTSA 4KXUA 4QPCA 4RF5A 2O8CA 4HQ0A 5JWHA 4INZA 1EFVB 1YZ3A 1THMA 1OSNA 2FMKA 4NAUA 4RK6A 3T5GA 2PZMA 4Q4DA 3TBHA 2HEIA 4EB8A 2XXJA 3WAKA 2QW0X 2QSYA 2OFOA 2XBUA 5I4KA 4CIAA 8OHMA 3G2HA 3RYCB 3L7MA 4N5MA 4C05A 1A04A 1DNPA 4BMSA 1BKSB 4WK0B 1SB9A 4F9GA 2QTNA 3ONFA 1KGSA 3ZTWA 4MXDA 5HQ3B 5K0FA 1CVIA 2JEOA 4P4UA 3VYUB 2A9QA 2ZWPA 1CIJA 2O3RA 3WLAA 3ZBQA 3OC6A 1ZIDA 2O14A 2G9QA 3AQ4A 5JPCA 3KEMA 2BI8A 4HZGA 1O7JA 2BGRA 1D2CA 1V8OA 4AZSA 4B48A 3R8FA 2D6FA 4LC1A 4M36A 1P4JA 1M1NB 2P6NA 3H1GA 4ZDWA 4NCIA 1PR9A 2ZRBA 4O4HB 4OF4A 4L4XA 4B5LA 4IEIA 5BNWA 1GTSA 3QTTA 3S7TA 2I80A 3TAUA 3OCWA 1IEXA 4DNPA 1QIEA 1RBZA 1LBQA 1T1RA 4K9SA 2EKZA 1ISRA 1PG0A 1P29A 2BMEA 3CLSD 3IHKA 2HCTA 7ADHA 2CN1A 1RIIA 3U3JA 4U9HS 3PRYA 4KWCA 4IRXA 4JEUA 4LC9A 4CCSA 3CR8A 1CB0A 3NIBA 3K96A 2NZJA 1U0BB 1L8AA 1Y98A 3OSZA 2G1KA 3FPSA 3KPUA 1CETA 3C1AA 1G21E 3RJ5A 4DE5A 5F73A 4I1VA 1EHYA 3DM9B 1NBMD 4N39A 3OUZA 4K2AA 3OKFA 2VRCA 2I4MA 2AFIB 4Q12A 5I7VA 3OP4A 2QLTA 2H2AA 4N54A 5A6SB 4BMCA 2QZPA 2Y1CA 1WABA 1KFJB 1Y1SA 4PLYA 4C4AA 4PYLA 2JIOA 1HTBA 2R96A 3CVWA 5TX7A 3DL0A 3U16A 3S4YA 1GADO 3L41A 4XSHA 4LEIA 3QPBA 5EJAA 1T9CA 4YP7A 3DXFA 2C82A 1JLLA 2EQBA 1J7JA 1PS8A 2J67A 3IUMA 4RS3A 5KVVA 2QOEA 3V4LA 2C0CA 1CVRA 3G49A 3HSKA 3QXSA 5KTTA 1EG7A 3RIYA 2UV8A 5A0FA 5IJZA 2FPIB 2ZI3A 4DA8A 2FWRA 3E7DA 1L5RA 5BMVB 1OX4B 1PZFA 1S3FA 2ZYAA 2J5QA 4YP0A 3ZU4A 3LT5A 2H85A 2IIVA 3ZHVA 4QNMA 2ZCUA 2XVXA 4ZICA 3TBFA 1TVMA 2CFSA 3Q7RA 1BXRA 5AP9A 3NTOA 5DT2A 3ITKA 2JFPA 1UBRS 1WZCA 1QGUA 2WYHA 4U4AA 4DF3A 5EP4A 4YRFA 5C80A 3BXHA 5LYYA 2FSVC 1TEXA 2RFLA 1BNCA 2WKRA 1PKEA 2D1QA 3BM5A 2P5YA 2J0SA 4NCBA 1QZZA 5DU2A 2IFTA 3BFKA 4G4IA 4BP8A 4GICA 5A5EA 2FOLA 2QG6A 3PWSA 4BE9A 1XZGA 2I1QA 3A6FA 4EENA 4MVJA 5ILGA 2JLQA 1GTMA 1KZ4A 5AXDA 2PUEA 2B4RO 3W90A 1IUOA 4CF6A 1JEEA 1N75A 2ZK7A 4P3YA 1PEDA 4WX2B 3ACCA 3QFSA 1EDEA 3VJKA 3PXGA 3NU1A 1SXJA 4MKHA 4OMUA 1E5LA 3AP2A 4PPGA 3VPDA 3QKTA 5HRAA 4INJA 5DJ5A 1SOWA 4ALNA 1CUXA 1P4AA 3AEQB 4UBOA 4ZOEA 5L3QB 2WOOA 4EY6A 4DADA 2Q2WA 1OTHA 3G17A 2DUUA 4A6PA 5ARDA 1Q91A 2WMDA 4C08A 1MOQA 4N7RA 3RT1A 3IJ5A 1BVUA 3BL8A 4QWMA 4XARA 1PJAA 3R3VA 3TW8A 1HYQA 2C58A 4O5AA 4KSCA 3C3DA 3TR0A 4A0RA 2QW8A 1KIFA 4RVCA 9LDTA 4QYTA 4O4LF 4ZQFA 3DEIA 2D2VA 4R1SA 1WZ2A 1HXHA 5LZ5A 4HS4A 5L6MB 3HJTA 3RG8A 4DV1B 4LF8B 3R0QA 1O87A 2D5IA 1P2SA 3DAYA 3LVBA 4CR6A 2ZS8A 5BV8A 3S7ZA 4ETNA 4RXUA 1PNRA 4J0KA 4RA6B 2B8JA 