1MJ5A

Linb (haloalkane dehalogenase) from sphingomonas paucimobilis ut26 at atomic resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase
publication title Crystal structure of haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26 at 0.95 A resolution: dynamics of catalytic residues.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 112
structure length 297
sequence length 297
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mj5A00
4UFOA 3HI4A 4FDMA 4KYVA 5ALPA 1UK6A 3IB3A 3KD2A 1XROA 2RIPA 4H18A 2WG1A 4B6GA 1GKLA 3UUFA 4MWSA 4E11A 2Z5GA 4Y2PA 2WHPA 2B9VA 2AJ8A 5DTJA 1GKKA 1XZJA 2ZJ7A 3WK4A 3R3XA 1VZ3A 1XKLA 3WJ1A 1H2YA 4B7ZA 4RPCA 2OGTA 3BE8A 3ZI7A 3P2MA 1YAJA 3YASA 3QMVA 3C5WP 1IZ7A 4O08A 4CIBA 4J3JA 3AINA 4BC0A 2HADA 2O2GA 4Q3OA 1QZ3A 4PSDA 1YSCA 1C4XA 2HA4A 4OYLA 1LBTA 3DNMA 4MJ3A 4KE9A 4OYYA 2Y6UA 3ESAA 4WCVA 5A6VA 2B61A 1CUAA 4WY5A 3VDXA 1QIIA 1UK9A 4W1PA 4INZA 2XDWA 4UBKA 4G4IA 1P0MA 1QIJA 4B83A 1XLWA 3PICA 4ARBA 3R3YA 4EHBA 2G63A 5AM5A 1QIDA 5LIPA 1GPKA 3V1MA 1XZFA 1ETHA 4C88A 3E3AA 5J3JA 3QM1A 3IULA 4RGYA 3GFFA 5ALXA 2V96A 2WU4A 7YASA 2GBCA 5AP9A 3DOIA 2PSEA 1WHSA 5JARA 2PU5A 3IUQA 4HTAA 1IUOA 3FLEA 3HRHA 2QJWA 3Q0TA 2WFLA 5JD6A 5HK9A 1XZDA 1T4MA 4NZZA 1EDBA 4QWWA 5EIAA 4Y2SA 5AIBA 5AOAA 4U2EA 5ALVA 4C4XA 5AKZA 3FYUC 4W1RA 5T4FA 3RK4A 3WK9A 1NU8A 5C8XA 4H0CA 4ZXFA 5K3EA 1RP1A 4ETWA 4BATA 5AK4A 1CRLA 1ZJ5A 3IA2A 4F21A 2O2IA 3O4JA 4BE4A 4EB0A 5YASA 5H3HA 5HF9A 3AIKA 4ROTA 4FNMA 3WL5A 1ZD5A 5ALYA 1UOQA 4AQDA 4B0OA 3I6MA 5ALWA 4DMKA 1G4HA 1ORWA 5E4TA 3SC2A 4HAIA 4LKOA 4H7KA 4QDZA 1ZICA 4G1FA 5IVKA 4X71A 3D2AA 3EBLA 4K6HA 4QE3A 4ARAA 3LCRA 4PSCA 2BGNA 1K5PA 2G5TA 2ZVDA 1XZAA 3WWDA 4QDUA 4PF1A 3L1JA 1MX1A 2OCKA 2HA2A 5CT4A 3SX4A 2QM0A 3V9AA 1QLWA 1VZ2A 2YH2A 5IH7A 4BBZA 4AN1A 4BCDA 1BRTA 4X6UA 5HF6A 3R40A 5AKJA 5ALLA 1SCKA 2XMQA 2GZRA 3O4IA 4WFIA 1MN6A 3I6ZA 4H7FA 4AO7A 4IH4A 5CTAA 4UBNA 1VOTA 3VISA 1UWCA 5AK6A 2ZYHA 2PBLA 2ZYRA 4FFVA 1YA4A 1E8NA 3O95A 3U0VA 2HA6A 1CUDA 3H2GA 3WKBA 3D2CA 5ALIA 3FVTA 3SWWA 3FYUB 4UHCA 4J03A 4B85A 4MYDA 5JZ9A 3O4HA 2AJBA 4HZGA 4EZIA 1MTZA 2OXEA 2WSLA 1J06A 2OG1A 5DLPA 1CVLA 1J2EA 1XQVA 1XZBA 3QYJA 4X91A 2H7YA 5ALTA 4AMYA 5AI8A 1HKHA 1Q83A 2Y1KA 5CH3A 2D0DA 1VKHA 2QUBA 4KRYA 4UHBA 2VJCA 5E4YA 1XRLA 3WZLA 3UMJA 5DYYA 3BIWA 3K6KA 2VF2A 4KR0A 4ZV9A 4BYMA 2XUOA 1LNSA 2HRRA 4M0EA 4Y2VA 1E8MA 2EDCA 1WPXA 5HF5A 3F9CA 3I28A 5EHZA 2LIPA 1F0PA 4B0PA 3FCYA 2RONA 4FBMA 4EY7A 1CQWA 2DCMA 3NWOA 3FNBA 5BOVA 4B9AA 1VXOA 3H18A 5AK5A 5DNVA 3D0KA 3R0VA 4KEAA 4KE8A 2GBGA 1CEXA 4BRZA 1CR6A 5CXUA 1EXWA 3WL8A 1SOMA 2JEYA 3DL4A 2Z8ZA 2I03A 3OM8A 1A7UA 4AMZA 5CH8A 1THTA 4ZRDA 3NUZA 2HFJA 3WK7A 4F60A 4RE5A 2PSHA 3HXKA 4YASA 3M81A 1LPPA 2XQGA 2OAGA 3ZV7A 1BN7A 1MPXA 1EDEA 1TCAA 2OAEA 2DQYA 4X95A 4DNFA 3HABA 1W52X 2HU5A 3PFBA 1HQDA 1P0IA 1HLGA 4Y2RA 1KEZA 2AJCA 2BUBA 3CCBA 3JYHA 2QXUA 2H1IA 4NVRA 1EINA 1K6EA 3IURA 1A8QA 5CRIA 3ANTA 3QZUA 3I2IA 3I1YA 4FBLA 1EB8A 3O9MA 1YAHA 4FMPA 3TRDA 1HBJA 5C8ZA 3C45A 4AX4A 2C4HA 3BJRA 5DTIA 3PUIA 5HQ3A 2WHQA 4LHEA 1K8QA 1LPMA 1VJ5A 2C58A 2V97A 5A2GA 4BAUA 1N5RA 4DM7A 3HLKA 3VXKA 1S8OA 3F97A 2H7XA 2C5GA 1YS2X 2ORYA 3KWFA 4HS9A 4XWGA 2XMDA 3G7NA 1TAHA 5JASA 4B84A 3DEAA 1F8UA 3CCCA 2OGSA 5ALDA 3BWXA 2WG0A 2ES4A 2P8SA 5ALZA 3LIPA 5ALJA 4MYSA 4Q3KA 4Y2XA 4AXBA 1W76A 5AKEA 4JYPA 1LZKA 2VEOA 1XRPA 4G8CA 1U4NA 4WDQA 1YB6A 4IHAA 3I6YA 1ZD3A 1FFDA 2H9YA 2PX6A 2B4KA 2PL5A 4QLAA 1UZAA 2YASA 4W1SA 4Y2TA 4ZI5A 1Y7HA 3KSRA 3VJLA 2JGJA 1JMYA 3OG9A 1WM1A 4PV7A 2HA0A 4FWBA 5EFZA 2XMZA 2ACKA 3C6BA 4XVCA 4U2GA 3D4LA 1EA5A 2DHDA 1CLEA 4ZV7A 2OLEA 2CUTA 1AUOA 3GZJA 4JH0A 2ECFA 2HU7A 4U2DA 3V1NA 2GBFA 4QDOA 4D9JA 5AJHA 2DFPA 2XE4A 3DD5A 3A2LA 3H1AA 4L72A 4B82A 1TRHA 4I19A 2IX9A 1ZIXA 4FTWA 4LYDA 4GHWA 5AI0A 3N2ZB 3DOHA 5T4HA 4BC1A 1FFCA 5JZSA 4E15A 5FLKA 4EY4A 4L9AA 1XLVA 3G0CA 1QIMA 2PKYX 4H7IA 5HFNA 2JGMA 4L0CA 5IKXA 1R1DA 4DMHA 2GZSA 2JGFA 3HEAA 3C6XA 5BWCA 3MUNA 4QDXA 4OD0A 1IUPA 2QRUA 3QH4A 4NS4A 2QS9A 1E8DA 2BKLA 2IIVA 2VA9A 1O6FA 4BCBA 4H7JA 3X3HA 1OILA 4DLNA 1W75A 1JU4A 1NX9A 2PSFA 2XT0A 4RNCA 3ANSA 2EEPA 5FUMA 3G8YA 1CFJA 1FFEA 5EI5A 5EIEA 2XLCA 4GDMA 4N5IX 1CUHA 1Q0RA 1K63A 3U1TA 3WYNA 4KJXA 3IIIA 3BXPA 4K6GA 5ALNA 1CV2A 3MGAA 2BCEA 4BZWA 1PJAA 1B6GA 2J4FA 2R8BA 2HA5A 1CUGA 4G9GA 3HACA 3T4UA 1GPLA 4BB0A 4X85A 1DWQA 1VLQA 3PI6A 4G9EA 5DJ5A 5ALGA 5K3DA 3WL7A 4AO8A 4EY8A 2R11A 3A2NA 2DR0A 4JYMA 3KDAA 1XRRA 2O7VA 5FPPA 4GBGA 2CJPA 3PF9A 3WL6A 4A16A 2JGIA 5LZ9A 1H2ZA 5KBYA 4CCWA 4UBOA 1W4LA 2PSDA 3AZQA 1EK1A 2HA3A 4UHEA 1MT3A 5JAOA 2Z8XA 4MWTA 5ISMA 1CUUA 3JW8A 3W04A 2WJ3A 3WQHA 3FCXA 4YPVA 3R3UA 4EBBA 1CUZA 4QA9A 1IUNA 2XLBA 1E3QA 5A7GA 1UKAA 3K9BA 1ISPA 1U2EA 4TPKA 2WJ4A 2Y2VA 2OCIA 4CFSA 1SCIA 2K2QB 4Q34A 2YYSA 3DS8A 5LZ4A 2XMRA 3IVMA 3EQ8A 3IUJA 4U2FA 3A70A 2RGUA 2G4LA 5AM1A 1AKNA 2WM2A 4Q1VA 2OCLA 1EX9A 1CUSA 2XUAA 2RHTA 5E2IA 3M82A 3H2IA 3S2ZA 5FPQA 1U8EA 1G66A 1F0NA 5AKIA 3RKSA 2WILA 2CEKA 1GQRA 5AOBA 5AO9A 3GROA 2WFMA 3DLTA 3ZLVA 1W1IA 1C7IA 1YR2A 3ZLUA 3V1LA 3O9VA 4LYEA 