1MJ5A

Linb (haloalkane dehalogenase) from sphingomonas paucimobilis ut26 at atomic resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase
publication title Crystal structure of haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26 at 0.95 A resolution: dynamics of catalytic residues.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
total genus 112
structure length 297
sequence length 297
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mj5A00
2CKMA 2VEOA 4OB6A 2BCEA 1L7AA 4C4XA 1XQVA 5IH7A 1XKTA 1N8SA 3TGLA 3WWOA 1O6FA 2O2IA 4GXNA 2XUKA 1AMNA 5LZ9A 1FFBA 1UOQA 2ZYRA 4UBJA 2OPHA 4KAJA 2GYUA 5ALKA 4UBOA 2RIPA 1R3DA 4LYDA 1JKMA 4OYLA 2CEKA 3STUA 3IIIA 4BC1A 2O7VA 1CUGA 3CN9A 1L7QA 2DHEA 1ZOIA 5ALXA 4BE4A 4Z49A 4TGLA 1RYYA 4H7FA 1MJ5A 3DLTA 1A8QA 1UKAA 3B3QA 5FP0A 5FPPA 4CG2A 2JGMA 4Y2TA 1LLFA 4FWBA 4CIBA 4UHCA 2Y1KA 4Q05A 3G9ZA 1VXOA 4PSCA 3R41A 3F8SA 4H7KA 3M82A 1XRPA 2PPLA 2WUDA 4G9EA 3WK9A 4KR0A 1IUNA 2HFKA 1D07A 2BKLA 4QDXA 3ILSA 3T4UA 1ZIXA 5KREA 4CG1A 4H18A 1JMKC 2XUFA 3WYDA 4DMKA 5ALQA 1BCRA 1SCKA 4GI1A 1JJIA 1UK8A 1L7RA 2WU3A 2PUJA 2VJAA 2WUGA 1TCCA 5JAPA 3HACA 4J0JA 2XUIA 2H9YA 1BN7A 4PNZA 4KE9A 4GLBA 4WFJA 3WWEA 5AKGA 1Q83A 4HXGA 1CUDA 4K6GA 3AILA 5C7YA 5H3HA 2HU7A 4ZXFA 4X91A 4FHZA 2BAGA 3OM8A 4M0EA 3WIOA 3FLEA 3SC2A 1GQRA 5D3ZA 4LXIA 3I2HA 5JYCA 4MYSA 4Q3LA 3WJ1A 3H1BA 5C8VA 5JANA 2WFLA 2G63A 1YS2X 4JEIA 4ITVA 2I3DA 1CUWA 1LPMA 5E4YA 3W06A 4ZRDA 1YS1X 1GPKA 4RE5A 1ODCA 1BRTA 4L0CA 4BAGA 3I2FA 1ZD4A 2D0DA 4FMPA 1U4NA 5CH8A 4N8EA 1A8UA 4O08A 5AK5A 4H7EA 1USWA 1UOOA 3WL5A 3C5VA 2QS9A 3D4LA 3FLAA 4UBKA 2H1IA 2VF2A 2O2HA 4AXBA 4UHEA 4GHWA 3LP5A 4H35A 4AO8A 4W1QA 1AURA 1SOMA 3AZOA 3I6MA 4Q3KA 4BBZA 3DNMA 4W9RA 3OOSA 2HRRA 5ALEA 4E11A 1W76A 4RNCA 5LP1A 3U0VA 1DQYA 4X94A 3FSGA 4ARAA 4F0JA 1YA4A 4RPCA 2FJPA 2XMSA 3AUKA 4L72A 1UK6A 4C6HA 4NMWA 2RHTA 4H0CA 2OGSA 2ZJ6A 5FDFA 1DT5A 4HS9A 3ESDA 4BVLA 5YASA 4U2BA 1XRRA 5AKIA 5DJ5A 1YB6A 3DS8A 3FYUA 1K6EA 5LZ7A 4Y2PA 1WB6A 1KEZA 3G0IA 1VE6A 4OU4A 3PE6A 1J06A 2DHCA 1WHTA 1E8MA 4GEGA 2JIDA 2R8BA 1WB4A 2DQZA 3H2GA 1HDEA 3WWDA 4WDRA 3EQ7A 2OXEA 4H7IA 5AHXA 3E0XA 2WIGA 3HI4A 1DWOA 1P0QA 3MUNA 3G0BA 2AJBA 5EIHA 1EDEA 4W1RA 1Q84A 2HA3A 1WB5A 5A7HA 3KWFA 1KU0A 3FCYA 2HIHA 3BJRA 3LLCA 4ZWNA 3DCNA 3ZLVA 4B84A 3WKBA 4V2IA 4J03A 1O6GA 4QNNA 1JT2A 1CFJA 4MWTA 3G9TA 5K3FB 4AO7A 3HEAA 1N5MA 1DQZA 1W4LA 4B9EA 2V98A 3V1KA 1R9NA 4G8BA 1WOMA 3Q0TA 1XKLA 1EB8A 1VZ3A 2JF0A 4EY6A 1EB9A 3C5WP 3V9AA 4ETWA 3CCCA 1M33A 4EY4A 4MYDA 3PI6A 1I6WA 5T4HA 2XQJA 4UHFA 1EDBA 1IMJA 2Z8XA 5AM0A 3FNBA 1TRHA 3ZWQA 5JD5A 4CCWA 5AP9A 3E1GA 4FLMA 1Y7IA 1XLUA 3T52A 4BAUA 3QMVA 1XZHA 5HK8A 4KJXA 1OCEA 5CT9A 1ACLA 3SWWA 1WHSA 4I3FA 1T2NA 3H2KA 1J07A 3M3DA 1MT3A 3R3UA 1AUOA 5DTIA 2XLCA 2XUOA 4LXGA 4N5IX 3O9VA 3UUFA 2XMCA 5JAHA 4U2EA 1QFMA 3KOOA 4ZREA 1R50A 5AJHA 2J4FA 3PDCA 1HL7A 3E4DA 2CJPA 5HFNA 4FKBA 1EK1A 4KEAA 4UFPA 1VXRA 2DFPA 1XZAA 2OGZA 1H2ZA 2GBGA 3AFIA 2AJCA 2Z3ZA 3R3VA 4JH0A 5D6OA 5A2GA 3BE8A 3ZV7A 2VT7A 2BGRA 2QTBA 1WM1A 1ZD5A 5HF8A 3M81A 1E8NA 2ZSHA 3FLBA 1XQXA 2QZPA 5AKEA 2JGLA 3VXKA 4FFWA 2XT0A 1THTA 3H0CA 5A7FA 2HA2A 5E4TA 5AK6A 2VA9A 1PV1A 3AJAA 4G4IA 1OXMA 4N8SA 4X6UA 5EHXA 1KU6A 4X90A 4PSUA 4M0MA 4MXDA 4KE8A 3G0CA 2B4KA 2CUTA 4DIUA 3O4GA 5AI6A 1UT6A 2WUEA 5FLKA 4F21A 3LIIA 1EVEA 2X8BA 1MU0A 1QONA 1Y7HA 1C7JA 2PU5A 5A7GA 4K6HA 2ES4A 1T4MA 2VSQA 3EQ8A 3QMMA 4CG3A 5CXUA 4X6XA 3O4HA 4B81A 4B7ZA 2HU5A 4NS4A 4IH9A 4JNCA 4KAAA 4Y9SA 2PUHA 2J3QA 5K5EA 5F4ZA 4HTAA 3WIBA 2IITA 1CUJA 3WWCA 3C45A 1ZIYA 5AOAA 2EDAA 5DNVA 4DSAA 3FBWA 3BXPA 3WWPA 4UFNA 1VJ5A 2BUCA 1ZGBA 5ALHA 5DYTA 1VKHA 1FFAA 2HRQA 3K9BA 1EI9A 4G4JA 4OB7A 2QUBA 3H2IA 4MWSA 5ALYA 4BVKA 2BGNA 4QWMA 1GZ7A 1MX1A 2JBWA 4X93A 4J0DA 3FYUC 1THGA 3K2IA 2QKYA 4ZGBA 3V1LA 3PF8A 1P0PA 1JU4A 1N1MA 4B0PA 2XUQA 3DL7A 1MPXA 2RAUA 1MNQA 4M0FA 3RM3A 1XZKA 4FNMA 5JADA 2Y2VA 3IUQA 3GBSA 3JYHA 1YAHA 5LKAA 3MVEA 4MQMA 4J7AA 4AQDA 4NVRA 1XZCA 5DTJA 2EEPA 2WIFA 3IBTA 3C8DA 1BCSA 2QM0A 4C4ZA 1QIJA 2W22A 1XZFA 3R3XA 4BCDA 3D0KA 5FRDA 3H18A 3IDAA 3BWXA 1TQHA 2XUPA 1XZDA 4C88A 2ZVDA 3S2ZA 5DLPA 2EDCA 2VTVA 1ORWA 1QIGA 4BP9A 2O7RA 4I4CA 4MJ3A 2IIVA 2Z5GA 1MTZA 3E3AA 4QA9A 2WUFA 2JGEA 5AKHA 5C81A 1R9MA 2VJCA 3I6ZA 4WDQA 4KRXA 4PSDA 1CUZA 4FBLA 5T4FA 2WG2A 4DSZA 5JAUA 4MEAA 3GUUA 1EX9A 4YASA 1CVLA 3WK7A 3FVRA 3CCBA 3DEAA 3N0TA 4DNQA 3R40A 2YH2A 3H1AA 3WK5A 4P9NA 4OCZA 1VA4A 1W1IA 5ISMA 3R3YA 4BVJA 3QZUA 3MUOA 4Y2SA 4N5HX 3FWHA 2QXTA 5DNWA 1H2XA 5ALMA 1U2EA 2ECFA 3KXPA 1QO7A 1UFOA 2C58A 4Y2JA 5D3KA 3A2LA 3D3NA 4UBLA 3CN7A 1CV2A 1JU3A 3OURA 4INZA 4OPMA 4W63A 1PJAA 4P92A 4UHDA 5T4EA 2PBLA 1GKLA 5AICA 2AXEA 4BTVA 4Y2XA 4KE7A 2DR0A 5J3JA 1LZKA 1XRMA 3KD2A 2PKYX 3G02A 3WKDA 2GBFA 2WTMA 3ESAA 2PSEA 3NGMA 3FVTA 1ACJA 2OAEA 1X2BA 6YASA 3AZQA 4K2AA 3D5EA 3R3WA 5AKXA 1Y37A 4DTCA 5HK9A 5ALNA 2JGJA 1DX6A 2GZRA 5D7BA 3QPAA 4JUIA 2LIPA 4GDMA 1ORVA 3DKKA 2JGFA 3IUNA 5HFAA 2FX5A 4CCYB 4E15A 3BJMA 1CUYA 3Q8WA 1X2EA 4QE3A 5HQ3B 4A23A 3H2JA 3R3ZA 4AZ3A 4Y2VA 2VAVA 3D2BA 2ONCA 3AIOA 