4AICA 2H1IA 3DWIA 4J1TA 2UUPA 1SH7A 4QDXA 4XUGB 3GW8A 1UWCA 2IQIA 2ZXFA 3PX3A 4FMDF 1GVHA 1F8UA 4PN7A 3ZHBA 3AEXA 5LWHA 1RKUA 4P86A 5JAPA 2JGLA 2ZPAA 2ABWA 1L7XA 4JI6B 2DH5A 2YFHA 3IOBA 3WRXC 1EA5A 2D8AA 2WYWA 3LA8A 4WXYB 2HMUA 3DDNA 4HNQA 3UMFA 3VU1A 1V4NA 4ALLA 4QGSA 5KSOA 4Q1EA 5EHGA 1K92A 3D8HA 1XRQA 2YY5A 1G5QA 4JC4A 1BWPA 5FFNA 3MPOA 3CEHA 5FR1A 3SIWA 4XR9A 1F8XA 3AVOA 4TV9F 1LB1B 3AY6A 5GJWC 2EZ4A 3WJ1A 4EGJA 2K4MA 5J2UF 5HZKA 5AHXA 5D3MA 2Q9BA 5ECYA 3GJ7A 1ONOA 5H3HA 1ZUHA 3F9RA 1H6DA 4DPKA 4E5PA 4WXRA 2DHEA 3T7JA 2ZB8A 1Z2NX 1RI3A 5ITZB 1ISSA 1RM5A 2RH8A 4IY1A 3DMFA 4B43A 4PYNA 1EGVB 1B43A 4ZYLA 5AH0A 4DV3B 5AI0A 1XZNA 4GP6A 3UB4A 1I2DA 1E69A 3KKKA 3LIIA 1KK0A 2RK4A 1KI3A 2J0VA 2Q3EA 3BX1A 4LNHA 3GLGA 4TKZA 3FN4A 2XB2A 3QU4A 1M1YE 2ECKA 4EVQA 2OXFA 1UFKA 4OHRA 2FUNB 3ROTA 2AQ8A 5CNKA 1V6CA 5A9SA 4IJVA 2NO9A 1B1CA 2O23A 1XA3A 5DHFA 3NV9A 4NICA 4IF4A 1KP3A 2WHRA 3OZVA 3ZQUA 4D99A 1BRTA 2ZGVA 3BMNB 3PYMA 4K7JA 3STUA 4ND6A 1XO1A 1BEUB 1N92A 4D96A 3DBLA 5KQRA 1J5PA 4YRRA 2YXEA 2EGGA 4NARA 3AXSA 3OX3A 4CM4A 4TQUS 4DG5A 1CIVA 3B5JA 1IPEA 1TJ3A 2Z95A 4NULA 1L5LA 2IYQA 4IIFA 4BFUA 5BWMA 1AHPA 1OHHA 5CJJA 2HCRA 4ND7A 4BJ3A 4YAIA 5DMXA 3W04A 2LPMA 2ZU6A 2HX1A 3CLTD 5HIJA 5LP6B 4NNOA 2DFPA 5B2FA 5LDHA 4PNZA 3DR5A 2GPBA 3LVRE 3F8SA 1I0LA 3QVOA 1YR2A 1T6YA 1G5IA 2NM0A 2ZRCA 4WZBB 5F2EA 4D1YA 3I5XA 5IASA 1E3LA 4ML3A 1XWWA 2N47A 3M49A 1NC1A 1RC8A 1IIBA 1RDFA 2VDQB 3VJMA 3EEOA 4YRMA 3TEJA 1PZGA 1S9DA 2NVUA 4BFTA 4X94A 2BONA 5DISB 1JLMA 4F56A 3ZXIA 3SWWA 5CBKA 1MC4A 5CLJA 4YP5A 3TPCA 2IYZA 5TT1A 2YIMA 4RY9A 5JOQA 1OWOA 1Z6PA 4XSGA 1N2HA 3KSRA 4JEIA 4WKBA 3ZD9A 4I1PA 4AKTA 5BQXA 4UFOA 4PX5A 1L7AA 2Q0HA 5EIOA 2IELA 2WLSA 4PPYA 4O4HF 4EO9A 1HETA 4U3JA 5IUNC 4ISCA 4EUHA 5I51A 1K9SA 4I4IA 4MS4B 2W2LD 1ZY2A 3CZ5A 3EZ2A 1RCTE 2EAUA 3ABZA 1GRQA 2HJRA 2JLSA 3N6VA 3ZDDA 3MUFA 2MSWA 2FFQA 3FYUC 3J81k 2GDJA 2J46A 4N01A 2CJWA 1U8AA 2ZYRA 2PKQP 3QVTA 2EEPA 2B25A 3NAMA 3KKOA 3KQWA 3OEHD 4ZAXA 4KQIA 4AJPA 1DXHA 3OHSX 4OUDB 4JP3A 4LYJA 4UU7A 1SCUA 3ZJYA 4KAJA 2QN9A 3UJCA 3GJ0A 3R7LA 1FDTA 1E9BA 4HAYA 1CUDA 2CLLB 4NBVA 4WASA 1N2BA 4PNPA 5E4TA 1QE5A 1Y3HA 2F00A 3KUKA 4JX8A 4RCZA 4G85A 3IBGA 4R1MA 2V7UA 1ZI6A 3JTMA 1UT8A 1EZ1A 2XD4A 2GZ1A 3LX4A 1FFSA 2OILA 2VHEA 4XFDA 4B3GA 4A27A 1RAEA 1SVIA 5DE3A 3H5LA 1GGVA 2SECE 4F2GA 2AC2A 4INPA 1Y1RA 4F3CA 3EISA 1JDZA 2ZKIA 3DAHA 4RL4A 4XWGA 1X74A 1S2LA 2DLDA 