1XKTA 4J0CA 4GXNA 4J0IA 1YS1X 4DGQA 1AX9A 2OQVA 3V48A 1IMJA 2VAVA 1MO2A 3R3ZA 5C8VA 2ZJFA 3FAKA 3E0XA 5HKBA 3JWEA 2X76A 1A8SA 4BVKA 3AILA 4DNQA 4C4YA 5AM4A 3NOXA 3QMMA 4Z49A 1JT2A 3KXPA 4V2IA 1U65A 3A2MA 4QLOA 3A6ZA 5CW2A 2HRQA 4FLEA 5AH0A 1WCYA 2V9ZA 1DX4A 2JIDA 2WU3A 1H2WA 4ZWNA 1XRNA 3WK5A 1XRQA 4A23A 5ALSA 3RM3A 5D3ZA 3O0DA 3WIOA 1N5MA 4FKBA 1Y7IA 1MNAA 1FJ2A 1CUCA 3STYA 2G5PA 2C0QA 4LXHA 4CCYA 2BAGA 3AZOA 4N8DA 5D6OA 4HXEB 5HFAA 5LKAA 4X97A 1GT6A 3E1GA 4BDSA 2Y2UA 1JU3A 3ESDA 1K4YA 3BL8A 1CPYA 3F98A 4Q05A 2QVBA 5IVHA 5ALKA 2QKYA 4XX1A 1Q0ZA 3DKKA 4C4ZA 3CN9A 5LLSA 4JNCA 4B81A 3O4GA 1CUWA 4X3CA 3QVMA 3F8SA 5DNWA 1UT6A 1FFBA 2PUHA 4X6YA 4G8DA 1BE0A 1WOMA 1GPNA 5ESRA 3D59A 3W9BA 1WPRA 3BF8A 4KE7A 4B80A 1EI9A 4MEBA 4I4CA 5DYTA 3H2JA 3ZPXA 4MEAA 4FNGA 3D5EA 4BDTA 2HU8A 1R4ZA 5AHXA 1ZIYA 3S8YA 2EDAA 1DQZA 2OCGA 4G5XA 4HRXA 5C7YA 2J3QA 1TCBA 4QEKA 4J7AA 4EUSA 3H19A 4J0KA 2JBWA 3WLAA 1XZLA 3DDUA 5IVDA 1QONA 4BVJA 1BCRA 1ACJA 4GI1A 4EA6A 2XQJA 5K5EA 2WKWA 3L1HA 3STWA 5AI5A 4OU4A 4C89A 1QTRA 3WK6A 1DTEA 5AK3A 4GWLA 4DIUA 6YASA 2PUJA 2OGZA 5JADA 2DHCA 4TGLA 3R3WA 4DMCA 3M3DA 2BUCA 4H77A 4A5SA 3WI7A 1JJBA 2HM7A 3G9ZA 2VJBA 4KAJA 1A88A 5A62A 4CG3A 1JFRA 3F96A 2XMCA 1CUIA 1CUFA 1XZEA 1QOZA 3DCNA 3HJUA 3K2IA 2HFKA 4FLMA 5AKLA 4UUQA 1ZD4A 5JIBA 3Q8WA 2BJHA 2WG2A 3QPDA 3GUUA 5D7BA 1N1MA 4K2AA 1LZLA 1BEZA 4BTLA 3DQZA 3BJMA 4N5HX 1MU0A 1ODSA 4L3WA 3WIBA 2VQ6A 2WTNA 2WHPB 3W06A 2WTMA 2WIGA 3OTQA 3AUKA 3QPCA 2IITA 1X2EA 2E3JA 3R3VA 4J0GA 4JEIA 4IH9A 4KAFA 2Z3ZA 4J0JA 3VVMA 5ALMA 2XUIA 5JYCA 1ACLA 2QMQA 3V1KA 5AIAA 2VT6A 4DNOA 2JEZA 5LZ2A 2YXPX 1UXOA 3WMRA 1GQSA 3FYTA 4G4GA 4LXGA 4G4JA 3EF3A 1RYYA 3LIIA 1X70A 5KWIA 2CMFA 3B3QA 2O7RA 3M83A 2GYWA 2XUPA 3RLIA 5ALUA 1UKCA 1R9NA 1XQWA 1E5TA 2ONCA 2J4CA 1AMNA 3I1IA 3FYUA 4W63A 2WFLB 4N8SA 3B12A 1AZWA 1MX5A 5LZ7A 5I8PA 4IQ4A 1GZ7A 1IZ8A 2WIFA 3I2KA 1VE6A 1DQYA 1TK3A 4GECA 3ED1A 1ORVA 3L1IA 3LS2A 3PDCA 5CT9A 5FOQA 4BRSA 1CUBA 4PSUA 3ICWA 5AKHA 1BCSA 4QNNA 2JGEA 3G0GA 4U2CA 4HRYA 3I2FA 4FLFA 4KAAA 4Y2QA 5CT6A 3ESBA 1QJ4A 2FUKA 5AKKA 5AKGA 4BAZA 3CXUA 2QZPA 3HSSA 1L7QA 4DSAA 3DKRA 1JMKC 1DT3A 4P93A 5FV4A 1N8SA 4H7DA 2QT9A 4UBLA 4M0FA 2WIDA 4ZGBA 4G8BA 1DWOA 3H04A 1QO9A 1EB9A 5JALA 1LPAB 2CKMA 1J1IA 3DYIA 4J0HA 3FSGA 4QDTA 1HDEA 3G9XA 1TCCA 3EIOA 1KU0A 5EHNA 4X00A 3WKCA 2DHEA 2WLSA 2QJRA 1ZJ4A 5AI6A 4X92A 5JD4A 4X90A 2ZYIA 1YA8A 1CUEA 4AZ0A 1YASA 1UOPA 1I6WA 3W2TA 1GGVA 5LKRA 3NGMA 3W9UA 2ROQA 3PFCA 3VJKA 1QIFA 2WUDA 4H7EA 3WKEA 3H2HA 2D5LA 4P08A 1DX6A 2WQZA 3AIOA 5HKAA 1EVQA 2VTVA 1ODCA 1LPSA 2UZ0A 1W6RA 4Y9SA 1L7AA 4YX9A 4S0XA 2ZJ6A 4HXFB 1B41A 1UK7A 3ILSA 5CBKA 1MAAA 3G9TA 3T52A 3HC7A 2XMGA 1ZI6A 1USWA 3WYDA 2BGRA 4PQEA 1LPOA 5JAPA 2W6CX 1OXMA 1EHYA 1EVEA 1QIGA 5K3BA 4P92A 4F0JA 4HVTA 2X8BA 4Y2JA 5FP0A 1XQXA 4B9EA 2Y6VA 3DL7A 5BWBA 1XLUA 4Y7DA 4IH1A 3WKDA 2WUFA 3FOBA 3WWCA 3IUMA 4UBJA 5EGNA 5AM2A 3H1BA 2VT7A 1WB5A 2XQKA 1QGED 1A8UA 1AGYA 1ZI9A 1DINA 4HXGA 5K3AA 1QFMA 5FKJA 1R3DA 4GLBA 3RARA 2QXTA 4AZ3A 3WA7A 2X5XA 4UHDA 1C7JA 4UHFA 4GW3A 3PE6A 4M0MA 3QPAA 1BROA 3OURA 1CUYA 4YK7A 2XMBA 4OB6A 2XQIA 3EQ7A 3E4DA 1X2BA 4ITVA 5AKXA 4BCCA 2C0PA 3IUNA 5DWDA 2JGKA 4H35A 2XB6A 3FBWA 1UKBA 1AC5A 4OPMA 5SYMA 3BF7A 4MQMA 1AURA 1CUJA 4E46A 3ZLTA 1UOOA 5CH5A 2XUJA 1LGYA 4DNPA 2WIKA 4U2BA 1M33A 4FOLA 4BZZA 3I2GA 2HA7A 4QWMA 4WJLA 1QIEA 1LBSA 4OU5A 2CZQA 2FX5A 3MVEA 2QOEA 2C5FA 4WY8A 1PV1A 4X6XA 1D07A 3WWOA 4UBMA 4E14A 1TKRA 5JATA 5CXXA 2VAXA 5LZ5A 4C6HA 2PSJA 3WWPA 3LLCA 5K3CA 1H23A 3FWHA 4DSZA 1WHTA 3H17A 3FVRA 4EY6A 1LPNA 4KE6A 5LYYA 5AI9A 2OQIA 3C6YA 3FLBA 1XRMA 5I9IA 5HQ3B 1O6GA 2JGLA 2HHAA 4OSEA 4UFNA 2CB9A 2C7BA 3MUOA 4EY5A 4UBIA 1FSSA 4DTCA 3STXA 5AOCA 1QIHA 4F5ZA 3BDIA 5D3KA 3G0DA 5A7FA 1Q84A 5KWJA 1DWPA 3AJAA 3OOSA 1QE3A 5K3FB 3G0IA 1G5FA 2QR5A 1P0PA 1XFDA 5ALOA 3WWEA 1P0QA 2DQZA 1Z68A 4IO0A 2XMSA 2ZSIA 1WB4A 3D2BA 3QITA 2HL6A 3H2KA 4C01A 1ZI8A 2JF0A 5IVIA 4LIPD 2Z3WA 2QUAA 3FSGD 4W9RA 4BTVA 2QTBA 5CMLA 5SYNA 5ALHA 4DMFA 4RE6A 2NW6A 3WA6A 3D7RA 5ALRA 1QFSA 3IBTA 1MNQA 4ZREA 2XUHA 3AIMA 1EDDA 5CT5A 2XUKA 3BDVA 1EH5A 3WZMA 5AM3A 1XZIA 5FXMA 2WIJA 2RI6A 4CI9A 3W05A 3H0CA 1XZCA 1AQLA 3C6ZA 1XQYA 3TGLA 3OPMA 5DYWA 1H22A 4CG1A 4OB8A 3STVA 1XZMA 5EHXA 4H7HA 5AICA 4Y2UA 3DYVA 1EK2A 3ZWQA 4UFPA 5I7UA 2Q0XA 5EIHA 1IVYA 1H2XA 4J0DA 1QO7A 5AM0A 2OPHA 1GXSA 3AFIA 2I78A 4KRXA 2J3DA 2HDWA 4X93A 1MX9A 3KWJA 1YB7A 1R88A 2XQFA 4QZVA 2RHWA 1VA5A 1THGA 3VKFA 1UFOA 5E4JA 2ZYSA 3ICVA 5A71A 1ZD2P 4P9NA 1KU6A 4MXDA 1NU6A 1Y37A 1R9MA 1QTIA 1UK8A 1HPLA 4FHZA 1VE7A 3G0BA 1CUXA 1E66A 1JKMA 3G02A 5JD5A 3IDAA 5HCUA 3UUEA 2PU7A 3KOOA 3WK8A 1FFAA 1RWQA 5T4BA 3WJ2A 1G42A 4X7BA 4PNZA 2AJLI 2GYVA 2XUGA 3QMWA 5EHQA 2FJ0A 5LZ8A 4K5QA 4GEGA 4X94A 1T2NA 4AO6A 2FJPA 2AXEA 2VATA 4BE9A 4N8EA 3VJMA 3R41A 4WFKA 1XZHA 4PO3X 4BVLA 1BU8A 3C5VA 3CN7A 4Q82A 4XIIA 1MJ5A 2B20A 2ACEA 4BAGA 2WHRA 2XI4A 3LP5A 2W22A 2RAUA 3VVLA 5LP1A 1ZGCA 1XZKA 2GBIA 5KREA 3C70A 1SC9A 5DNUA 3ESCA 4OCZA 1JI3A 3QBJA 1HL7A 4WDRA 2XUQA 5BV7A 3D3NA 2I3ZA 5AI4A 5AKYA 2ZSHA 