1MJBA

Crystal structure of yeast esa1 histone acetyltransferase e338q mutant complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Esa1 protein
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjbA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjbA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjbA02
1YW8A 4KN7X 1I1DA 4M9XA 5E18F 2BUEA 2NYXA 5JHUA 1IIDA 1QQIA 4UBRA 4KORA 3CDHA 1XCBA 3GZ5A 5J6XA 4U0YA 3HTSB 2EV5A 3UY5A 1IYKA 1DPRA 4PCQA 2P5KA 5BPDA 4M73A 1WSUA 2KIMA 1QPMA 1M1DA 4YFKF 4KA4A 3FXQA 4LB6B 3WTZA 1M4IA 1H9TA 1U6GA 3REOA 5H6RA 5E1WA 3T8TA 1XMAA 1FBQA 3LODA 4BHBA 1QGPA 3EY5A 2RGVA 3GXOA 2ZJ2A 3TO6A 5CVVA 4IHTA 3O3KA 3SQNA 3NEUA 5L3FA 4KUBA 4AVBA 4EVYA 2HQYA 2VZYA 1OR7A 1KU3A 4HV5A 1XGMA 1R1TA 4JQFA 5J8CA 5HLHA 1CJWA 4N9IA 3PP9A 1YYVA 2M30A 3MWMA 1OPCA 1KU9A 4EV0A 1S3ZA 2DT5A 1R7JA 4ASNA 1W5TA 5KK1A 2UWMA 4MI4A 4B5OA 1D8JA 3I5UA 1KQ0A 2V6CA 4KOXA 3K1MA 3AAFA 2GA2A 2EA4A 4F6AA 3WTVC 4Y17A 3J81K 2R7FA 4OIQF 2L01A 1BI1A 1BBYA 3KZYA 4HX7A 1UFHA 3IL2A 4EJUA 1U78A 5FLXZ 2XUBA 1P4AA 4L18B 1L0CA 2L54A 3R9GA 4KN4X 1XD7A 3E6MA 3PZJA 3W6JB 3KETA 5FFXA 4U9YA 4KIBA 4OINF 4B09A 1EH7A 1ZG5A 1Q2YA 3R95A 3J7AO 4HOBA 3TKYA 1E2XA 4IF5A 5LHHA 1D5VA 2L3DA 3HYIA 2EFQA 2F5DA 1HSJA 1F4KA 2IP2A 2FE3A 2B3UA 4HW0A 2DFIA 3K9TA 3MQ0A 5D5VB 1FYLA 2E7XA 4A5NA 3WE2A 1JHHA 1BOAA 2ZPAA 2HKXA 2Z10A 3I53A 2HZTA 5FGMA 1O3TA 1P4NA 2FBHA 2OH1A 2HYFA 2VI7A 2ZFWA 3SFZA 1UCRA 4ZYEA 3KKWA 1FC3A 1P4WA 3FMQA 4UNOA 2Z3YA 4XSZF 2FCKA 2PR1A 4KOSA 4PSWA 4UVCA 5D4RA 2RNJA 4HF1A 3NQOA 2XROA 1KUVA 3D2MA 4LLNA 2YX7A 2VC1A 1K78A 3CXSA 4IPAA 5F6FA 3IGRA 2GQQA 2ZW5A 3RJPA 1K4JA 2XRNA 4FD4A 1ZGAA 4IXAA 2G7UA 4RB1A 3HRUA 1IB1E 