3S55A 4BNDA 3MVEA 4GX0A 3I6BA 5FLXA 1MC1A 5EPEA 1NQOA 1DS6A 4A5OA 4B9AA 1K5DA 3GFQA 2ZEJA 2R7KA 3NM5A 3FLAA 1R6TA 4M98A 5ALWA 2DULA 4A3SA 3GYBA 1T2DA 5JS1A 2QI9F 1J2YA 3OTWA 3JQAA 5EXSA 3RLIA 2TMYA 2CV0A 2G36A 2P0EA 4C2TA 2X1VA 1QX4A 3QFFA 1RBYA 4QXRA 2RGAA 5TMDA 3TSCA 1S1MA 3B1KA 3QLVA 3WLNA 2NU7B 1KERA 4MR8A 4X61A 4ZAYA 5KOJB 3II6X 1Z2DA 1CR4A 4I08A 1T36A 2A9JA 3U4CA 4YCLA 3THWB 5LUAA 2A92A 2ZIGA 3X43A 2C97A 4E2FA 1A88A 3D1LA 3CX6A 1N2JA 2FFJA 2EEZA 4CIVA 3FPAA 3WKAA 3X1XA 1DHRA 4CTOA 4RHFA 4QYWA 2P9HA 1GZ3A 4GYYA 1NYLA 4GC9A 3EY9A 4QPDA 4ZRNA 2BEKA 3ILYA 2C4WA 1SQGA 2I6QA 1IK6A 1XTKA 4AAYA 2IOFK 2RGNC 1PD0A 1YVDA 2PEZA 3C8UA 2HQRA 3FFWA 3HFJA 4HGOA 4PG5A 4ZO6A 5EWMB 4EKGA 4ZIRB 5GIOE 1RR6A 3EHDA 3EA5A 3GEIA 1WXIA 4XRRA 2DBZA 1AA9A 4MLPA 5P21A 3GA7A 3JY6A 2ZULA 1E7QA 3IVXA 4F2WA 3E7XA 5AVZA 2PT6A 1PGNA 1TQHA 1QV6A 1TI7A 1VL6A 2HREA 2B99A 3DQPA 2ANBA 1QQ7A 3D2BA 4URWR 4WXEA 3SR4A 2O3SA 4FWIB 3HUEA 2FUG6 3I04M 4YBZA 3RTAA 4YI3A 1GCGA 1RRFA 5EKTA 5L8VA 3S8YA 1RP7A 2AC7A 3H42B 1JSXA 2IA5A 4KFUA 2G5CA 5LMNB 1D07A 1PYGA 1VSUA 1OBOA 1Y6ZA 3IAUA 1C4OA 4K03A 4W4TA 4BJ5A 1IEQA 3LXXA 2Q8NA 1XRRA 4EQZA 1E32A 4F2PA 1RABA 2JJYA 4NU8X 4LYFA 1DFIA 4KX5A 5KC9A 3PUVA 4FK8A 4PX2A 2BR5A 4OX9B 1IY0A 1O6BA 3SQNA 4HN4B 4ZEVA 4QXPA 1UQTA 2NU6B 1PSWA 2XGSA 2ZI5A 2XR1A 2H3EA 1QH1B 2Q5CA 2OK7A 3EH1A 4IAOA 3HYCA 1FTWA 3QXXA 3GA0A 4FYVA 4TUYF 3KLMX 1QK5A 3B1WA 4CMCA 1XK6A 1CQPA 3CF2A 1NPDA 2EFYA 4YAEA 3T7TA 1OGYA 4GE0A 3VPCA 3NBZC 2AMVA 3WK9A 1BX0A 1YBVA 3E23A 2UYGA 3CNNA 2BSXA 3GCXA 4KAAA 2I76A 2IW3A 1V16B 1Q5PA 3RU7A 2BFAA 2ZE5A 3ZIAA 5J2UB 2JFGA 5IZCC 4S2EA 4FGWA 1LCIA 2H51A 2QUJA 3L9XA 4C7KA 3LNCA 1L7MA 3LT4A 2C94A 3Q87B 5K45A 1M34A 2ALJA 3LL4A 2BPOA 4Z0HO 1SULA 1MFPA 2X8BA 1KNQA 3CR3C 3H3XA 5DO9A 4WLVA 1B3BA 4WOBA 4J90A 3A0UA 5DTIA 3SX4A 4IDNA 3IQGX 4Z4QA 4BFSA 2OT3B 4GKAA 4LCBA 3SEFA 2DCUA 4J3FA 1IBCA 2G71A 4BKQA 4CM9D 4IXDA 3ZK8A 4YP9A 1MDFA 1YD7A 1IY2A 3RJ9A 2QBYA 2KHZA 2QL9A 4CLXA 1ZP6A 5ICFA 1YTUA 1PV2A 2RSLA 1Q1QA 1C3OA 3AERB 4HSEA 2PS0A 5F1PA 3UAVA 5LD2C 3VO9A 3R0XA 4RTRA 4MW4A 1H9CA 3PC6A 5KWVA 1XD2A 2P0AA 2Z2ZA 1OIWA 4KIFA 4NIMA 4KRGA 1R4NB 3KE8A 3PJGA 1S3GA 4L3VA 1MA0A 5DN6A 5IULC 1ANKA 9LDBA 2C96A 3U4IA 3PUXA 1KOFA 1DIRA 1JS1X 1SHTX 2FPOA 2SNIE 4I3FA 1H8ED 3D8TA 3AKYA 4OJNA 1YVUA 4X1KA 4XQGA 1A8QA 5BN4B 3W9UA 3SM3A 3OHMA 3NASA 5CNMA 2VTBB 1FFDA 4XD7D 1LRLA 3WL7A 1TW3A 4RYDA 2BGKA 