5ALQA 5ALFA 3HYSA 2V98A 3G9UA 1PFQA 4TVKA 3FLAA 3OC0A 2VJDA 3WKAA 4FFWA 5K3FA 2HIHA 1BS9A 1JJIA 3STUA 2PPLA 3N0TA 2VSQA 5JZBA 1CIJA 3AZPA 5HF8A 1L7RA 3C87A 4AN0A 5F4ZA 3GA7A 3I2JA 1XZGA 4CG2A 1BN6A 1CQZA 4BP8A 3STTA 1F6WA 3PF8A 4LXIA 1ODTC 4NMWA 3C8DA 3SK0A 1TIBA 4KACA 4UHHA 1ZGBA 2GYUA 4UPDA 3F67A 1LPBB 1DT5A 2VJAA 1VXRA 4Q3LA 1E89A 4C87A 2DSNA 3GBSA 4K6KA 5JAHA 3B5EA 4JUIA 4W1QA 2WJ6A 5HK8A 2H7CA 1JJFA 3C43A 2WFZA 3DJYA 5T4EA 5CT8A 3TEJA 2PVSA 3I2HA 1MAHA 1WB6A 1SCQA 4OUKX 3BIXA 5HZGA 1OCEA 3HZOA 2CBGA 1R50A 1BEEA 5JANA 2XUDA 1J07A 4PW0A 5ALEA 2BUAA 4XJVA 1TQHA 2O2HA 1CUVA 4AB1A 2PM8A 5JAUA 1YCDA 2I3DA 1ZOIA 1VA4A 5FDFA 4MQLA 3TJMA 1LLFA 5C81A 1SFRA 5FRDA 4WFJA 2BFNA 3EQ9A 5CURA 4Y2YA 5A7HA 2WUEA 3C8HA 1QIKA 4OB7A 2WUGA 1DU4A 2AJDA 3PUHA 4BP9A 4CIAA 3GELA 4CCYB 2XUFA 4DYHA 4I3FA
chains in the Genus database with same CATH superfamily
1Z2EA 2YRWA 2ZROA 4M1KA 3LD9A 3TVTA 1HDOA 1ESZA 1RXEA 2JLSA 4ZC1A 3RS3A 3OEHD 3D8TA 1F5NA 4FDMA 3C41J 5EESA 4HH0A 1RJGA 3DF7A 4G3XA 5ALPA 3L40A 4O29A 1NJ1A 1SXJB 3SP1A 4M8LA 2ZIEA 4ENQA 2FW6A 3OEWA 3HK2A 2P0EA 4H18A 1M2KA 3OE4A 4L22A 1P7CA 2LCFA 3HO6A 3RRMA 5COBA 1O58A 3HA5A 4BGUA 3Q10A 1DARA 3VV3A 3IE0A 1MIOA 3TTTA 5EFOA 2PXXA 2FDXA 2NSHA 2L19A 1MVLA 2B9VA 2L42A 1AO0A 2PV7A 3W2HA 5DTJA 2FP4B 1GKKA 2N46A 1W6UA 3AGQA 5DFAA 4MZDA 1T10A 1XZJA 4NLLA 3ENKA 3KTAB 5DB4A 3WK4A 1NZFA 2ZTHA 4JHXA 3BERA 1NYLA 2E4YA 3R4VA 4G5YA 5F2OA 1JDJA 2ECPA 3B3GA 1H2YA 5KDLA 1P2FA 4OAQA 4GWGA 2JLZA 4AF6A 4FNAA 4A3SA 3AP3A 5JSQA 2BLNA 3N7TA 2PZMA 2YXNA 4Z3KA 2PL9A 3P2MA 3MWKA 3ZJ5A 2Q27A 3YASA 2MIIA 3KYDB 2VHJA 3BCHA 1ZRHA 1MD9A 2FPPA 2AUNA 4DHEA 3M1LA 1WLYA 4CIBA 4XPIB 1UUFA 4DA4A 2JI7A 3OFND 5WRFA 2X0DA 2CVFA 2DUNA 3MJTA 4PSDA 4DFDA 3VKGA 3KNZA 3HCDA 2HA4A 4KNVA 5GAJA 3RYIB 3DNMA 1J90A 4MJ3A 3DHYA 2JIOA 4D0NA 3GUYA 1KMNA 3DOOA 3LSYA 3QXHA 4QYXA 4B75A 2IZ5A 3JQ9C 5A6VA 2PKRA 3BRWA 3LC2O 4B6JA 4PQYA 3SOZA 1F7UA 3IR6A 5CXQA 1II0A 3FCOA 1OGIA 4GYWA 3F4KA 3O2JA 3VR5A 5F64A 1JEAA 4W1PA 5FJIA 2G76A 2O3TA 3A6DA 4UBKA 4F3KA 4F7WA 2CD7A 1TLFA 4RESA 2Q1TA 2QV0A 1XLWA 4H0FA 5GZ3A 1U63A 2VT3A 2A9QA 3W5AA 3CW8X 4ARBA 4CNBA 2XRZA 4EHBA 3ZUPA 4YRGA 3NFRA 1XQ1A 4Z4GA 2QTLA 2ZAGA 2E82A 1JHYA 1KI3A 5THKA 1R5OA 1GPKA 3ZVLA 3PXUA 3Q7TA 3O03A 5J3JA 1GKYA 4QAQA 3DPUA 5CDYA 5EQTA 5BV1A 1UJ4A 1X6VA 1GSAA 3QM1A 1OBVA 2A84A 4C4OA 1JF8A 3DLIA 3HB5X 2F4VB 3LZDA 1I4LD 5ALXA 1ZAYA 3FZEA 2FPGA 1K3UB 2FB9A 2RGNA 3FD8A 3HWSA 3LDFA 1NYQA 4PC1A 4TL8A 3JARA 5ICGA 3SVLA 3WRYA 3DOCA 2GBCA 5AP9A 3NCHA 2DY0A 4ZYYA 4MS4A 3JVUA 5IAAA 4HQ6A 4C0JA 2ZI6A 4BNYA 2PU5A 4EHJA 4NPCA 5TE9A 1Z6AA 2YICA 2PBZA 4RH1A 4R2WA 3VNBA 3Q0TA 3W90A 4CM8A 4TT3D 2OORC 4ESVA 5CM8B 1UPAA 5JD6A 4IVQA 3T9BA 4KK3A 1T4MA 4NZZA 1VCMA 3CUUA 3Q9NA 4HQKA 2PGDA 2RG1A 3AQ4A 3H3JA 3G8CA 3I3SR 2ZZMA 1MPTA 3K71B 4HN4B 5I7EA 4DG5A 2BGWA 3LXRA 5CAEB 4LDZA 4L4XA 1K4KA 4X64B 5BPHA 4RVDA 3GLGE 2WLTA 4AKGA 5ALVA 3KQYA 4PRYA 4C4XA 5AKZA 5KYTA 2XJ4A 3KXDA 2ZM6B 3FYUC 4AL4A 5AVZA 4QM6A 5SZIA 2P68A 4UJ5A 2R6JA 1NU8A 4NOJA 4RVFA 2F1JA 1TO6A 3IOYA 1EIZA 4R3NA 3ZDEA 4XRRA 1RP1A 4M87A 1AHPA 1P6UA 1C8VB 1E9DA 1T8PA 1IEWA 2QG4A 4BATA 2MINB 1CRLA 2FI1A 1ZJ5A 1XYGA 2FDRA 3A0UA 3DMTA 2NU9A 3IA2A 4Y1EA 4HOYA 4X8LA 5DHSA 1YOVB 1XCGB 3O4JA 3OJWA 4TMTA 4E31A 1SURA 3O73A 3N8DA 2AA3A 5COAA 3GH1A 3ICOA 5ESXA 2WAYA 3W9YA 4HNTA 4WCFB 5CK5A 4NQRA 2CYCA 4ZVNA 1UP4A 4JDPA 4X1YB 3DD1A 4BLQA 4FNMA 4GDFA 3WL5A 1NR5A 2ZQYA 1MAWA 1C3OB 1R3UA 3MJHA 2BFDB 2GPWA 4AQDA 3DUFA 5DSXA 2BFPA 4F3CA 3FTCA 5ALWA 3DWIA 1QF6A 2RGRA 2PLRA 3MJFA 4J3FA 1NLZA 2V7WA 1IHYA 1T8UA 2PJUA 5SY4A 1V1RB 3CQ9A 2MSWA 3CKKA 2BF7A 1Z06A 2JH3A 4HAIA 2ISQA 2JFVA 3BIFA 3LT2A 1EXDA 4NKRA 2N1MA 1KY4A 4QDZA 4S04A 5DNEA 4FW9A 3EA5A 3KQWA 2IQ5A 1ZICA 1E1CB 2HEGA 3RRBA 3IAXA 3V6MA 4GOXA 1NKVA 3QYAA 3VUEA 2AGVA 3IERA 4YPFA 2GXAA 3JWJA 4X71A 4ED9A 4A15A 4JR0A 3V7WA 3L1UA 3NI2A 4PEVA 4P98A 4BJ6A 5J4YA 1YL7A 1FS4A 3IP5A 4FMCB 3AUUA 4J07A 4LC1A 4ARSA 4BMDA 3KB8A 4LZPA 3PB3A 3WMXA 3AVXA 3O26A 1COWD 2O1SA 3H7IA 1PN3A 1U1CA 5DN9A 4BMXA 5IKPA 3RSCA 2A5LA 2VDVE 1GGFA 2PFGA 2C4TA 2YN0A 2BGNA 2G5TA 4UUPA 1T34A 2ZVDA 2AVNA 4N65A 2VHXA 4JCCA 3VZRA 2EIXA 4UM7A 5T67A 4DCTA 4JXZA 5HXAA 1ABEA 3KKEA 4IDHA 4FDLA 3B51X 3X1XA 1XTZA 1TYBE 3X0DA 1G3IA 1KIMA 1UIRA 1K08A 3N2NA 1KTVA 1C3LA 1MX1A 1F2UA 2Q2NA 3L18A 4LWOA 2A0WA 5CTJA 3TUJC 5IZCC 5IANA 2G25A 3R0JA 5CT4A 1GL7A 2NUTB 2XGOA 3EA4A 1BD3A 2OHFA 3MUEA 4MR8B 3SX4A 3ITNA 1NM5A 3C3JA 3OP4A 4QG3A 5F52A 5JNRA 4FK8A 2FZ4A 3RYTC 1R8JA 2UDPA 4BBZA 1B8PA 1V96A 2OXFA 4MCJA 1XDSA 3CF0A 4AN1A 1U0NA 4BCDA 5EXEA 1N6OA 3E7FA 3DMPA 1F4LA 5A3JA 1YULA 3AETB 1O57A 5ALLA 1JH8A 2OBLA 2FK7A 2GZRA 3HZHA 3ROPA 1YR3A 2LD4A 2P65A 1CF2O 5IS2A 1A9YA 4EA9A 1F2DA 2ZUWA 2CT8A 1MN6A 2B25A 3AEQA 3UHOA 1O9GA 2IZOA 1DFIA 4Q9AA 5M29A 1AQUA 3A31A 4AO7A 2Z8YA 4BS9A 2UUPA 5FFFA 3AFMA 2EGGA 5FLXA 2IHTA 1M7HA 4A7PA 2NO0A 2EKLA 5BQ3A 4UBNA 3EA0A 1WIWA 3HEBA 3VISA 4XIJA 4DJ5X 1FSPA 1VL0A 5LB2A 4CEIB 3KAJA 3VR4A 2ZYRA 4JV5B 4FFVA 1L5HA 1YA4A 3ETEA 1NF3A 1XZ8A 4TXHA 3WY9A 