4HQEA 2J8NA 1F9NA 1ON2A 3V7CA 3EFAA 2P7CB 4N9HA 2D4PA 4NSQA 3V8KA 4JWPA 3R96A 1S7FA 1UHWA 3K9UA 2GZWA 2XAFA 3KE2A 4M3SA 5AIQA 2J5PA 1QSMA 4M71A 4FT8A 3DQVC 3M8EA 3P2FA 2DBBA 1D3YA 4MBUA 2OZGA 2PSWA 1ZG3A 1Q1HA 5HS9A 5IV0A 3ZMUA 3KCCA 2RQPA 1IF1A 4CHUA 1G3TA 2WV0A 1X3UA 3M8FA 5ERIA 5DEQA 3JTHA 5ILSA 3WTUC 2RV8A 3QPHA 3HSFA 2VXZA 4F7ZA 1J0RA 3D5LA 5HDGA 1KGSA 3L00A 2HEOA 5D8KB 5TRDA 3M1EA 4R9MA 4LG0A 4XLPF 5DD4A 4P9UA 2FE7A 2M45A 1G4DA 1BJAA 2Z5UA 4UWIA 4MGRA 2EV0A 3R9FA 3FF5A 3B73A 1ZRDA 4KVOE 4ZH4F 2FNAA 3TDZC 4FD6A 4KNYA 3KP7A 1U6MA 1CM0A 5J8FA 5CVIA 2QZ8A 1XMKA 2E1NA 1FSHA 2VBWA 3FB3A 2K5TA 3C7JA 3TO7A 4YFNF 3WTXC 5HLGA 4L9NA 2PFBA 3MAJA 1VHSA 4FD5A 3C18A 4BH9A 3LAJA 1KQ9A 4U0VA 4R3LA 1W4MA 4MHDA 3G73A 2FSRA 3T90A 1QO0D 1Z91A 1QSNA 1KZFA 3ABTA 1USSA 3P2HA 3W6XA 3DSBA 3HUGA 1KYZA 1M44A 2G0BA 2XAQA 3F6VA 1S5KA 4YFJA 3HHGA 2V1XA 2QM3A 1A04A 3TE4A 1FOKA 4CS0B 3G3SA 2VONA 4FHTA 3L7WA 4R57A 3LWFA 1HKQA 3HTUA 1YS7A 1OYYA 3LQQA 2JTVA 4QWQA 3R1KA 4LFUA 1S7NA 4CGZA 3RIRA 2P6TA 4G8XA 4AD9A 1MDMA 2FIAA 3F0AA 4WX9A 4L9JA 3S2WA 4YFXF 3DP7A 1YTYA 3FRMA 3S6FA 1F1ZA 2H6BA 2ISYA 3PFIA 4KVXA 5K5RA 3BJ6A 1FSEA 1Z1DA 2ZW6A 5IX3A 3DEUA 2GIVA 1Y9KA 4BMHA 3I3GA 2NNNA 1K6OA 2VN2A 1XDSA 3BLNA 2LF7A 3R9EA 5LHGA 3MZYA 1IZ1A 2B0LA 2R98A 1WK4A 1T2KA 1O57A 4OIPF 4XLNF 3F72A 2COMA 4FX0A 2FA5A 1XGOA 3BY6A 4M6YA 1QSRA 3V4GA 3H3ZA 3SXNA 1AWCA 2B5GA 3KP6A 2B3VA 4KIFA 4KOYA 2FBKA 4NHJA 4L5IA 4L9TA 3FZVA 2C6YA 3L09A 2PJPA 3LQRA 4L0ZB 1MJ9A 3ZMSA 1MD0A 2MBFA 1WKMA 5CNPA 5LEKA 4I98B 4LUAA 2FMYA 2K7LA 5GCNA 2HQNA 3WTSC 3RYOA 1STZA 2K4JA 4AIKA 3MZHA 4S04A 4PK2A 3MGDA 2FU4A 2GXBA 1OZPA 4JD6A 4PGGA 3PQKA 4BNCA 2A69F 3N7ZA 4OU0A 4ZZLA 