3HJCA 5ALKA 3TLGA 1ZNXA 2JPDA 5DTQA 5GZ1A 1RBMA 2I2XB 3ZV7A 3WADA 3L7BA 3E3LA 3LX8A 4NENA 5T3YA 3U80A 5LNK1 2A5DA 2B9VA 1TF2A 4I2VA 4EJFA 3EZNA 2HFJA 4N65A 4M46A 4NMXB 2VZ8A 2QYHA 3I42A 1Z4NA 1PSDA 1O2DA 1RWBA 2LE0A 3N8KA 3P5SA 4LZLA 5C5CA 2FEKA 2HYIC 2KPOA 2WNHA 2FSGA 1R1DA 1KBOA 4PS1A 4FLEA 3U48A 1BXRB 1J2JA 4HN9A 3DZFA 4IJQA 2CLSA 4C3ZA 2WWFA 1AT1A 2ZRGA 2C61A 2EF0A 2UYOA 3AU9A 3MUEA 3IV9A 1YE5A 3NW9A 3VR6A 4HB2A 3VDQA 5LOVB 3WBFA 3I04A 3MJRA 3X1YA 3E7WA 1WLYA 4D3DA 3ZNOA 1KYQA 1Q77A 4Q7KA 5ABPA 5LQUA 2C2WA 2JFXA 4J4BA 2WT9A 3PFNA 5HSGA 2AFRA 3S6JA 5J23A 1QS0B 2D1TA 2C98A 1E2JA 4NI5A 2GUGA 1M2JA 4K28A 5TQ2A 3AR7A 2FE4A 3SC3A 1H3NA 3H4MA 3PDCA 3W3AD 2A0YA 5L53A 3RUEA 4R7TA 1C80A 1L0BA 3CNBA 4HUQB 5K51A 1L5KA 1P74A 3WMEA 4IS3A 4Z86A 4X6LA 4I0WB 2JASA 1I3KA 2XIQA 1WXFA 3LBHA 4JVOA 5DM4A 4G1VA 2A8YA 3RSQA 3TSOA 4B3FX 4FP9A 3EQ6A 4QQKA 3I73A 2O0LA 3TYXA 2H16A 5B4VA 1QDLB 1FLDA 3ZD8A 4LFAB 1JEQA 3UJ8A 1Z8FA 3PDUA 4FDAA 4WY5A 1KSFX 5ELLA 2IYLD 1JVSA 3EASA 4M89A 3WGVA 4E1VA 2QZ4A 4I55F 2P2NA 3CGGA 4ARIA 1QTIA 4MPRA 4MJXA 2CVHA 1QAOA 2YDXA 2E9SA 2HY7A 3Q12A 3ZOKA 4CV2A 4DN6A 7REQA 4MQ6A 2PD6A 3E0XA 4FJ0A 1P60A 3EEFA 1WY7A 3CMCO 5LA6F 3BE6A 2HDOA 3LKDA 3A4IA 4PZPA 4FQ8A 2B37A 1N6RA 1OXBB 1QO9A 4HDKB 4YMUA 3DMYA 4FLFA 2Q2QA 1HZZC 1XRSB 2QN8A 1QU2A 4WN9B 2ZWAA 1E7RA 1PL6A 2WW8A 3P4XA 3CVYA 1KMIY 4U7DA 2OHVA 5E1MA 1HDYA 1HM5A 2Y4NA 1JG1A 5CH5A 4E5KA 1Q22A 2ODTX 2QD4A 2WHXA 1NJGA 2AHOA 4Q9HA 1XLWA 1A1SA 1OT3A 3C5WP 4RZUA 2R4TA 2J3QA 3H65A 3EPHA 1H4VB 1UK9A 2FJUA 2A0XA 2K7ZA 2O07A 1QO0D 1GN9A 2L82A 2PPLA 3ENNA 2YWJA 2NO0A 4EPVA 1G291 4KNVA 3ZY5A 4CV3A 2Z2IA 3EXHB 3KQPA 3TD9A 3M6IA 3SS7X 1NJ5A 4JU8A 3SDBA 3U7EB 1VPWA 3UGTA 1PNVA 4C4SA 5JAIA 2IT1A 2QJFA 4R2JA 2X7XA 2JJMA 4U0KA 4DLLA 1UOQA 3OTGA 4TS4A 2A0KA 1JMYA 2WD9A 4DTIA 2XTAA 1TOAA 5BY2A 2WQ6A 1PIWA 1PUJA 1QCCA 2FGKA 4W82A 3ZKAA 3ZHTA 5KSYA 4B2IA 3SHFA 3TKAA 4ZHQA 1XLTA 1YQ9A 4QUDA 4HRVA 3P7MA 1LRKA 3DQZA 1O94A 5TJHA 1CS0A 4RD4A 3EIUA 3EXEA 1T10A 4OHBA 2HHHB 1WAMA 4INAA 3P27A 4WGGA 1A2KC 1UT5A 1TC1A 3IEXA 3MXTA 3PI7A 3ZDQA 2O59A 2DR2A 3R5HA 1SUIA 1TXGA 5E4FA 3ZHUA 1XPJA 2DC1A 3DWEX 4YV7A 4K05A 1N0HA 1WMAA 1SXJD 2QL7A 2KYRA 3D6TB 3FYDA 4PFKA 3VR3D 2HA4A 2C7RA 3M8KA 1GV0A 2VHCA 3UMMA 4X6UA 2CVQA 3FLBA 2JVKA 3JQ8A 5EXPA 1NXXA 2H4JA 1UDCA 3EB9A 3D0OA 4TL9A 2Z2XA 1RM0A 2MR6A 3E84A 1LJUA 1ULAA 2X0JA 4H17A 3TW6A 4H59A 1CF9A 1E6WA 4TLMB 