1MJ7H

Crystal structure of the complex of the fab fragment of esterolytic antibody ms5-393 and a transition-state analog
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
214
structure length
193
Chain Sequence
LQQPGAELVKPGASVKLSCSSWINWVKQRPGQGLEWIGNVYPSTNYNEKFKNKATLTVDTSSSTAYMQLSSLTSDDSAFYYCVRKDFPYWGQGTLVTVSAAKTTAPSVYPLAPSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN MS5-393
total genus 38
structure length 193
sequence length 214
ec nomenclature
pdb deposition date 2002-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj7H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj7H02
4P59L 4MNQA 4FQXC 4RMWA 3DGGA 4PLOB 3S4SB 3CFBA 2VQ1B 5B8CC 1I7UA 3M45A 1MCOL 3IVKA 5DRXA 3EBAA 4OZHE 3RL1A 4N0FA 3IJYA 4LVHC 4NQCD 3VFPA 3HRZB 3QXWA 1ORSA 5C2BH 4MWFA 2P8PA 5DUPL 5MERB 3K74B 4UB0L 5D8JH 4LCCA 3CK0H 3BSZH 3ARBD 2X42A 4WCYL 1DANT 5DFVD 3BJLA 4FTVD 3O9WB 4TUJB 1FIGH 1H8SA 1F3JA 1S9YB 3CH8A 5A43C 1F4YH 1LO5B 2R0ZL 3O6KL 32C2A 4H1LA 3V7AG 4FQCH 1KCLA 2FBOJ 1N0LA 2QBWA 1S7TB 3FB6B 3MRMB 1U0QA 1VB9A 3SDXF 4Z7VF 1FFNA 1RJZA 2ZOLB 4PB9H 2QKIA 2DYPB 4QTIH 1CK0L 3ILQC 3FQRB 2VLJD 4YJZL 1RJZB 2ZOLA 1YQVL 3K8LA 4LLYB 1LO4L 2F53A 2EYSB 4HX1B 4I13B 1BFOB 1YUHA 2MQ3A 5ADOL 2CK2A 2DKSA 1R24A 1FO0L 1NSNL 1J0YA 1HI6B 1EEUA 1FN4B 3O81A 4G80B 2BCKB 4HZAA 4N68A 4Y2DA 4XCFH 5IFAL 1CK0H 4ZQKA 4R4FH 2DLFH 4D8PB 3RVVC 5FGCB 4J8RB 1WC7B 1ITBB 2YD9A 2WWMC 3IFNH 5F96L 3LN4B 3MRMA 3TH3T 1IGYA 1RIUH 4Q9QL 2APXA 4GOSA 4NZDA 1SJHA 4ZFGH 4M8QB 4U0RC 4NBYB 4ZOCA 2BNQD 4G6MH 3C2AH 5BV7H 5IWLC 3QUYA 2VISA 3CSPA 2X4RA 3LRHA 2FGZA 3PNWB 3RIAF 5IGXL 3QUYB 5D1ZC 3K2UL 4J3XA 1LNUB 2BXYA 4LARH 5EIVA 4BSWA 1Q72L 4FZ8H 5DUBA 1CD1A 3CFKA 5I73C 1VA9A 4MAYA 1OP3H 3IVKB 1CD1B 3LN5A 1VKXA 4UDUB 5E2WH 4BUGA 3FN0L 3MRNB 1HCVA 1GGIH 1I7TB 4M48L 4ENEC 2HN7A 3O6LH 3DHJA 3CCHB 4PTTB 4U1LB 3O4LA 2PXYA 2AJYH 5HVHC 2BNUA 4RFEB 4TTDC 3FFDA 4M62H 1WJ3A 1M6OB 2E7HA 3L1OH 3TEUA 1QSZA 5ACLA 5J57B 2JB5H 4QRPD 2AXHA 2W92A 2MMXA 3KLHC 1YPZE 3SGDI 1E6JL 3BEWB 3T0EA 4PREA 1AGFB 3CJJA 2CXKA 3AS0A 5F44A 2DQFA 1MSPA 3FB8B 1KF9B 3QNZB 4XRCB 2ESVB 4ZFOB 3W81A 1HKLH 1K4DA 1PZUB 1IJ9A 1V3KA 4G8GA 4OIIH 5IEKB 3E3QC 3PWLB 4NM8L 4U1GB 3MUGA 2RB8A 3MRNA 2OJZL 1D5BB 4M7KH 3HFML 2FEDD 2H9GB 4X4YB 2VSCA 3OG4B 3FO0H 5M94B 4F7MA 1CFTB 2DM3A 5JW4Q 1DL7H 4ELMB 1B88A 2EDWA 4PGBB 1DSFL 2EKSA 4JDVB 1UB5B 4KVCH 4ODUA 4BJLA 5J1TC 1GH7A 4KC3B 3AXLB 3L7EB 3MMEB 2HG5B 1IC5L 3EGSA 3GJEA 4L4TD 5BXFA 4CADA 3GHEH 3QHZH 3S5LA 2FHCA 3IKCA 1GHFH 3HE7D 4OCXH 3AS3A 3C9NA 4EXPX 4ISVB 3OZ9H 1CR9H 1D9KC 3PGDB 5EZIH 2AEPH 1KNOA 1HXYB 4DN4H 4WW1B 5CWSB 1KJ3H 2BY0A 2FECI 1MJUL 1AFVL 5I1DB 1VDGA 4S1QL 3KXFA 4WFED 5FF6A 2EDQA 2OMNA 4ELKA 3OKKA 3MJ9L 4HC1L 5DJCA 2BSTB 3H9SE 4QRPA 3SOBH 3PGCA 2EYRA 1A7NH 2F15A 2BVPB 2CRYA 1NCWL 4F8TA 5FYLL 4YX2H 4JN2A 5C2UB 1TJGL 3D69A 1BMGA 1WBYB 2CK0H 1S7VB 4P3CL 4JZJC 4F3FB 3TBSB 2DM7A 1BLNB 1WAAF 5FYKU 3O6FC 4IS6A 1MJ8H 3G08A 1Q72H 3UTSA 2DWEB 3MCG1 4HKXB 4AL8L 1K3ZA 5GQBA 1TQBB 3BEVA 3A6CH 4HCRH 2E6QA 2DIJA 2GIYA 3MJ7B 4HUNB 2V9RA 2YKLL 3W11D 1T5WB 3NABH 3RZCB 4QXGL 1HHGA 1IAOB 5FOBA 5B3NA 4GKNA 2FJFB 2NNAB 1F4XH 4PJIF 1DFBH 1YY8B 3U6RB 5EO0B 3U4BH 3GSQB 2W9EH 1QACA 4JFZL 5CEXA 1TFHA 3D1MC 3UYRL 5DHVB 5GIRA 1A8JH 3WNLA 4WO4C 1JGEA 4BA8A 1J88A 1R5VA 2BY2A 3QDMD 3MJ8B 4FFWC 2CLVB 4ZUUA 3U0TA 1JHKL 3T0AA 3L3JB 4UB0H 3U0TB 4Y2DD 3D3VD 3TP4A 5J89A 4OKDA 3TA3B 1IM9A 2VXSL 1X5YA 3GM0A 4PJEE 5EO9A 4ZO8A 5JO5A 4ZO9A 1D3CA 1NGYB 1YJDC 3B5TA 4HIHB 3TNNA 3KPLA 4X7SL 1OL0A 6FABH 2AVGA 3UROR 5ICYB 4GBXD 3RY6A 4WDIA 4PV8A 3O41A 1HWHB 1I1AA 5KZCB 4DUVA 5HTSA 2Y6SC 4DQOH 4B50A 5M95B 4GQ9H 1NBYB 2W38A 3DV6A 3QO0A 3ARTA 4LIQL 3QCUL 1FYTE 2GITA 3ULUC 1DVFD 3WNKA 4KVNH 2AK1H 4IRSC 4N90D 4H20H 2PYEB 4P46C 3SQOL 4RNRB 4OQTH 2BJML 4YIQB 2VOTA 3QPQC 5KSUB 3TA3D 4B7IA 1I3RA 5DJXA 3EFDH 1OB1B 3TO4B 5FKAA 4HIHA 5FHBL 1Z9SA 5JORA 3RVWC 4JFEB 4ODVL 1RULH 3S34L 4QHKI 3B9VA 1GZQB 1ZT7B 4APQA 3VXSD 1G9NC 1EAJA 3DUHA 1W72A 1L7IL 4Z7VA 2FL5A 4MQXD 5ENWA 1OP5K 3PQYE 1CIDA 1KPVB 1S9XA 3ZT7A 4U33A 4FQJL 4KHXH 5FUZL 4LCWE 1JE6A 2NY2D 4DGVH 1VHPA 5C07B 4FS0A 3WUWA 2IPKA 2OXGA 1BIIA 1WZLA 2IAMC 4QRPE 4YBHA 3MTRA 4XI5D 2MQCA 2FBJL 5HHOB 1FO0A 4Z0XA 3EYOB 5IIEA 3IXTB 1AD9A 1F8TL 3O6FD 3ULVH 4P3WA 4R4BB 3A0OA 4JKKA 2FJHA 2J8UB 4JFYB 4L8BB 5FDWA 4HLZG 3BN9C 3EYSH 3P9MB 3GSVB 1FFPB 3ULVD 5SV3A 2FJHB 2J8UA 1TZHA 5CBAA 4I18C 1NCAL 4KU1A 2YA0A 5EO1A 3QG6B 1IAKB 4HG4K 1MIML 4M61B 4UI2A 4AMKL 3QPXL 1P6FA 1Q0YH 1JWSB 1ZAGA 1U8PA 4FHBD 1ZKAA 5JR1H 3PE9A 5KANI 1ADQL 1EJOH 3ULSA 1XCQA 4JAMB 1ZA6B 1MCSA 5CBEB 4LFHD 3LKOA 5D7IF 4B41A 4G8FB 3F12B 1ES0B 4MNGA 2DTML 4PJHA 4C83A 3LZFL 5EOCJ 2WSKA 4WGWB 3KJ4C 3F7PC 3O6FB 4DOHE 3MYJA 5BS0A 4NZJA 3HHRB 4YDVA 1LE5A 1IZJA 1YN7B 3ZTJH 1W0WA 3GKWL 1JNJA 1RU9H 5IG7B 1YEJH 1YEHL 5KSUA 4EIGB 3MRCB 2N56A 1D6EA 2WQ8A 5A2LH 1KNOB 2NY2B 4Z7UE 3Q5YA 5TDPA 4PRID 3QWOB 5IFJB 3PWPB 1JZ7A 4NKDA 1MAJA 3S97C 4XNMB 3HUJE 4L29B 1OD9A 1YN6A 5ADPL 3A6OA 2R4SH 4GG6F 5ALCL 1DN2A 1DCLA 2H6PA 4MLIA 3U30B 3FN3A 1YEJL 1SQ2N 4GAFB 2X9XA 