5B3LA 5HMLA 4LMRA 4WLOA 3E82A 4E30A 1J39A 4BLPA 1CUDA 4V2UA 3D6HA 3AF4A 4LHVA 4MVJD 1NN3A 5JCOA 2BGMA 1J22A 4LZJA 4NAUA 2UV8A 1ESMA 3NPMA 3QOXA 2O8EB 2I4OA 3G79A 3U1BA 4J03A 4B85A 4MYDA 4PFSA 3KLPX 5F98A 4O5AA 5M3BA 3TECE 2FMHA 1DXYA 4YRJA 2AJBA 4DW8A 1XMIA 4OI2A 2HPHA 3VZBA 1UWLA 5EWLB 3N05A 2JRCA 2B21A 3S2UA 2OXEA 3SLRA 3VPHA 5IDQA 3PEFA 1O2DA 1QQTA 3ROKA 2R2GA 1U2ZA 3N7AA 2IXGA 1J06A 1VKNA 4RZQA 4NABA 4RJIA 3MTIA 2X13A 4QTUB 1GTMA 2EFGA 1UMCB 3C1TA 3DTVA 4OQMA 4W99A 4TMVA 5TPZA 3N5KA 4EVSA 4ENSA 4N7JA 5DLPA 3EC1A 3BULA 1Q0TA 1KYXA 3A58B 1XP8A 4W7HA 2QL7A 4WAUA 4CYMA 4LY0A 2WUVA 1X0XA 4KDFA 3G13A 3DXXA 3WBFA 1YJ5A 1N2CB 1NSFA 1R37A 3C16C 1ZN2A 4PO1A 1IN5A 1EWTA 4L4UA 3L7YA 2J5XA 3PDUA 4MUEA 3KV1A 5DYYA 1RU3A 3JZIA 2E5FA 3NTQA 3Q7EA 4HX5A 2FRVA 4IINA 4O0LA 4DC9A 3ER6A 1YBHA 2WF9A 1L7DA 1YZYA 1Z39A 4O1MA 4BYMA 1NNUA 3E2IA 1XEFA 1E1QA 1BDJA 1JLLB 2EDCA 3LZ6A 2UUCB 3B6KA 5HF5A 4M88A 1Z5GA 3OZDA 5IASA 3L6RA 5EHZA 5BNIA 4B0PA 4HVCA 5IJ9A 3IVAA 4ZI7F 3KT8A 2VPTA 2IP4A 5UKDA 2AG6A 3EYAA 1M2VB 3I6BA 5KQGA 2DCMA 4IFEA 4UVHA 1PNTA 2EARA 2GWRA 1EUDA 2YXLA 5BOVA 1C9JA 4ZVPA 2PRYA 4H2DA 1T1RA 3OE1A 3QFCA 3U3ZA 1W48A 1ELOA 4Q1DA 5C35A 1E6LA 4J94A 5KJCA 4JJ8A 4UASA 4B45A 1CY0A 2Q21A 1V71A 1S2OA 4MPJA 2VKTA 1Z17A 4YGXB 2WTXA 2X5NA 4JGBA 2CHEA 5T8KC 3D1LA 1PD1A 3FKQA 3HDQA 3NDPA 4IAOA 3KB6A 5CYPA 1KJYA 2NUAB 1V7ZA 2FQ1A 3MAJA 4I2VA 2BFCB 1CR6A 3W8DA 4WCDA 1U7TA 3ASUA 4LYFA 2QTRA 1BE1A 3DBVO 3NJ8A 1SOMA 2ZR0A 4JB2A 2GM5A 4PLHA 1Z47A 1LA2A 3DL4A 4PYJA 3Q5GA 3CEJA 3HCWA 3IBYA 2I76A 2R7NA 4KXFB 3VAAA 3ZY4A 1NUSA 2CY0A 3H8WA 3Q6MA 3U4IA 4GS5A 4HDSB 4IDCA 3PLAE 4FT4A 3RFXA 1CJMA 3OM8A 4ALNA 5C8YB 4A27A 3U4QB 3M6XA 1DQPA 3IOCA 1XBTA 1DEAA 1LBQA 5KNCA 4MQEB 1N5IA 3NUZA 2O2XA 1FS5A 2YZMA 3AR7A 2HFJA 3E5HA 3QX8A 1K8RA 1P5RA 5JO0A 3A1FA 1G8JA 2IHUA 3UWPA 3W6UA 4QUKA 5L3ZA 2R8XA 3DEKA 4F60A 3T9CA 1OOEA 2PSHA 3BXEA 2XOEA 1MG0A 3QKUA 4CV0A 2EP7A 2XQGA 1W9HA 3QSGA 1JKIA 4CLOA 4PYNA 3AO0B 2GDJA 2BPOA 2WJYA 2EZ9A 2C1EA 3Q8LA 1BN7A 2W2MA 1RXWA 3W1EA 2BCJQ 3HBAA 3RAGA 4QYMA 4Z1OA 2CWWA 2DQYA 3AMVA 4RF5A 4DIEA 3N76A 1KOJA 3A1CA 3DV0B 3SICE 1NJ5A 2C88A 4EHHA 2YN4A 4FFSA 1P0IA 1O94C 1HLGA 3HUDA 4INPA 2ZU0C 3ZQUA 4JC8A 3THYB 4KFUA 1U6KA 3GWZA 1T9DA 2PFSA 1SUIA 3W79A 1R12A 1ZL0A 4AP9A 4EG4A 1UQTA 4HAOA 4M99A 2AJCA 4NVRA 1ESCA 3T8YA 2QXUA 5BN1A 3DB2A 3N07A 5K7SA 3U6KA 4QU9A 1KC3A 3IURA 3P26A 4C6RA 1KQNA 2FMFA 4LOAA 1M1NA 3VR3A 1TYCA 2IY9A 2PSSA 2RJ3A 1CZLA 1FBNA 3ANTA 2JGDB 3QZUA 1HLDA 4RFSB 4D6PA 2GCGA 3ROFA 3NYRA 3ZY2A 4BP3A 1EGHA 4KIFA 4EPRA 1FX0B 1WQ1R 3KUKA 1Y3CE 3FVQA 3O47A 3DM5A 4FMPA 1HBJA 3C45A 4EGJA 5AW2A 3FPHA 4MITA 5HYVA 2JIBA 1VECA 2D2EA 4M8KA 5DCUA 4PLPA 3QKSA 4GX2A 3RS4A 5FAXA 3T1QA 4KAXA 2YBEA 1K8QA 5B58C 3GFVA 1Y1KE 3MTEA 4J7XA 4PM4A 2YVUA 5ETJA 5LOVA 1YD7A 3L9WA 1EFAA 3LDUA 4TKVA 4BAUA 4ZGGA 1S2MA 3TDKA 3B6MA 4DM7A 4G5FA 2IU6A 2YMMA 5GWXA 1THZA 1RYBA 3A9UA 2Q5CA 3G2LA 5E6RB 3G2KA 3VU9A 3ZE6A 4QBGB 3SIXA 4GLJA 3V00A 2QX7A 4PHGA 4YJDA 1TA0A 1CQJB 3ZNQA 3I5AA 3IUSA 4KXWA 3ANXA 4ZV4A 1K7SN 1YZLA 2G09A 2DJIA 2NLOA 2NYUA 3S68A 4AZTA 2H4HA 2R96A 2QM7A 4R8LA 2CLKB 4BNTA 5AESA 1OLSA 1BIFA 4MV0A 1MORA 2DBRA 3WIEA 4EX6A 3A9RA 2KS6A 3SFZA 5JVDA 4Q3AA 2OXCA 3O3CA 1JHRA 2W6JD 3UW1A 4BO7A 3G7NA 3TK1A 4XM0A 5HFJA 5LA6A 3GT0A 3KOMA 1C4OA 3KQUA 2R48A 1ANKA 3U9TA 1RACA 1AJEA 1F8UA 4EVIA 2G5GX 1XAGA 3BWXA 5ALDA 2X4DA 4KQ2A 4D9BA 3WRXA 1RNLA 3D8NA 5JEEA 1IK6A 3LIPA 4RLFA 4A9AA 4EQ6A 3SXJA 4L8GA 4MGYR 4D81A 4K9NA 5JROA 4U3JA 4EB6B 5B36A 4JI5B 1KH1A 2QLMA 3HMKA 3MLAA 4WACA 4WY2A 1XG5A 1X38A 3ZDYB 4AZ3B 3TH5A 4LMAA 3WYCA 4DRXB 3T7KA 4BNDB 2ZI9A 3AFHA 1M7GA 4RETA 4EB8A 5C1BA 1DAFA 1Y7LA 4WDQA 4ACBA 1FFDA 2YNMD 4FGSA 5J2UA 3HPQA 4DV4B 3S1AA 2RSLA 3L1VA 2IP1A 1UDCA 1ZM9A 1KK2A 4RTJA 3DBHA 2C7VA 4JZYA 3UJNA 1OH5A 1Y7HA 2Q2QA 3MJEA 2X23A 1MH1A 2ZUBA 4LRWA 3OF5A 4RACA 3KSRA 5KYUA 4I81A 1JMYA 1OUMA 2A9VA 2V4UA 4MS1A 4R2JA 4X8OA 3VJLA 4YRAA 4EI2A 3OG9A 5KX5A 1XCMA 5CDFE 1CWUA 4KRGA 3EWSA 2JI8A 2XKAA 4LZWA 2QM3A 2DP4E 5B7GA 2Q1UA 2X0NA 3U61B 2F3RA 2XMZA 1OGJA 2FUNB 2I3AA 4XJXA 3FRIA 3U5TA 2ACKA 2VPQA 4OHUA 5EERA 4JX9A 5TRTA 3ZZNA 3LFTA 4QOGA 1J20A 5GONB 1SG9A 1I13A 1X3LA 2IX3A 2V9PA 2J0SA 4BVEA 3RLFA 2FMXA 4B7AA 1XTSA 2PY6A 1ZCAA 3K6RA 3D8UA 1V7CA 3K4PA 4I1VA 1NVKA 1RWKA 3GZNA 2BKEA 1ADBA 4Q5IA 1YA6A 1PUJA 1UCFA 1U0SY 1A2BA 2OLEA 4LJSA 4A6XA 4YMTA 3FDXA 4Q37A 2H2GA 4FFBB 3ETGA 4GLLA 3ZWBA 3U81A 821PA 3LYLA 3ZQ4A 5EEGA 2D1FA 2HU7A 3AEYA 3LKDA 3M9XA 3CX6A 1NOJA 2GBFA 3UV3A 3V1NA 5I3CA 4I08A 2O3JA 3SE7A 4ARZA 2ZSBA 1V16A 2HLDA 3AEUA 4QODA 4QDOA 3P9RA 2HMTA 3L2OB 2H1SA 4IIDA 1NLYA 3PJEA 3ZGVA 4DR2B 2IS6A 2AFIA 4I7EA 5IBPA 2XE8A 3H86A 2OBYA 3A4NA 4QG7A 5I9TA 4MVJF 2R1ZA 3BXZA 2REQA 1D2EA 2CFTA 4HPWA 3ZXIA 3F3SA 2NU6A 4P5EA 4FP9A 4YJKA 3VPDA 3MRSA 4XARA 5JE8A 3FZQA 1SCUA 1YJ8A 2XCLA 2LTAA 3JQAA 4L6AA 5FV7A 4MB2A 3UY4A 4L72A 2V7UA 4ERXA 2D62A 1KBOA 4I19A 2RC5A 1SVLA 4LF4B 1PJ8A 1YK1A 3MELA 1JALA 3FAZA 2NXNA 4P36A 3BWYA 3I05A 4B17A 2J32A 1YVRA 3KTDA 4LYDA 3QLUC 3NKVA 4GD3Q 5AI0A 