4CLRB 3MOIA 1C0LA 4BTEA 3PHBE 4OYLA 4BX3A 4M9XA 4W7SA 2BHNA 3PBKA 4WI1A 1AZSC 5H70A 3DKPA 1AV7A 4Q3AA 2CCJA 3FYHA 1NZFA 3KEOA 3DV2A 5SY6A 4YJDA 2P6OA 3BGOS 4K87A 3GN1A 3FMGA 3GJ8A 3AL2A 1S5PA 1X0VA 1N6OA 2VKQA 1CUJA 3I8SA 4WDQA 3M1AA 3GFGA 2ZBGA 4FJ2A 1C4XA 3E22A 1CY1A 4AG6A 2FG6C 1UWLA 1OIVA 4NK4A 1D0IA 3B3FA 4RLHA 4UUBA 3COPA 4Q7JB 1A2QA 1XMQB 1JWBB 3SGLA 4DYHA 1G0NA 1E2HA 3FFAA 2VP6A 1F4VA 4JB0A 4A8JA 1EESA 2YWGA 4QYMA 4JP2A 4ZKEA 2ZTUA 5THXA 5CYGA 1VB3A 3MTJA 3ER8A 5CA1A 3V4ZA 3W7BA 2GAFA 3GMTA 3R6TA 3RF7A 1IUPA 1DEAA 2O8VA 3U4HA 1YZNA 4CQJA 4DWVA 1W1UA 1P6UA 3QJYA 4UZSA 5AJZA 2IHNA 3OCZA 4QOHA 4ZCIA 5JAMA 5KCMA 2O3JA 1Q0QA 2VLBA 3IAM6 4RYLA 2JANA 2XLBA 3KUUA 4BV2A 4EZEA 1XZQA 5JSZA 4A2CA 4D4HA 4QFCA 1RI1A 2H1LA 4D8UA 4MV3A 1HE2A 2ZIUB 5LMUB 3ISTA 3ORSA 1WPGA 2CNBA 2W2MA 3PGKA 1V2GA 2V4MA 4I9UA 4XB1A 1Z5WA 4RHCA 2JLBA 2G04A 2ZJ2A 3P9YA 4O2BB 5CH8A 5DX1A 5CDYA 3D0RA 1I1NA 4FC6A 4EGQA 2G9VA 4Q00A 1GTG1 2QPAA 1VL2A 3TQQA 1REQB 1KH1A 4O02B 3RVSA 3VZPA 2IYUA 5A0VA 3DTNA 5FPKA 4BNTA 1BROA 4XH9B 5ILOA 1C30B 1V47A 3D43A 3RK4A 1XWIA 2ODEA 5HUJA 1JIJA 1PYOA 3K1ZA 5EYPA 2J4CA 4YT4A 1AH2A 3DXYA 3L4EA 4R5MA 5G3ZA 3DFKA 3GDOA 4IQGA 3RIXA 3KSAC 3FCCA 1U2RA 4DZZA 1N6HA 4HADA 1YRYE 5CFMA 3FNEA 3QK7A 4DR6B 1SOUA 4IDCA 4O4LA 4J29A 4P6VF 1R9GA 1XMIA 1T2EA 4M88A 4O8ZA 2JLWA 1CY2A 3UICA 4Y2UA 4AY3A 2O2EA 4URXR 1Y6QA 1GEEA 3DTVD 3RVNA 5J4KA 3CUEF 1KY3A 3UY4A 4FM9A 1KMNA 3NUZA 1E6UA 4YROA 5AIBA 4LV8B 4XWYA 4IGIA 4JIGA 2W2VA 4N40A 2YJNA 3O4JA 5LSAA 3JSAA 2H59A 4S0XA 4BBZA 5I4CA 4OQPA 3SYKA 3RHTA 1UPFA 4A5SA 3LHKA 3A6PC 1P33A 1QLWA 1XQ1A 3ZWKA 1ZVJA 1V0JA 2Q1UA 5JYCA 4R69A 3HB9A 2WNIA 1UAYA 3JQDA 5LLTA 5J59A 4HNUA 3GQBA 3QX7A 2ORWA 1Q15A 5K8CA 3OT1B 2PKQO 1QLJA 2VAMA 4LMAA 1P62B 1VOTA 5EKSA 1PJ2A 3T7KA 1AGXA 4L22A 2P8JA 3KWJA 2WM2A 3QU2A 4WKPA 4R0MA 4MP8A 3JAKB 4MDYA 4MVJP 3T5DA 2DT8A 1E64A 1ULTA 3K6KA 4GT1A 3C1TA 2DPLA 2PUBA 2CWWA 2Q8PA 2AVDA 4XFKA 1RXWA 1R5NA 1RFLA 3H9GA 3Q9SA 4HC4A 4QPJC 5BW6B 3KZXA 4H7PA 5AVXA 2WIAA 2Q46A 1KRHA 3AI7A 3KYDA 4KKXB 5CB4F 3WYBA 3OFND 1N34B 3PR3A 1ECBA 3GRZA 3KTDA 2ACKA 1FTNA 4KGZA 1K8RA 4HNAA 3ZZMA 5AVSA 2LGJA 3K1JA 1QH8B 3ZR4B 1QRSA 4CQLA 2W00A 3D3KA 4OHYA 1P18A 2OGSA 1K4MA 3WWCA 3K6RA 3QLEA 4CEJB 1GG8A 2FRVA 1U8XX 3FYUB 4QO8A 3V1TC 4GKJB 3ONVA 3VYSB 4FE3A 5CW1A 2VK1A 2YZGA 2BI4A 4AS2A 5ICSA 1G6KA 1Q84A 2HHAA 4R98A 2EFHB 2Z04A 1Z3IX 3H11B 3MRSA 4U8GA 1WZUA 