3G5YB 4Z7WE 4PRDB 4QXUH 3RY6C 5B39G 2AGJL 1YJDL 4YDJB 5FECB 3V7MA 1MREL 1RZ7L 5TPWL 2VO5A 4P5MB 1RIVL 4LSQL 3SCMA 1A7BA 3MNWA 3ZKQD 4HBCH 1A4KB 1FCGA 3WFCH 2QSCL 2F5BL 3VGFA 4F58L 5L2KB 2JB5L 3OMZA 4TSAH 4WUUA 4XCCL 2UWEF 2EDHA 3VXTA 5FYLH 4EXKA 4LRIC 4WEBL 5C0AB 4JQXA 4O2FA 3MX0A 5IB4A 5K9JH 1JYVA 4HIJA 4X5WB 1AGDB 4QRUB 5D7JD 1YQ2A 4AIZB 1KB5A 1IGMH 2BVUA 4CJ0A 4AY0A 2XT1B 4LASH 1QNZL 1T1WA 1HINH 3PABA 2APFA 4LLWB 1JPGA 4JHAH 3KXFE 4LSRH 4CNIA 5HJ3B 2O93L 1E27A 5TF1H 4CNIB 2V6HA 4X0KA 4CRPA 1NCAH 5BS0D 4TUOB 2CO7B 4PYHA 1YECL 3LKPB 4B0MM 1FRGL 4NKOB 5I16A 4P5TA 4ZODA 4KWUA 5HHVL 2G9HB 2DQUL 1IC5H 1Q0XH 2DF3A 4NC2B 1U36A 4C56B 4KTEH 1CLCA 3FOMA 4PRPE 3LB6C 3VRJB 1CU4H 3I02B 3EOAA 4NT6B 4D0DA 2Z35B 4M4RA 1FP5A 3ARDA 3AS2A 3VFOB 2GW5A 5JNYB 4YBQC 1CFSA 1MFNA 5AZEH 5HHNB 4BQCA 2GTZA 3BDYL 4BM7A 4LCCB 4O4YL 1S3KH 5KSVB 1Q0XL 1FC1A 3OAUH 4KI5D 1KUMA 4Y16C 4Z7WA 3OXRA 4MXVE 1G7QB 1T7WA 3PWLA 4HWNA 5T3XD 1GHFL 1UA6L 3I3BA 4E5XB 43CAB 4Y5YA 2OR9L 4BSWB 5I16B 4PRDA 1Q1JL 43C9B 5MHSD 4UINL 4ZQKB 5DR5H 2Z8SA 3QIWA 2E8YA 2ZCLL 4O2CB 4LEOA 4ZDHB 3IDNA 2MPAL 2ZNWA 1MJ8L 1OTTC 3SKJH 1HEZB 3KLAB 4G6JH 3WFEH 4ALAH 4PJ9A 5C9JB 1BIHA 1WSST 1BLNA 4XMKL 3EOBB 3GB7B 3UZVB 3QXDA 3WSQH 1REIA 3NABL 4PJGB 2ZUYA 2X4TA 1FNHA 5IT2L 5DTFA 2LABA 1UEMA 2XG4A 1GGBL 1HH6B 4OZFA 3IJYB 2Q8BL 2FO4B 1ZHBB 3NTCL 3JTTA 1JFQH 4M9OA 2FO4A 4R4ND 5DUPH 3CFKB 3BH9A 3LSOB 2VC2L 3UTQA 3EO0A 3ULVE 3MBEA 4OTXH 1WIOA 2AEIT 2CLZB 1T21B 5HJ3A 4M43H 4BQBA 3KYMB 2HJFB 2EXYC 1VGEL 3BUYB 5TE6H 3V4VL 4CVXA 5FUZH 3QRFM 1TJIL 4K8RC 1JV5A 4QRUA 4C56A 3WE6B 5LVEA 4HULB 1T5XA 5M7QA 2QSVA 2DJSA 1FLRL 1UB5A 2VUYA 2VMFA 4ODUB 1BZ7A 4D9QD 2NY0B 5CEYA 1EERB 4U7SA 1RPQA 5D1XD 3OF6A 4YE4H 2X05A 1TXKA 3GI9L 2F53B 1NAML 2VABA 1T20A 3PIQB 4R9HA 4RQQB 4N9GA 4XXCA 3WYRA 3EJYC 3IKKA 4QOKB 3I9GH 4OLXL 1B0GA 2GSGA 4HKJB 4QYOB 4QHMB 1CBVH 3QDJE 3RWHA 3W11C 3MJ9A 4LHUG 3NFSL 3MCLL 4MJ6A 1A6TA 1EUTA 1E4XI 2BVQA 3CFEB 5T3ZL 4X6DF 2JIXB 5E24E 4ZTPH 4K94C 1Q9WB 4JFXB 1RIUL 2IQAA 25C8H 2A6KB 2HLFC 4LKCB 2J8HA 4P9MH 1C16B 1ONQB 4OM1H 4RZCB 1JHTB 3C2AL 4Z7OF 2DKUA 2MOVA 4PJIA 3VXNA 3GUTA 2B0SH 3CZJA 1NCCH 1TNNA 4NRXA 2X1WL 2WINB 2J8UE 3GK8L 4RGNC 4GLRI 1R0AH 1IT9H 4A6YL 2IGFH 3MFFA 4GT7A 5DJ6A 4Y2DB 1YEEL 4GRLB 4LLDB 1FL6A 1BECA 5HDOA 3AB0C 4KDTA 3UPRA 2DN7A 4XWOC 1OCWH 3RWGA 4JFEE 3JV4B 4MAYC 4ZOEA 2FHBA 3ZLQC 2EIEA 4OCSL 2DS4A 4GAYA 3HPLA 3M1BB 1OTSD 2X4UB 4X6BB 1X5LA 1QBAA 5ESAB 1ND0B 2X1QA 1GGCH 4YHOL 2F8XC 4M62L 1O5DT 1RUKH 3OKLB 4GBXC 4XVSH 1A1MB 5DJAB 1QLEH 5LJYH 5I19H 5HY9B 5T33H 3VXRE 4XP5L 4X5LA 5CEZE 2GJ6A 3T3MF 2E7LC 2ORBH 3RPKA 1WFTA 5CJQL 4P5KB 2DD8L 2X9YA 4P49A 1U6AL 4G7YL 1ZGLM 3QAZB 8CGTA 3TO2A 2R1YA 3UDWA 3HFMH 1U8MB 5CILL 2ITCB 1QSFA 4R4NC 4LSUL 1K3IA 4F7EB 3VGHA 3ULVF 1BFVH 3O8XC 4KMTH 1I8LA 2WBWB 1FYTA 5C6PB 4XXDA 4OLUL 2DYPD 5I1EL 1BQHB 4R90L 1ACYL 3JZ7A 4AG4L 4H1LG 4CDHA 1WITA 1G7HB 3EYQD 4N8VA 4AMKH 4ODXB 1M7XA 2J1KA 5ID0A 3MRKB 3G6DL 1TTUA 5T1LD 3L3JA 2GUOB 2P44B 3TO4C 1C5DA 2BNQE 1NAMH 1CGSH 2E6PA 1JZ2A 5DD1H 5ESQA 4MJIB 3RWFA 3CMGA 3MA7B 3BUTA 4E42A 2ZUXA 4GSDL 5D9SB 4HH8A 2QQLH 2FATH 3CSYB 3MRBA 4QTIL 1TPXC 3EO9L 1FORL 1JPSH 2WK2A 2E27L 5J13C 5CMAB 4YXLL 5HYJA 4EJ1C 4PRHB 4NOBA 3GSRB 3L6FB 4L4JA 4ZD3L 4BZYA 4KV5F 1NC4B 1JWSA 4P2RA 2I26N 1RU9L 1AQKH 3LQAC 3QCVL 1WZ1L 2VKXA 3VU2A 2XZZA 5FCUH 2CK0L 2NXYC 3TA3A 4HWZB 1RZIB 5MP6H 3HZKB 1B4JL 3DX8A 2CDGB 1I1FA 3CD4A 2MKLC 5F21B 5I18L 3RFZC 3GIVA 4Q6IA 4HPOH 4YDLC 5FA4A 1I1FB 4RSVA 4P5TC 5J3HC 5EU5A 1MWAL 4X7TA 4U3HA 4D0BA 1HHGB 1JNNL 1UCTA 1FHGA 5D2LE 1Q94A 1G9MC 4H1LH 4QRTA 3PWNB 5FYJE 4PJBA 4NP4L 2R0LH 1CLOH 5I18H 5JW4N 4A2MA 5ENWB 5AG8A 3MV8A 3MRPA 2VLKA 2GAZB 3B5GA 5E6YA 1KEMH 2Z92A 5DRNB 4GKOA 4MA7H 1NGZB 3SPVB 3TH2T 2B2XH 4F7PA 2GFBB 4NN7C 3FQTB 3QWRA 5DYOB 1YPZA 5F7EL 2G5RA 3OKEA 2ICWJ 1KB9J 2R4RL 2VZ1A 5E9DA 5FKAB 3SPVA 5I2IB 3UTOA 4HKXA 5C0RH 4JG1H 4C54A 5JHLL 2KH2B 1FNEB 2KZ1B 3FN9A 5C9KA 4NJAH 4OZHF 1BD2E 2ESVA 5DMJB 4X9GA 1NAKH 5JXEC 5F89A 2UVEA 1FV1A 1NGXB 3CX5K 1KPRA 2VLME 4QCIB 3X13B 5C92A 1U93A 4OZIA 1UQSB 1NANH 4NRYA 1PG7X 1I8IA 4U6HA 4QRSB 1WISA 2DQHH 4FABH 4BQ6A 5D1XC 2EDOA 2E9JA 1X5JA 1FSKC 4QRSA 1CN4A 2EIDA 5EU6B 4A6YB 5CD5D 2JJUA 5ICYA 1FGVL 4ONOA 5ISZA 3SDDD 2VSDA 3DMMD 3H7BA 1KN4H 1YDPB 3B4NA 2A73B 3MMEA 2Z31C 5DD1L 2GUOA 5KSAD 1Y6KR 3GMNB 4X7FC 3H3KA 1CVRA 2Z0BA 3MR9A 4GG6E 4KPHL 4GQPH 1U95B 4PR5B 3GI9H 2FATL 3GI8H 4H20L 4ZUTB 2F54D 2R56H 3RKDD 3S5LG 4APQD 1A1NB 1MCFA 4JRWA 2C4FU 4CDGC 5FM8A 5HGHB 4MS8D 3TO4D 1TDQA 2C4XA 1YNKH 4Z77B 3NCJL 4LAQL 4UIKL 5GGVH 4UTAL 2X2YA 4K3JH 3BHBA 2ARWA 1PG7H 4YO0A 3BPCA 5HHME 1NUNB 2FLRT 3CC5B 3ZYIA 5D1QC 4WIQA 1JWUB 5T1DL 3MFGB 3K2UH 1FE8L 1U3YA 4G8IB 3BISA 4XVUD 1UWEH 5JOPD 1NC2B 4KK8C 3Q1SL 1KGCE 3ESVF 3UZEA 4MNQD 5MP6L 3O3EA 1LK3L 5GJTH 5DJ0B 1C7TA 4X6CB 4HC1H 3PQYB 3PG2A 1TLKA 1ZA3B 2B0SL 2I60L 1ADQA 5KW9H 2Z8RA 5TH2A 2PO6A 1FNSH 1T7ZA 2ED8A 2P5EB 2HFEA 3SJVB 4F7TB 5I1IL 4QOKE 2X89A 2Y06H 3QBTB 4R26L 4DAGL 4ONFH 4FQHA 4JPVL 3X12A 2IADB 3U79A 1WFOA 1YEFH 3QSKB 1JF1B 4PTUA 1BWMA 2CUMA 