3OF2A 4Q4HA 5TQ2A 1PO7A 5BRJA 3DOHA 5BWMA 1GRCA 2C97A 1FFCA 3K73O 1YTUA 3GCWA 1K7CA 3HN7A 3C0KA 2Y1DA 1IVNA 2I1VB 1AB5A 1NZJA 4UTZA 2B98A 4DAOA 1A9XB 4V0RA 3X1MA 3HA2A 4RHCA 1HOXA 1JXOA 2ALJA 3BSFA 5KSZA 5GJBA 3FTDA 3RVRA 3N3AC 1U2DA 1JR2A 3BRSA 1XNGA 1SHTX 1FOEB 2OWEA 3D8RA 4L9AA 1DJNA 1JXMA 4LOKA 5FPYA 1QIMA 2A9KA 3GRFA 3TTSA 3ADCA 4Q02A 1ZIPA 4DY4A 1KJQA 2JCVA 1VHLA 2JGMA 4DDUA 2AL7A 2GZSA 2XWJI 2JGFA 1WXEA 3OZIA 4LXYA 3VPBA 3RAEC 2O8DB 5CD9A 2XCRB 3SHFA 3LLUA 3U6BA 1GN8A 3KYJB 4DV6B 5BWCA 1L7BA 1MOSA 4URWR 4EA7A 4BXOA 2Q4DA 1XJQA 4PFJA 1KDVA 3DBLB 3D5QA 1AQYA 4RZXA 2CXSA 2WKQA 3I8XA 4PG6A 3UOWA 4AJ4A 4ALMA 5BMVF 5KYNA 4NV1A 3NAQA 4MP3A 2W6ID 1TPZA 2QS9A 1E8DA 3UJPA 5ER6A 1SCDA 3LX6A 4FC6A 1RHJA 3KQQA 4Y67A 4R0NA 1YVPA 5IJXA 3PHCA 4LJKA 3N74A 5DP2A 3ZY3A 5BR4A 2JLVA 2VA9A 4C2BA 5L45A 1O6FA 1TKAA 4J9UE 2G9VA 3WWZA 4DLNA 2IHZA 2VSXA 5CVJA 5IM5A 1RP7A 4J0QA 1YI1A 1ZD1A 2EJWA 2HK6A 2PSFA 4JX8A 4XTCS 3WGOA 2GEVA 1QKJA 2JFFA 3RSHA 5EJ5A 1YE8A 4OREX 5FUMA 1Z74A 2NX2A 2OVBA 1Z38A 4L6CA 2D5BA 4R84A 1U28C 3IO5A 5FBQB 4CM6A 3EDYA 1PR3A 4YRTA 3WWYA 3GEBA 2Q6LA 4U4AA 1SGWA 2GAAA 2RH5A 2WSBA 2Y0BA 3DVAB 5B1EA 2H92A 4IOMA 3RC2A 4KJXA 4CJXA 4UNNA 4QJIA 3VJRA 3BXPA 5KPJA 5K3SA 2YY6A 5DZSA 4CQJA 2B8JA 1CB0A 2ASVA 2VF7A 3A7DA 2BCEA 1JLSA 4IS3A 2NXEA 4UCFA 1A1SA 1U8FO 4BZWA 2GPSA 4AQ7A 1YB1A 5CJPA 1WMFA 5HIKA 2CVQA 2YOGA 5JFOA 4KQ9A 3HCPA 1TCUA 2HSJA 2EFHB 2D7DA 2UYOA 5ENVA 2ZCUA 3NOQA 4N12A 1YE3A 2NZ2A 1MO5A 2CLDX 2I67A 3T0FA 3J81A 3RUHA 4CG0A 4MKFA 3NASA 1E1DA 4RJKA 1XDUA 2D3TA 1JW9B 5KYYA 3AR8A 2JJ8A 2J7PA 1P8AA 1Y34E 1WCV1 2CVPA 2R11A 3CE9A 3N9IA 4RELA 2HDOA 3JQBA 3KYBA 4BECA 3O3MB 3T06B 1E3JA 1GRNA 1JSLA 3WICA 1TQ8A 2GSDA 1HTBA 4ZO9A 1A71A 5I9LA 3JALB 1SVKA 3RHSA 2QHXA 3MILA 3T99A 3K0EA 4GBGA 1OYYA 3NIBA 1DP4A 1NC3A 3WS7A 1Z0JA 4LGYA 4U7GA 3K70B 1ODJA 1QUEA 3A6FA 3UKDA 1HV8A 2P2CA 3AVYA 1KFCB 1QHHA 4YJ2F 4CRWB 4D74A 2C4VA 5F5NA 1H2ZA 4HX2A 1ESEA 1R8SA 2FZCA 2OC9A 4GMGA 4A8JB 2R1VA 3QFSA 1X8JA 5FR1A 2FR1A 4A1FA 2YFHA 5IC5A 3K9WA 2HA3A 1PDWA 1NN1A 5BSRA 2Z8XA 4IM7A 2OB2A 5DW3A 1YR6A 1OXVA 1A98A 3NTRA 3L82B 2UZ1B 2ZWAA 1N3LA 4RMHA 3LPAA 2DKOA 4NG4A 4NQZA 4PX5A 1E1RD 3VSBA 5F7OA 1AMUA 3W8FA 5ITWA 3HZZA 3QLVC 4MIEA 4N0DA 3Q1LA 4RLHA 5ESWA 3UAYA 3KQNA 2I4NA 1SWWA 1JNXX 5B7QA 1IUNA 2O7QA 1BCRB 1T2FA 3O8NA 2AR9A 1ULUA 2ZUTA 2I8LA 1P91A 1EE2A 4J7UA 1SC6A 5JV5A 2XWSA 4KXVA 2J3HA 1DGQA 2WJ4A 3A3OA 2OCIA 2GGSA 2OHVA 2R3SA 4YMWA 4WHMA 3SYKA 1KEKA 5E1DA 3IELA 3LRPA 3HA3A 3WGIA 4JBHA 2K2QB 3U4AA 2YYSA 5BY2A 1QGZA 3L02A 5TVGA 4XOIA 1K4MA 2R6R1 2AR0A 2YWJA 1Q50A 1HG1A 5I51A 2O2EA 2HIAA 3WLPA 3WAKA 3GLVA 1VKZA 4QNMA 3THOA 1DXQA 1Z5NA 2DUWA 3DEIA 4V1CI 4FJ1A 2DPXA 2OFPA 4I66A 2WM2A 4OGWA 5H80A 4Q1VA 1IULA 4CDMA 3WBJA 2OCLA 3RYFB 1EX9A 4UTVA 4CUJA 2O05A 2XUAA 1ISFA 1Z22A 2CJWA 2C31A 4PZLA 3TLJA 1Z2CA 2DBYA 2HCTA 3RSQA 4NI5A 2FG5A 4MUIA 3CGWA 5JDIA 3PUKA 3A9CA 1QMGA 3L7NA 1U8EA 5AKIA 5J23A 3RU9A 3RNLA 3ZU2A 1PHPA 4DM4A 2Q5LA 1YL6A 4OH7A 3PIIA 4LBZA 4RSRA 3RKSA 2WILA 4OQFA 2CEKA 4RFVA 5IMSA 2PZJA 2G5CA 1D5CA 1SA0A 5AO9A 3VU3A 1F2TA 1DAOA 1R6UA 2J5QA 5D3MA 4HQRA 3OJEA 2PLFA 1XL0A 2R5NA 1SC1A 2ZBDA 5EMJA 2GZ1A 1SB9A 4FEGA 2WYHA 3V3KA 1NJFA 2P9YA 4E94A 1KIAA 2GXQA 2IE0A 3ILVA 1EMDA 4LN1A 3RTDA 3ZLUA 2VNSA 4J0IA 1XKTA 4J0CA 1NT4A 2QX9A 4DGQA 4Z7JA 2BYTA 1AX9A 1UOEA 1SK9A 2HRZA 4IJ6A 1ZGJA 2H7VA 4LE1A 4M21A 3ELBA 3EIFA 5K09A 4ZRMA 3NCTA 3GG9A 1DRWA 2HBRA 1TMOA 2R751 3GFRA 4WLUA 2AQKA 4NSNA 4OH1A 1LDNA 2BMAA 1IMJA 4GKAA 3RFFA 1QHXA 3CBQA 3QE0A 1I0LA 4IV0A 3IE1A 4RHYA 3EZNA 4UE3S 2WWFA 4N4AA 4OFXA 2ZJFA 4HGYA 2EF0A 3E0XA 3ZX5A 1EUCB 3QPBA 5HKBA 1DO0A 3DDWA 5KJ1A 5EQJB 3SD7A 3NBYC 1I7DA 1C9NA 4O4LF 3TDMA 1J49A 3HVJA 4JGIA 1Z0ZA 5AW6A 3JQ7A 2Z0MA 3MPUA 1H5NA 3ENQA 3A9VA 4R0VA 3VDMA 3WG9A 7AT1A 3SJBA 3DE4X 3TYXA 3C7AA 4IKOA 3L7OA 4WL0A 1TXGA 3UQZA 1UAGA 4YAJA 4Z49A 1P4AA 3GFGA 3KXPA 4NL4H 4WESB 3V8PA 1WNFA 1U65A 1TD1A 1PZXA 2W6QA 4LYGA 3RVJA 2B7BA 2NZ8A 2ZBPA 4MA5A 2XR1A 2B4AA 4MW4A 4UC0A 2XITA 2P2NA 4X44A 5ADUS 4O4HB 2CXHA 2Q2VA 3SNKA 1SXHA 1KNQA 2EJTA 5A06A 4QFCA 1JKXA 2ZJ5A 1DX4A 3CUTA 3JAWA 4NX2A 4MI3A 3RASA 2QRPA 2HSDA 4DA0A 1YZQA 1DRJA 3WK5A 3OCWA 2WWTA 2YHIA 3HXLA 1PEYA 3PFHA 4IJWA 4B6OA 3W6OA 4HGNA 1V1JA 2C2YA 1GQQA 2JFWA 3GAAA 2OCYC 1AZLA 1W581 1D4AA 2HJSA 3WIOA 4KUEA 3O82A 4YIKA 2AFIE 2JDID 1FJ2A 4DQKA 6GPBA 3W5DA 3VTFA 2W4IA 4TS9A 4L0QA 1NSYA 5FTKA 3PE4A 1A7KA 4TZ0A 2J33A 4E3ZA 1CDZA 4IMPA 1SZDA 5F78A 5HIAA 3AHEA 3DM9B 4GKKB 2FUG6 4HXEB 2HU2A 4RVUA 2B0CA 8LDHA 1NNI1 1XCJA 1GT6A 2Y8EA 3E1GA 4BDSA 3ZDZB 2Y2UA 2H3EA 4NRDA 4BGDA 4LV6A 1B3BA 1JU3A 3ESDA 4YXWA 4DN6A 3X3HA 1AA9A 2Q6KA 3TLYA 4EGCB 4QOHA 1I01A 5BT9A 1CPYA 5JRJA 1BH2A 2QUKA 4HLNA 5GZ6A 4F7DA 5U4XA 1EHCA 3GUCA 3HYRA 3M1YA 3HCOA 4RA9A 4IWYA 1Q0ZA 4X1IB 2D2IA 3S3TA 1CG6A 3UMVA 3CN9A 3CJTA 5A3VA 1OX5A 2GKGA 4W6QA 1A8IA 3H84A 1TF2A 1WU7A 3OCXA 3QPVA 4TV8B 3K8QA 4W6ZA 3PR3A 4UDOA 3UM9A 3CF4A 4EKIA 1J5PA 4X3CA 1U7UA 2I91A 4ZPXA 4LSMA 3LBIA 1ZJZA 1GPMA 1XGKA 4EELA 3U3MA 3M4NA 5TXGA 4X6YA 1Z6TA 3Q7PA 4G8DA 