2OAZA 4QUSA 4EQQA 2IVMA 1FZPB 5HH1A 1BI0A 3WU0A 4EMSA 2FSWA 2HTJA 3BJ8A 1P0HA 1EH6A 2LF8A 2V79A 4HKFA 4ENNA 5F1RA 2R7HA 3KP3A 4IRGA 4YIIA 3KP2A 3R0AA 5E17F 1XSDA 3O6BB 1C0WA 4PK3A 4KLVA 3IRQA 2W24A 1W7PD 3Q5FA 3QU6A 5HDNA 4Q47A 5E8GA 4LK0F 5IT3A 1T39A 2D4OA 2FIWA 2H94A 3Q9VA 3GF2A 2LNBA 2B58A 1WWXA 2Z0ZA 4M9ZA 1J9IA 2K4BA 3J80Z 2KIFA 4YG2F 5D6FA 1FP2A 1S7OA 3BP8A 3SZTA 1JGSA 3R4KA 3K2ZA 2JSCA 3QU3A 3P9CA 1Z4RA 1I1SA 1CF7B 3B8GA 2EVNA 1SD7A 3FBUA 1E17A 4QLCU 5ILUA 2H27A 4XPLA 4HF2A 2J8RA 4M9SA 1B1BA 2FMLA 3KFWX 5ICEA 1MKMA 1Y0UA 5L3EA 3QP5A 6PAXA 2GAUA 1Z6TA 4RI1A 1KU2A 2F5CA 3GX4X 3ZP5A 2ARHA 1O3SA 4MQ9F 2KJCA 1SMYF 2BEIA 2ACJA 3P9KA 2JPCA 4RGXA 4ZYHA 3GFIA 3OV8A 5FD6A 2P6SA 1HXDA 5HS7A 2QBYA 1W5SA 5AONA 3BDDA 4A5MA 3ERED 2VE8A 5DUIA 2O0YA 2EV6A 3TTHA 2EUIA 5DWMA 3DFGA 1S6LA 4Y49B 2A61A 4NEXA 1SD4A 2F5IA 4EM1A 3ZMZA 2A3SA 5L3BA 2H09A 2QECA 2REEA 1ZHFA 4J3GA 4R8HA 2DQRA 4TV7A 2YU3A 1TNTA 4KOWA 2YSRA 4HNWB 2W25A 1WRJA 3SHPA 2CSOA 2IRFG 3IHUA 3MCZA 4MTEA 3KEOA 1R58A 2GWRA 2IA0A 1QBJA 1G3YA 3L9FA 2CNTA 1PU9A 4HYEA 1IYLA 5D5XB 2Z33A 4BHCA 1IN6A 3W6KB 5ICCA 2Q2EA 2P5VA 4HNYB 2YX4A 5HMNA 1V4RA 2FQ3A 3V8LA 3RI4A 2E1CA 1BI2A 1BO4A 1RNLA 4KMUX 5D6EA 5D5WB 5BMZA 2PMUA 1BC7C 2I79A 2EK5A 4IRIA 1OYWA 3DNSA 1YR0A 1XE4A 1JXSA 2DU9A 2UZKA 3ROUA 4R3KA 3F8CA 1IXRC 4LK1F 2HV2A 5IT9Z 2M5WA 2CG4A 1I12A 5ILVA 2L4AA 2I00A 2PC1A 5LBQA 5H20A 2HFHA 2YPRA 5F49A 3RYPA 4EGZA 5FLXK 4I09A 1B59A 2R8VA 1S7LA 4KDPA 1U5TC 3N4MA 2MC3A 5F64A 4KUAA 3GEZA 4B5PA 1G3SA 1U5TA 4ON0A 1V0CA 2ETHA 3I64A 3EETA 4UVBA 1I5ZA 1F5TA 1Z4EA 3T0YA 4HA8A 1R1UA 1XSVA 5CVRA 4GGGA 2V1UA 1FBSA 3F6OA 2QWWA 2Z99A 4JLYA 1QSOA 4BXUA 3H3UA 5EEGA 4R79A 5JFRA 