1YCDA 1XZEA 4HZGA 2VQ6A 2OCKA 3QH4A 5CBKA 3AIKA 5KBYA 4AMZA 4KRYA 4Q1VA 1E89A 1DWPA 3FSGD 3FAKA 2OGTA 1G66A 1LPOA 3TJMA 2WHRA 2OCLA 4I19A 1XRLA 2PL5A 4LYEA 1J1IA 1BROA 1Z68A 4UHBA 2Z3WA 3G9XA 3G7NA 4DMHA 1ZD3A 1K8QA 1QIFA 4G8DA 4WJLA 2XMQA 2C0PA 3OG9A 2HA4A 2B9VA 2K2QB 1DT3A 3STWA 3WK4A 4BTLA 5CH3A 4KACA 1ZJ5A 5A6VA 1EH5A 3DL4A 1ZI9A 2JEYA 4QDUA 1UKCA 2QXUA 2O2GA 2HU8A 1VOTA 1WPXA 3G0GA 4GECA 4OSEA 1RP1A 4C4YA 2WSLA 1AZWA 3DDUA 1CUBA 3WLAA 2QR5A 2C7BA 4LXHA 2VAXA 1DWQA 4QDTA 3O4JA 4UFOA 2HADA 3I1YA 2OG1A 5ALPA 2XMZA 1TCBA 1ODSA 5AM5A 2Y2UA 1YASA 5JALA 5ALDA 2HDWA 3M83A 4IQ4A 3SX4A 2WTNA 4QWWA 2BUAA 1MAHA 3W9UA 3QYJA 3WZMA 3YASA 1MN6A 4AB1A 2AJ8A 3RKSA 4RGYA 2YXPX 1LNSA 5DYWA 2PVSA 4F60A 1FFEA 2VATA 2XMBA 5JZ9A 2JGIA 1CRLA 1UOPA 2Q0XA 2PSFA 3HJUA 5HCUA 4RE6A 1X70A 4XJVA 1H2WA 2DQYA 3PICA 2WHPA 2GBIA 2C5GA 3OTQA 1Q0ZA 3IURA 1LBSA 3EQ9A 3ESCA 1GPLA 3ZLTA 1GKKA 3C87A 1A88A 4NZZA 3QBJA 2XQKA 1TIBA 2E3JA 5FXMA 1TKRA 1VZ2A 4G9GA 3C8HA 4BDTA 2I3ZA 5CTAA 3G8YA 1TK3A 3IA2A 4EBBA 5ALVA 1FFDA 1NU6A 4K6KA 2BJHA 3FCXA 2WJ3A 3EIOA 2WU4A 3DYIA 3B5EA 4BCCA 4J3JA 3N2ZB 4HXEB 3I1IA 3BF8A 5IVKA 1XLWA 3EF3A 1CLEA 3HABA 5DWDA 5AOCA 4AN0A 2AJDA 4UHHA 3O95A 1BEZA 1IZ8A 3IUMA 4TPKA 2GYWA 2XDWA 3HLKA 2XMGA 3B12A 1F0NA 1MNAA 3LCRA 3I2KA 3JWEA 5HF9A 5K3DA 4WY5A 2WFLB 2VJBA 2XUAA 1EK2A 2QOEA 2XUDA 1CQZA 5AO9A 4HXFB 1EVQA 5CH5A 5JZBA 2PSHA 1VE7A 1ZJ4A 2ZYIA 1AGYA 4UBNA 2XUJA 4B6GA 2J4CA 5I9IA 4LHEA 3WK8A 1ISPA 3TEJA 3WKAA 4U2DA 2RONA 3U1TA 3WKCA 4IH1A 1CUAA 2WG1A 3EBLA 2JGKA 5LZ4A 2XLBA 5LZ2A 3LIPA 3WL8A 4D9JA 4B80A 4BATA 3QMWA 1N5RA 4EY7A 4GW3A 2WIKA 3OPMA 2WHQA 1F6WA 1BN6A 4L9AA 3VJLA 2DCMA 1UWCA 2OQIA 1XFDA 2RGUA 5AI4A 2QJRA 1GGVA 3PF9A 3S8YA 5K3AA 4HVTA 1VA5A 1QGED 5AI8A 1QTRA 2B61A 3W9BA 5AIBA 4UPDA 5HKAA 3RK4A 1JI3A 3WI7A 4JYMA 4XX1A 1EHYA 4FNGA 3WJ2A 1PFQA 3KSRA 1F0PA 1UZAA 5LLSA 5AM4A 4QDOA 2H7CA 4KYVA 3VKFA 3OC0A 1DTEA 1U8EA 2XQFA 5AIAA 4C89A 2W6CX 1R88A 1YR2A 3X3HA 5AM1A 4ZI5A 4YK7A 1K63A 5HZGA 3I2JA 5FOQA 3O0DA 3RLIA 5ALFA 1AX9A 1U65A 5K3BA 3FYUB 4DNOA 4HAIA 5CT6A 4HRYA 3VISA 3JW8A 3C6XA 1QOZA 2ACEA 4P93A 4EB0A 4BCBA 1J2EA 2OCIA 1YB7A 1B41A 3SK0A 1EA5A 4K5QA 5EFZA 1QIDA 3GFFA 2AJLI 4Y2UA 5SYMA 3TRDA 5C8ZA 5AKJA 1HQDA 4CI9A 4LKOA 4C87A 5AK3A 3BL8A 5ALOA 3WYNA 3DOIA 3BIXA 4U2CA 1QO9A 3ZPXA 3VJKA 5BOVA 4LIPD 1CUCA 2PU7A 3PUHA 2XQGA 1DU4A 1E3QA 5EI5A 3GZJA 4B83A 4CIAA 1QIMA 1FFCA 2I78A 2Z8ZA 4GBGA 5AM2A 1F8UA 3A2MA 5IVHA 4OUKX 4OU5A 4QDZA 3WL6A 4WY8A 1TAHA 5JZSA 4BZZA 2G5TA 4WCVA 1ZD2P 2YYSA 5AK4A 4B82A 1W6RA 3F97A 5EHZA 1ZICA 1QIIA 2WIJA 1XROA 2HFJA 3QITA 5AKZA 3FYTA 1G42A 2ZYHA 3IUJA 3NOXA 2WFMA 2G5PA 3ICWA 5JARA 5ALZA 2WQZA 3WA7A 1FSSA 4EA6A 3AINA 4N8DA 3BIWA 2XMDA 3VVMA 1CQWA 2ORYA 4BB0A 2DSNA 4S0XA 2VJDA 5CT8A 2ZJFA 4L3WA 1IUOA 2HA5A 1QIKA 1MX9A 1YSCA 2PX6A 2WIDA 5K3FA 3V48A 2OCGA 3DQZA 2PSDA 1JMYA 4P08A 4PV7A 1E5TA 4AN1A 4H7JA 3P2MA 3A6ZA 3F67A 5KWIA 4KE6A 4J0KA 4X85A 3RARA 1ODTC 3HXKA 3ANTA 5A62A 3ZI7A 5HKBA 3H19A 2DHDA 1RWQA 4FTWA 2V9ZA 4C01A 5AOBA 2V97A 2G4LA 5ESRA 2FUKA 1HPLA 4FOLA 2HA7A 3DOHA 3AIMA 1CUEA 1IZ7A 1MO2A 1Q0RA 3UMJA 4PQEA 4IH4A 3IB3A 4EUSA 2HA0A 4H7DA 2WLSA 4CFSA 1ZGCA 3FOBA 1TCAA 2IX9A 1GQSA 3DKRA 4ZV7A 3STTA 1A7UA 5CMLA 1W52X 1XZGA 1XLVA 4AO6A 4Q3OA 1HBJA 2WJ6A 4DYHA 1ZI6A 5ALUA 4OYYA 4AMYA 1HKHA 3W05A 5DNUA 5LZ5A 5DYYA 3GA7A 4J0CA 4BZWA 1HLGA 1G4HA 3QPCA 4TVKA 1BEEA 4F5ZA 4WFIA 3D7RA 1JJFA 2H7XA 5AI5A 5IKXA 5AKYA 3STVA 3O4IA 1GPNA 4AX4A 1BS9A 4G4GA 2XQIA 1H2YA 2WJ4A 1E66A 1VLQA 2GZSA 1NX9A 1XZBA 5AKKA 1BU8A 1EDDA 1P0IA 3G9UA 1B6GA 2XB6A 2XE4A 4BE9A 2JEZA 4Y7DA 3D2AA 3QM1A 5CXXA 3F98A 5JATA 1YA8A 3HC7A 5E2IA 1XQWA 2ZJ7A 1CUFA 4ZV9A 4FDMA 3H2HA 1NU8A 3C6BA 4Y2QA 2RI6A 4QZVA 4G1FA 2ROQA 1FJ2A 5JD4A 5ALGA 3L1HA 5KWJA 1IVYA 4DM7A 3NWOA 2PSJA 2GBCA 4X6YA 4X95A 2HHAA 1H23A 4E46A 1LPPA 2ACKA 3HRHA 1A8SA 2WKWA 5IVIA 2Y6VA 1UKBA 4A5SA 4Y2RA 4AZ0A 4B9AA 2QVBA 1EXWA 2I03A 5K3CA 1LPNA 1P0MA 3BF7A 2OQVA 4BYMA 4B85A 3KDAA 5BV7A 1UK9A 1WPRA 4ARBA 2C0QA 3GROA 1UK7A 3F96A 3WA6A 2QRUA 4X71A 4QEKA 3DJYA 3L1JA 4H77A 4Q34A 1CUSA 2BUBA 4DNFA 5JAOA 1LZLA 2OLEA 3A70A 1LPSA 1JJBA 3PFCA 1ZI8A 4DNPA 3DD5A 1QJ4A 1SFRA 3PFBA 1AQLA 1BE0A 1XZMA 4W1SA 1AC5A 1MAAA 2VT6A 3O9MA 3W2TA 4EHBA 5JASA 4B0OA 2WG0A 4DMCA 2OAGA 5LIPA 2WFZA 1XZIA 5FKJA 1CIJA 3VJMA 1G5FA 3VDXA 5CURA 5LKRA 4G8CA 3C43A 1EINA 5HF6A 3C6ZA 1QIHA 3ZLUA 3IULA 4FBMA 3VVLA 1XZJA 4IO0A 2CZQA 1C4XA 5JD6A 1SCIA 3STXA 3WZLA 1CPYA 5CT5A 2V96A 2XMRA 2QT9A 4J0IA 2XUHA 3NUZA 4OB8A 5IVDA 3I2IA 3R0VA 3AZPA 3HZOA 1QIEA 1H22A 2XI4A 3HSSA 4XIIA 3ESBA 3G0DA 3V1MA 1QTIA 3HYSA 4EY8A 3F9CA 2FJ0A 4G5XA 3WL7A 1QZ3A 2HA6A 5CRIA 5AKLA 3QVMA 5EGNA 3LS2A 1CR6A 1K5PA 2CB9A 2XUGA 4DMFA 5EHNA 3ICVA 4OD0A 3PUIA 4HRXA 1LGYA 1MX5A 4BAZA 3A2NA 2J3DA 2Y6UA 5E4JA 4XVCA 4FLEA 3ED1A 3I6YA 4E14A 3D2CA 1DX4A 3H17A 4Y2YA 1C7IA 3H04A 4QLOA 5FV4A 4X7BA 5FPQA 3K6KA 2QJWA 4W1PA 4BRZA 1XQYA 4QLAA 4DLNA 5EIEA 1R1DA 5ALIA 5HF5A 4WFKA 5SYNA 4PO3X 1XZLA 4X97A 5BWBA 2B20A 2BFNA 1CEXA 1AKNA 2C4HA 1W75A 1XRNA 2D5LA 4UBMA 1IUPA 1QE3A 