2B94A 1ZWLA 1OQAA 2IHNA 2Z6UA 2D1RA 1P1BA 3QU5A 5ESRA 2QAGB 2D7CA 2MSDB 3D59A 4ND7A 1ID8A 4FOOA 2YZKA 3C3PA 4YXFA 1BNCA 3E8XA 3FDJA 4JC4A 4L2IB 5D5PA 4F6RA 2RBGA 4WA7A 3W9BA 5C37A 3PX3A 1XU7A 3OKAA 2C29D 2DXIA 3O1IC 1JAXA 3DP9A 4DG9A 3P2JA 3QEJA 1JI0A 2QP9X 4GE0A 1NG1A 5HQJA 2GRJA 4JP8A 4B80A 4ER6A 3KPJA 4I4CA 4H1UA 3N6XA 1VL1A 1X42A 4LJ8A 4TV9F 3OOYA 3OQIB 2JAQA 5CEJA 16PKA 1VL6A 4YRKA 3ABRB 1VG9B 1ZL2A 2VJPA 1Z16A 1K92A 4IICA 1EWVA 4JBIA 4L78A 1G18A 3ESRA 1QYDA 5C3UA 2M6LA 1CE8A 3W5HA 4YAIA 3EJ6A 3I9MA 5JLJA 2IBTA 1W4AA 3K4QA 2VRWA 5I9MA 4P32A 3I4FA 2XXAA 4WVLA 1PCXA 1UQRA 2PS0A 4MYUA 4GSLA 3M0EA 5F35A 4D3DA 5L53A 2ILTA 4AX8A 2YVAA 3MRVA 3H11A 4Y6OA 4DUGD 4D9MA 1KI6B 3O4FA 5D8DA 4LNUA 3MQFA 3NHUA 4OMFG 3W1VA 2FWRA 1VIVA 4MX8A 1L5WA 4ZAGA 4B3BA 4D8WA 9ATCA 1C4WA 2HWXA 4J7AA 3D3WA 4HAXA 4IKPA 3FPBA 5EJEA 1JZQA 2NO5A 3NQ41 1H1DA 3M3PA 2BKAA 4NDNE 4R7GA 121PA 3R7BA 1Q14A 4Q9DA 3WB9A 4GI2A 2XDAA 4PNHA 1RWMA 3OUZA 4EJ2A 5HBRA 3SJZA 2GJ9A 2X14A 5DX8A 3REOA 3I39X 3AIIA 1J9EA 2F1RA 1JHPA 4EBFA 2C7PA 2GAFA 4B7CA 1D6SA 1JBEA 2XQJA 2VA8A 3WSTA 4FR5A 5K4HA 2ON6A 3IFSA 3WLRA 1W73A 2ZJ8A 4PG4A 1L7OA 1N57A 1W34A 4KB5A 5DYIA 5AI5A 3WNDA 4OU4A 5CD1A 5L3RA 1R8XA 1W96A 4PLZA 3WK6A 2ZRHA 1T24A 3GT3A 2CDNA 2C04A 1RZ3A 1Z36A 2I34A 3KQTA 3NWEA 5DE3A 4BUCA 3SQWA 3M1AA 1ZSNA 4D80A 4JKIA 3VSDA 2I87A 3C3CA 2WHEA 2DHQA 1RHQA 2JKYA 3RFCA 2JCBA 2COKA 2XB9A 3BZBA 2IS2A 1R0XA 1V9SA 1KQ3A 4XFKA 2DHCA 2C4NA 3AY3A 3K09C 3IIJA 1SELA 3R3WA 3QUQA 4G1CA 4HRAA 3FJ1A 4G1UC 2B8TA 3GJSA 3CE6A 1XA0A 5INTA 3M3DA 5DYNA 1YKSA 4EIWA 3PNVA 1OE0A 2K7ZA 3BA1A 3OLWA 2C8KA 4Q39A 1G60A 5EPOA 1L7PA 5JXJA 3G9ZA 3E03A 4QYSA 3OX2A 4J4BA 2VJBA 1NQVA 3RYHB 4TM7A 2ZJ0A 5K2OA 2P9BA 3OZFA 3T7TA 5JS6A 1SK8A 4EAQA 3KJEA 3LW8A 4OXKA 2VAPA 4FMCF 2E85A 2WA2A 4GUDA 4FHFA 5KSOA 2EW2A 1CUFA 2J46A 3KYIB 4KHZA 5JJIA 1G4UR 5FYDA 4L4ZA 4E4YA 2HFKA 5IEJA 3W77A 3L3BA 4X60A 4LY9A 5LXTB 3NBQA 3QKRB 4HFRA 1EP9A 2VXOA 4BN4A 1ZD4A 5JIBA 3Q8WA 1TX4B 1VHDA 3HADA 1YJQA 2BE7A 3NYIA 4X7MA 4YJFA 1OROA 4R71A 2GJ4A 2BJHA 1PWZA 1Q1EA 3L6EA 2QNBA 2HO4A 3AM5A 3K0FA 4KKXB 3UEOA 1PWXA 3GUUA 4OJYA 5JRDS 2YTZA 3L6CA 4I0WB 1KDYA 4YYZA 3GJRA 3ELYA 4KQFA 3ZQ6A 2H4YA 1SUBA 2QMUA 1G63A 3QOWA 4MUHA 1RRKA 4R2IA 3TL6A 2ZTLA 4N5HX 4F2GA 1JA1A 1EVZA 1MU0A 1ODSA 5PNTA 3E9MA 3UV7A 1C5KA 4F5DA 2DQSA 5IJ0A 4Y0VA 1TGVA 4KXMA 4L3WA 3TR0A 5IFKA 5KTRA 2BGTA 1NNSA 1GGJA 5B12A 2WTNA 4R1UA 5HRAA 1RC8A 1P2GA 1T2VA 3R8XA 3AHGA 3OEEA 1A04A 2WIGA 2MSCB 4E32A 1UZUA 4CFZA 3OTWA 5T57A 2WJPA 1J5EB 2BOVA 1Z15A 3D4BA 5A03A 3HU1A 1U2QA 2WJHA 4ARIA 3CW9A 2QVCA 4X8HA 5G4KB 1HE3A 3BKWA 2DAPA 4JEIA 4KAFA 4L5JA 4DPKA 1XEXB 1WG8A 4FFPA 1QORA 3B2EA 3QVVA 2QJFA 3RIHA 1R0YA 4HTFA 3OIUA 4J16C 1NQ5A 4BMYA 1P3JA 1F8XA 2FFRA 3JQ9A 3JD4A 2A59A 4UE6A 4DR4B 1FW8A 1XE3A 1HK7A 2IHYA 3O5AA 4Q93A 3SS7X 2XUIA 4PZEA 4NEGA 3RTEA 4AMUA 1QR6A 4ZT7A 3RAPR 3SEQA 5FUYA 1U2GC 1OTXA 3CRNA 2EZTA 1FRNA 2R97A 1Q0LA 2P41A 3TQHA 2O8CA 1C1HA 4PHHA 4X3OA 4XASA 3U9LA 4G4SO 2YQZA 4Q15A 3SS9X 4OJMX 3N2KA 3VU1A 3M9WA 5ECGC 3EF1A 2X0JA 3OQHA 3V4ZA 2WINI 3JVEA 2GEJA 5JPIA 3F6BX 3COPA 4PQFA 1U0EA 4MARA 3G7UA 5EE5B 1E6EA 1GQSA 1TC2A 2HMUA 5ENZA 4TLLB 1N4DA 4C05A 2FSHA 2O3UA 4HNUA 4G4GA 3AF5A 3OJLA 3ZHVA 1WSDA 5H82A 4G4JA 2VHQA 4UVGA 4OY3A 3LIIA 1M8PA 1QG6A 1EK0A 3BRQA 2H1HA 4CCAA 3WSVA 2W2NA 1MJGM 3KALA 1JFFA 3FPFA 4XM2A 2CMDA 5HJ5A 5CIWA 3DV9A 2P6UA 1YQDA 1QFXA 2ORWA 3B3QA 2Q0QA 2OORA 4OG2A 3LWNA 1OA1A 3IT2A 3LYHA 1L5LA 3IHLA 4BVAA 2O7RA 4DADA 3NETA 4HDCA 3RV4A 1GTL1 4OGLA 4PBSA 4QXRA 5REQB 1WBJB 3RLIA 1C3EA 5ALUA 2VBIA 3IEXA 4IIHA 1KAHA 1XQWA 4FXPA 1NONA 2YUTA 3TFQA 2WMYA 4NMLA 1LS1A 1WHSB 1E5TA 5AUQA 3SX0A 3LP6A 3V33A 4IHJF 5HEKA 2FSUA 1AMNA 1DIHA 4N40A 2DWOA 2QU7A 4M3NA 3I1IA 1VYVA 3D1JA 1RJ9B 1HDYA 1PJ4A 1RWVA 3FYUA 4MB0A 4AJPA 2N0SA 3VYRB 4YJGB 4EUFA 3RC1A 4HQFA 3KSDO 2UKDA 4FEEA 3LC1O 5EQDA 1MX5A 2VXCA 4RQUA 3DHEA 4N01A 5I8PA 4NNPA 4IDAA 4WN9B 3GMDA 1L1RA 1Z75A 3TCNA 5D3QA 3TLGB 4RXUA 5KOYA 3BILA 1WUYA 3W8NA 3Q3HA 3N6VA 4BNKA 1RHMA 4IIJA 4HDAA 4WNYA 1Z8FA 5KQLA 3FR7A 5BNTA 2J3KA 1VPEA 3DOFA 2JKVA 3ED1A 3MWLA 2E4XA 3GJ7A 3GNSA 1VP3A 4HDMB 4JD5A 3SFTA 4C0KA 1XVVA 2PXAA 1OJLA 3EISA 3FPLA 3M5DA 2YRXA 4OEHA 2JVKA 1D2AA 3LY8A 3VSCA 5K6AC 4OQYA 3G5LA 3EGCA 4JJ7A 4P6VF 5J2TA 2DBQA 2R1UA 2IT1A 3G2MA 3GEDA 2AOTA 3I83A 3P32A 4BQEA 4Y1FA 1J4AA 4D9IA 2RKWA 4EHAA 1XD9A 2VIIA 3FSRA 2XD9A 2LUOA 3ICWA 2P9JA 3RUCA 2IGTA 1Z45A 3EVTA 1O6BA 3PJDA 1H0SA 3EWIA 4HEA6 3TLXA 3HXMA 2I6XA 4OQEA 2GZAA 4MI6A 3TG2A 3N5CA 1YONA 3I4LA 4RWEA 3S81A 1GNQA 2V5UA 3HDTA 4JENA 3VOBA 4BWFB 2PO7A 3P0JA 4RPJA 3PHLA 3QF4B 5GOTA 1M2OB 1TJ3A 3KCNA 1ENYA 1RXYA 1H42A 1SOUA 3OLVA 5P21A 3ZHBA 1L6IA 4ER3A 1F8YA 2XAUA 1NPYA 1LK5A 4K9SA 1RLMA 4JOQA 3VH2A 2NU7A 1PWEA 3TZLA 3OD5A 4AJNA 4XCVA 4C08A 1I3LA 1OSNA 2QZPA 3AX6A 4TX1A 1QS0B 3P5SA 1L7QA 1NJ6A 2ZPTX 1Z4LA 3ANMA 1Z8HA 1S02A 1Y4UA 3ZWPA 3BAZA 1C29B 2WZQA 5LYJA 1ZNQO 1JX6A 4IJQA 4MUNA 1OI3A 2YW2A 4EPYA 5B7PA 3DMRA 1J5XA 3OIDA 5FOSA 2IF0A 1R74A 2C78A 3DT6A 2I4IA 2VDUE 1IBLB 2C3UA 