3ZDYF 1ZLSH 2BK8A 1VERA 4DVBA 1ZEAH 2VDOL 1XF1A 5TQ0H 1G1YA 3FQNB 1M6OA 3DETD 5JIIA 4ONFL 5D2NA 5DZOA 1BBDL 4IMKC 1JPTH 5KJRL 1JGDB 1FDLH 3QUKB 5DT1H 1GXEA 4WFFD 4OFDA 4JFZH 15C8H 5EBMB 5I73B 4WTZG 3I6KB 5L8JB 4PRBB 4ZTOH 3U30C 5GZOC 1I75A 2FECL 3N0PB 3ORJA 3EYVA 4PLJD 2NXZD 4RFOL 2P8MB 1W72L 4E41A 1JGLH 5K59E 3HA0A 2HRLA 4U6VL 5DDHA 1JN6A 4TSBH 4Z7UA 1A3RH 1A0QL 1IAII 3HNSH 5GGQH 4NOFA 4L1DA 5IB1B 4EI5C 4UTBL 4F37K 5KVEH 5I1JL 3QDJB 4PRHA 1CE1L 3ZL4L 4O2CA 2A74B 3C5JB 1I9IH 1RVFH 3QNZA 4JDTL 5DMIH 3DOSA 1CFQA 3KDMA 2FX7H 1UEYA 1JGUL 3CLFL 1E6OL 4F57L 1AR1D 4WW2F 1L0YA 2NX5B 2QQKH 4ZTPL 3PHOB 5INDA 1X5ZA 5F72S 3ARYA 3GHBH 5K59F 1FZJB 3O8XA 5TFSL 3V2AR 2NY0C 2Y23A 1GRWA 1CCZA 1QRNB 2CPCA 3CUPB 3E6HB 3BPCB 5I76A 2AXFA 4FQXA 1A6AA 2ICES 4OFVA 3F8UB 1IT9L 4A6YH 4OQTL 5DQJB 1IBGL 2Y36H 4L4TB 4U3XA 2B7DT 3A6CL 3IFPB 1VEOA 4YUEH 4ZSOB 3VFWA 5KSAB 1I7ZB 3AY4C 4Y1AE 5D1QA 4OZ4B 3RDTA 1AJ7H 5EU4A 4F2MB 2IC2A 4G43A 3VD3A 1FNAA 4N0YL 3NZ8A 2VWEC 2HVKA 3RNQB 3RUGE 3SDAC 5HYFA 2EEAA 2NY5H 2AJSL 3MRQB 4LLWA 4ORGB 4OF6A 5DUBB 2GJ6E 2NCMA 1IGCL 1QFPA 3K81A 1JGDA 4K8RL 4QT5B 1IQDB 1EHNA 4JQXC 4WI2A 5AYQA 1CE6A 4XHJD 1MF2H 5DXWA 5IVNA 3E6HA 5I76B 4HKBA 1S7SB 3V5KB 3I6LD 4JHAL 2C3VB 4G8GD 4R3SA 3WBDA 2ZG3A 4JY6B 4TQEL 2F8OA 3OG6B 3WL9A 1MRFH 5ESVA 4H8WC 3ARED 1DVFB 1RFDH 2BCKA 1CLZH 1KELH 4U1GC 4KGJA 2BRQA 1J12A 1CD0A 4KY1H 4WWKA 3LN9A 4U6XA 2Q1EA 5DT1L 1RIHH 1HE7A 2MFNA 4EN3D 2FJGB 1JZ4A 1P4BH 2BX5A 5ACZB 1ZHNA 3IETA 5F7MC 3VG0H 3C5JA 3FAWA 4DKDC 1YNLH 5F6IB 4NWUH 4NJAL 1WCBA 2CIIA 3TCLB 4JO2H 5K9KA 1G1CA 3DPBA 4Y16B 4OF0A 2VLRA 1IGTB 4FZEH 4BH7A 1EJOL 2IPTL 2DDQL 4RCAA 1BVKA 2VL5B 1BEYL 3JWOC 4LLUB 4CU8A 2IWGA 1CDCA 3MBXL 3LV3A 4IIQB 3QP3A 4UT6L 3GHEL 4JANB 4LDEB 4ZD3H 5HVGB 3F58L 1KN4L 3BD5A 4PJEA 4X4XA 4ODBD 4IOIA 2CDGA 4V2BA 4PJFF 5FAAA 3EJZD 3O6ML 3CMOL 1XZ0A 4J3UA 5DC4B 1MH5A 1HH6A 5LBSL 5LGKA 4N1CA 1RULL 2HVJB 3S34H 4AEHH 2D0GA 3WKNA 5KZCD 5CHNB 4YDKH 1WWBX 1D5XA 4DUXA 4K3JL 5GHWL 1MCHA 4KHXL 3PJSA 3RIFK 3MV9A 4H25B 5CP3A 4J4PC 3SGEH 1BFTA 2XXMB 2DQJL 2P5EA 3SJVA 4CVZA 4PRPD 4OIAA 12E8H 2IEPA 4LEOB 5CJBA 4C57C 2FGWL 5TE6L 1H3XA 3RGVD 1NKOA 1UKSA 1OGTB 2GEEA 2GJZA 3GSOA 1S9VB 2FWOB 3C09B 2NYYD 3DXAD 3WFHA 3WFCL 3IU4H 5FA3A 4U1HB 2C7UA 1OLLA 5HDLA 4L3CA 4P2QA 1A5FL 5HHXL 4M6MH 3RTQD 3HI1A 3V95A 5KS9F 4WEBH 4WV1C 2K7QA 3O45A 1AP2B 4MLSA 2I24N 1MF2L 5D7KE 3WFBH 2QHRL 1T6WA 3N1PC 1DFBL 1M71B 3FB7A 3IS0X 1J0HA 1IMHC 1P4LB 3G04A 5HYSA 4BZ2L 3ET9F 3LD8C 4MWFB 4WHDA 3V0WL 1OQOA 1CT8A 4PJFB 5F1IB 2F19H 1KENL 3BH8B 3MLXH 5TE7L 3SDAA 2HH0H 2ZUUA 3FO9A 2XZQL 3SKUD 4PJFE 1RJLA 5EU3B 1QBML 1LEKB 1QEWB 1B6UA 2C1PB 3TPUB 5EU3A 2DL2A 3P4OA 3ALXA 4MB4A 4XNQA 3GMRA 3K4ZA 1C5DB 3FCTA 1I9EA 4R97C 5JA9A 4K7FB 2VXVL 2C5DC 4JFYA 4LVHB 2A6IB 4BK5A 1IC4H 3BP4B 4ONGH 1LEGA 1J8KA 3MRHA 5DS8B 1SYSA 2VLJB 1P4IH 3ROLA 2J5LB 5D7LE 3IF1B 5FGSA 3W0WB 2P49B 2EDJA 4JM2A 3W9DB 2VDPL 3MRIB 4R4FL 1OAXH 4M7ZC 4MVBC 4S1RH 2D7NA 4OCMC 5C0BD 3DVGA 1UQSA 3IFNL 2VDMH 3MA9L 2WUBH 3AVEA 1I8MA 1A0QH 1C5BH 3O4OC 1XF3B 4KUCF 3PDDA 2OX5A 4JFFB 2G75A 3U9UB 1U8IA 4TNVK 1OLZA 1XF4B 1XF3A 4JFHD 3TT3H 3P0VL 4YBQD 4QRQB 4PJHB 3QWRD 5DI8B 5SWZD 2BFVL 1KC5H 4MZ3A 5CUSH 3Q2CA 1UM5L 4FP8H 3N50A 4HS8L 1JNHB 5HPMB 5E0QA 1DQLH 3HC3H 3CX5J 2FD6H 4KKCD 3LKRB 3VFRB 3Q6FB 4JKMA 4PB0L 3MV8D 1D5XB 1JF6A 5BRZD 3L3HB 5D8JL 3MV9B 4H25A 4OGXH 4PJCF 3QIBA 4CKVX 3MYZA 4LLDA 5IKCB 4LQFL 4PG9B 4GG6A 1FDLL 1F4AA 3L1OL 5C7XL 3CVHH 3VA6A 2ITCA 3LS5H 4MXWH 3TJEL 4LSUH 5DJZB 4G6AD 5HHXH 1L6ZA 4EUPA 3FB5B 3DYMA 1CI5A 3RU8L 4I4WA 2NY5L 2NYYC 2C3XA 3FB5A 4GRWH 2J2ZA 4CADB 1LP9B 3I2CH 4KXZI 4WY7L 4ZNEA 4G9FD 4P46B 4ZUUB 3MBEC 4R4BA 4P2RD 3SE4C 1I3VA 4TVSa 3VFNB 3P0YH 5BVPH 2PR4H 2VB5A 5L8LB 4PJDA 4HS3A 1DQMH 1H8OA 4DTGL 5J56B 3KYOB 4OLZH 4LSTL 2R2EA 1JHLH 3SDAB 4KDWA 4YHKH 1IGJA 1SJXA 1BJ1H 1MHCB 4N1EA 5DJXB 4R2GB 5DJ2B 2AV7B 3LAFA 3U7YL 3U83A 4NM8H 1AQDA 2BSTA 1NJ9B 5C0NC 4DZBB 2E9WA 3FCTB 3HPJB 3U9UA 3O41B 1U8NA 3NA9H 4NNYA 1QBLH 4HT1L 3RIAK 5EZOH 5F9WC 4RAUA 4MDIB 3K7UA 2HTLD 2XFXA 1TVBB 1KT2A 2PF6A 1F58H 3PHQB 3QRGL 1D6VL 1BBJA 4IMLA 4PGDA 4F57H 5CEZH 1WFUA 3V6OC 2BHYA 1I3RB 3D87B 4WRLA 5HPMA 1YEIL 1V7NH 3L3GA 4DKFL 3HC0B 4NGHL 4JVUA 4UAOC 5TGBB 1QSFD 3PGDA 3D2UB 3KPPB 2OI9B 4LHUB 4I8DA 2NXZB 3FN0H 5FOBB 1EXUB 4NM4H 4FA8A 2FH6A 4QY8A 3QDGD 2DI8A 4G7VH 4JFFE 3RVXD 3E0GA 1MQKL 4KKLD 2UUDH 1NDMA 1OAKL 1K8DB 2AQ2A 4QF1A 2XPGB 5CEXB 1IC1A 4L4TE 4ZPTB 2XQBH 3OKLA 3UYPA 5A2IH 2CDEA 3MLTB 1BIIB 4HFUL 3O2VL 4M43L 2V9TA 3WIFB 2CLRB 3WFDL 4URTB 4WO4B 1TQBC 2BOBA 2R4RH 4KRPC 2FSEB 3GZKA 4RIRA 3T77B 1IILE 4HFWB 3UBXI 3KS0H 2YRZA 4PJXF 2G9HA 4E41D 2XQBL 5D5MF 4ONHB 5GRJL 4YHZL 1JZ5A 1BGXH 4GUPB 3RNKB 2BSSA 5E6IA 2H2SD 4W68A 2P8LB 3IDYC 2EE2A 3FONB 4NQTA 5HYSG 4S10A 1KCRH 3UC0H 1MI5A 1XGUA 3DUUB 1BPVA 4MYWB 4O00A 4LASL 4GXVL 1AD0A 2JF1A 4X7EC 5GRVL 3P77B 3TPKA 1C12A 1RK0B 3B9EA 5FGCE 2V7NB 5GS0D 1BVZA 2DDQH 1ZLWK 3U2SA 4KZDL 4FQLH 4B7LA 2DLTA 4EN3B 1XEDA 2OSLA 3H8NA 3LRSB 1FVCA 3KJ6L 4M5YL 4M7JL 5EG6C 1ZLWH 4CGTA 2LU7A 5ISZE 1OGAB 4FXGB 4X7SH 