4MEBA 3C70A 5LZ8A 4YPVA 3STYA 1QLWA 1DINA 1R4ZA 4X3CA 4DGQA 5T4BA 5FUMA 4BDSA 5ALJA 2PM8A 3L1IA 3V1NA 1LBTA 1CUUA 3W04A 3UUEA 4X92A 1SC9A 3DYVA 5LYYA 5A71A 5K3EA 5AM3A 3MGAA 2C5FA 1OILA 5AI9A 1CUIA 4CCYA 1LPBB 1GXSA 4FFVA 4PW0A 4FLFA 4KAFA 4U2FA 4J0HA 5AI0A 2YASA 2QMQA 3IVMA 1YAJA 1GT6A 3BDIA 5HQ3A 4XWGA 3I28A 3GELA 1ETHA 4EY5A 1QFSA 4EZIA 1UXOA 4X00A 4YX9A 1K4YA 1CUVA 3ANSA 5ALRA 1XRQA 4J0GA 5EHQA 5C8XA 5BWCA 1CUHA 4IHAA 1CUXA 4MQLA 2HM7A 3WMRA 2CMFA 3QPDA 2P8SA 4JYPA 4ROTA 1E8DA 2ZSIA 2GYVA 3WK6A 2CBGA 4GWLA 4PF1A 1LPAB 3CXUA 4BP8A 5I7UA 5EIAA 4UUQA 3WQHA 2R11A 2X76A 5ALLA 2WILA 5ALTA 2WM2A 2UZ0A 4BC0A 1JFRA 5CW2A 3C6YA 1S8OA 2RHWA 4U2GA 4H7HA 7YASA 5AH0A 1SCQA 5ALSA 3WKEA 5JIBA 3BDVA 4BRSA 2ZYSA 4UBIA 2X5XA 3I2GA 5ALWA 2H7YA 5I8PA 3D59A 4A16A 4Q82A 2HL6A 2NW6A 3KWJA 2WHPB 5CT4A 2QUAA 1WCYA
chains in the Genus database with same CATH superfamily
1FA9A 4NULA 2UUOA 2QL7A 4YJHA 2F43A 5IJ0A 3L8ZA 4O1HA 2BFPA 3MS4A 5K0TA 4L07A 4HR7A 1TMKA 1JSCA 1NBEA 3AM3A 4OB6A 2BCEA 3PSAA 3U2QA 2CHUA 4GSLA 4EA8A 5TQ2A 1CJCA 2DFVA 3OPYI 2PL3A 4DDHA 1YBVA 2ENUA 3CUUA 1RRCA 4RH3A 2UXBB 4BFYA 3M2TA 2A3RA 5G4KA 5IJAA 2ODEA 4HWSA 4BJHB 1XKTA 1MJFA 1X92A 5KNDD 5FAXA 2J9ZB 1JFVA 3NIBA 1FTQA 3S0JA 3OQIA 5C1BA 2JI9A 2OQRA 4JI1B 2H4FA 2ZSBA 5EKUA 1O6FA 5AVOA 3NVKI 1KEWA 2O2IA 4N76A 3EXEA 3AVVA 2XUKA 3KYDA 2JDIA 2W0SA 5BRNA 2AFRA 1AMNA 2JW5A 1LCIA 1V3TA 1WCWA 5LZ9A 1F4PA 1FP7A 4I4TB 1GDTA 1PYOA 2ZYRA 3QBVA 2AG6A 3J81A 4RY2A 2VNAA 3ZQ4A 1ZJZA 4RCYA 4K0RA 2H4YA 2RGWA 3UYLA 1CP3A 1JHPA 3PL1A 4EB8A 5ALKA 4HB2A 4UBOA 4M55A 8OHMA 3BK2A 1SRRA 4LYDA 2AI3A 5IJWA 3FHLA 3EZYA 1T8RA 3NJ4A 3B6KA 1B2RA 3NYIA 3IIIA 2O7VA 1SZCA 2X0JA 2OK7A 3BK7A 1NT2A 1XEAA 3DEIA 4PONA 1P7PA 3GZTB 2ID9A 1ZOIA 5D7NA 3D6NB 1CS0A 1Y8QA 3L04A 3O2QB 4HG2A 4RETA 1RKQA 5CK4A 2OP1A 4BE4A 1RWXA 4K1XA 1RYYA 4C78A 2B4AA 2O3UA 1D0SA 4H27A 4IBOA 1DARA 1JWAB 1KYWA 1P7YA 1SKBA 5K6RA 1A8QA 3DBLB 2NQTA 2RBKA 3S2YA 1NSYA 5IN4A 1I2DA 1X7YB 4F5YA 4F1JA 1RI4A 4CG2A 2ZAYA 2JGMA 4FWBA 3FY4A 4G1EB 4MRMA 3ZV5A 1ATIA 4KWHA 5KKNB 4TV8F 2O57A 2OHVA 4IW3B 1FYXA 1MEOA 1PL8A 3G9ZA 5JBNA 1P29A 2BSQA 2AC2A 3F8SA 4H7KA 3L9WA 4WTOA 2D2VA 3ANMA 4CQLA 1SXGA 4YUWA 3TVTA 2F8MA 3AB7A 2PPLA 1L4LA 5P21A 2REXB 1GL9B 4IGIA 4ZU1X 3AU9A 5LBIA 1EKXA 3R4CA 4DRXA 1IUNA 2DMRA 4UE2A 5FUQA 2PUAA 2BKLA 2B1RA 1SMKA 3TTUA 4ZOQI 1GNLA 4U9UA 1F06A 1NNUA 1PK7A 1WU7A 2AT1A 1VL1A 3KT3A 4A10A 4H18A 1F48A 2GWRA 4CL8A 3C7DB 3P2EA 1AMUA 1LV8A 1M2JA 1JVSA 5IKEA 4W5QA 1ZHFA 2EKLA 3OZWA 1QDEA 1L5SA 3AJEA 3VR0A 2VJYA 1N2GA 2GZAA 2Q1WA 4N1AA 4YRSA 1VSBA 2O3SA 4ED9A 3L8HA 4P0QB 1FU8A 4F72A 3DTTA 4RPKA 5KOHB 3ZKAA 3DMDA 5JROA 3EMDA 3BMQB 1FPQA 4Y67A 2FSSA 2YBEA 1Z7EA 1ZUWA 2B1IA 3DOCA 4AY5A 3E5MA 2WU3A 4HDNA 2WUGA 5WRFA 3TX6A 3L05A 1DQSA 2YV4A 1VG8A 3AFOA 3CH7A 4HB4A 4QSMA 3OM0A 4UZFA 4YFVA 2HKIA 1UZLA 1BDIA 2AFHE 2B6NA 1I0IA 2GHIA 2QTHA 1SN7A 4PNZA 1TEHA 3NBYC 1NNEA 1AKMA 4WJKB 2JCXA 2D0OB 4FYKA 5AKGA 4WADA 3FOCA 4M54A 5HIIA 2EZUA 3NTLA 1Q83A 4JEHA 2B8JA 2CL0X 3HUTA 5BSWA 2ID7A 3EQ6A 4K6GA 5F51A 5C7YA 1BOOA 1YVUA 1D6SA 4M9SA 5EVCA 3O2NA 5TMPA 1L4GA 1QPBA 1XF9A 3KQPA 4MI6A 2J6IA 3GT3A 3IDOA 2F9MA 4RFVA 3TYXA 3FZQA 3OM8A 4M0EA 1GQRA 1Q2XA 3I9V6 3VYWA 5UKDA 4BWVA 5AVUA 2CXPA 3SXPA 1YK1A 1TF5A 3I2HA 4LEIA 4D3DA 3EGXA 5AVYA 3AV3A 4Q3LA 1FXWF 3WJ1A 2B83A 4AJHA 3GZNA 3AF0A 3WQRA 4CTMA 2WFLA 5CA1B 3EEBA 4WVFA 3JZFA 1P1BA 3X44A 3OEWA 3ACBA 4Z9YA 2WDPA 1ULUA 1H6CA 4G09A 2QB5A 2ZSAA 1T4CB 3W06A 3LI2A 3WY9A 5JTTA 1HORA 1EZZA 1GPKA 1Q7BA 4R9VA 4L0CA 3ZY3A 1DHTA 3NHKA 1R3UA 2PRKA 3EASA 2CDAA 2ZJ2A 4EELA 4UTRA 4NQRA 5I01A 1K8ZB 2H06A 5DHSA 1SU7A 1FUUA 1R6TA 3SXJA 1ZD4A 2IZ5A 3GEGA 2D0DA 4JODA 4P4SA 3I1JA 1XGKA 3M33A 3BMCB 4FDVA 1KDVA 2NYAA 2OXTA 4ZFNA 4GL2A 3ET5A 3GMTA 4N8EA 4URYR 3ENVA 1XTZA 2VTBA 1NAIA 3TD6A 1FB5A 1A8UA 2C3MA 3AYZB 4US2R 5CJ2A 5AW2A 4XDGA 2ZU6A 3OPQA 3GLFE 4G0PA 3FN4A 4JP2A 1UOOA 3GVHA 1R0WA 3O94A 2A14A 4MYRA 3ZJTA 2QQGA 3HJRA 4F9FA 3GUHA 2PYDA 7AT1A 1V4BA 3TCKA 1VFNA 4IHQA 3DEKA 1I3CA 2D4AA 5K0LA 3OU6A 2D5IA 4EYEA 3MGCA 4P80A 4KI7A 3ZHQA 1H0SA 4RS3A 5I4BA 1ZHOA 2H1IA 4MS4B 2QP9X 3D2LA 4QUJA 4BFUA 4UHEA 4R8RA 4OQYA 3MF4A 4RTOA 4V0LA 4ETNA 4J9UE 4PPYA 1N2JA 1Z33A 1ZMXA 2QX9A 4AO8A 2GPTA 4UXHA 5MGNA 1L5MA 1W29A 4GMHA 3C3YA 2FPPB 1ONNA 1TF2A 4GXRA 4Z1MA 5IZ4A 4LXUA 5E6SA 5L7TA 1JEQB 3IJEB 2FFBA 1KAGA 1NFFA 5D86A 4ARIA 2EGUA 4PXSA 4A8JB 4B3XA 1QNLA 2HWUA 1BYIA 1U8AA 2AK3A 3RT7A 1R4MA 3KLPX 4MYTA 3ODGA 4J1TA 3OPXA 2C3YA 3WHPA 1A9RA 2VPXA 4DN6A 4AWXA 1NVVQ 1WUIS 1CY0A 1YWGO 3KALA 2Y0EA 3W34A 5JXWA 1W76A 4D8TA 5LP1A 3FOZA 3U0VA 4GPIB 4X94A 2OGUA 4X1KA 1S8AA 1KEEA 4FDTA 4KQGA 4F0JA 3DL0A 3HO1A 1FNBA 2ZRQA 5I7FA 3GV0A 3T3MB 1AKEA 1L1RA 4J94A 1MIOB 5KMGB 2GN9A 2CL5A 2FJPA 3X2EA 2XMSA 3S1AB 1ESCA 3DP7A 3OPYA 4RKFA 1CR2A 2PQ2A 1UK6A 4C6HA 4OI0A 1ATZA 4H0CA 4KQ6A 4ZD6A 4H1TA 1GZHB 4NCIA 3CR7A 1KPGA 1XDSA 2X8LA 2ZI5A 2FE4A 1VHTA 5FDFA 1FK8A 4KQ1A 3K9WA 1QC5B 5F12A 2AZTA 1A5AB 4HS9A 3T95A 4RCZA 3U9TA 2FXIA 4FDUA 4LQDA 3SM9A 4YCMA 2FWPA 4ZRMA 3D6JA 4U2BA 2VDPB 