2CMKA 3KJEA 4IIYA 4HS9A 5CDFA 5ALHA 1VCNA 2JDID 3CIOA 4KDFA 1KWKA 2XT0A 2FG5A 4MDEA 1RMQA 5LP1A 1X1AA 4JI8B 1NM5A 2RGWA 2VT3A 1IPHA 2WT8A 3VPGA 2P8SA 5C1BA 4ZA2A 4EHBA 2RMKA 2WJWA 5LIPA 5MFZA 1IHDA 2FN4A 1FXWA 2J48A 1I4DD 2FN8A 1V6AA 1R0XA 4WJKB 3SJCA 1G2PA 1U8ZA 1LQ2A 2JGNA 3RSCA 2QDKA 4GOMD 1IOZA 4KEAA 3L0PA 4GZMA 1TIKA 2GARA 3HY6A 3QRWA 4CM8A 2A9OA 1N6IA 4XYGA 4UAUA 3BAFA 1R7RA 1W87A 5TRTA 1XCOA 3GFVA 3BB4A 3KIPA 5AW2A 5L45A 2LWIA 2O6LA 3GUYA 4PEVA 2ZIAA 2FN9A 4DAOA 1KQFA 4RMHA 4PXAA 4XZ3A 4K26A 3I5MA 3JYLA 1VQ1A 1TUBB 3PUZA 1SKAA 3OM0A 3FNRA 4I4CA 4MA0A 4V1CB 1ZUIA 2ATIA 1XZCA 4B40A 1MP0A 3HN6A 3UUWA 3JQPA 3LZCA 3DEHA 3GCWA 3GQBB 4AN0A 4MYRA 2UYYA 4RY2A 4BEBA 5JANA 1JR4A 5IJ9A 1JAIA 4OAQA 5KX5F 1X87A 2KBEA 4BZXA 3EPLA 2G0TA 1QHYA 3FLEA 2DR0A 3DC7A 3LLSA 1RLUA 4LY3A 3KR2A 3K72B 4RK4A 1RRVA 5SZJA 3TRJA 4QUKA 4EUSA 4B44A 3ND9A 3EDQA 1P5FA 1ZCJA 2BWJA 4JJ8A 4QOJA 5DWDA 2OSVA 2YIDA 3H84A 5ETJA 2CE7A 2JGDA 5AHOA 1E8MA 5CG1A 3KB8A 1I7LA 1R6AA 4X92A 4WESA 3AL0C 1WPQA 2RI6A 1VMKA 1IN4A 2TMGA 4JP8A 4X44A 1PFKA 1SUBA 3QV1A 4DLRA 1EFPA 3B3AA 3GOHA 1CR2A 4Q02A 3H9BA 1HPLA 3L6BA 1V39A 4C30A 3PCTA 1OH7A 2GR9A 3OAAA 1CJSA 1XQWA 5B1EA 5FADA 3NYWA 2HADA 4IIJA 3O84A 5BUSA 2QY6A 2C9YA 1XD2B 2PRIA 5A3JA 2Y66A 3P26A 3DE5X 4NABA 5ICMA 3U19A 2BM8A 3H16A 2QRGA 5ALNA 2VP5A 4V0ME 3BS4A 2NO7A 5JSKA 1NXPA 3QNMA 2H2WA 3H1TA 5EMHA 3JALB 1HLPA 4GAEA 2QP3A 2R1UA 4B6GA 1DMRA 1E9RA 3VPAA 5JXGA 5D5HA 1TNDA 3K0FA 1U3FA 4GMXA 4Z3DA 3RNLA 5M5BA 3GFBA 5F9FA 4LJRA 4BWGA 1DXYA 1SVMA 2OHHA 3A58B 5J5VA 1C0PA 2ZJ1A 3A2LA 4PZUA 4RDXA 5GJBA 4JR1A 3NUGA 3LJKA 5GOZA 1H66A 1WHTB 3F6RA 1GEGA 4P31A 4R8LA 3GLHE 1Y0BA 5JSYA 1XA0A 2VN8A 2POQX 2VO1A 3MWFA 4YREA 2HWWA 2IKQA 2P5UA 4G2NA 4LZNA 4EHIA 3O92A 4FOLA 3T4XA 2Q8QA 4RTLA 2PRZA 4MDHA 2VPZA 1PJZA 2BE9A 2J0QA 3QPVA 2P2YA 2GEFA 4U2EA 5DBOA 2TMKA 2R7AA 1JB9A 3P2YA 3LS2A 4IJKA 1MQ8B 1ZN2A 5FNVB 3TPZA 3EGVA 4IMJB 4JZYA 3QEMB 5KB3A 3HJFA 1XVVA 1MJNA 2PWBA 2Y1XA 4C7BA 1W36C 1F2UA 2DB3A 2NO1A 2PMBA 8AT1A 2D74A 2BKAA 4RDHA 4PZ0A 4RY0A 4JLOA 1W85B 2DUMA 3W79A 3IC5A 3F71A 3RRFA 3NFRA 2NZUG 1UDXA 2V7PA 4I5GA 2FPRA 5C0OE 5BW5A 5CB0A 5E4JA 5A3RA 2E4WA 2JLYA 1TA9A 5J5CA 4DR5B 2NAPA 3QA9A 5JNTA 2ZKLA 5IG2A 2HT6A 2OCAA 4UARA 3SEAA 2CZGA 4NBWA 1O95D 2QWXA 4LHXA 5TY0A 3JYOA 3KQLA 1DI0A 5KU7A 1TM5E 5LUBA 4LSWA 5YASA 1PR2A 2QLBA 2JK0A 3JV7A 4X64B 1RTTA 4KVGA 5AK6A 3LRTA 5T4EA 2TECE 3NHYA 