2C3VA 2FZ3A 3ES6B 4F7MB 3FOMB 2VYRE 1GSMA 2DQGH 1URLA 1RSFA 4WU5B 2VXUH 3SDAD 4HUMB 3GBNH 3MLXL 5ESVB 5TE7H 1AGBA 3CFDB 1NMCC 1OP3K 3EJJX 1BQSA 2VZTA 3ZE1E 4JPKL 4EKXA 1U8JB 2KUTA 5C09B 1DQTA 5DMKB 2IMNA 2F53D 3KPLB 2Y1VA 2GTZB 4Z7QE 5T1KD 4O4YH 1NL0H 2WP3O 4CMHC 4DEPB 2IAMD 1CGXA 4PRAB 4BH8B 1E28A 4JFHE 5BV7B 3QCUH 3QNYA 4XC1L 5GJTL 1MH5B 1OTUD 3U36A 1SJVA 1H8NA 2X4SA 2CXGA 3SDDB 3OBAA 3U36B 5IBUB 5IESH 4R2GC 2SEBA 43C9A 2AK4A 5ITBH 4D8PA 4FXLA 3SGEI 1KCKA 3O3AB 1CD9B 1MCPL 3CFCH 4TVPL 5FO9B 1S9KC 1OSPL 1MFEL 2CDEB 3MLTA 3RWIB 1C1EL 3UBXB 1Q1JH 2X1PA 2AS5M 4YDIL 3RA7L 1FIEA 5GGRY 2A6KA 5IOPA 5BV7C 5IOPB 2NX5A 3WFEL 4ALAL 4U1HA 4U49A 5J9PA 4Z18A 3OSKA 3CPLA 2ZUTA 3AMKA 2VQ1A 3WHE0 3X3GL 2YPLE 3UPCA 1KPRB 4Z7NF 3BPLB 5KSAA 3PV7A 4Z95H 2X4TB 1HILA 2EE3A 3H9HA 2R69H 5ICZB 1EUUA 4HS6A 3I6GB 3O6KH 5EFIB 4Z7OE 2AJ3A 1IQDA 1GOFA 1C12B 4OTXL 2CRMA 2Z91A 2YHGA 4ORGA 2VN4A 4MDJA 4HJJH 1X4XA 4KXZH 3RWIA 3UBXA 4BSVA 3FT4A 4X6DE 1PYWA 1RK1B 3F65A 1R3HA 2XRAL 3S36H 5DEGA 3ZE0F 3ARRA 2ERJB 4R3SB 4YHNB 4TVPD 2F5AL 4K71B 3RVTC 4U1MA 1ZHLA 3MOBL 5C0BB 4EEEA 1IKNA 4UTBH 3GIZL 4PP1C 1ETZA 4Y2DC 5E99L 2ARJB 4JN1H 3MRQA 1CFQB 3PWPA 1DN0A 3DROA 2PN5A 3FQNA 2Q3ZA 2Y5EA 1AGEB 3ZSSA 2A73A 4TNWF 1E6OH 4JPWL 3RGVC 3PDOB 2FLBT 2AI0L 2VKWA 2MCPL 2XTJE 5I6XC 5J06A 1SMAA 4HKZB 4HCRA 1S7WA 1FFOB 5TFSH 2XTJB 2E8ZA 2BC4A 5DEGB 3ARGC 5IF0A 1UWGL 1CS6A 4YDLB 5MEQA 1J05B 3MGAA 2DTMH 2WUCH 1DVFC 1LQSR 5DMKA 3CC5A 3QI9D 3NH7H 5I8EA 4PJDF 3I75A 3L3GB 5I1KL 5CD5C 2CQVA 4X8JA 4PJ9B 5GSRA 5C9JA 4XC1H 2BNRA 5INCB 1UADC 1NMAH 5LXGL 4GAGL 1A7RL 5L6YH 1XGTA 1GAFL 3OJDA 3O0RH 3HC4L 2QLVB 2ITDA 4X99A 3TIEB 1MHEA 1QFWH 4IEFB 5D70H 4ZSOE 5DD6B 2A0LD 4KFZC 43CAA 2H26B 4LPVA 4G80A 2WWKT 3RVXC 4U6TA 4WHTA 4JO1H 4TSAL 3MGOA 1MY5A 1I3GL 4X8XA 5JXEA 4NM4L 2Y5TA 5DD3L 3SCMB 1P7QD 3F7VB 2VDNL 5BS0E 3ARWA 4QHUA 1JK8A 1E4KC 1BOYA 2EDTA 5C07A 1KIPB 1QO3B 5I1IH 3O2WL 3BMVA 2MKWA 5J12B 4HUKB 4Z95L 1CGUA 2A6JA 3RBGA 3KR3H 3LY6A 4Y5VC 1LDPL 1RHHA 4XPGL 1KJVA 1HHIA 4HIXH 5E2WL 4XCCH 1PDKA 3IDUA 2ICEB 4YHIB 2YMXL 4QXTA 1BOGA 3DYPA 3HMXL 1IGIL 1RZFL 1RZ8A 4Y88A 1D9KD 1CTOA 3I6KA 3HE6A 1BVLB 2EYSA 3SKMA 3E8UL 1I9JL 4AM0B 1OT1A 2CIKA 3FMGH 3H42L 2FO1A 2VITB 3OB8A 4XNYH 5F88B 2PYEE 2IANA 3S37L 3TYFB 3IFOA 2C1PA 2JCCF 4DTGH 5EORH 4OLUH 5ITFB 3FFCD 1JCKA 3BPLC 1W72H 4NNYB 2X4QB 3MV11 1KTRL 4MQ7B 3KG5A 5IB3B 3LKOB 1KG0B 5MEPA 8FABA 3RVTD 4HC1A 4HUWB 4UIMA 4WFHE 1R3JB 3M07A 2NY7H 3DARA 4X8JB 1T1YA 4HUWA 4LPWA 2W1NA 5EN2A 1XIWB 3MCKA 4DK3A 1IKNC 4N0CC 4MA8H 3LQAH 4BYHA 5JHDE 5IJKC 4CN4A 3HZMB 1DUZA 2EXWD 2XA8L 3TM6A 5SWZA 3BXNA 3VRIB 4NZTH 2EXYD 1SJEB 3DMMB 3HRPA 3X14A 3AM8A 3P30L 3CGTA 5CEZL 5ICXA 5F71A 4D0CA 4K8RD 4KMLB 3PHSA 3L5WA 2Z93B 1AQDB 2P43B 1AHWC 1K8IA 3SQBA 4G8IA 4GKSA 4POYA 4HFUH 3U7AA 1OSZB 3B6SB 1OQXA 4U1NB 3HAEA 3C60B 1A1NA 2E5EA 2GTWA 1NGZA 3MODL 4WO4D 2CO6B 3W9DA 1J0KA 5LGJB 5JHDA 2ZJSH 4XNZB 1RZJL 1UENA 4PGEA 4HUXB 2FYYB 1FFQA 1CLYH 4M02A 1T80A 3EJYD 3OAZH 3JTSA 5CLWA 3MRGA 4PPTA 5F9JB 3WN5B 3B9KD 5E03A 3IXAB 4GW1B 2P46B 1UC6A 4D9QE 4YHIA 1ZT7A 5EBLA 2EICA 2ZPKH 5HSFA 1ODAA 1TTGA 4D0BB 1JF5A 1J8HA 4NBZB 2B1AH 1F4WH 4JFPA 5D6DC 4N0YH 2L7JA 2Z91B 5JPMA 4F33A 3ARBA 3VFGL 1WAAE 5B39B 3MUGB 3VXRD 4OM0H 1QSFB 3OF6D 3ZMRA 1EMTH 4NWTH 1L9MA 1QBMH 2W0KA 5F7LB 5LKNA 1K6QH 5AAWA 2JJWA 1SBSH 2BVQB 3MACH 3RTQA 3A6BL 4L9LC 4OD2B 4QHKJ 5DD5H 3DV6B 1G7HA 3RTQB 1RZFH 4PJ9C 4B5EA 4Z8FH 2EEBA 3VFGH 1RUAL 5F7DA 4XCNA 3VXUE 3HUJB 4OFPA 2MTPA 4NKMA 3F7QA 5DEZA 4G6KL 1FLRH 1SBSL 1DBKH 4YR6B 3TNNB 2VDKL 3KPRA 5BMFL 4HZLA 5DHYB 4X4YA 5EUOB 3BT2L 5E2UL 3NN8A 2NX5E 5IMOA 4HIEB 2ICCA 2D4FA 1NFIA 1XGPB 3ZKND 4PP2A 1IM9D 4KHTH 1XGRA 3BPNB 4NC1C 3KS0J 3I84A 5GRXG 4HDIA 2R0WL 3EZJB 3SKJL 2NY1B 3QA3A 1MCBA 5I1LB 1FGVH 1Q94B 2XTJD 1EZVY 2CKBA 4HWEH 3QDMA 5FYLE 3OKMA 6FABL 2EH7H 2K9UA 1BAFH 3C9NB 3G5VA 2OQJA 4MGXA 1CICD 3ROLB 2IFFL 5FA4B 3RKPA 5C70A 1O7SA 4QO1A 4RNRA 3RWDB 5FUCC 2JJVA 4GG8A 5ICXB 5IHLB 3MOAH 4EDWL 3IDMB 3KPOA 3UX9B 1I8MB 5F96H 1N5AB 2F9BT 2Q20A 5HHPB 1C1EH 5FO7B 3W82A 4G5ZL 1A7OH 2A0LC 2RBLA 3S36X 1GCFA 1FL6B 4LCCC 3QJHA 2NW3B 4IRSA 1FPTL 3O2DA 2XWBB 5EOCL 4XXDB 5L6YL 4OLVH 4JRYD 1DQJA 2PNDA 3DVNA 3EFDL 4V1DB 4LU5H 1HHHB 3TN0D 3QXTA 3EYSL 5J3HD 3RWCA 5BJTA 1NBQA 2HP4A 2YRLA 3MLYL 3DXAE 1XAUA 1UZ8B 1OCWL 1QRNA 1ZV5A 2IAMB 3TVMD 3AGVA 3MROA 3PWUB 4H5SA 2ADIB 4X7CC 4YWGL 3HI1B 4XPAH 2H2PD 1T0MA 1QEWA 5C09D 5CKGA 2R0ZH 5K9QI 3H9SB 4CN6A 1MCOH 1NCBL 2D3VA 1RFDL 4X9IA 4JKPH 1UXWB 1MCWW 5GJSH 2WLYA 4XP5H 5GS1B 2EDFA 2YK1H 3H3BC 4PJAA 1KIUA 2HAZA 3MGTA 4KKAC 1A7PL 3GRWA 2NXYD 5TQ0L 1JGVH 3EOTH 1NLBH 2XRAH 3S36L 3MV8E 5HDQH 1DN0B 2Q86B 3EDJA 3MV7B 1CXFA 4KTEL 2YA1A 5FB8A 1RK0A 2Z8VC 3BIBX 4XNZC 2RIKA 2JCCE 3HUJF 4PS4L 1PAMA 1UXSB 4HMDA 4DKAA 3C5ZC 1NDGA 5T1KA 1D5ZB 2XV6B 3U7YH 1KXVC 2OTPA 1SBBA 3CH1A 4U6YA 3WXVL 5E99H 1TZIA 4KMTL 1H3VA 3T2PA 1HZHH 1MWAA 4MD0B 1VFAB 3K46A 4LCUA 3MUHL 4JDVA 3WS6A 4JFDA 3TESA 3V6OE 5IM7B 4WFHD 1JGLL 3QR2A 2EH8H 3LEVH 3LRSA 3WXWH 3LEYL 4QHMA 1Z5LA 4JPWH 7CGTA 5FYKD 3TV3H 4IOFC 4N90E 4YEEA 