3HFGA 3OOHA 3WLJA 3P32A 3PEWA 1RPTA 2ZRNA 3LWZA 4HMOA 2QY9A 4U2KA 2QVCA 2Q3EA 1JPJA 1N7JA 1QZTA 1J7KA 1YRBA 1RWOA 3LOQA 3L9XA 2AWOA 1GL6A 2VBFA 3FYUA 1D0VA 1OBOA 3E7XA 4ID3A 4TSFD 5AMXA 3UH0A 4GVPA 1JQKA 2Z1DA 4HLCA 4Y2PA 721PA 2UDPA 1RJFA 4CR8A 1KEZA 3G0IA 1L5HB 3UWOA 1KQFA 2NADA 3Q1LA 4KH0A 3PE6A 3E2MA 1MJGM 4H15A 5TGTA 4R84A 3WFIA 1BMTA 1E8MA 2PGDA 4GEGA 4YTEA 2KPOA 4YAUA 5EJ9A 2JIPA 2PGOA 2RGBA 5L3ZA 4K7JA 3QKSA 3D8UA 4YRFA 5LA6B 1A96A 1VSTA 2JIDA 1RACA 4KU4A 4OQLA 4TM7A 5H70A 1EFVB 3EYAA 3OIUA 4FN4A 4QJIA 4XGRA 1QRSA 2OSVA 2A5GA 4C29A 1AJEA 1HDEA 2M32A 2CWWA 421PA 4QG3A 3W1WA 1CB0A 3C1TA 4GDFA 2C4MA 5TMEA 3UW1A 3ZS8A 4KVAA 3TIVA 3G1WA 1KXJA 1O9GA 1K7CA 1K4MA 4H6VA 4C0WA 3NV7A 5FWYA 2C2KA 2ODQA 1F8FA 2FDXA 4M98A 4Q24A 4UXIA 1NDQA 1BJRE 1SU6A 1XXHE 2EFJA 2HA3A 3NRBA 3HP4A 4J43A 3RUIA 2O20A 1WB5A 3KUKA 4URXR 2FW8A 3NBAA 3NTQA 5A7HA 1G291 3KWFA 4H17A 3U40A 2YMMA 1L1EA 4KWEA 1I6LA 1E1DA 4MR7A 1JHDA 2BKUA 2GXQA 4BV2A 1R9JA 2VUUA 2HIHA 3OEHA 3INGA 1XPRA 3U7EB 4HAVA 2ZIXA 3BJRA 3IT0A 3DCNA 4EM6A 3ZLVA 4Z4FA 5FUYA 5GGXA 5A5GA 1URPA 4V2IA 3KNZA 4QTTB 5CPBA 3A9CA 5DX0A 4DB2A 1ZK4A 4JBYA 5DRYA 1A9XB 1P73A 1XHEA 1X6VA 4NU5A 1K9VF 3BAZA 1SVUA 2Y0DA 2J8ZA 4KQ9A 5KQSA 4HLDA 5DBOA 4AO7A 1B8OA 4RVHA 4D0SA 1JT9A 1L8LA 3A6JA 5IG2A 2QX6A 3F7TA 2JFQA 3W6ZA 2B1QA 2LBPA 1R0XA 2FSFA 3HKBA 4JOQA 4Y0NA 3FMGA 3CJTA 3TEMA 3EPRA 1M34B 4PCLA 3BH0A 2FWAA 4IIJB 4R1SA 3SP1A 3AOEA 4XD7A 4CTNA 5M2QA 3BYZA 2P9BA 3GP8A 1WOMA 9LDBA 3IPCA 1C14A 2NOAA 3ASVA 3MMPA 4CODB 1H4SA 4F5EA 4ZHQF 1VHQA 1JH8A 4BQPA 4S2EA 5JWOA 1VZ3A 4EY6A 1EB9A 1U94A 1AZTA 3C5WP 3V9AA 4UU8A 2BT4A 4Q7EA 4ETWA 5BSUA 2O2SA 4NXMB 4GC5A 1L5NA 1EVIA 4BLTA 3GT0A 1B6SA 5A3SA 1XAHA 5DBGA 3BXHA 4MYDA 4X5OA 1IOLA 3PI6A 3QJGA 4N65A 3OO0A 2IC5A 4TM8A 3TQSA 2XQJA 1Q1ZA 3CEPB 2OM6A 5GJBA 4UHFA 2D8MA 1XTJA 3HA2A 3JWIA 4I9FA 5K0NA 3PHLA 4A2CA 1UBJS 1D09A 3CVWA 2FPSA 4D9IA 3G5LA 4LYAA 2F48A 2GCOA 2IBMA 2ZJYA 3ZWQA 3K9NA 4G67A 4YC7A 1OLUB 1R5JA 1ST2A 4QASA 5AP9A 3AEKA 1SVIA 3REOA 4BNFA 2AVNA 2VG8A 4FCVA 2P0EA 2REOA 5JDIA 2FMUA 3ZBUA 4COOA 4FLMA 1Y7IA 1B7GO 1XLUA 4EHNA 2PE5A 3L1UA 4YRDA 1K6XA 2WJIA 4PC6A 3DXXA 1YACA 4NBSA 4N39A 4ENWA 2GN6A 1KI3A 3A1FA 4LYJA 4N0PA 2WW8A 3TZHA 5IWAB 4P7JA 1QVAA 3L4SO 1QO0A 4H16A 4E5MA 3TBFA 2W6ID 4M1MA 1BA2A 4LJSA 3SWWA 2W4IA 4DHWA 4ZDWA 2ZRAA 1T13A 2AXPA 3SS8A 3LHFA 1DOZA 2CHEA 4GQAA 4IRXA 4M1TA 3C97A 3N07A 1AUOA 2HREA 4XOUA 2WJGA 4K6FA 3BBLA 3WL3A 3AOGA 1W1UA 3PNQA 4FR0A 4A0SA 2NXEA 3FUTA 2XUOA 4LXGA 5TR9A 4NZNA 1CX9B 3Q3VA 2PX0A 5FHQA 2HJVA 5HTOA 2ZR0A 1AUXA 3E84A 1KVTA 3ESYA 2FPRA 3SYTA 3HJNA 5IJZA 5A9SB 1Q0SA 2XMCA 3OSUA 3D0QA 1KBOA 2RGNA 2A9FA 2H08A 1KYQA 2VH2A 2VR1A 4HBGA 3JSAA 5DO9A 1KAHA 2L0XA 3FSRA 1R50A 1V1MB 1JF8A 2LTAA 2QD3A 3DV0A 4I1SA 2J4FA 3K6JA 3PDCA 1SQSA 2J67A 4LCBA 1E0DA 2FPLA 2GZ2A 2ZT5A 4OIFA 1IIBA 1CJSA 4RIGA 1ORIA 1UBCA 2IE0A 3RC2A 5K20A 3ZHRA 3MLAA 4X8HA 2EJWA 1IQ0A 1VXRA 2I6XA 2PSSA 1G55A 1SHLA 2IHJA 4FNOA 4R7TA 4YJGA 3FROA 5AUNB 1K92A 1FP4A 3KB1A 3P96A 2DP4E 5BSFA 5SY9A 1E2BA 1T0UA 2EW1A 4JH0A 3HXMA 2KW5A 5D6OA 3KOXA 5C3UA 2AR9A 2AZMA 3OLQA 5TNXA 2RJOA 2B0CA 2BGRA 3UC5A 4CT5A 1L5FA 3GF4A 1P1HA 2BCJQ 2QTBA 2WE7A 1QAMA 1IVNA 3ZWPA 1ZD5A 3PD0A 4Q7JB 5FBLB 2HO4A 2GJAA 2IXBA 4JXJA 3JWJA 4R3NA 5BSKA 4JLBA 4IV5A 4TN5A 1JDTA 1XQXA 4MVWA 5AKEA 2JGLA 1EQUA 1QGZA 1ZLYA 2O3JA 4LK3A 5COBA 4YRQA 2ONJA 3VXKA 3K5HA 1OLXB 3EQ2A 4M9ZA 2XCTB 4LJLA 1THTA 2DHRA 3EDQA 3GJ8A 5AUPB 5E4TA 3AJAA 1E79D 4OHUA 3A6PC 1J5XA 3T7AA 4C6RA 2Q3CA 3GFQA 4NFSA 2B5OA 3N7UA 1QTQA 1YKSA 1N0IA 4S35A 4WCFC 1KU6A 2GZ1A 1IOVA 5AD1A 3RYIA 4F93B 1Z63A 4WA7A 3KS9A 4RM3A 1WDTA 4M0MA 1WZEA 3A8TA 3O4VA 1ZR2A 3ENKA 5JZOA 2CUTA 2E4YA 1E6EA 4X1YB 3L0CA 4GE3A 2QSUA 5CM9C 4AFNA 3KC2A 5IJ9A 2O5VA 4BNNA 4C2UA 2R68A 5SZJA 4JCCA 4H1UA 3V7WA 5B64A 3GR6A 2HDNB 3W4JA 4HS4A 4DIDA 1HYEA 4F21A 3QENA 3LIIA 1XMVA 1CEYA 3QHPA 1KAEA 2BGMA 1FDSA 4JB8A 4L4UA 1EFKA 5KC8A 2JJ2D 4R5HA 4RMIA 4EJFA 1DKUA 4ZYZA 3HBJA 2YOHA 3AESB 4L57A 3WGNA 3Q12A 3A1NA 3UPTA 3ACDA 2PU5A 4CL3A 1O95A 5A7GA 2C03A 3BB3A 3DONA 1F14A 2ES4A 2VSQA 3PXUA 1EDOA 2LW7A 4A8TA 3NZEA 4UAUA 4AZ0B 3UMGA 4MS1B 4AF6A 3WGVA 1KOGA 3WP1B 4NG4A 2VAMA 4MS3B 4DY6A 1BRMA 3AQ4A 1WU8A 1QYVA 2AXNA 4V0SA 4TVOA 4KXMA 4TXJA 2ZRFA 2HU5A 3OFNA 3WGZA 5LDDC 3SNHA 3H2ZA 2C9OA 1ADGA 2QRKA 1YDWA 4JNCA 2P5YA 5TVGA 2PUHA 2O2EA 5TQ0B 1T5SA 3FNRA 1CEEA 1LDEA 4MVJF 1M2OB 2WPDD 3OAAA 4WNIA 5F4ZA 3TDKA 3U4MA 3CUYA 3D8RA 1O96B 3R0ZA 3W79A 4FS3A 4G97A 1CUJA 4ZGGA 4IIYA 1LV7A 2BDTA 4PNPA 5A6SB 1ZIYA 1U8TA 4WW0A 1VLJA 2EW8A 4AP5A 3CRW1 4Y6GB 4I81A 3UO8B 2QHXA 5DNVA 2XBLA 4AZTA 3G6WA 2RH4A 5F7XA 1NUUA 2H52A 4DSAA 1E2MA 3L79A 1SXIA 4OV6B 2W58A 2ZQZA 3GRCA 4RTJA 4MV8A 1I5EA 4RK1A 4RM2A 2CDBA 5JFOA 1O94A 3ZC3A 2OLKA 1A9SA 3IP5A 2FZWA 5ALHA 5DYTA 1X94A 2G80A 3TOSA 3VPDA 2VUSA 4HWPA 1SH7A 3WHLA 1IL0A 3WLHA 2G17A 3QFSA 2H0AA 2SECE 3ORRA 4ARZA 1NUQA 5A3RA 2HXSA 1LW7A 4TT3A 4AECA 3U62A 4R8VA 4JI0B 5EQFA 3VYTB 2PZKA 2BGNA 3FWZA 1QH8B 1GZ7A 3LYAA 3ZE0B 3EXIB 4P98A 3TNFA 2G1AA 3W4KA 4ERXA 3QX8A 