2VBYA 2AXLA 1GVJA 1YIOA 4GXOA 4L0YB 4XPKA 3SXYA 3TOAA 3H92A 1XGNA 1KUXA 5LGTA 2ZNZA 1YW9A 4I7HA 2K02A 4OLLA 5E1ZB 3KP4A 5DCFA 2K27A 4CDGA 1IN8A 4MEYF 5EC4A 2J5OA 1G3WA 1BOBA 4OAEA 4O5VA 2IA1A 3CO7C 4ZYDA 4Q5SF 3RKXA 1T38A 3DR8A 1DPUA 2W85A 3I59B 3V8IA 1EV7A 1JHFA 4OMYA 2D1HA 3RDIA 1LDDA 3D0SA 4CO8A 1XCVA 2R1IA 3TQNA 3WGGA 2X4HA 2BBYA 2F2EA 3EYYA 2ZKZA 1PP7U 2VXKA 3QOPA 4EJWA 1IN7A 4LX9A 4WK8F 4IF4A 1FPQA 4KT5C 3F8KA 2CQKA 1NE9A 3JAMK 1BN5A 3P9IA 2OZ6A 2PLYA 2CW0F 3TT2A 1IAWA 4E2AA 1IICA 2OQGA 4ENKA 2FL4A 4HX8A 5KTAA 4PGHA 4ZYGA 5DYMA 2B5GB 4U0WA 1LNWA 5CJ9A 3HOSA 3BJAA 1V3FA 1NSLA 2BEOA 3F23A 5H6QA 4U9ZA 1K79A 4G9YA 3JW4A 1IXCA 4R1HA 3E5XA 4FX4A 4IHSA 3ZMDA 2QIRA 2DXQA 2OZHA 4XNHC 3LA7A 1XSXA 3LAPA 5JQ4A 3WTWC 3BPXA 3MFKA 4HDUA 3GO5A 3WTYC 3KZZA 5ED4A 4QVTA 3FIXA 3EXNA 4II9A 2A68F 3J81Z 1LDKB 1ZN2A 3ABUA 4MNUA 5D8LB 2KCWA 4NCZA 1P4XA 3C1DA 1YVKA 4CYDA 5A2QZ 2VZZA 1FP1D 2A6HF 3CO6C 1GHCA 3VEPA 1U5TB 3FXRA 5HOOA 2PBIA 2DQLA 4LLGF 4MTDA 3I71A 3ZN1A 2WTEA 1I6XA 1T0FA 3IWGA 3IWFA 2WPXA 1T98A 3HHHA 4H89A 4AG7A 2PR8A 3V8JA 3HOTA 2XAHA 1Z9CA 5D4SA 2B4DB 2X7BA 4CAXA 2Q0OA 2RDPA 3NRVA 1PP8F 2GXGA 4M85A 5BPIA 5CVJA 2XIGA 5BQTA 4HDVA 4RS2A 2A5YB 3ML6A 2JPBA 2DI3A 3GY9A 3ZJ0A 4UV9A 4JXRA 4LD5A 3K0LA 1SFEA 4Y13A 4YIFA 2FNPA 2ESNA 2RVCA 2OB0A 2TDXA 4G7HF 5IT9K 2LDUA 1Y9WA 3HSRA 5F48A 2PI0A 4NXYA 3E3VA 1KUYA 2GANA 3E6CC 4A0XA 1BIAA 4X5KA 1JE8A 3J80K 2DK5A 4E70A 3DDDA 1U2WA 2DTRA 3GFLA 2HDCA 1D8KA 3E5QA 4UUVA 3F8FA 3I0TA 3I54A 4I2OA 4XPDC 2FF4A 1CGPA 3EUHA 2VOOA 4GYGA 3HRMA 3DPTA 1IRFA 2QBYB 2B4BA 1WI9A 1YVOA 2BL1A 1PUEE 3V7RA 2CY2A 2H6CA 3O2PE 3L2CA 3I9SA 1R36A 2L4MA 4S05A 5TJJA 1YLFA 2DK8A 1KQ8A 3FMSA 1IUYA 4CICA 