3VXQB 4AIXA 4RISL 1H15A 3VWJB 1KCVH 3GMMB 5E1AA 3GJFB 4JQIL 3NGBB 3M8OL 5L9DL 3P77A 1P69B 1SJHB 3E2HB 5IP4A 2CRZA 3FQUB 2BMKA 4XWGL 4FQXD 1DBBH 2FCBA 5AZ2L 5BOPA 3MZGB 1I8KA 1G6RH 2Y25A 3SDXE 1XR8A 4Y5XA 3HPJA 5DJCB 5C0FB 3UTTE 3F6IA 4U7MA 4KQ4H 1MVUB 4K7PH 5E95B 3SDXB 3CLFH 2FZ3B 3ES6A 3RVUD 1NCDH 1YMHA 4JQVC 5JPNA 5LXGH 3L95B 5B8CA 4M5ZL 3CFBB 4MNGB 4PRIA 1JNLL 4YHPB 5EUKA 5IV2A 2X44D 4ZAKD 3WFDH 4MXQC 3QIWB 1CE6B 3O2VH 3C8DA 3S6CA 1GOGA 3UTQB 4PY7B 1A6UH 3T4YB 5EU7E 2UWEE 3GSWB 4PLKC 2IFGA 3GFUA 4OFKA 1XMWA 1FQ9C 2P8MA 4E41B 5L7XH 5EU4B 4F2MA 3KPQA 1QKZH 1TZHB 4I0PD 1ZANL 2X4RB 4RWYH 2EC8A 2AKRA 4IJ3C 4LQFH 2V7NA 1X6LA 4JVWA 4XT1C 2DQUH 3UJJL 3I3EA 1B90A 4FQLL 4N0FB 4XNYL 3CXHJ 4YXKL 5BQ7A 1AXSB 1BF2A 3H9ZA 4IDJL 2JK5A 2HFFB 5FV2A 1W0VB 1U8KB 4O51B 5FYKH 1WVZA 4MNHB 3EHBD 1TJHL 4KJWD 5MERA 4NKOA 4JVPA 3CU7A 4JFDB 5FYLD 4RWYL 2F58L 4LLUA 1O7VA 2RFXA 2NY6D 4WW2A 1XFPA 1EHXA 2AV7A 3GJFA 4KY1L 4L4VE 3UTPE 4GAJL 1FYHB 4DKEL 3VXMD 4NFDA 4FQIH 4YC2B 5IEHA 2XNAA 4M1CC 1JHLL 3O3UN 3V5HB 3FQRA 5DMYA 3NAAL 4MA1C 1A2YB 1KJ3L 1XR9B 2R29H 1ED3B 2OP4H 3MLWL 1RUAH 3TWCH 2EE6A 5KVDH 3RI5F 1JVKA 2XKNA 3VGAB 3A67H 4U0QB 4PRNB 4JJ5A 3L3DB 4HV8B 3SE4A 1KT2B 5C0FA 5E5RB 1FH5L 1ZHBA 1JN6B 3JVGA 4N5EC 32C2B 4H1LB 4Y4HB 2J88H 1RUQH 4OUUA 3GMMA 4TUOA 4JGUA 3SKNA 3DUSB 4MA8L 1YC7A 2D31A 2V5YA 2W65B 5ITBL 5E6IC 5FGRA 4LLAA 5DC0A 1A6AB 1SEBB 1QSFE 5I9QC 4ZFZA 4DVRH 1OWWA 1F11A 1SYSB 3WUZA 4Z6AT 2XN9E 4ZFFB 4XAKD 1JUFA 4LNRA 4NGHH 5D1ZA 3HMWH 4HFWA 5F97E 2JJSC 1P6AB 5DRWB 1IAIH 3HI6H 3NZHL 5DJYA 4O2EA 5JIHA 4DGIL 4NJ9H 4GUPA 4P23A 2F54A 3RNKA 3IXAA 1I7ZA 3C60C 2HRPL 4MD4A 2HT2C 1NAMA 2ERJC 3RHWK 3DI2B 4LOUC 2DBLL 4UNUA 3RWCB 4NO5A 1AHWB 1AY1H 3TBYA 3MBEB 5DQDL 1ZT1B 4AT6A 3WLWD 4WO4A 4FFZH 5T1MB 3STZA 1A7QL 4NYLB 4PJ8B 1YA5A 3TBTB 4YEFA 1FBIL 2HT4D 5L7XL 3EDKA 3EDDA 1T22B 4I3RH 3P3YA 3VGBA 1BM3L 4LPUA 1XGQA 5C0AA 5EC1B 1F4XL 3T09A 1JHKH 4RDQF 5I1AB 5EOTB 2VXQH 1WLHA 2BZDA 1P1ZA 2P7TA 4XNQB 1FNEA 4D2NA 3N85L 4FTVE 3HE7C 4L3AA 1DBKL 3QUZA 3SO3B 5EC2A 3W9EB 3OB0H 5DD5L 5F8RC 1EAPB 1HYSC 3AFLA 5JUEH 3MV7D 4GLRH 1CTNA 2ID5A 25C8L 4HW6A 3WLBA 5GZNC 4NN7B 5IJVB 2H2SC 4XNXL 3FZUC 3LMJH 4N8VB 1DANU 4PJ7F 2CGRH 5GGRB 1OAZL 4Q9QH 4P0DA 4NNXA 1RUML 2XY1A 1KBGL 1FGNH 4XP6H 1NEZA 4AJ0A 5I75C 1ZGLP 1D9KA 1WZMA 3BP6A 1N26A 3HG1B 1C08B 2GTWB 5CGYD 3O4OB 1A3QA 1YC8A 1TVBA 1AGCA 5ID1B 1NMCB 2VZOA 2VDML 4HEPG 2I27N 3VRLF 1FLTX 4NFCA 4NCDA 2HJLA 2YSSB 2V2TB 5GGTL 5I1HL 3P4NB 4IRZH 4KK8D 4LBEB 1ACZA 1F6LL 5CSGA 5F9JA 5JW3H 4OF5A 1HNFA 4LVNC 3HR5B 3NCYS 1FPTH 1P5UA 1DLHA 4KZEH 1INEH 4BKLB 3C6LC 3QDGB 1FL3A 5FOJA 4PV8B 4EN3C 2NY3D 5J7CC 4G9DB 4WV1B 4H0HB 3D48R 4MHHG 5B38B 5SWSE 1YEKL 2GHWB 3SCMD 1MFEH 4CVZB 3G6JE 4LSVH 1L0XA 4MQSB 3QEGL 4EI5B 4U6XB 5IK3A 3V0VA 4S2SB 5GPRA 1HHKA 3OGOE 5EU5B 1MI5E 3MRKA 5IK3B 3PP4L 5CHNA 3JTSB 3J8F7 3KXFB 4LVEA 2NR6D 3UO1H 1IGIH 3OX8A 3QEUB 5F7EH 1V7ML 5ALBL 5DK2B 4Y89A 1RZGB 4J23A 2WIMA 3REWA 4GW4B 1RV6X 3OQ3B 4KRPB 1HYRC 1IAKA 1RUKL 4QT5A 1NCBH 3B9DA 3K1KC 1CXHA 3X13A 2AXGB 3ARBB 4GG6B 3HZYB 5I8CA 2HN7B 3FMGL 2Z31D 3H42H 5BZDB 3PWVB 5CKAA 3IJSB 3AU1A 1A22B 5IB5B 4PGBA 35C8H 4I4WB 3WXWL 4GW1A 4DW2H 4Q9CA 3QPXH 4XPTL 1T5WA 3UAJD 1XF4A 3GJEB 5HY9A 3PXHA 1YDPA 5CILH 3V6FA 2J4WL 3DV4A 2A6DB 1ZWIA 4K3GA 3OKOA 1ZLVK 2IAND 3RDTC 2XNAB 5ESQB 1YY8A 1G0YR 1T03H 1HXMA 4ZYKA 5IFHL 2XY2A 3RUGF 5CMAA 1NGYA 4XRCA 4AG4H 3GGWB 1MIEL 3JWOL 5BVPL 5JDSB 5EO9B 2CDFA 4ELME 3LEYH 4Q2ZA 4ZXBC 1QVOB 4X9HA 3B5HA 3VRLE 4BQ8A 1HYSD 3EFFB 2MCPH 1QR1A 4OF8A 2RAMA 4GRWF 1KPUB 4BZ1H 3GMRB 2ED9A 3MJ8A 4ELKB 3K1DA 3STLB 2I9TA 5DQ9B 4KK6C 4U7KA 5GSRB 1S5HA 2AJXL 4I3SH 2NW2B 5CGTA 4P3DA 1GC1C 1RZJH 3VGDA 2R2HA 1XGTB 2VXTH 4PYGA 4ZFFA 2AV1B 3ILPB 1ZE3C 3QT2A 1T66D 1T1YB 1S7QA 3WDIA 3ETBF 3MUZ1 4LIQE 4JFQB 1MUJB 4F3FA 2P5WD 1MAKA 1UCBH 2CJUH 5D93C 5JXED 1CVSC 4U31A 3IDGB 2AJSH 4I2XA 1J5OH 1YEEH 2R1XB 4U1IA 1MFDH 3ARGD 3V52H 5F6IC 5GRZA 5L2KD 2ZCLH 4UDUA 4GRWE 2WWMD 3QUMH 1NBYA 3MO1A 5AG9A 1MFBH 3UP1A 1U8OA 2BRRH 2G2RB 1F97A 2I25N 2X7LA 5T1MA 3STZB 4Y5VB 3ZO0A 2E9IA 2VZSA 2WNGA 1HSAB 5FXCH 1DJSA 3MACL 2W9EL 1MFDL 1Q9LA 1T83C 3FTGA 2AK4D 1H3PL 1F6AB 2F58H 5IJKA 1JFQL 1CG9B 3QQ3B 3TN0B 1FZKB 4NKQB 1TZIB 1AXIB 1T04B 4UBDC 4Y19D 4HGMA 2FR4A 3QQ3A 3WDHA 3JWNC 4UT7H 4OJFH 4PB9L 5H94B 3BP7A 2LTQB 4YHZH 2FJFA 3H9HB 4AENA 3VXRA 1HK6A 1EEZB 1U8JA 4ETQB 3WFZA 2A83B 3QEHB 1EFXD 2A1WL 5CEZD 1ITCA 4M3KB 5ITFA 4YC2C 1N5YH 3MV9D 2GSGB 4HKJA 4R8WL 3VDAA 4GQ9L 5E00B 5FO8B 2N7BA 2WQRA 2W60B 3V4PH 5GS0H 4YPGB 1IEBA 1BAFL 1LDSA 4YPJA 3HE6C 3JV0A 4CVWA 1E27B 3RX7A 4J6RL 2VXUL 1E4WH 5EBWA 1WAAA 3R06A 1IC4L 3UTZA 1P7QB 3PL6A 3IDNB 4WW2B 1MJJA 1IEHA 4G6AC 1MCCA 2A74A 4LLYA 2J5LC 4QEGA 3NZHH 2OR8A 1I7RA 1I8KB 5ANMA 2UUDK 5IW6A 5HYQA 3N1GC 3IDMA 5L8KB 2HTLC 4J6RH 3SE3A 3SY0A 2E3VA 1QG3A 2MSPA 1PLGH 2NZ9C 1MVUA 5AYUL 3DO3A 3NIFF 4NQEB 5BO1H 1FFOA 5GSVB 4Z76A 5MI0B 3HI5H 4LSPH 1VGKA 5L2JB 2YD3A 1AI1H 4PJEF 3U1SL 3QEQA 3JV6A 4FQ1L 1PY9A 3DX6B 5L2JA 3Q6GL 1WT5A 3GSQA 2AJ3B 2VDQL 4H0IA 4HWBA 3TJHD 4P5MA 4OCNC 1OM3H 4XPAL 