4FE7A 2DRIA 4RENA 3T38A 1R7RA 5AVRA 1Z6PA 5IBPA 3DSRA 4QPJC 4FEYA 4MV0A 1UBRS 4EVSA 2KJQA 4J0DA 5JXIA 2HWWA 2MOKA 4XARA 1J20A 3SEFA 4LMPA 1UR5A 2PBFA 1V8PA 3K2IA 3ZGOA 4Z86A 3IOEA 4YAWA 5J40A 4ZGBA 2W6QA 3GLVA 1GKUB 4UNPA 3RVBA 1PJTA 3GEIA 3V1LA 3WXBA 1G8PA 4O2RA 2JANA 2P2LA 4MHSA 5TT0A 1NJ8A 1RQLA 4QYSA 2YHSA 3E5NA 1CF4A 1U80A 1MPXA 2NUAA 2RAUA 4HATA 3UWKA 5FEMA 2GYYA 4ND5A 4Z6KA 3O7MA 3RO7A 2QAGC 4POAA 2PUBA 1M6VB 1L4YA 2XGOA 3A0UA 1TGVA 1MD9A 4NDZA 4HWRA 4PQGA 3H83A 3B1JA 2EATA 1TT5A 3GBSA 2N42A 4HNHA 3OZTA 2W2OA 5EESA 1D7AA 5BSEA 2R87A 3NALA 1L5YA 3FYSA 5FYDA 5KSPA 1IZ0A 1I6KA 1OI4A 2AEJA 2NPFA 1UQRA 5EGSA 3ILVA 2X7HA 4D0LB 4F4FA 1V8BA 4NVRA 3EQZA 1JDPA 1H1LA 5I7WA 2O8BB 3KHKA 3A31A 1YHYA 1C4OA 4A91A 1W30A 3VR4D 2X42A 2P11A 1O89A 4RXUA 1SRQA 4LBWA 2WIFA 2DQ4A 5DSTA 3HMQA 2J9RA 1UQTA 1PGOA 1DUVG 2UUAB 5NULA 1PJBA 1N0WA 2QM0A 3SM3A 2BL4A 2Y1CA 5JLJA 5C34B 4BEBA 1XZFA 3PYMA 2OFXA 3SJBA 4BCDA 3GX1A 5LA6A 3V5NA 3ZKWB 5TPZD 1W19A 2XT9A 1HM5A 2QSZA 3D6HA 4GXTA 4IDPA 3WRVA 9MHTA 3Q7QA 4OBEA 3NORA 4PAOA 5JMTA 3BWXA 4FBGA 1M7BA 1Z36A 3AUJB 4TLBA 3LV8A 1OY1A 1NW6A 3IV6A 3IQHX 2FQ1A 3L8CA 4C88A 2CC2A 3R7SA 1A4XA 4OG2A 1R5BA 3F1KA 5E1OA 3MBIA 4BGUA 1MFZA 1G18A 5F35A 3S2ZA 4MVYA 5DLPA 5FULA 2QN9A 1S5PA 2ATIA 4TYPA 1J2YA 2EFCB 1YJ5A 2P9TA 2VTVA 3DE4X 2C57A 2BDUA 2C9DA 3OE1A 3OT1A 4DJEC 4ZCMA 5DGHA 4DQLA 4MJ3A 4CM7A 1C0IA 5JC8A 2Z5GA 1YVPA 3M6XA 2B8WA 4N4AA 4MUHA 2DWPA 3VU1A 3QKUA 1I5OA 3ABOB 3V7NA 4ZT2A 4OHOA 4QA9A 4HP8A 3ZCUA 2EZ4A 4DM3A 2JGEA 4JL6A 5JXHA 1FX0A 3U5ZB 3AVXA 3SHFA 4ZDKA 2FEKA 2ZFUA 3RADC 4RDCA 2BM0A 3TG2A 1IJBA 3RB8A 2IRWA 4ZYTA 5MN4A 1YV9A 2YS7A 3LQ4A 4MLZA 3AR2A 3RTCA 3SDBA 3V1YA 4KRXA 5I7RA 4JXZA 4RANA 4O5AA 5K2MA 1KVUA 2WJAA 2O6HA 3FOFC 4AJKA 2ZXFA 2JASA 1Z0DA 5JAUA 5B3LA 2AQ8A 4GOOD 4K26A 3IJ5A 2FPUA 3KQHA 3U9LA 2JFUA 1PFVA 2RIRA 2ZDGA 3NHZA 2YZNA 3P97A 3S3TA 1ODFA 2WAXA 4N82A 5F2NA 2E0IA 4QHYA 1UBHS 3AJRA 5HCIA 4DNQA 3BVPA 3R40A 2O2JA 4GUAA 4C6SA 1UKZA 4E7OA 1QYIA 4Z0NA 1F4VA 3LL7A 5SY4A 1GA1A 1TYCA 4MRNA 2A92A 4ZAYA 3LOPA 2YZGA 1SGWA 1ITZA 4MJXA 2R65A 2EG5A 1WVMA 2JNWA 1OBVA 3BIJA 1VJ0A 4R8MA 5JCOA 3FD8A 4YREA 1BKYA 3D8TA 3EA0A 1ANKA 5FEUA 3U48A 4G5HA 4DV7B 1JHOA 2H65A 1ZESA 2P3OA 4HAOA 5A9TA 2C95A 3B8HA 1DADA 3GQBB 4OSOA 5TF0A 3WGHA 4ARVA 1AT1A 1E4YA 5DNWA 1H2XA 1VI5A 3QX9A 4JR1A 2G72A 4J0QA 5JRDS 2AFHA 2ECFA 1QO7A 1Y6QA 3HTXA 4BO1A 5MF6A 2MR6A 4HYYA 4I5FA 4EYQA 2F3QA 16PKA 3LDHA 3N58A 1R0ZA 4PRYA 5HS6A 2OR3A 1BTOA 3TFWA 1LI4A 1VB5A 4D9MA 3Q7RA 3DBRA 2IYAA 4IPTA 4DC0A 5JNSA 5ERYA 4OHCA 1ISJA 3PLNA 2Y66A 5EJ4A 2QUKA 1PJAA 3VI4B 4DR3B 3L0PA 5ITZB 1QFJA 1AHHA 5ECYA 1Z9BA 2BEVA 1K5DA 5IYZA 1OZGA 1YH3A 1JDUA 1KRHA 2VH1A 2A5DA 3HUEA 4B2LA 3UHJA 3ANXA 4CLRA 3JQPA 4MCJA 1R8XA 2CW5A 3ZIDA 2AXEA 2VJMA 4MUBA 4N40A 3V1TC 3SYMA 1AN0A 1RWWA 4BTVA 1FTNA 4Y2XA 3ME5A 3UXHA 3LTNC 1IVSA 3A4NA 1ID8A 2Z5VA 3IMFA 1PW7A 1RXYA 2FYTA 1LI5A 4Z3DA 1E1RD 1C8VB 1OTHA 2R6CA 4OUDA 2GN4A 3WG9A 2RGRA 3WKDA 3EZ7A 3WHKA 4Q1CA 1EBUA 1NT4A 1JSZA 4FHEA 4UKDA 1VBMA 3ZU4A 3G13A 3ZDRA 1RZVA 3PWSA 1PX2A 1DI0A 2PSEA 3FVTA 4DSUA 1ACJA 1OKKD 3V8RA 1F6BA 2HBYA 1V5EA 2J0UB 1GQYA 1E6MA 4POOA 1Y37A 1Y1PA 1Y9JA 4F2WA 2RK3A 4YWJA 1F5NA 5CLGA 2H9IA 3WLSA 3AL3A 2P3QA 3NONA 1YQGA 4Q4JB 2GZRA 5AJUA 2R6HA 1PSDA 5D7BA 4JUIA 2XNDA 2G67A 4GDMA 4W6ZA 2IV3A 4D9BA 1I0ZA 3DAFA 3LPMA 3PHCA 3COVA 3CJQA 4GZMA 4UUPA 4CCYB 3GLFA 1T0PA 4BNWA 5ILOA 1GSHA 1BXRB 2OSBA 2Z8YM 3H87A 1I4LD 4IOKA 3HU2A 3GFOA 2K5UA 4OP3A 4UPVA 4MHTA 3P9PA 5MN5A 1W48A 1A9PA 4K3UA 3PTLA 1M0SA 2YXEA 4NK5A 5HQ3B 4RTKA 2PQ6A 2P9ZA 3S8EA 3PHGA 3QYAA 1C9YA 4AK9A 4AZ3A 5IXJA 2VAVA 2H4XA 5HJ2A 1K7SN 2ONCA 3CUEF 3DZJA 1LRLA 1RLIA 2R6FA 3HNOA 1KJYA 1VL6A 2FK7A 4N3NA 1NC3A 1YA6A 4JLAA 4X7PA 2H2DA 2FRDA 1V11B 1NW8A 1XZEA 1DIRA 1XQ1A 2VQ6A 2PS3A 3H9EO 2C97A 4C4SA 2A1TR 2PGNA 3ZYZA 1ZISA 1HO3A 3T3NA 3FYDA 3C2QA 3AIKA 5CBKA 5ELLA 2B35A 4O4LF 2IA5A 3VPSA 2H31A 3OMXA 2VP6A 2GD6A 2ST1A 4KRYA 4RHXA 3S44A 3TNYA 4G5OA 4Q1VA 3CH5A 4UEJA 4L8YA 1MVOA 4OK5A 2X0IA 3ZW7A 1B73A 4MUYA 3TJMA 2B98A 3ZD7A 1TO1E 2G0NA 3AERA 1PL6A 3WDLA 1E3DA 1KY3A 3CCFA 1KEPA 3ONDA 4R54A 3F3SA 4X63A 5F23A 2PL5A 5DTRA 3O9ZA 2CYCA 1BROA 3C3DA 4MMYB 1GPMA 1PT9A 3EVTA 4PLYA 1FZTA 3OICA 3G7NA 1OJLA 3BQNB 4FSDA 1E3LA 4TS1A 5IDWA 2J59A 2XIQA 3LRTA 4G8DA 4TLLB 2WY2D 3E18A 2CNBA 1UPBA 2FKNA 4RIEA 1QLHA 3KUDA 4RHCA 3PV0A 1QGUB 2XZDA 2CJXA 2B9VA 4YJKA 4D4GA 1A7AA 3E2IA 3A05A 3EAQA 2XZLA 5I8ZA 1JL3A 3OU2A 1EGMB 2A35A 2JD0A 1XU4A 1DO0A 3WGJA 3U1BA 3K53A 3R8XA 1JAIA 4EHJA 3M4ZA 1SCAA 3HR7A 3Q3GE 1ZJ5A 2XW6A 3N87A 2JFNA 2V5AA 3PQFA 1EH5A 4WN9A 4YBRA 3FKQA 1SIUA 2JEYA 3KLBA 4C5CA 4IX1A 1Q1NA 2O2GA 3HWRA 3QFRA 3GARA 2HU8A 4UE3S 3NHPA 4M0PA 3ADKA 2Y1FA 3G0GA 1BVUA 4P3OA 1SNYA 4C4YA 1VQ1A 3DLIA 3BD7A 4WHMA 1M2KA 3T1HB 5EWJB 1DJNA 3LXRA 4YRTA 1UBLS 3THXB 4B3GA 2EKBA 3VPBA 1GA6A 4L4RA 1WV0A 3LW8A 3O91A 2I8AA 1R74A 3N7AA 1MORA 4RVOA 4DCTA 3T0GA 3F5DA 4E5YA 5K0CA 1IDOA 2C7BA 4OLFA 1OW3B 2GO7A 4KQCA 1NBOA 2XITA 1AG9A 2W6JA 2OGWA 2A86A 3DHWC 3K35A 3L84A 4G5GA 4G36A 2VAXA 5E8RA 