3OF5A 4D46A 2XCTB 1ESDA 1ECLA 1R3UA 3L1VA 1SZPA 4NYJR 1ZOPA 2EX4A 3BMCB 4WZBA 2EZ9A 4V2UA 1MB3A 3PUIA 2Q6VA 1L3BA 2ZSHA 4C7XA 1CRLA 1RHJA 2ZUDA 5I9TA 3CLRC 1DRUA 1EFTA 3NDJA 4P7KA 4Y2XA 1T6NA 3M3DA 3B1YA 1Q7GA 4FFBA 2WJPA 1C14A 2PEYA 1K6JA 2V96A 3EMKA 3EXEB 3MLBA 1IAVA 3DKRA 1OXUA 2XUJA 4FQ5A 4FYKA 1CDEA 4QUJA 4RGVA 5GV8A 5J2TF 5JNVA 1LZLA 2E21A 4L8LA 1QZ3A 2VRBA 4OQYA 3O4GA 3ROEA 2EFEB 3C3PA 1JEAA 4I99A 4L3OA 1SBIA 4HH3C 4EECA 3DFFA 4PGGA 1D6JA 2EHDA 3EOBI 4HFNA 3IP5A 3I0MA 1BHSA 2Q50A 3PWKA 4AO6A 3EZGA 4A82A 2DGDA 3A4MA 1WIWA 3KO8A 5CUQA 5DYNA 4G8DA 5C3UA 5KYYA 4EPYA 7MHTA 2CBGA 4FHEA 2Q2OA 2H4ZA 1RPTA 3TZQA 5G02A 5J47A 2FUG1 2Z3WA 2FQWA 3WSTA 5IK2D 2FV8A 2IXGA 3G2MA 3Q6NA 4IGFA 4RGBA 1YNOA 3OOWA 3KZVA 4AJ4A 3AFOA 2ZRHA 3K9BA 5EYPB 2YFQA 1QONA 3GVXA 3UJBA 1MT0A 3O3OB 4PR3A 3G79A 4YB8A 1KHTA 2IUUA 4A6EA 4BWYA 2XMPA 4R84A 3DLHA 3D2CA 4ZREA 4PLFA 3FH0A 2WFAA 1A2BA 1FP1D 2D1FA 4Y2RA 3TTTA 4S1NA 4BNGA 4ZEMA 1XQ9A 2KSQA 3P2JA 2IDKA 2AOTA 4L8WB 4XB2A 1FJGB 4X3OA 1BHJA 2IH4A 2WTEA 5CB4B 5DGXA 3GFFA 5KQMA 2XA1A 1NYRA 5B1HA 1NDUA 3M7IA 3E9YA 3KOMA 5D84A 2E89A 2HQBA 2RHCA 3I2FA 1Q50A 3E48A 4CF3A 1QKKA 4ZGBA 1PZEA 3U49A 3QBTA 5DOVA 5LQKA 4E33A 1J07A 4QUAA 4FB4A 1EJBA 3H4IA 3EXIA 4OATA 1TCCA 3HKCA 2A78A 4XAQA 4IQ8A 2OGWA 1W4AA 3ETEA 2PAFA 2IX3A 3OM1A 5JS6A 3TQFA 3N5CA 3QMWA 4HZUA 3AX6A 4UPVA 4G26A 1US8B 2JLXA 4RY8A 4X1IB 1IWBB 3EEIA 3T52A 3UBMA 4F7DA 1EM6A 1VBNA 2XCSB 4REQA 3GAMA 3IULA 4KAFA 5A7GA 3MS2A 3TI9A 2AJ8A 1TF7A 3VHXB 3KDSE 1RKXA 1VPVA 2QKYA 3QPCA 3EPKA 3A2NA 1K68A 4R9VA 1B1AA 3IMGA 3BJZA 1VJCA 3NGMA 4Z0NA 1RRMA 1ZSYA 3TEFA 2Q1SA 3WY9A 3O9MA 2WD7B 1CJTC 4WLOA 3UFXB 3W5HA 4LBYA 5H4GA 2EU8A 3K9GA 4QL3A 1HQCA 5AOCA 2LVBA 5BNTA 4PZCA 4V03A 1B26A 2WINI 3L8HA 3ADOA 4KVFA 5IH7A 3AH8A 3MTDA 2H31A 3GT4A 4HY3A 2XT6A 1GN8A 3DB2A 2JIDA 4S1PA 3DNMA 1JU9A 2AKAB 3N07A 1E1LA 2ZRIA 1UM8A 2C59A 2QM7A 3IA2A 3M4YA 1Y5MA 4O29A 1V4BA 3O82A 1SRQA 1WZIA 1RSZA 2H0QA 3AF5A 1VLZA 2RK6A 2YXPX 4M83A 5EMKA 1VHDA 4DSUA 4E08A 1IZYA 3DZGA 2PSSA 2GFQA 4BEWA 3MCTA 4WK4B 1SCNE 3GRRA 3P9SA 4R2KA 2VSOA 1JX6A 2BFBB 1VIVA 4B7UA 3N8GA 4BFLA 5TNXA 1DT3A 1XQXA 3HDTA 1P2BA 4TYMA 3W5JA 3MLEA 4K9PA 3PVZA 2PGDA 4NEHB 5A2QA 4MS3B 4N0EA 1T3LA 4Q1CA 4U7TB 1WQ3A 3FKQA 1XNHA 4IVQA 3V80A 2WR8A 3ZGVA 1PWXA 3MS4A 3JWHA 3I2GA 4K86A 4MV6A 2PXHA 4MQBA 4ZC8A 5JI2E 2V3CC 4NOJA 5ALIA 4IUBS 2FJ0A 5FOVA 3IP9A 4BKPA 5LP6A 3LO8A 2NG1A 