5BJTB 5JZ7D 1QSEE 2EXWC 5EBMA 4YDJA 1T2QL 4PLJC 5F7NC 2BNRE 1MQ8A 2ZJSL 4ELMF 1MCJA 5GGTA 1T66C 5DVLA 2VTFA 4AEEA 5A16A 2JK5B 1CDHA 5JOEA 3X12B 3VXSE 3S4SA 3LKPA 4OZ4A 3RDTB 1X5AA 4L8DB 5SWSD 1MRCH 4JGJA 3DSFH 4H88L 4P2QE 4YHOH 4YR6A 3DRQA 2G60H 2KZWA 4RFOH 2VDLH 3LPWA 1H3PH 3C09C 3QEQB 3I2CL 1HHHA 3D0LB 3V4VH 3H7LA 3HE7A 5C0RL 5C2BL 1YEFL 5EFIA 4MX7B 4EVNA 3B9KC 4HKZA 4HIIB 1T83A 3CFJA 2DQEH 5BOZG 1NFDB 5ETUB 5F9OH 3OAZK 4MNHA 4XVJL 5EA0L 1GYAA 4DFIA 2FX7L 5KSBB 1UXWA 4UOW1 3FB6A 1CGTA 5JUEL 5GRUH 1X9QA 1KEGL 1OF2A 4NNPL 3AAZB 1A1OA 1LO5A 4WEMB 5TQ2H 1BJ1J 3I9GL 5JDSA 3ZYOA 5FUOH 4WI6A 2R2EB 3MLZH 4CU7A 4HX1A 4RBPK 2O61B 4XBGB 1KOAA 3VXMA 4H26A 1FO0H 2XA8H 4MMZC 2BDNL 5F1SA 4YFLF 3KVQA 1F45A 2PW2A 3MR9B 5D1QB 3U82B 4M8VA 1KPUA 1CFBA 2XPGA 3NACL 5D7SH 1UM5H 5ADPH 1UGNA 3P4NA 5F3HB 5GGVY 1N6VA 1I85C 1TTFA 2Y36L 3EO9H 3QQNA 3TF7C 1MIEH 1OOAA 3DLQR 4UOJA 1IEAA 1QBLL 4HT1H 2ZKHH 1TVHA 5MEOB 1P2CB 4NSKA 4HS6B 3RVWD 2AXFB 1JNLH 3IRPX 3BHBB 2ICWB 5HI4C 2F5BH 1K8IB 2DQDL 1MAMH 3DWTA 4QTHB 5DJDA 4ONHA 4NUGH 1XF2B 1MOEA 3VXTB 2DQTH 1INEL 4XP1L 2BY3A 2FL5B 2YWZA 1G6VK 1S7UB 3WD5L 5GZND 4G6ML 3U1SH 3LKNA 1F3JB 1QPXA 1S9YA 3IS1X 2HFGL 2CMRL 1Y0LA 4KGLA 4MB3A 4JY4A 1CICC 4OKVB 3FFCA 5FO9A 2WBJA 5LAXA 4LLVA 4PV9B 3VH8A 3SE9H 5D7LA 1A5FH 1GIGH 1ORSB 1N0XH 3SGKC 3L9RA 4HHAA 3QB7C 1AO7D 2E9BA 4ZDHA 2BNQA 4J7RA 4KTDL 3UJIH 1J8HB 1Q9OB 1V7MH 5ALBH 4QNPE 3O2WH 2GSIA 4LCWB 3MRLA 4TUJA 3OV6A 1D7FA 4HUVA 1CFVH 2AW2A 3DSFL 4H88H 3VXPB 5L88L 4WUUB 3RJQB 3VGGA 5LWYL 2AJYL 2NY1C 4UILH 1J1XL 5FHAH 1ZWIB 4XPGH 1V3LA 1HCFX 1YY9C 5AZEL 3UTTD 3OHXB 1OAYH 1YZZA 4UV4L 2UVFA 2XWJA 1FNFA 1IGYB 1FVDA 1XIWA 4JG1L 3O4LE 1BOGB 5C0DB 3SDCB 1IAMA 2VLJA 4I0KA 4YFDB 4PJHE 3GM8A 5F9OL 1ES0A 3K2MC 1JPST 2XICA 4GO6B 2OP4L 2H32B 4C56E 1IQWH 4PRPB 5C08E 1QR1B 5J13B 1IC7L 3O3DB 5EORL 4MJ4A 1NGPL 3BOVA 3LRGA 3TFKD 3WJLA 4KJPC 1IKFL 3RJDA 3MNZB 4RMQA 3VFTB 1B0RA 1RUQL 3MLZL 3MA9H 3IJSA 4Q9RL 3S96B 1N7MH 3V4UL 3KYNB 4JR9L 2I07A 4S0TD 4YDKL 1IRAY 3MV9E 3DVFA 3HUJA 3UJTH 4HEME 3C08L 3MRJB 1BBJB 5JQ6H 4F8QA 3QIUB 1P7KA 3VMNA 3CZFB 4WVRA 1NGQH 5I8KH 5DEFA 2UY6A 3BXNB 3ILQD 2YSSA 1IL1B 3CSBA 5B22A 1KJVB 2DBLH 3L3DA 4HV8A 5HVWA 2VUOA 2WM0A 1GGUA 3IT8D 1LO0H 4JFFA 5ECJE 1SJEA 3DMMA 2P8PB 1KJ2A 1ZSDA 4PV9A 3MRRA 3Q3GA 5JPMB 1AY1L 2NPLX 3BD3A 3REWB 3JWDC 1B2WL 3GMLA 4LPCA 2Q8AH 1LO3L 4Z7VB 3RZWA 1OSPH 1KJMB 1FBIH 5CINH 3ULUH 1QLRB 2C9AA 4C59B 5F88A 3WN5A 5DJZA 3BO8B 5K9OB 5L0QC 4UU9B 1RY7B 3GIVB 1TJIH 2F54B 3QFJE 3U0PA 3OR7B 1FNSL 2OK0H 4ZAKC 3QAZC 1DBAH 4X5XB 1KLGA 5AAMA 1U8QB 4JFPB 1AXSA 4MVBD 5MI0C 3QUXB 4M7LL 2Y5TB 2A1WH 3FO2B 5C6TL 4AT6B 3OKDB 4FG6D 4AZ8A 2Q3AA 5I15L 1IGFL 1NGWA 5CBAB 2VABB 1P4LA 3G04B 1CICA 4Z5RB 4ODWB 4OLWL 4LLQA 5GGSA 4S2SA 1B0WA 5FYKE 5IMMB 4I1NB 2FWOA 1YPZF 2P5EE 4HK0B 4IBLT 5KVGH 3HNVH 1NL0L 4ZPVB 4P23D 3ZKMD 2IG2H 4LKCA 4GKSB 3IF1A 1NFKA 4Y5XC 1ED3A 3VFNA 1UJTA 1TETL 1WQVT 5I17B 4UIMB 4RGNE 1LEGB 4BFIA 1AGEA 1DLFL 4RX4A 3DURB 4JB9H 4RGNB 2C1OB 5HYJE 2V2TA 1EFXA 3O2DL 2YPLB 2VLKE 3U46A 2QSQA 4O2EB 5CUSL 3IFOB 2YOCA 4K7PX 2X10A 4GRLA 4UT6H 4LVNB 2LTQC 2NTFA 3D3VE 1U8LA 4JY5H 4JEGB 2PTUA 4JHBA 3MV7E 2OR9H 1U9KA 1JK8B 3R0MA 4N0CD 1MHPL 2NNAA 4P2YA 1RURL 3BKCL 3CSYA 3MRBB 3FRUB 5FUCE 3WIHH 5SWQB 5HI4D 4QRRD 3OTTA 1NMBH 2DAVA 2P42B 3Q5TA 4JO3L 4MA3B 2R9HD 1S7RB 2Y4SA 3MBED 1M4KA 3GKZA 4V1DD 4NQDA 5TDOB 1QHOA 2LAAA 1GZQA 3NGBC 1QSEB 5C3TA 1CZ8L 1B2WH 5IR1B 1L7IH 3BKCH 5JORB 2VRAA 3GMLB 3N1MC 1I1RA 2A9NL 3BKML 1R3LB 4NKIL 5IBUG 3T65A 2ZNXA 1YMHB 5JPNB 5GRJH 3ULUL 4DGVL 3HZVB 5GSVA 4Z76B 1HINL 1H5BA 5DUMH 5CFHA 1N59A 1Z3GH 1C7SA 1YMMB 5I1AA 4J3SA 4PJIE 4RGOH 2D9QB 5DD3H 1IFHL 3VFVA 4XPTH 2VR4A 5J8OA 1EHLL 4GXVH 2X4OB 2AEWA 3C5ZB 3PGFL 1J11A 1RZKH 3CFJB 2CUIA 2WW8A 35C8L 3SGJC 4R7NB 1T3FA 5T3ZE 3WDJA 3T4YA 4EQ2A 2ZCKL 3NFNB 4YHNA 2QADC 3FQWB 3DTXB 5E7FA 1Q9WA 4JFXA 1H15B 1MFAH 3MRHB 5DS8A 1S7XB 5E8EB 1EEYA 5IVZB 5JMOC 4NCC1 4UZGA 3TJHC 3BESR 3IFLL 3P9LA 2QQLL 5E08H 3EO1A 5A40E 4JRYA 1CL7I 4YE4L 2X1OA 4L8SB 2QKIB 3U48A 1CDGA 3VXMB 1WV7T 2ZCKH 4NT6A 1DEEB 5EB9A 3NACH 1KJ2L 4N0UA 1T7YA 2VL5A 3KPSD 1HZHL 1CDUA 3C6SA 1YEIH 3ARDD 3IAPA 4R7DA 1FVCB 3PQYD 4WWKD 3L3OA 2VH5L 1LEIA 4OD1L 2JJSA 4MD0A 4WNQA 4LNVA 1TZGH 4LP5A 2BDNH 1G7QA 3F5WB 3CFDA 4GMSH 4LEXH 3B43A 2WUBL 1YEHH 4X9BA 4PUBL 1TPXB 1SYVB 2DLEA 4F80A 4L3EA 3RIFF 3BMWA 5J6GA 3IYLW 4ZXBB 4U1SB 1PG7W 1T0MB 5HYQB 4XWOD 2AJUH 4ESKA 1QPPA 4O9HL 5DVKA 4ZXBA 3QA3B 2YPVH 1MLCB 2O61A 1JNNH 5E5MA 4WTWA 5I1HH 3VD5A 2Q87A 5GS2D 2X4SB 3UJTL 5IHUL 1Y18A 3GB7A 4LF3A 3ZE2E 4P46D 2IGFL 1MFBL 4JFDD 4V1DA 1YN6B 3RGHA 1V7NL 5F9DC 3S7GA 2X7LB 4OGAD 1CIUA 4PG2C 1OT2A 3SDXA 2QR0B 5F3HA 2FD6L 5TH2B 5ICZA 2YD6A 1A7NL 4OZFB 4AH2B 3BKJL 1WWAX 1A6WH 3FFCE 2JJTC 1FCCA 1O0VA 3SDYH 1ZVHA 4ZO7A 1AIFA 3LS4H 1I7RB 4QGYA 3WJLC 1WEJL 1T3FB 2R9HC 1HKLL 5H2BB 2BVYA 3EOBA 3RWJB 4PY7A 4OCWL 5ACMA 4W70A 2J3SA 1VGKB 2FNBA 3QUXA 3VI3F 2H45A 3AREB 2HLAA 5CINL 5C09A 3MNVA 4FQCL 1SM3H 2OS7A 3N9GL 3ESUF 4M6NL 1J8HD 4L9LB 1L7TH 3WO4C 1KB5B 1DQQB 4KMQA 1FJ1A 2D9CA 5E4EC 