1XMXA 1SNYA 1TE2A 3E22B 3T34A 5JOQA 1KRHA 1QO9A 3DHNA 1EB9A 3OQ1A 3ZHTA 5JALA 3H9JA 1TVMA 4RQBA 3ZI4A 4J6EA 1NW3A 3JR3A 2HXGA 1EVLA 1N6PA 1IPFA 4I4TA 3ZCPA 2BMJA 2VYQA 5IZCA 3FOFC 1NUTA 4DLYA 3DYIA 4J0HA 1BE6A 1BDBA 3L6BA 4Y1GA 1LU9A 2RFLA 3D4IA 2QAIA 3FSGA 4QDTA 3TOCA 2YXBA 5C9ZA 4XB6B 3G9XA 3OZXA 2QBYB 3EIOA 3P45A 4GRAA 1P1JA 1N2BA 1FYFA 3PENA 4IW3B 3ADOA 1F1JA 4NWIA 4GM4A 2YV4A 4P3OA 1HNZB 5T5QA 4HSGA 1MC4A 5E7IA 3IC5A 4ABTA 3JD2A 4RZ3A 3L43A 3WLFA 4I5EA 4A8PA 4AJKA 3GA5A 2OENG 4R2HA 3PNLA 3ORQA 1VB3A 1CNMA 1ACMA 1GNPA 2QJRA 4EECA 3CLHA 2QUIA 3TSZA 1RRCA 2ZYIA 3ISJA 1CRWG 3ZZUA 1MDBA 1JKJB 4RYLA 1US8B 3VU8A 3HLTA 5DM0A 2YWRA 5HBGA 2IS1A 2AVDA 3D3JA 4DE5A 1OWPA 1Z2OX 3LNTA 3F6CA 5BN4A 1R4NB 3Q9SA 2LBPA 1TTPB 4X54A 4R69A 2V7GA 2ZAOA 3U2QA 2WWRA 5TV2A 3RE1A 4B43A 1XMPA 2BH9A 2ZBEA 4JODA 1D4ZA 4R05A 4ZT2A 4BQQA 3VJKA 3LBAA 1OFTA 2OC4A 3ID6C 3EASA 1QIFA 1P62B 1C1YA 4DNXA 4HH4A 4M8NE 3WKEA 5AFSA 2P79A 221PA 4JQOA 1NN0A 4MTCA 1VGVA 4R81A 2NU8A 3V4SA 1GQYA 1XLTC 2W2LD 4RZ2A 5C32A 3WQBA 2A4MA 2VTVA 5FTMA 5FNVA 3TNLA 3L07A 2R65A 5EMHA 1PNQA 3W78A 3MB8A 4PR3A 1PE0A 3QU7A 4YX9A 4S0XA 2PXHA 1WAMA 4KO2S 3QSYA 1IJFA 1NDQA 2F43A 2H4FA 3ZZ1A 1JR3E 4OFZA 5ELXA 1XTVA 4FGLA 3OU7A 4I99A 2PX0A 1JDVA 1IN6A 3IV7A 5ANRB 3T9DA 4FI3F 1V6CA 3IIEA 5CBKA 2QN2A 2ZFUA 1QKIA 2A5FA 1MQAA 2I29A 3L7IA 5KOHB 2WYVA 3CUVA 5IDWA 4JLOA 3AWIA 4JIMA 3D2LA 3HCRA 1JG3A 3PGLA 4L4YA 3U3OA 6ADHA 1PL8A 4HAYA 3LAWA 4PQEA 1LPOA 3IPLA 4CLXA 1IUKA 1P2UA 3PWTA 3ANNA 3JU3A 1UJ6A 3KJFA 3ORFA 4KC0A 3GRYA 4MW7A 4RCZA 4RIFA 3PQ4A 1QIGA 3KPWA 4P92A 2WQ7A 1JPJA 3L0CA 2O2CA 4HVTA 2OK7A 4LJAA 4DCJA 1E32A 2IXFA 2DX7A 2OZVA 4Z1MD 3ADPA 3ZZTA 3G88A 5C1OA 1HFJA 3DBRB 1R7RA 3GHYA 3HG7A 3OWHA 1I1NA 1ENZA 4B9EA 1A5SB 2GZDA 4I5DA 4KFRA 4QO7A 1NVTA 1W0KA 2F67A 3HKCB 1N6HA 4Y7DA 3NBKA 1G38A 3RWOA 1XZNA 3OCCA 3CIOA 2YZGA 5EIFA 5ITZA 5HS4A 2YYYA 4N03A 4WT7A 4HYTA 1N5KA 4UBJA 5EGNA 4LZAA 5AM2A 3ET5A 3EFBA 1U1IA 5E0OA 3JQDA 4UAUA 5KTTA 5CLIA 1PK8A 1WB5A 5AVOA 3NEPX 5IXYA 4QPDA 1QCZA 1V43A 3BICA 1Q7TA 2NAFA 4TXJA 1A8UA 3KEGA 5KWEA 3R0XA 3SLGA 1IEVA 5JJ5A 4HXGA 4MR9B 4LDJA 1Y98A 1QFMA 1T3HA 5FKJA 5T8KA 3ROXA 2XZLA 1Q1GA 2IHVA 4D3FA 2QXTA 2G8NA 4BGVA 1HZJA 1WOYA 3WA7A 4DHWA 2C42A 2X5XA 4I4LA 4QGSA 4HLCA 4LSGA 3OAAD 5AVVA 2IPOA 1W9MA 2GMWA 2JFHA 3IPXA 4WW0A 3IAFA 2PJZA 2J0UB 4UHDA 3A3PA 1XTKA 2YZ2A 1BOOA 1NY6A 4K86A 1Q44A 3ZGOA 5FADA 2AZMA 5CYGA 1RQNA 4YDSA 3JZDA 4JBXA 5FBRB 4KHPB 3QPAA 1BROA 3HZRA 3EZYA 1S01A 421PA 2WTUA 2ZXEA 1PS8A 2LE0A 1U8XX 1XPOA 2XMBA 4OB6A 5J1TB 1FBTA 2YIJA 3IMKA 1SG0A 2UVPA 3ZEAA 3H9CA 2R68A 2VAMA 4PRZA 2JEOA 4TUYB 5ILGA 3EQ7A 3FGNA 1X2BA 1BFKA 4XOUA 4YFVA 1PG0A 4WGGA 5AKXA 4AY6A 1ZJJA 3E5RA 3NEAA 2JZCA 4BCCA 1R66A 3K6JA 4M38A 3VZCA 3FXAA 4CIXA 1EU1A 4KSBA 2A7XA 3SF8A 3U7GA 2YXEA 4OKNA 1Z0KA 3O4RA 3DO6A 2D2XA 3DAYA 3EXHB 3R5XA 2NP7A 2Q5QA 4K7JA 2WFAA 4L76A 1P1KA 2C5LA 5SYMA 3LRXA 1F14A 3GLRA 3CX8A 4REQA 4E46A 1YZKA 5ILQA 3KDPA 4C0HA 3T7SA 3U49A 2O48X 1KI1A 2ZR7A 3NM6B 3UJ9A 3PGXA 1TVCA 1RLIA 1NFFA 4OHYA 1O94A 2JIZA 3EXG2 5TC4A 5IPFA 4Q4JA 1UM9A 3E61A 3TIGA 1CKEA 2NSYA 2RIRA 3A36A 4B4UA 4BZZA 1GAXA 4WJLA 1PFYA 2QTCA 5CYFA 1G8FA 1LBSA 3SYLA 2GK4A 2QRZA 3C85A 2PGIA 1NVUQ 3ZWOA 3KYCA 5K03A 2X22A 4MWGA 4K0RA 3TGPA 2DEUA 3M4XA 3REFA 2FX5A 1X7YA 4FILA 5JANA 2P9FA 5DLEA 1J0CA 3MVEA 1SHLA 4PHCA 1KVTA 4J1NA 1PV1A 4RTMA 2CYBA 2YV3A 4LPSA 1PV2A 2FPMA 2N47A 4UBMA 4E14A 4D44A 2DFLA 1LNZA 4YRCA 4DSOA 1MO6A 3AF1A 2RGWA 5A9SB 3OQ6A 4DQUA 1X92A 2CJXA 1PQYA 3OLCX 2GFQA 3DZGA 2QRMA 1N9ZA 1E2GA 3HB4X 4HDKB 1LBHA 4WXHA 1FS6A 4AP5A 1XU4A 4EM6A 3MCAA 1FU4A 1M74A 1TUIA 2VDNB 4L5CA 5K3CA 5JZMA 2V0GA 3N2IA 2W6JA 3ZH2A 4R3UC 1P73A 4ZU1X 3H17A 1O5OA 1USIA 4UATA 4C4TA 3QEAZ 3FJYA 3DMNA 1BMDA 2Z04A 4G5OA 2PWAA 3U7HB 4BQNA 3OA0A 5DHRA 3FUXA 3C3KA 1QOQB 3K0AB 3MLBA 3NIDB 4FYYA 5AI9A 2OQIA 1I51A 2JBAA 1VMKA 1RKUA 4UQPA 3ZIUA 4BNXA 1PFVA 3SBOA 3ZZMA 1W36B 1M8FA 4PICA 2XXBA 2W11A 2JI9A 3KIPA 3MK31 3AUAA 2ONYA 4P4SB 5SY9A 1XRMA 5SZHB 1BKYA 1DCKA 4GOOD 4QUDA 5HQ3B 4RK6A 1NW5A 3MOSA 3IEKA 3NHLA 1XD2A 4LX0A 2JFBA 3A6GA 3ZGLA 2QTTA 3NHYA 3OKPA 5JS7A 3JATA 1RZVA 3T5PA 1ADFA 4TMYA 4JGGA 2GM9A 1T4GA 1T1EA 1TVKA 3AERA 3I62A 1XJCA 3MFYA 1Z5OA 4BEVA 5I5EA 1D03A 3I64A 3SX2A 3U09A 3AR9A 5KTKA 4XWYA 4TMWA 3RS5A 3WQSB 3KT6A 2CHVA 4M0PA 3G0DA 5B37A 1OX4A 3QEMB 1Q84A 3HVKA 3BK2A 2GZMA 2HAEA 2D5IA 3QYPA 1U1FA 4GQBA 5ICFA 2VYND 1KH3A 4JT9A 4D8YA 2AG5A 2OK8A 2QQFA 2H2HA 4DLBA 2QR5A 4N5MA 1QVAA 3R0IA 2IH4A 4CEJB 5FTJA 4PSAA 5ALOA 4J1QA 4Z2AA 1TM5E 2VDOB 2HH9A 4R9NA 4YP0A 3L8DA 1LSOA 1E7WA 2JFZA 3EFOA 4IO0A 5JH7B 5B58T 1YNOA 2NUPB 4OL0A 2VCHA 3CRVA 3OMXA 1WB4A 2RHBA 5FAKA 3DONA 1NMXA 3H2KA 2ATXA 5G41A 1VIDA 4KQWA 5AXCA 4BIIA 1U3GA 1T8SA 1OTHA 5LFAA 4WZAA 4LIPD 2P6RA 2QUAA 1A9ZA 5TDHA 4DY6A 1Z0AA 4N3BA 3ZDBA 2NNLD 3SEFA 3K5WA 3ED5A 4BTVA 1M72A 5J43A 1PT5A 3COVA 4FIDA 1SKYE 5ALHA 4I55A 3W2IA 5BUZA 2HJHA 4WNAA 3D31A 3D7RA 3S5UA 1ZYUA 1XOIA 1IXZA 1DTSA 1MNQA 3GRUA 2XUHA 4XGNA 2R8PA 4G85A 1TT7A 1A95A 2HJRA 4LE2A 5AK0A 4V0MA 2XUKA 