1FUUA 2OZKA 1LTKA 4H77A 4KO4S 2WFLA 4MS3A 4R6WA 4X8LA 4ZCQA 1C1XB 1AGYA 4KNWA 4J6EA 1FFGA 2P2SA 1UCFA 2E1PA 3PPYA 4U5QA 4IW3B 5TARA 4F9TA 5JO0A 3AVPA 2E4AA 1E6CA 1UMBA 4JFRA 5IEBA 1WG8A 4XUEA 2AVNA 2PZKA 3UKJA 3QVKA 4DWWA 5A02A 5JAZA 4Y7DA 4GR5A 2GPSA 3RWMB 2QRHA 1U2DC 4NFSA 2Y0PA 5L3ZA 3U9TA 1DFHA 1RWKA 2PKRA 3SKVA 3T8YA 4AZ0A 2V5UA 1BMFA 5LL6P 3BRWA 2PL3A 2V5AA 3KKEA 1UJMA 1WVMA 1CJBA 3DM5A 4J0FA 5G0TA 3NWJA 1T8TA 3KELA 2JGMA 2RHTA 2ZUUA 4JYCA 1N7IA 2FWJA 3BB1A 4M1MA 3VPFA 1E0AA 4MHOA 4P0PB 3NYQA 5LMCA 1CIPA 2V97A 4BMPB 3NXSA 4MVJI 4CDNA 4RZ2A 3VR0A 4LF9B 2Y2UA 1PGPA 1A27A 2P9TA 2PLNA 2G5TA 4LBWA 4ZVLA 3D0KA 3BXPA 4F6RA 3MC1A 4C06A 4F4IA 1A5ZA 1NP6A 1T6BY 1V3UA 5FPPA 4J43A 4RLFA 1OYOA 2Q6OA 3B38A 3RS5A 3JTEA 3R3HA 1N33B 3OY2A 1XZLA 3GELA 1CZOA 2Z6VA 4RU1A 4PO9A 3ZK9A 4RH1A 4E3WA 3KOWA 3LUGA 4P7BA 3IE1A 4G1UC 2VH1A 3C4JA 3R5JA 4WLUA 1XRNA 5J40A 2C0QA 1XPOA 3ECCA 1UM9A 1IQRA 1YS2X 4YDRA 3VTZA 1RJ9A 2RG1A 2LP4Y 3OURA 5DYYA 4F06A 1NR1A 4MB2A 3NBMA 4XE5A 2Q07A 1Z6TA 3D6VA 2JH9A 3I4CA 3MINA 2HHCA 3SDSA 2YOFA 2DTXA 4N41A 1G5TA 1FP7A 3FKJA 5D85A 1N77A 3V3KA 3C3YA 2B1JA 4O1IA 3NM6B 1I7SB 3SJZA 3QE2A 3H2HA 3NLLA 1WRBA 4OSPA 4RZXA 4C29A 4ENVA 4Q7QA 1GUDA 4FYIA 1VIAA 2C5SA 1MH1A 3WDLA 4AQYB 2POCA 1SC1A 4RLQA 4RZQA 1SIUA 4A0FA 1DX4A 3CKLA 4JDPA 2R1VA 1LY1A 1TUEA 3SQLA 3WKBA 4AZ0B 5BSFA 1T35A 3AHIA 3BMQB 3QE3A 5KYGA 3TW4A 4EKYA 5KX5A 2MTBA 4OQ4A 3Q7EA 2K6GA 1A9OA 4RKFA 4RQAA 1W29A 2HNAA 1IRIA 2WEKA 3AI3A 4G5XA 2C84A 4RPCA 2GWRA 2IOFA 1O03A 2AD5A 1UBCA 5FBKA 2IP4A 2WSSD 3G89A 3W8RA 2C8JA 3AUUA 2B34A 1GU1A 4H6PA 1E3WA 1GCIA 1YZKA 2H00A 4IGEA 4GKVA 4HDQB 2QMOA 4JSYA 2H57A 4OXRA 1C7QA 1ZAKA 1GTL1 3ZHSA 3LUCA 2RAUA 3MMSA 3PEVA 1A96A 4FFSA 4XYLA 1C3VA 1TU0A 2OCBA 4YV2A 2C4VA 4BVLA 1PGJA 2CLCX 2F8LA 1PK7A 3JZDA 1Y1TA 4Y9DA 4FSXA 1GVNB 3MCVA 4HDCA 3ICVA 3O47A 4D9NA 2FZ4A 2JFYA 4G86A 4OREX 2VHTA 1K6MA 4TMZA 4YP6A 3VQTA 4BAZA 2AOXA 3PENA 1KDRA 4RIIA 1ZD1A 3HU1A 4FZJA 2HA6A 5HTKA 1N9GB 1EI9A 1H0RA 4OMCA 4YJGA 2HR1A 3K05A 7AT1A 1FYFA 2IYTA 3H1AA 5KJ1A 3BC1A 1FJXA 2VOJA 4L76A 3ZWVA 5JRJA 1EM8B 3QEBZ 4MKIA 3LBAA 3IGFA 5AW5A 4CEIB 1Z3CA 4FNGA 2FAXA 3N6XA 4LCJA 4UBMA 3K1TA 2PSEA 1J49A 4FMCF 1A50B 4UZEA 5IHPA 3OJEA 1C3OB 3AERA 3K16A 4LVNA 1C9EA 2MOKA 2NTJA 1QRTA 1ZLYA 2J9FA 3I2KA 4I5FA 1G38A 1EFAA 4F1KA 2J5BA 3DHEA 4I6GA 3UUFA 2QEQA 4YQEA 2YS6A 3ICPA 3PIIA 3O3NB 2AV6A 1TT5B 2PL5A 5CRIA 2DX7A 2X41A