5E8PB 2OLDA 1ZXQA 2Z4QB 4OM0L 4UILL 4K94L 4QRRE 5IVOA 2NY2C 1LO4H 2NY0D 3EYVB 3ZHLA 1H5BC 4AYFA 2K1MA 3GSVA 2DWDB 2OSLB 3ECBB 1G7JA 4HKBB 1GVIA 2IANE 3IB4A 5D96B 5TDNA 5T3ZH 4XI5C 4KV5E 1QFWI 5HGGS 4PRIB 4OLWH 5H35B 4NZUL 2QADD 4YXHH 5C8JA 4I9WE 2JE8A 3KWWB 4N5UA 4OAWA 2E7LA 4JRXE 3BGMB 4HWEL 1KTDA 3D18A 1D6EB 5D71H 1EBAA 4LKXA 2O5ZL 5I0ZA 3NMEA 5DEFB 4HIIA 2JB6B 3NIGE 3S3JA 2DL9A 3ZSTA 5DJ0A 5FO8A 1I1AB 3U2SB 2VAAA 5I75B 4J1UA 4MHHI 4OCYL 1DDHB 3OXRB 1S7QB 4WEUD 3T1FA 1PFCA 4J3OC 4WWKC 1GZPB 5SX5H 1II4E 1NH6A 5CJ8A 3MRCA 1LMKA 4UDTA 5GISL 3PL6D 1G7IA 2ZPKL 4Q9BA 1U3ZA 4UINH 2CH8A 2YPVL 3MRFA 5T3ZD 3LN5B 1LO0L 5D96C 5FDWB 4GG8B 1CDYA 4WGVB 1JPFB 1F2QA 4PJXA 4RIRB 3C8KB 2V5TA 4YHLL 5IW1A 3AUVA 4U4BA 1M05A 2YBRB 4O2FB 4JFFD 4LVOB 4HBQA 2Q86A 4KJQC 4ODVH 3BP7B 4M7LH 3V5DA 1Q9LB 1I8IB 4U6HB 4JQVA 3A6BH 2MHAA 3DVNB 4JKLA 3DX6A 2DI9A 4POZD 3NTCH 1WIUA 1S78C 3WEXB 5FM5M 2AJZB 1K2DB 1J10A 1T04A 2IPKB 1UVQA 2B2XL 4OFYD 1A7PH 1I1CA 4PRBA 1Q0YL 1PEZA 2QHRH 2X41A 4UT9L 3MXWH 1KEGH 2B20A 3BT2H 1HHKB 2AI0H 3D39A 3QJFA 4PJ5D 3ULVL 5MHSE 1ZHKA 4Y19A 4TSBL 4KKBC 5DSCB 5I1JH 1MCKA 1ADQH 1WIPA 4CBPA 5MENA 5HVHB 1XF5A 5GGUA 4RGMC 5F7DB 1T0NA 4P9HC 4NIKB 3HAEH 2X5PA 1RZGA 1I4FB 3LPGA 3SO5A 2YPKA 4JM2B 5FK9B 5D7IB 3LKSB 3R0NA 4JFOB 7FABL 3VJ6B 1F42A 3RGVA 1R3JA 5HDQL 4I48B 2F5AH 4NHUA 5I1KH 4MS8C 4OQ1A 3TYGH 3NPZB 4Y1AD 4ZYKB 4I48A 5ILTL 1AH1A 2R0KH 2C4FT 4C83B 4Q2ZB 1HIMH 4L8CA 3VXOA 5GS0L 5CZXD 2VDPH 5D4QA 1KYOJ 1FZOB 3ARGA 3GSNB 4RWHA 3DXAB 3FO1A 2Z8WC 7FABH 3VFTA 1G6RL 2VXTL 3NFSH 4QLRA 1BQLH 3QXAB 4XVUC 5DSCA 1QOKA 3PWJB 4D9RE 2VQTA 3BYYA 1HOCB 2QQNL 3I6LE 4PJAE 3OR6B 5DO2C 4P2OB 2X4NA 3TNMA 1K5NA 3SGJA 1V05A 4HH9B 4I0PA 4HUXA 4W81A 1GGIL 4L29A 3S4SG 3WD5H 3CDFA 3GMPB 4MNQB 2HFGH 1J7VR 3MLUL 2GCYB 4GMSL 4LVOC 4LHQB 1GIGL 1LO2L 3HTLX 4P23C 2FHFA 3BPNC 4NQSB 4X98B 3ZKMC 5JW5A 3U0PB 2R2CA 4F15C 4NRZA 1VFBA 1NMAL 2PUQT 4HIXL 3AROA 4LLVB 5DUML 4PG9A 4RRPG 2AJUL 3PWPD 3HC4H 1YJDH 1CXLA 3L5JA 3NPSB 1I8LC 1KJMA 1T4KA 1PX4A 4ZUWB 4G7VL 1FL5B 1RZKL 4HAGA 1CYGA 2OXHA 4AQOA 3ARVA 1RHHB 1K5NB 3WUWG 4ODWA 3C2SA 4Z7UF 5FYJU 4F9LA 3RL2B 3BEVB 2LV4A 4NWTL 5JIPA 3FOLA 1AD9B 2W9LA 5CJQH 3SJVE 4S1SH 3HE6B 1K4CA 3GSNH 2V17H 4X5XA 1YECH 4FABL 4PJDB 4P5KA 1KACB 2UZIH 4WHCA 4NO3A 4KI5E 5TE4L 1K4DB 2QV2A 1CWVA 2VL4A 3QHZL 5EZLA 3S3SA 5FF6B 2AXGA 1ZT4B 3MLRL 2VH5H 2NXYB 4JY6A 1WK0A 5HI5D 2AQ1A 5EA0H 4ZUSA 2AEPL 4NSKB 3S35X 3OAUL 1U91A 3L3IB 3NCCB 2Q7YB 3VFUA 2FIRT 4M8QA 4E9LA 3BP4A 2XKUA 3EGSB 2EDXA 5FKPB 3BIKA 3HPLB 3M1BA 4GAYB 4X6BA 4ERSH 5I1GL 1IM3A 4GAJH 4DKEH 4NPYA 3VD9A 5IHZB 4NZRL 1T03L 1NGQL 1HH9B 1HIML 3GSRA 1NFDE 3L6FA 2OL3H 1KTLB 5AWNH 5D5ME 3K3QA 2BJMH 3E2HC 5KSBE 4BFBD 2R8SL 1I1AD 3QCVH 4PUBH 3MOAL 3VH8B 5TJWK 1UYWL 3GMOA 1U41A 2IJ0C 4HWUA 3U6RA 1QRKA 5GRWA 5D6CA 1XGQB 3RWGB 3NIDE 4RZCA 2C3HA 4DN4L 3OGCA 1XIWC 3LKNB 2EIZB 4K9EC 4YGAB 4J3TA 3S5LB 5D70L 1X7QB 3L5HA 3C8KA 1N2RB 2HWZL 1KIQA 1RMFH 4OF3A 4OZGF 4PJ5E 4P2QB 1BQHA 3MCKB 1J5OL 1U58A 1MWAH 2DLIA 4UQ3B 4NHCH 1QFHA 3UTSB 4X80L 1PGRB 2JCCB 3V8CA 4ODXA 1BX2B 3MC0A 4XHJC 4M1GL 5DVOA 2D0HA 4I0PC 4MAYD 5J6GB 1NAMB 2XXCB 4LSRL 2D03L 4LK4A 1JZ3A 4OI8A 4JKPL 3JV4A 3BWAB 4PD4J 3IDXL 4HUUA 4GBXB 2HKFH 2HH0L 2AKRB 2IBZX 4O5LH 2VC2H 4FFZL 4P59H 2QEJA 3T0EC 1I1YB 2IQ9L 4IOSD 4JZOB 3C5SA 3CLEL 2XA3A 5F3BB 2RR3A 2GJ6B 1W0VA 5CS7A 4X83A 1JYXA 4DCQA 1S7TA 3AB0B 5A16B 2V7HA 2H3NB 3H0TB 1EVTC 4O58H 4GW5B 1S3KL 2XN9D 3MREA 2D7QA 5CP3H 5C0AD 1ZVSA 2DJ4A 1WCBB 3QQ9C 1J1XH 5BXFB 1U8MA 4WU5A 4MJIA 3RWFB 2OJZH 4OIBA 5F1NB 4MAUL 3ZT5A 2C3GA 1BFOA 4LFHG 5KSBA 4DVBB 4Y1AA 5E8EA 3SCMC 3QHTC 1FIGL 5JNYA 2Q76A 5AEAA 4MNGE 3VCLB 2I9LA 1H3GA 3I3DA 1KCVL 3T3PF 3VXSB 3IDGA 2DBJA 5HDBF 4U6YB 1B0GB 1DEEA 3CDYA 3DECA 1H0DA 3IU3A 4N8CH 3RAJH 3VG9B 2P24A 3D0VA 4XP9L 4J1UB 1XGYL 4D9RD 2X4UA 3IJHB 2VZ3A 3WS3B 2JIXA 3F7RA 1GZPA 3DUSA 1MHPH 2BERA 3MREB 3UTZB 1ZVYA 4MJ2A 1FGNL 5D7JA 2R0KL 3PHQA 3TIDA 5EBGA 5EBWB 5EU7C 1EX0A 5D7JB 4JO3H 3MJ9H 5C8JB 2AEQL 5HXMA 2DLFL 1Z2KA 3VCLA 5F7HA 5F6HJ 3SOBL 1DBMH 3QFDA 5L2KA 3PHOA 1B3JA 4KROB 2LVCA 1SHMA 5C7XH 3JV6B 5J1AA 4NKIH 5B8CB 4LF3B 3ZDXE 5FB8B 3K8KA 1S5IH 2VLRE 3F5WA 2NW3A 2J6EA 3UZQA 2X6MA 3SDDA 3VXRB 2UWEA 4IMKA 1HNGA 4EDWH 4G43B 2Q8AL 4TULL 5K93A 2YKLH 3DIFA 1XIWD 4LCUB 3DNKA 1AKJA 3B2VL 3BZ4B 1A6PA 4PJ5B 5IB2B 1S7RA 1NBVH 3O11B 4PS4H 5KVMC 5C0JA 1FZKA 2VQUA 2Y06L 5DDHB 3P0YL 5EWIH 4FQJH 1L4IA 4OV5A 4LPYA 4HXBH 3RWJA 3IFLH 1Q9KB 1MRCL 2PXYD 3EO1B 1JBJA 4GW4A 3ZKXC 1TMCB 4ZFOA 1QFUL 1EZVX 1XGUB 4FFYH 1ZLSL 4HIJB 1CBVL 4W6YB 4L8DA 4YWGH 2M26A 2Y7QB 5E9DD 3WMSA 1ZK9A 3NCYP 3QUKA 4ZUVB 1F8TH 4YHKL 4OAWB 4LSSH 3B2UC 4NC0B 1CG9A 3RY4A 4K07A 4V2CB 4Y5XB 1D5ZA 2APBA 3QDGE 1NFDF 4NO2A 3T0EE 1E28B 2ADIA 5DGRA 1XR9A 1KCSL 4X4ME 1QFUH 4FFYL 2WIIA 3K4AA 3ROOA 4TTGA 5CJXC 3IJHA 4YXLH 3OKYA 4WNQB 2DWDA 4N9OB 1RUPH 2IG2L 1AGBB 3CVHA 4Z77A 4XVTL 4E5XA 4EDXB 4X9FA 3MNWB 3ZDZF 2GK2A 4Z7UB 4N0RA 1A7RH 1NCDL 4OLEA 4MA3A 3DMMC 4Z0BL 2NY4C 3L5IA 1DL7L 2VLJE 5T5FH 4QY8B 1WT5C 4XHQA 3JWDL 4OUOA 3HE6D 4U1SA 3KPOB 3X11A 1JWUA 4LHUA 