5HJEA 2R4UA 1GTRA 1XZIA 5FXMA 1T3SA 2DWCA 2VS1A 4XIFA 2OSBA 4KYTA 4AIIA 5BSWA 4P86A 3O21A 1UJCA 1AZTA 4WK6A 1X1QA 1TEXA 1AUPA 1RQLA 4JU8A 4DIDA 3D6AA 4EO7A 2P9TA 3CA8A 1SCBA 3AXSA 3NHRA 1T5TA 1IXRC 1TDJA 3ZOKA 3NTOA 1E2UA 3DCIA 2ANCA 1Q0QA 3E70C 3AB3A 5LBIA 1Z9BA 1NI4B 1PBNA 5LIRA 1HLFA 4ZJPA 2AUTA 5DYWA 4JJ6A 2Q3FA 3PUXA 1DFHA 5DISB 4QULA 4PZCA 2VZEA 2ZJYA 4E5SA 1Y3FE 4JNKA 1G41A 4G5HA 3K92A 3TGWA 5F2NA 3FCSB 4KLNA 1TJYA 2G6BA 3S8MA 3TI9A 2V7PA 1YQWA 5CJJA 4V0OA 4RCVA 3TZEA 1I36A 2ZB7A 2XT9A 1FDSA 1PJSA 1V9LA 3ZBTA 4ND2A 2EZ8A 3EG9A 4M49A 4B34A 3BTOA 3QLUA 1FIUA 1KO4A 1P2VA 5K99A 5BUSA 3DYVA 1JJAA 2FGJA 2BM9A 1HYBA 3K2BA 2AQHA 3MAGA 4A2QA 1V95A 1ODKA 5LMNB 4WK0B 2A5YB 4M8IA 2VSOA 1IVYA 4P84A 5EIBC 1M1YA 4V24A 1QO7A 3V8NA 1AHHA 2OHGA 3IEUA 4IEIA 1WTCA 1RLOA 5F2KA 1A9RA 2FE4A 1OD6A 4G0XA 2ZBGA 3T15A 4FMDB 1VMEA 2NO7A 4O3FA 2GK7A 1E79D 2I78A 4QFMA 3ROZA 1IPHA 2J3DA 3ZN2A 1W7AA 3ADKA 4MDHA 4ZGWA 4EFLA 1C1XB 1MX9A 1NQXA 2Y0PA 3ESXA 2P30A 3MSXA 1CY2A 1MLDA 2I2WA 3KWJA 4LKRA 3O8OA 1SVWA 2QRVB 4UD2A 5JNTA 1WZ2A 2XQFA 2YHAA 1A77A 2WIAA 4BZPA 1ZH4A 1ADCA 1IJKA 1D0VA 1VA5A 4CTOA 2FMTA 1DL5A 1VL5A 3JWIA 1D3AA 3OBBA 4CVNA 5KSWB 3HXTA 1JYFA 1YCGA 3O7WA 2FP3A 4W82A 1SD1A 1W85B 2PX3A 4FPXA 1JMVA 5H16A 5AJTA 1WCIB 3TVYA 1WW3A 3RT7A 3U3XA 3VKFA 3KETA 4CL3A 1JIIA 1YBFA 1UFOA 2A6PA 2IYEA 3HO1A 2O19A 5G4LA 1U31A 1XEWX 1GRVA 4IZ6A 5DMHA 3NXKA 3RS0A 2OM2A 4YYEA 3SU8A 4YALA 3AI2A 3HTXA 1ESNA 1PJ3A 2HRCA 3N0RA 1Y37A 4WV3A 2I6TA 1ONOA 3C2QA 4ND4A 5EXPA 2JH8A 1QTIA 1U28A 1ABBA 4GI3A 4OHPA 2W4QA 1B6RA 2AC4A 4JQYA 1H3NA 5AWFC 2ZTVA 1WABA 1KERA 3C5CA 2BDUA 3GT7A 4C4AA 5DGCA 3UH1A 4ZAFA 1RYZA 4XX0B 1QP7A 3IVCA 4DDVA 3IDAA 5K0LA 3VOAA 3U4CA 3ZG6A 2AYXA 4PZ9A 3WGMA 4OGKA 3B38A 3UUEA 1QJCA 1OX6A 3TW8B 3KOOA 4HLDA 3MMZA 3IKLA 2VF5X 1FFAA 2Z4TA 4KWEA 4M7RA 5DI9A 3SZRA 3VZDA 5HZHA 1A9SA 5T4BA 2RDMA 2BMFA 4MVJI 2WD9A 4I8DA 4PCVA 2G0AA 4IR7A 3W4JA 1A9OA 3LHIA 3WJ2A 1XWWA 4QVKA 2P0AA 2QG6A 3TFOA 1G42A 1ISRA 1JQBA 2WRZA 4X7BA 5EUQB 2IEYA 1IWOA 3VZSA 1KZYC 2ZUDA 4GKJB 2H65A 1R0RE 5MGBA 1UBUS 2DPGA 5B6JA 2W2XA 4GEGA 4GGMX 4X94A 5K45A 2CVHA 1PR6A 4MR7B 1R6VA 4DYVA 3HXOA 2AT1A 2OHXA 2FJPA 3L5KA 3TMYA 5BYKA 2JAHA 2VATA 1DAEA 3KFVA 4QBTA 5FBLB 4BE9A 1WF6A 3E9NA 2J8ZA 2AN5A 3FGPA 2I66A 4LFCB 2QN9A 5A9TA 3R6DA 4R1PA 3NKFA 4WFKA 2GCOA 4QBKA 2FQWA 621PA 3I8OA 1LF5A 4F38A 2G82A 2DPMA 3GLKA 4BVLA 3HL4A 4AWAA 3NV7A 3GGDA 2QM8A 1QGUA 3S2SA 3M6VA 5JJLA 3FCEA 2ONKA 1PZEA 3BMNB 1EJ0A 4IWXA 4P7KA 1HZZC 5BQFA 3L8CA 4IV8A 1Z08A 4OHCA 1AA6A 2QRGA 2X2OA 3LP5A 1EFTA 2FG7C 2KJQA 3JWPA 3LSTA 3EEBA 3OLXA 1I5EA 4KXLA 4LBWA 4QUJA 1KYIA 3IXQA 3A2KA 3BWDD 4AJ9A 1ZPDA 2YDXA 2R25B 5EE9A 2R5FA 2ZANA 4TVOA 1XZKA 1G98A 4JELA 2F9MA 3ILHA 1JYEA 2FETA 1KFJB 2YHUA 3I32A 3IT3A 4TSFA 4A0RA 4XYGA 5JCPA 4MV8A 2YC2C 4OCZA 2CDBA 4TV8F 2QSZA 3JWGA 4XSGA 2E4AA 4BX3A 2PD6A 3HN6A 3I23A 1QFJA 4HN9A 4WDRA 3BWBA 3IAS6 1B0UA 2CKDA 2I3ZA 5EZYA 3R9IA 2B8WA 2Y67A 2CFSA 4EW3A 5CG1A 2GM4A 4DQLA 2HMSA 5ALQA 3F46A 4M1SA 4GOKA 3HYSA 5ALFA 3QLVA 3DZ8A 4E5YA 4WOPA 2V98A 4JK3A 3CLSC 3NP9A 2QD3A 2EU8A 4L6IA 4RTNA 2NTVA 4E5MA 3TZ6A 1WMEA 3Q3IA 2OILA 4JVSB 1XVTA 3E3NA 4GBED 1WA5A 4TVKA 2IUUA 2P2SA 4C0AC 2E18A 3OF3A 1UPUA 2H8GA 4F9TA 1WULS 3CLRC 4MLCA 2NVUA 3TKAA 5K3OA 1K06A 1C30A 3OX3A 5K3FA 1KI2A 1R6TA 1UJMA 2NO1A 4LS3A 5C7LO 2PKXA 3KPUA 1FVHA 2F00A 2FRXA 1JJIA 1MV8A 3BZUA 1BFUA 5IFLA 4X65B 1EWKA 5IH3A 3R5SA 4W5NA 3N8IA 4DCCA 1N2SA 2XB8A 1PWYE 3CZ4A 4QGBA 1CB7A 1YJXA 4G0UA 4LQCA 3VNSA 4LJ5A 3UUWA 5B64A 1X1TA 5KTNA 5K4AA 2HOQA 2W00A 1IQUA 3CNLA 3USES 4IHKA 3O8LA 1XJWA 4WZBB 3P0HA 4RWZA 5BWOA 1ZH0A 2HHLA 2PRIA 2WW8A 1JEQA 2CLFB 2QZZA 4PBTA 5JJBA 1SXJC 3ZHZA 1UBGA 3N39C 2GTPA 3C87A 4QSHA 4C3ZA 3NGXA 4L07A 4RM2A 5EQFA 3TQCA 4IGKA 5DPMA 4PG8A 6LDHA 2CXQA 2PD3A 3BGVA 5AVWA 4ZARA 4G5GA 2C61A 4RVGA 1G0OA 2F9FA 4QRHA 4I1YA 5FOVA 4Q0MA 2YCBA 3AY7A 5BOSA 2BP7B 3NOVA 1GN9A 2DECA 4M37A 3GL9A 1E3WB 3VH1A 3C4VA 3ZWKA 1TZJA 2A9PA 3F71A 3ZNPA 5DM70 1CQZA 1H3FA 2MDTA 3JQQA 3BREA 5CB6A 2UUAB 2GK3A 4RPGA 4NMWA 5EUCA 4JI7B 3L0OA 1G3UA 4Q4AB 3BHNA 2VP5A 4KACA 4L50A 4IVNA 4UHHA 2GYUA 2NAPA 2VK2A 5IHXA 2CF6A 2NU9B 4NPAA 5FLYA 1LPBB 2GRUA 3JASA 3PFFA 3VPSA 1JHMA 4EX7A 2C96A 4OAOA 3UJBA 2VJAA 2OYCA 1VCOA 1P4HA 4TKUB 1OH7A 3KR2A 2E5LB 2JHPA 4D9HA 1NBHA 2GARA 1U0FA 3MT0A 2KYRA 1VXRA 2W7TA 1TK2A 1KJNA 4OXRA 1CHDA 3DXFA 3GBSA 4GOMD 1VGRA 5ULLA 1EQUA 1U3TA 1E3IA 1XR3A 2C1XA 2B1JA 4GI7A 2N3ZA 2I7TA 2R8EA 1U7ZA 4WI1A 1BH6A 3FPSA 1P75A 1WUJS 4N39A 2GO1A 3NALA 5CT8A 1FP6A 4O4JA 2NTEA 4E6PA 5IJAA 4L5YA 3GQBA 4GOND 2ZSKA 1XJ5A 2K7FA 3PPXA 5CR9A 2QL9A 3FPJA 3AJDA 3B5JA 1RQPA 2SECE 1ETUA 2V0NA 2WJAA 4HXYA 2CUZA 3UQYS 2A1TR 2QTAA 2Z2JA 5CNMA 3JZAA 4BFTA 4ZICA 4L4SA 2VQFB 4G86A 1R50A 1AV7A 1I3OA 4MQFA 1BEEA 2A0KA 2QYSA 1PUXA 2Q46A 2FNAA 3GIWA 3NH9A 3MT8A 1BTOA 1QK3A 1Q20A 1WDKA 2E49A 1YZGA 2G4VA 1OLUB 2EIHA 2L69A 4TQGA 4V0ME 3HDGA 5TPWB 1J07A 4PW0A 4N48A 2X9NA 3KC2A 2BUAA 3VR2D 2JA2A 1JG6A 5CVEA 4EZBA 1L1EA 4QT4A 1MF7A 3M89A 2A9RA 4MLDA 1XXHA 1WXXA 1P4RA 4KLRA