4ZT3A 1QRUA 1IE3A 2QLBA 1Q14A 1B0PA 2O8CB 2FG7C 1J33A 3OIYA 5HXAA 3I45A 1C9EA 3O4JA 4MKXA 4M7OA 2IPXA 4PE5B 2VLBA 1NZJA 3KEQA 3ETEA 1N25A 4BVFA 3I1YA 2XNCA 4NV0A 1O96A 1VJGA 2OG1A 3KQOA 2XMZA 4PRLA 1L7PA 1VIAA 1K8XB 1ODSA 3R7BA 2Y2UA 1YE5A 2P1ZA 1VPEA 2XCSB 1ECPA 1WXGA 3QNUA 2BE7A 2QN2A 2YYZA 3NGLA 3RGGA 1MEJA 4FI3C 5C52B 4QDJA 2GN2A 2XF8A 4KMSA 5H16A 4Q1AA 1U0OC 4DC9A 5CFZA 4LHSA 3A6HA 3M83A 1XXHA 4ZJZA 4OY3A 2EX4A 3SX4A 1T36B 4LOLA 3PDIB 6REQA 2XADA 2BUAA 3P45A 3O73A 4KXYA 1KI9A 3UZUA 5HM8A 4TSFA 3WZMA 4FYXA 3O8LA 4NJEA 3RW9A 2PV0A 3REFA 1MN6A 3CEAA 3E05A 4WJZA 5DTMA 1WBDA 3ZCSA 3RAEC 4RGYA 3FPHA 1P81A 2JGRA 3QNMA 5BYBA 4BFSA 4C0SA 4GBMA 1JG1A 2BONA 3IYLW 4QARA 1K3FA 3HB0A 3C3KA 4N7RA 1A4RA 1RAGA 1MJHA 1Y8RA 2PA3A 2BRUA 2V1XA 4LBVA 4EKDA 4UOQA 3EDCA 3IAS1 4WXYB 4XFDA 1YXMA 3WGYA 1D1PA 1WSBA 2QN3A 4JSRA 2Q0XA 5DYGA 3IVCA 3DD1A 2GS9A 3BA6A 2H92A 4ME6A 1J2TA 5BW6B 5BP7A 3B6IA 5BQFA 3BGOS 1J8FA 5M7EA 1XRSB 1YUNA 1OWMA 1DC6A 1P1FA 1NHWA 1E20A 2XXAB 2BP7B 1U99A 3G2PA 5FJIA 1MABA 4TZTA 3PICA 5KCMA 3AR6A 3CLKA 3H1TA 2GBIA 4P7KA 1P72A 3M5CA 5CDHA 2C5GA 3ZVLA 1FVXA 1ZMTA 1LBEA 3ILHA 3DCIA 5EWLB 1AN9A 3RF7A 1Y81A 1D0IA 5C7LO 3BOSA 2BTQB 2ZEJA 3EHDA 2O5RA 3MW8A 4KGXA 1ZITA 4Z8YA 2Q7DA 5KNLA 2JLVA 2ZE5A 5FBWB 1RQ7A 4H6WA 2IH5A 1GKKA 1RCTE 1PHRA 3CF4A 3KKPA 4GLJA 4DLTA 3G89A 3QBJA 1D8TA 3KSAC 4RH0A 2OD9A 4BJ1A 2BLNA 3VR6H 4EKGA 1FS5A 2RG1A 3I58A 3BJIC 1PL7A 4MWOA 3G2OA 4HGQA 3PGMA 2IYSA 2V7WA 4A2WA 2QTAA 1X1TA 1KAOA 3VO9A 4EDHA 3A1UA 1NI4B 2J3JA 4G9GA 1IY9A 2IIBA 4YRCA 3B7GA 2XD9A 3E4CA 3FIJA 1XA0A 8MHTA 4YCNA 3JPWA 4FOTA 3RUEA 1KQOA 3KFXA 3VVBA 1R6DA 3EPJA 3CX8A 1NA5A 4AP6A 2CMDA 3MIIA 4AAYA 4KR6A 5T8KA 4XUGB 1T2VA 4B6EA 5JJBA 3AIIA 2O7NA 3V6MA 2AW3A 3P2JA 3ZWKA 5CM2Z 2AFIE 2GO1A 3KL2A 1KP2A 2P68A 2AL7A 4GOKA 2FPGA 3FCXA 4QPPA 1NXXA 2X6TA 3AP2A 3IJPA 3MXOA 2FKAA 2I7TA 4NICA 5CK5A 4HB0A 5IAJA 1KQNA 5FWDA 5JD3A 4CQMD 3KSZO 4QT4A 3M89A 3CPSA 3PJEA 1XNQB 4CKCB 4DDUA 1JPNA 1L7DA 3M7IA 3V6LA 3HA3A 4C3VA 3SQDA 4X1OA 3R0QA 1DBQA 2Z2ZA 3CEHA 3OZBA 1CCWA 1R6AA 2OBFA 3I1IA 5SZHB 5LP6B 3F6BX 1G5PA 5IVKA 1XLWA 1OLSB 2Y76A 5DKFA 4C7OB 1O97C 1EGHA 5J5CA 1TMYA 1SD2A 4O1IA 3WNVA 4L8LA 3HABA 3IO5A 2O1XA 2AKEA 2AOTB 2AJDA 1I9CA 4NJMB 3ABIA 3K0EA 3DNPA 1I6MA 1OAOA 4JLNA 4RWZA 3GT4A 3MWDA 2QW0X 1BEZA 3FVQA 2RAFA 3OHSX 3DR3A 4H6XA 5DVZA 5FTWA 2DY0A 2EKPA 3L06A 1C9MA 3DZIA 3IESA 5B1HA 4DA0A 2F67A 3HCAA 1YR1A 4K6MA 4YCDA 3HCFA 4KW7A 4TSKA 1C1XA 3WIUA 3H13A 2IYUA 1II9A 3HDHA 5K3DA 4DJJA 5LQNA 2PRJA 3VDRA 3SEQA 1HV8A 1ZIPA 1XD2A 1EK2A 4Q4CA 5A0VA 4W99A 3EEQA 1L1FA 2ONKA 1CQZA 4P5EA 4YRJA 3TNJA 4HXFB 3BSWA 1SY7A 3RV4A 3V80A 3I12A 2OHFA 1KVSA 4XRRA 1TUBA 5CA0F 5JZBA 3UMYA 3RRXA 2PSHA 1SCDA 5CG1A 5A4JA 4XM2A 3U6BA 2I2CA 1EJBA 4CM4B 1AGYA 3DTVD 4YPOA 4C4AA 2F3TA 4ZYWA 2F1RA 3EY4A 3HBMA 4LZLA 2DUWA 4Z9BA 5LD2C 1ZBQA 5ICEA 4EKNB 3D3WA 4UTVA 3AMVA 3HXQA 2P65A 1BMDA 3WFJA 3EEYA 1Q3KA 4ZI7F 3QPWA 2WEKA 4GSKA 4PX2A 4IKOA 4AF7A 2IZ6A 3VO8A 3A9UA 3O83A 2XKBA 1O9BA 1SC4A 2RONA 4WNYA 4NX2A 3IIEA 3AI7A 4IH1A 4MA4A 4NOMA 1CUAA 1G7CA 3BFXA 1N5DA 4M0UA 5EMJA 4QOHA 3TEFA 4XTRA 5CLJA 5FJJA 2RKBA 3OY7A 3WWZA 3T9EA 1YU6A 4W6QA 5LZ2A 2W4QA 3LFUA 4D9JA 2R9VA 2QDXA 2AIRA 1A9TA 4LQ4A 4BATA 4J8PA 5LOVB 5EKTA 3QMWA 3RAJA 1J0DA 3I9FA 5J63A 1Z3CA 4DZZA 5CFRA 1FUEA 4E32A 2J3KA 3OPMA 5EL0A 2YR0A 4ZZ3A 1YZQA 3GJ4A 4LE1A 2OE2A 5CHYA 2Z98A 1T5LA 5CB0A 5DV9A 3TZQA 4AL4A 4QGGA 3VPXA 1KH2A 3VJLA 4E4YA 2AVDA 5CB4A 2GFIA 5JNRA 3F5MA 5JUWA 1UJ4A 4GP6A 3IPRA 4GM1A 4KODA 2RGUA 2IX3A 2AG8A 3ETDA 3PF9A 1AS2A 3GHHA 5K3AA 1J0EA 1QV7A 2EYQA 4HVTA 4HLNA 4Q9NA 3TW0A 3DZ8A 1NVUQ 5K0GA 1KP9A 1MFPA 2XNJA 3MN1A 1APBA 1UQUA 5B2FA 1EE9A 1Z6ZA 4ND3A 2QTFA 4L5YA 2NUBA 3ZE2B 4UPDA 1T4BA 4R1UA 3H5AA 1JI3A 3N6RA 4KPUA 3RUPA 2GH1A 1A5TA 2XYQA 4B6RA 2X9VA 1TJNA 3QA3E 4M49A 4RD0A 1T1GA 1S2LA 1TEVA 2REBA 1BGVA 4TMTA 2UVDA 2BW0A 2JGNA 4TQGA 2BJWA 3RS7A 4UM9D 4F5DA 2IPLA 2IODA 2OCDA 5F2EA 1KJZA 4GXQA 2CNNA 1UZAA 1XXLA 4ZDIA 2XCIA 4KYVA 3F74A 4Q47A 4QD3A 3LP8A 4IHJB 4GM4A 1ONSA 1DAPA 1MC1A 3HZZA 4C89A 5ICGA 2PUEA 4Q4JA 4KXWA 3T99A 3JWPA 2F3PA 3F6PA 1K2WA 1V6SA 2LXNA 3IC5A 4Q9DA 4X84A 1JAZA 1GRVA 2JEOA 3EWSA 2R7AA 1VBKA 3X3HA 1J8QA 5AM1A 3FPEA 1Q0TA 2B94A 4ENUA 1DQRA 3ZVMA 1RMYA 4N5LA 3QG5A 3I2JA 3EUEA 3QKWA 2M6LA 1NURA 3O0DA 1DC5A 3TMYA 4RABA 4B17A 1DIAA 4MKHA 5C1OA 2PUTA 2OVBA 2XJ4A 1QG0A 3L0YA 4RSRA 2VWHA 5EIXA 2CUKA 1U65A 2VZLA 1F20A 4HI0E 3AY0A 1OWNA 3F2IA 1RXVA 5JSKA 2A7XA 4X3PA 4JD5A 4QFCA 2IIPA 1GPUA 4JR2A 4TV9B 3BA1A 2D7DA 3BFVA 2CL7X 4HAIA 4HRYA 5CT6A 1D4OA 3WLEA 3L8DA 1CYEA 3VISA 3DV2A 1ORDA 3EXFB 2PT6A 3O6VA 3QQ5A 4S1PA 2I2BA 4M2LA 4C7KA 2ZIAA 4QRHA 5CGZA 1WHTB 2SKCA 4PG5A 1NOJA 2QEQA 2RHHA 2VWQA 2ZRJA 3KXDA 2AE2A 4QOSA 3TXAA 2PAFA 3G8BA 3GA0A 5EQTA 1QPGA 4GPEA 3L41A 3TF5A 4MKIA 1RLOA 3QLTA 4LA4A 3KBOA 2JKVA 4PAWA 2AOWA 3SK0A 3KVOA 4BNUA 2CXSA 4CM9D 4DV2B 4K5QA 1TM7E 1U2DC 5EFZA 4AKIA 3G0OA 1Q3HA 3HGTA 4NNPA 3GFFA 4R3UC 3OZGA 4KAXA 2VF8A 3TRDA 4QRDA 1U6JA 4X3OA 4HSEA 2G82A 4GBJA 1NKSA 4RELA 4BP1A 3WV4A 3RYCB 