5JOFA 4L3EE 5CP7B 1E4XL 1JF1A 4PTUB 3WS3A 1OAQL 2EDRA 5BW7C 3ARFA 4GH7B 2BVTA 4R7DB 3T65B 2SEBB 4Y4HD 1E4KA 4KKBD 5J1AB 1FN4A 3UCRA 4JREC 5BV7L 4I3GA 1T89C 3DRTB 1HHJB 1QRNE 2R2HB 4M93C 2PO6B 4HSQA 4NO0B 1QKZL 1AIFB 5DFVC 1KC5L 2Q8BH 1FVEA 3EUUA 4NQDB 5TDOA 3W39B 1MAML 2COQA 2DD8H 3PWUA 3HRZA 1YN7A 3DSNA 1CLOL 4UQ3A 2DQTL 1CF8L 4M1DH 3OXSB 5TGBA 3IU4L 4P57A 1PJ9A 4JDZA 3LOWA 2DMBA 2CJUL 3FRPA 1WFNA 4QGTA 3LQZB 4G9FA 3DGGB 3V52L 2BOCA 1F4HA 5I71B 4M3JA 3KYOA 2KDGA 4R97B 1KCRL 5IB4B 4UUJA 5B39A 4TNVF 3T0XA 5LQBH 2GAZA 3L95A 3KR3L 5DK0A 1KLFA 2EZ0D 3N85H 5T5NG 1I1YA 1QQDB 4S0SD 3BKYH 4P4RA 1I3UA 2UY7A 4NQCA 5SX4I 1NJ9A 4UMGA 5FM4A 1LP9A 1KYOK 4M7JH 1J1PH 2IADA 3F7YA 5E8DH 1V3MA 1CGWA 3C87A 1IFHH 5DFWH 3FO2A 4EBQL 1CD8A 3O9WA 1F4WL 1KV3A 3PWVA 2DQGL 3FRPG 2JELH 3UAJC 3JWOH 2OZ4H 1G9NH 4GMTL 3ELAT 3UJJH 4GRLD 1PSKL 2J6EL 4B53A 4IHOB 5FHAL 2GJ6D 1KN2H 5HGDA 3ARDB 3VWKB 2PYFB 2I07B 2R23B 2ED7A 4Z7VE 3VWJA 3WNNA 3KAAA 4FQQB 2Z31B 4J2XA 2ATPB 3D2UD 3ULUE 1JWMB 3VRJA 3REVA 1WTLA 5CGYC 1T1ZB 3S37H 1U8QA 3HS0B 2DKMA 3QCTH 1EDQA 5TF1L 3KPSA 1VACB 3CDGA 1LP9E 5GZOD 1WZ1H 1T1XA 1A6VL 5D9SA 3D3VA 3V6ZA 1VACA 1FRGH 4JO2L 2XN9A 2LU3A 4G8FA 4MMXC 5SWSB 1YEGH 3ARZA 4D9LL 4NQCB 2MPAH 4GJTB 1EIBA 1NBZA 1UJ3B 2FH8A 2H1PH 1S8DA 1H3WM 3TC9A 5F9AC 5BMFH 3LQMA 5FM5O 2YS4A 3H3PL 5C6WH 3VDCA 1TZGL 4YDIH 3RA7H 3RZCC 3WV0A 3MNZA 2DIAA 4P2OC 1U8LB 4K23L 3HG1D 4FQPA 3LB6D 2CRIA 4M6OH 1P7KB 8FABB 5CP7A 1FH5H 4EOWH 2CUHA 2IBBA 1KIQB 4X6CF 3VFUB 3SO3C 5C86A 1CFNB 2FEEL 4APQB 1TVDA 4JZJB 4NRXB 1WGOA 4TUKL 1R3KA 4KVNL 2B1HH 6CGTA 1JL8A 3GMPA 3FT3B 1KLGB 5E9DE 2VERN 3VFRA 3VMPA 5H37H 5EBLB 4NUJB 1A9BA 3T8XA 2HWZH 5E2VH 5KAQG 5BW7A 2HMID 2MHAB 3L7FB 4KKCC 4C55A 2HA1A 3D85A 1NUDA 1ZLVH 3ARFC 3BGFB 3U4AA 3UYRH 2DQCL 2E7BA 4UT9H 1XH3B 4WI3A 3UMTA 3MJ6A 3RU8H 1RJLB 1H3UA 1JPFA 2PKDA 3C60A 5GIRB 3BAEH 1S9WB 2ZUVA 5E2VL 4QHNA 3SKOB 5MENB 1CGYA 5EC1A 5SV4A 4XCEA 4CMMA 2D7TL 4IHOA 5LAXB 1N6QH 4UU9A 5EC2B 2IQ9H 3WCYA 3CLEH 3WIIH 3PP3H 3OHXA 1ONQA 2FBJH 4QXTB 3VI4F 1OVZA 3TLRA 1T1XB 3TBYB 5FK9A 1T2JA 1VPOH 1ERNA 2C1OA 3N9GH 4M6NH 4E42B 3TVMB 4RMSA 3DX7A 4PRPA 5KTEH 1P9MC 2B4CC 3BH8A 4HXBL 3BDXA 2A6JB 3MXVH 3C8HA 4KK6D 4UOW0 1HN1A 5CLTA 1CU4L 4UQ2B 1MNUH 2E27H 1VADA 2GY7B 4HXAH 2LQRA 1RJCA 2ICWA 1RHFA 3QUMA 4GKZB 4PJBE 1G9MH 4LRIA 1KG0A 1IAIM 5MEPB 3REVB 5B38A 5DJ8A 3GBLA 2BVOA 2BNRB 2YD4A 4JFED 5INCA 3UTPD 1R0AL 4TSCL 3MA7A 5C08D 4H8WL 1U92A 3I75B 4K7FA 3RAJL 2PYEA 3GBML 5TQ2L 4DKFH 4OLYH 4PRNA 1KB5L 3MLSH 5IGXH 4GRWB 3X11B 1G7MB 1QFWL 3T0ED 1Z9MA 4ZS6C 3VJ6A 4DEPC 3LHPL 2HJLB 3Q6GH 2ZP0T 4OZIF 2FYYA 5DA4A 3TV3L 4Y4HA 4X99B 3TIEA 1Z6JT 5I1CH 4JB9L 1A7OL 4WHYG 4L3CB 4L4VD 3ZHKA 1B0RB 4NN5B 4S11A 4XP6L 2IFFH 4YLQT 3QG7L 2AQ3A 3PJSB 3WJJA 1IBGH 1U8IB 1KPVA 1S9XB 3FHQA 3GSUB 3STBA 4JN2B 3DBXB 2X1XR 3WIHL 2WANA 1AO7A 3EYQC 3CPLB 4BK4A 2GK0A 4KQ4L 4CAGA 4S1DD 3RP1A 4FFWD 4JDZB 3LVEA 3GSWA 1HHIB 3MRGB 4DN3L 1GGBH 1A6ZB 3BZ4A 3WFHB 3G6AB 3ZKSD 4YHLH 1G6RB 2DWEA 1NCTA 2NZIA 1R5VB 2XZAH 4PJ7B 5IMKB 4JO4L 5I0DA 3B83A 3QUYD 1AC6A 4PJCB 1X44A 4BFGA 3ARBC 1Q9KA 2UZIL 3QUZB 5IQ7H 2A2QT 4TQEH 4LSVL 4RBPH 3O9WD 1D5BA 4PGJA 5IBLD 5CAYB 2YC1B 2MWCA 5HGAA 4MZ2A 1KLUA 2IANB 3R8QA 3QIWC 5E2TL 4GSDH 1CDBA 4M7KL 1LK2A 2XZAL 3F6LA 3G08B 3MOQA 2I9LB 4Y8DC 3RTQC 3MNVB 3EYFA 1BZ9A 3RPIA 3VFSB 2NY3B 5HD8D 4XBPA 1YNLL 3NCMA 3DROB 4M03A 1U3HB 5LWYH 1VPOL 3TBWA 1UH3A 4YAQA 4KJYA 5EOQH 1T20B 3PIQA 3VXQA 5C0JB 1G0XA 3ZTNH 2YUWA 2XZCH 3V9FA 1PW3A 2OTUA 2ZUQB 3IDIA 4Y4FC 5KN5A 5E70A 3Q0HA 2LU4A 3BDBA 4QHLA 2G5BB 3QZWG 4LSTH 3RWHB 4XBGA 1OAZH 2KQMA 2NZ9D 1T2XA 3D9AH 3KWWA 5DHVH 1DQQA 1HDMB 3TYGL 1KFAL 3VXSA 3TT1H 5T1LA 3O8XD 5JQHC 3M8OH 5IESL 1QD0A 4P4KD 4JZNB 4XPBL 4XP1H 4XBPB 3D69B 1DZBA 1G7JB 3ECBA 1ZOXA 5I6XB 3NA9L 1RD6A 5KVDL 3TWCL 3ZDZE 5F9WB 5J0BA 1OPGH 1IEAB 2WUCL 3O4LD 3LH2H 3MBXH 4K7PY 4Z7NE 1JRHH 5IM7A 4YBLB 1FYTD 3HI5L 3KLAA 3VE0A 4AL8H 4KAQL 2QQNH 2VAJA 4IRZL 2P45B 3TN0A 2FSEA 4EDXA 3C5ZA 1HH9A 2I5YH 1UWXH 5KN5B 4I3SL 4LCYA 2DMCA 5FCUL 2GYSA 12E8L 3L5XH 4WI7A 4OGYL 4ZOBA 3FQUA 2L4OA 1D5MA 5H94A 1OAKH 2UYLA 1I7TA 4GBXA 4M6OL 5BRZA 2A77H 2YD7A 5CGMA 2XIDA 4HBCL 4KAQH 3EO0B 1DQJB 5DO2D 2QHLA 4G9FE 5D93B 1Y18B 1YEDB 4YXKH 2ZG1A 3R4DA 5KBNC 1KLUB 3IDJB 3F62A 4PJBF 2WLZA 4RFEA 4KK5C 4OZGA 3BQUA 1TQCB 3CK0L 3VE0B 1ORQB 3BQUB 2ESVD 3VFVB 2FX8H 3P4MA 4Z7QF 4OCRL 3R1GH 5HHMD 5I17A 1G9EA 4DOHB 3L3IA 4GW5A 5IEKA 2VDKH 4U05A 5K33A 4YZFF 3ISWA 4GRMB 4AENB 3QUYC 1MI5B 4EBQH 4MAUH 1BGXL 4R90H 1H3TA 1VGEH 5E6IB 4WUKH 3KPQB 4PJHF 4XPHL 1D5IH 3KPRD 1KXTB 3E8UH 1H0DB 3IU3B 4L3EB 5E00A 1G9NL 3C6SB 4HDIB 4KUZH 3H7BB 1HSAA 4K3HA 4PJGE 1NAKL 4MDJB 4F37F 1U91B 5ANME 3AY4A 1U3HA 3KDMB 5I74C 5AUMA 1KB9K 1UJ3C 1R24B 4MXQD 5C0CE 2NX5D 1CDIA 1QFWM 5HHOD 1EEYB 1FE8H 4PJAB 1ZVSB 1Z9LA 5KAQF 4XB8A 4ZPTA 2VLMD 3BVNB 4KUZL 1FV1B 2VXVH 4JPKH 4XMKH 1BD2A 3SN6N 3X14B 3NIGF 1YYMH 4MXVF 5KVFL 1IAIL 3HI6L 3U46B 4ZS6D 4Y4FD 5HI5C 4PRHE 1U8NB 4FXKB 1ZA6A 2W0PA 1XGRB 4TSCH 5D7JC 2IH3A 5HHNA 2FGWH 2O5ZH 4HS8H 2D2OA 2F74A 3HZVA 1VEMA 5JHDB 5D2NB 3GEWB <