2JHCA 3BL6A 3GEDA 3EGWA 5CLQA 2EX0A 3UFBA 4HZUA 4BO5A 2WSYB 4YQEA 4UNRA 4C87A 2JFGA 4FU0A 3BL8A 1VGRA 3WYNA 2NU6B 5EWMB 4N7MA 4BX9A 4TMVA 1JLSA 2R6ZA 3DOIA 4RCVA 5E7IA 4EJMA 3EFBA 2W2LA 4U2CA 3L7BA 1MPTA 4OBXA 5HEKA 2WVGA 4TMWA 3ZPXA 3EFEA 4YYZA 3FPJA 3HG7A 2YYAA 2IS2A 3Q5DA 2RB5A 4K1LA 2WT4A 3GZJA 4WERA 4G65A 1AKQA 1T1SA 1M75A 3JYOA 3K2QA 4IKPA 4M6WB 2CCKA 4QM6A 1X1AA 3NOOA 4RDXA 1JHXA 3DKVA 2QTVB 4H6PA 2Z8ZA 3WLLA 4B2PA 9ABPA 3LPDA 1P2VA 4IS2A 3DCJA 3EIEA 4CEIB 1P39A 5AM2A 1DCFA 1WULS 3O3OB 5BN3B 4UQOA 5IS2A 2HK6A 3CZRA 1Q17A 3CUKA 3EDOA 4NZMA 5CITA 4MUFA 3BWEA 4NNOA 3QV2A 4GE0A 3U4IA 4OU5A 4OUKX 3UYKA 3Q9NA 1WABA 3UQYS 1SUPA 3EZ6A 2VTDA 5AJVB 1B4DA 4EI7A 5GV8A 3S5UA 2G5TA 2HK7A 4BZZA 1V48A 4L5AA 2C82A 3LK7A 5CGQB 1XJ5A 4YJ3A 2P75A 2VF5X 4AZVA 4EARA 2FF7A 2M9MA 3S70A 5GGYA 1D5CA 2C29D 5E9QA 3PUWA 3PGKA 2ZVJA 4NG5A 2BSAA 2BH9A 3EY9A 4AX8A 4LRQA 2CFSA 5KJ6A 1UDBA 4PQYA 1XG5A 3UVEA 3EXHB 3IAUA 3VV3A 4TV8B 3UT5B 4WZBE 3NHMA 3D4IA 3QUSA 1YB1A 2WKSA 1E9FA 3FYTA 2FZLA 2Q3LA 3NYQA 4J7CA 3I5UA 1H1DA 3BD8A 2C2OA 1HRDA 3ILXA 3L7KA 4K86A 3FR8A 3I3SR 1UUFA 3IMEA 1UKYA 1RIIA 1A82A 2HWKA 2FDCA 4W9MC 3MT8A 4DDKA 2YIJA 4XI9A 3KTAB 3I05A 3I76A 1HE8B 2HV9A 5AK0A 4OX9Y 3OZFA 5JWRA 3REQA 1N2CE 2IF2A 4R1LA 1NF2A 1Y3BE 3LO5A 4RD2A 1KRWA 1K0FA 5K09A 3HL4A 4ZVQA 3OC6A 2QRNA 1NW9B 2UKDA 4DEXA 5K8VA 2QV7A 3VVMA 2I66A 5EJAA 2FPOA 1XR3A 3VR4A 1GQ2A 1RQPA 3EFOB 2IXTA 5JC1A 4MWBA 4QG7A 3BRWD 2FXVA 1ZM3A 1E9SA 4CM3A 1O5IA 1XTTA 2WTEA 1HNWB 1KI4A 3WRYA 1U0HC 3SZMA 2IHTA 3P9RA 4TYNA 1JXMA 4LECA 1DQPA 4BXOB 2WIDA 2PL9A 3M9XA 5K3FA 2OCGA 3MCAA 3MHPA 3V48A 5IMSA 7REQA 2B8NA 4TWBA 1OE0A 1R10A 4R2LA 2R2AA 4XM1A 4H7JA 2VDUE 3SC6A 4YUAA 3P2MA 3A6ZA 3PHHA 3UFXA 4JGIA 1DAIA 4KH1A 5HG0A 3NH6A 4OFXA 2ZKIA 4ER3A 1N5JA 3A25A 4J0KA 1NSTA 5DGXA 3AEYA 2AYYA 4B3MB 3ZN2A 3MERA 2BY4A 1QWOA 4EB6B 4Z4EA 1ODTC 5FPTA 2DTDA 2AMLA 3ZJUA 3FMOB 5FORA 2L17A 1U8YA 4WSOA 4B44A 4F2HA 3KU4A 3OOEA 3WAJA 2AUMA 1R2QA 2QBYA 4YJ2A 1NMEA 2WU0A 2AFVA 4B33A 4IWNA 4N6NA 4HOYA 2PLRA 4IYRA 4ZEVA 4OXNA 1I94B 3A37A 4BKUA 4KQXA 4Y2GA 3FGPA 1RWQA 1G21B 2EJUA 4B35A 4G9BA 3SJAA 2M6KA 3AVPA 4HXYA 4EG0A 1WDMA 2VHTA 2QE7A 2KX7A 3QUAA 2VOEA 4K8RB 1RTKA 4NPCA 1LFDB 1PO7A 2GRUA 4NZ9A 3AFGA 3DV9A 4C01A 3U19A 3QVLA 5BQXA 3LUBA 2AG0A 4I7EA 2G4LA 1TM3E 5ESRA 3DLHA 4DWJA 2FUKA 2FUG6 2JGDB 1SPXA 3FLMA 4ZQCB 1FQKA 5LSAA 4BQIA 1JVBA 3AIMA 5TPWB 4PX3A 4AXXA 1W8DA 2NSYA 3O2JA 1G3QA 1CDEA 2B82A 5LQUA 4ALMA 1NJFA 4G5FA 4IVQA 2PMFA 4PQEA 4ZMSA 2C4TA 3L8FA 4IH4A 1Y3HA 2NP6A 2HK9A 2WM8A 1U2RA 1L5KA 3SHWA 2IYYA 3DFKA 5I9TA 3DTVB 2EKZA 2FV8A 2WSBA 5D3MA 4C08A 1ZN2A 4IRMA 1X1DA 1N6PA 1PV2A 2JI6A 4FGKA 4TQ9A 5KUTA 4WT7A 3STTA 1A7UA 1MZPA 5JV5A 1CERA 2FW9A 1ZYUA 3MJSA 1MAWA 2VPYA 1PQPA 1TUEA 1W52X 3QLUC 2NV0A 1A9OA 4AO6A 5K6AC 1PSWA 3SLRA 1BQEA 4YH1A 1COZA 3T1VA 3R8FA 5KI6A 3QXHA 1A1SA 4A6EA 3U4GA 1S6YA 2GK6A 2OHGA 3OSZA 1DRKA 4NFLA 2EEZA 5BO5A 4ZK2A 4QXRA 4MUJA 4XQ9A 2VSXA 1HKHA 1SAYA 1TAQA 4QYXA 1VB3A 2RI1A 3BERA 4KSYA 1E3MA 1OVGA 5LZ5A 3IKLA 3URMA 3UK2A 2AK2A 5FB3A 3E3OA 1I7SB 2EFHB 1N5KA 2HIGA 3Q9SA 1N2IA 3PX2A 5FBRB 4R51A 2Q0SA 1G4HA 3UBMA 1VYUA 2EX1A 2GM9A 5C8XA 3OQ1A 4F5ZA 5J1SB 4PLZA 3GRUA 5A9RA 3CVYA 2BJVA 2ZI7A 1KQPA 3A27A 3P9SA 2P69A 2NTNA 5AKYA 3STVA 1JE0A 2C7VA 2CL6X 2BC9A 4HN9A 2BI7A 3I0ZA 4MAFA 4BMPB 4QOFA 1M10A 4TLCA 3CNBA 4LF9B 4YP5A 3KZNA 4MCHA 1Z6YA 2JK1A 4YN3A 3GLQA 1VKRA 1ZCJA 3KZMA 3GJ0A 2GHQA 3L6CA 3QLVA 6NULA 2JJ1D 4JL8A 4KRFA 2YICA 1DG3A 4IIEA 4NIMA 1ZRHA 1XZBA 1S2IA 2C2MA 2EKDA 5CP8A 2JIZA 2GTIA 2XB4A 4CMIA 1MO3A 3CGWA 4I55A 4LVUA 3WB2A 4CIYA 1BU8A 1P0IA 1SBTA 1W6UA 3AW9A 3G9UA 3KKEA 4MVJD 3SYKA 2BGTA 1B6GA 1OKKA 4GQIA 1U63A 5L3SA 2ZE6A 4BL5A 4CHTA 5I7HA 1Y48E 1Q11A 2XB6A 4URHA 1Z28A 3AP3A 5I9SA 1CF9A 1PS9A 3HUUA 3PUVA 4TRNA 4OX9B 2GUGA 3QM1A 2N47A 1PFWA 1JILA 5CXXA 3F98A 1E0KA 3FFWA 2D3TA 3I4CA 3R77A 1E3TA 4MYUA 3ZS9A 4D56A 4EW2A 1TK2A 3BMNB 3EFHA 1VPWA 3BKXA 2F1HA 5B7QA 3K5PA 3QVWA 4O4JF 3Q2IA 2BKEA 3AGPA 4NOKA 2RK4A 4EJSA 3DFZA 4ZQGA 2JRLA 3P9NA 1WKBA 4GF5A 3MXTA 1NF3A 1FRVA 2PZAA 3ABRB 2DGDA 1E32A 1W59A 1CDZA 1ZIOA 1IULA 2B8TA 1ZAKA 3I3OA 3AXSA 1H42A 3JD2A 1H8EA 2PX2A 1GRCA 2ZJ7A 3ID6C 3GLIE 3BULA 2GXAA 1FJGB 3X2FA 3H2HA 1MC5A 3EWIA 3C6BA 1WMEA 2ZXUA 4WKOA 4L16A 2RI6A 2YHUA 1THMA 2RHLA 4G1FA 3G2JA 1FRFS 2QP4A 4DCUA 3OFSA 1K88A 3W8DA 1Z38A 2RKWA 2C3UA 3JQAD 2I1QA 4O4IA 4TLEA 5TS2A 4CKBA 5JD4A 4N0EA 1NVVR 3L1HA 1M1NB 2JBAB 3GGGA 3K0KA 4HWGA 1VCMA 3NWOA 4IY1A 5ANRB 4DM7A 1AO0A 2VT3A 5KKAA 3Q8MA 1E2LA 2QENA 5F9HA 2GBCA 4X6YA 4GX0A 3V4OA 4AUEA 3WLFA 5GINE 3WGLA 4E46A 1BHSA 3C3WA 1XJ0A 3HKCB 4YA6A 3BIFA 4QXMA 2R7MA 2V6JA 4PYJA 1SELA 4XZ3A 4OHZA 1UMKA 5HA5A 2ZTMA 1G1AA 1DBWA 2IZ1A 4CR6A 4PNEA 5LNK1 3SFZA 4E5UA 3F1LA 4WK6A 4ALKA 4Y2RA 3DEJA 3QBDA 3O8QA 3S4YA 4KBYA 4RMHA 5JCXA 2QVBA 3E8MA 1N1GA 4GPZA 5LJLA 1K27A 3BHNA 3NTOA 5BN5A 2C88A 4JJKA 1DBVO 2OQVA 3T5PA 1RJ9B 4O2LA 1AXRA 1T8TA 4WA8A 5BV7A 5G02A 2KS6A 2XTJA 1GR0A 4PZZA 2H1FA 1W4RA 2WTUA 3AV0B 2ZI3A 3CW2A 4EOGA 2QNBA 4CF7A 4YUYA 3PBKA 3CKYA 4UUOA 5C0OE 3WA6A 4DV4B 4B7AA 3S5JA 4A0GA 2W11A 4X71A 1OBCA 1ZNWA 1Q7TA 2XWJI 3F4KA 4TV9A 4QEKA 1FPMA 1XDZA 1MF7A 3L1JA 4QJBA 4WK0B 2HSEA 2IPAB 4WXRA 1D04A 2VSFA 4QC2A 4WXEA 1PWXA 1Q7EA 2F9FA 3OE7A 1CUSA 2BOVA 1I4DD 3KB6A 4P35A 2II6A 4ZHQB 1C29B 3KYIB 4DA6A 1LBHA 4G0YA 5IANA 1JJBA 2BF7A 2ZRKA 3HADA 4AULA 1QM5A 4DNPA 1KK1A 3DD5A 2KQUA 3T5TA 1QJ4A 1H3NA 2R0QC 1K7YA 2PZEA 2R25B 2D8AA 1NBWB 2R8RA 3DWGA 3RG8A 3TJRA 1UBFA 2VDOB 1SKYE 3D0RA 4J16C 3SCZA 3VTKA 3CF4G 4TWJA 3CRZA 2ATXA 5AVJA 3E22A 2HMSA 2X58A 4YT8A 4D4IA 2WG0A 2GILA 4KNVA 4B6PA 4PGAA 1QQBA 2HF7A 5EZYB 1UCFA 4N0MA 5F3DA 2YS6A 2IKSA 3L02A 3UWMA 4D2IA 2OAGA 2JJMA 1C0LA 2G4VA 3I09A 1R6UA 4RJIA 1E9CA 4H31A 2WFZA 5BV1A 2OV6A 1PZEA 3PXDA 3NEPX 4KVFA 1DKRA 2H48A 1TM5E 3VR5H 4PFKA 2QTCA 1G5FA 3GAFA 5CURA 2DZDA 6ABPA 4F12A 4DR1B 2KB0A 4G8CA 2XNHA 1EINA 4QYTA 4XCVA 2G3YA 4EW1A 6Q21A 7MDHA 2WR8A 4LNUB 4EGJA 1QIHA 2BGGA 4WOBA 3NTUA 1DXYA 1V5WA 4FOOA 5BSHA 3FM9A 4Q16A 3VKGA 4XLZA 2WQ7A 3PQDA 1FMFA 2HTFA 4ND8B 4ZAVA 3ON5A 4RZ2A 4ZVPA 4QFBA 2ZAMA 3EG9B 2Z1NA 3MIZA 1KH1A 2FSVC 2CZQA 4IO0A 1YR7A 2ZR8A 2O05A 1U04A 1C4XA 3PE3A 2QN6A 3VNSA 3KPYA 4D9CA 1TQ4A 1SCIA 3NC1C 5KCZA 4LSZA 1J5EB 3WZLA 2IGBA 1VKOA 3H5WA 1YRWA 1OC4A 3HVKA 3IQZA 2NUTA 2VXBA 2XVXA 1IHOA 1WZNA 1TJ3A 2VP9A 1NKVA 1J0BA 2XUHA 3KD3A 4OB8A 2PXXA 5TC4A 3SIPA 4TMYA 3CKKA 4ATNA 4EF4A 2GEVA 2WD7B 3S2GA 4YR9A 3KUCA 4QSHA 2AFIA 1P9LA 1QIEA 5JJLA 3HZRA 4BQQA 1Y6JA 1H22A 1PG5A 1VIMA 3FRJA 1YD7A 4LVOA 3L0SA 4TL7A 3TKYA 2WMNB 4LRSB 2Z2YA 1LX6A 3ESBA 4W5NA 4JX9A 2AUTA 3PXXA 3KEFA 4MQBA 1R0BA 1QTIA 4YV0A 4ZQHA 4FK8A 1PZNA 2HIMA 3PWKA 3HYSA 3F9CA 3N0XA 4FOSA 4YUZA 4CM6A 2Q4TA 3P0EA 5D85A 1OYVA 2GBLC 1ODLA 4CI0B 1H6AA 1HT0A 2J6CA 3F5FA 1R27A 3RAFC 1E9EA 5DYNA 1YZLA 3N0VA 4WASA 3UXMA 1WZUA 3OE5A 3MFYA 4PZEA 5AKLA 3WO0A 4CTKA 1SCUB 3LS2A 4MZDA 4A36A 1LU9A 2EZ9A 2XUGA 3LNCA 2Q4RA 4DMFA 1Y3IA 4RIIA 2PBZA 4OD0A 4RYDA 2ZM6B 5B7GA 2ZULA 3N2GB 3IL2A 4XDHA 1QU3A 2I5PO 3SC2B 1RWMA 3HJAA 6AT1A 4ZEMA 4BGDA 4ER6A 5JDCC 4V0KA 4ZRNA 4BAZA 4D4MA 1K97A 2I8LA 3DFIA 1ZM7A 2UZ3A 1GILA 1XNHA 5IFKA 4RKQA 4P5DA 4E08A 4I6JA 4V39A 4MK4A 5E4JA 2R66A 2A1UA 1YZNA 4GLLA 2P9HA 3AKZA 2GKOA 3NTRA 3KQSA 4CGYA 1JTEA 1FYVA 1FDTA 1YZHA 2IZ7A 2PZGA 2BZGA 2PMCA 3BQMB 3DMGA 2ZSUA 1QKKA 3DBOB 2CV1A 3FTNA 4EHKA 1KGSA 1DAEA 3GYGA 4GOND 4JELA 5CLLA 2OHXA 2L69A 3NLLA 4UUMA 4QLOA 5FV4A 3M9LA 1WZIA 4K05A 3OIFA 4FB4A 4LMRA 3QJ5A 3LL4A 1G17A 2OUIA 1GPAA 1GGHA 3VU9B 5JVDA 2PD3A 3K72B 2K7ZA 1RXWA 4X24A 1NRIA 2CFRA 4NQZA 1X7DA 3UV6A 2BZ1A 1OBFO 1FW6A 3DDSA 5DX1A 1GDHA 2D06A 3B51X 1BNCA 1ZH8A 1FNSA 3ZH2A 5ALIA 4TZ0A 4WFKA 4FGSA 2CWDA 1DRVA 4DE5A 1TQDA 3RANA 3WX0A 3QE0A 2A9PA 1O5OA 2V7UA 3O8OB 1JEAA 2YWDA 3RSOA 1OYYA 4BLSA 1U7TA 2B20A 4F4HA 2BFNA 2JL1A 3K9GA 3OJLA 1ZR4A 3Q87B 5TPWA 2BBTA 5ADVA 1LSOA 1ESZA 5BOSA 1QAQA 3AM4A 1HSZA 1D6NA 1J5PA 1KK2A 2NZVG 3PRHA 3B6JA 1FTGA 2LRHA 4XE5A 2CZGA 4AJ1A 3CYFA 3QWFA 4EG1A 2D5BA 4RESA 3P19A 3UHOA 1QE3A 3ISVA 2I4TA 1IY0A 4K46A 4W5RA 1N0VC 1Q1AA 3F3YA 2O8FB 4BX0A 4GEKA 4GYWA 3MQ4A 3Q98A 1UDRA 3STYA 3DLAA 3H9QA 3IAHA 3PNYA 3RTAA 1JPVA 5FBQB 3ZUPA 2C8KA 3G8AA 4QJ4A 3N0WA 1UC8A 2DULA 2GOYA 1OV6A 4NBUA 2G6BA 1Q50A 3OE4A 4V03A 3TLGB 4Q1EA 2B7LA 4IDCA 2F3SA 2E5LB 5B58C 3MG9A 3OQMA 1E7MA 5T4BA 3V32A 4KG7A 1LJUA 1I80A 2O0KA 3P4YA 2PM8A 1ZL2A 4WOJA 4W8GA 4BV8A 1GG2A 1NSFA 4CKWA 3PYLA 5MFPA 4EPVA 2Q07A 1JR3D 1C7EA 1QYWA 2G7ZA 3L49A 3W04A 3M8KA 3MS7A 3ROMA 1VMIA 1OX6A 3R5KA 1A2BA 1DAMA 2PGLA 1T5DX 2BHTA 1GZ5A 1U3CA 3G82C 3TZBA 1NP6A 4A6PA 1GVHA 3RFFA 2QN8A 3SBDA 7ABPA 5A71A 1KYIA 3E7PA 4QEZA 5E6RA 3MGAA 4HEA1 5AM3A 2ZUWA 1OIVA 2CXXA 4JK3A 1CUIA 1XN1A 2A0WA 4LRTB 1OTYA 2QLJA 1ZOLA 4G1CA 5T5QA 1V3QE 3IAEA 2R6AA 3AHIA 3SZLA 3C3MA 3M6VA 4OXKA 5E1DA 3QEMA 1YZVA 1SQ0A 1SXJC 2MSKA 1PD1A 2RBEA 3L6UA 5DLDA 4BFZA 1X9HA 3WJAA 3BEDA 1ENYA 4PZDA 1YAJA 5JS6A 1IYZA 5F5LA 1F6DA 2PRSA 3EVDA 4XWGA 2BDEA 3LYHA 4NKRA 4AMBA 4CQJA 1E96A 4YXWD 1AA9A 1D03A 3PZRA 2Q3MA 3FX2A 4EYGA 4YMIA 5HR5A 5BRJA 3QE2A 3HJBA 3LLUA 1JFFB 2H5JA 4X1KB 3EARA 5FOWA 3QVTA 5LLDA 1V5IA 3D64A 2UU9B 1EFCA 4D3YA 2I4NA 1QBKC 1BDHA 1S02A 1KE2A 2P0YA 4P38A 3THWA 4HX2A 5L3QB 3LGSA 3IRVA 1B6TA 3MJRA 1OXVA 3P9QA 2X86A 1YL6A 1CUHA 4D3FA 4EYSA 2HHHB 2KSQA 1N9GB 4G4SO 4MQLA 5U4QA 3JVVA 4WGFA 4DV1B 4WBNA 3FNEA 4JP5A 1BFDA 2UZ4A 3DDNA 2KBFA 4UATA 5FUBA 2HSGA 1CY7A 4PC7A 2PXAA 2IOFA 4JC4A 4PFSA 4E3ZA 1DV2A 3GYBA 3HYTA 2SBTA 4OGKA 4DADA 3WK6A 1J1ZA 3QG1A 3QUCA 4GWLA 3THYA 2NN3C 2A1TS 4U7HA 4BP8A 4I1OA 2V7EA 2X4GA 2I91A 4G23A 5CVEA 1K89A 4K9SA 1RWPA 3QK7A 1E7SA 4ZEOA 3VOBA 1XDWA 2PRZA 2QUIA 4TXLA 4YMGA 4MSUA 4IUCS 4H4CA 3BMOA 2H3HA 2WJZB 3V33A 3MINB 3KCQA 4ADSG 1JFRA 5CW2A 1LJ8A 2I1VB 5AW3A 5KDOA 2PLNA 2RHWA 2PT7A 3RASA 3D7LA 3I72A 1TCUA 4I8IA 3TUZC 3MOGA 2FMKA 2WZBA 4OJTA 2E4UA 4L0DA 4RL4A 2PGXA 3EC2A 5AJXA 3CSSA 4TYWA 5AJYA 2O8DB 3CKMA 3FTDA 4Q9KA 1YC2A 3RIEA 3WKEA 5TF4A 4PIPA 2ZYSA 1SWWA 4MVJI 1J0XO 1WF6A 1ZH2A 3JZIA 2NM0A 3GFVA 4QQRA 4XYMA 4UBIA 5C4IA 6PFKA 2NO4A 1JYFA 5ALWA 1AD2A 2QG4A 1G16A 1SOUA 4KFUA 3D59A 4GRDA 2Y0BA 2H4JA