2F5EA 5CLSA 1YLEA 2RKHA 1IN4A 1SQHA 2WC2A 3GW2A 4U88A 1XF8A 4KUMA 4CRYB 3Q9SA 2CGPA 4KMFA 5JI6A 4WXDA 3U9GA 2XAJA 3CLOA 2VE9A 3E0KA 4CAVA 2Q4YA 3I4PA 2Q04A 1J59A 4LJZF 5E20A 1S60A 1GHEA 4A2UA 1Z6RA 1ZARA 1N71A 2QENA 4G94A 4ESBA 2BE5F 5EBVA 2DAOA 3CUQA 4AIJA 3VFZA 1J4JA 2XV4S 2O28A 4NF1A 1TLHB 1LRZA 5D5UB 2OZUA 4WXCA 4DNCA 1BC8C 4RAYA 2P6FA 4XBFA 2HQRA 3QRFF 3FM3A 1EH8A 2F5FA 4RAZA 4NQWA 3EQLF 1HKTA 5FO5A 2A07F 2ZMEB 2FRHA 2STTA 1Z9UA 5E8IA 3F8BA 2QQ9A 1QSTA 2H5MA 4M72A 2D45A 3FXUA 2XGXA 1FYKA 2PN6A 2QMLA 2JRTA 4L8AA 3JTGA 3BPVA 2DW4A 2ZBKA 3S6HA 1Q2CA 4P9FA 1RO5A 3GZ6A 1VTNC 2EFPA 4QBJA 2VT3A 3BOQA 5C82A 5DCMB 2OU2A 2K86A 5ICGA 4ETSA 4G6DA 3M7GA 4U7DA 2PRBA 3CXQA 2O61A 1TQIA 1ZGJA 4HQMA 4U5YA 5DDGA 2ELHA 4MHGA 1PUAA 4A12A 2ISZA 4AVAA 5DWNA 4E0AA 1IW7F 1R5GA 1BM9A 2KJBA 2G9WA 2CFXA 4L89A 2FS5A 3R60A 3E6BA 1GXPA 4P96A 2G3AA 2GE3A 4WXHA 5HS8A 4DQ2A 2HOEA 4WF2A 4HX4A 4ENJA 4CZZA 3S6GA 1TW2A 2ESHA 3GLXA 2AS5F 3SHFA 1SFXA 5FD5A 2Z9OA 5L3CA 4AVPA 2PG4A 1HBXG 1J75A 4I0BA 4U7BA 2O6GE 3IKVA 4AWXB 2Q8KA 2W57A 3GYAA 2EFNA 2Y75A 1ZRFA 3C26A 3ZMVA 1LQ1A 1O7LA 3ZN0A 3ZQ7A 2G7HA 4EJOA 3EYIA 4P5OA 3ELKA 4KVME 1YX0A 3D8PA 2HKOA 2XASA 3D2PA 2ZCWA 4UXNA 4BHPA 4CXFA 3V7SA 2NMTA 1YO5C 1DDNA 3LSTA 2HR3A 4FD7A 1MDMB 5FVJA 2EFWA 3I59A 3GFJA 4I0AA 3GYHX 1XIXA 4XRFA 3FHZA 4GCVA 3TO9A 3HIFA 1FT9A 2MA3A 4KFCA 2HWVA 3LFKA 3E97A 5H86A 5KVRA 1MGTA 3K1PA 3F8MA 2PDOA 4K30A 1XMTA 2AE6A 1KU7A 4A6DA 1RXTA 1HW1A 2QQBA 4LGWA 3TGNA 2W84A 2IL4A 2CWEA 1REPC 1ZLJA 2YR2A 4LLLA 5JR3A 1YFHA 2FXFA 1YGHA 4D0PA 2P6GA 5LLQA 4ORFA 2LKPA 2L02A 3FYNA 2ZMEA 4O6JA 1R1VA 4UV8A 4EJTA 3EDPA 2PQ8A 2STWA 1SAXA 3VOEA 3BROA 1XDUA 3DV8A 2VBXA 5LGNA 4GS4A 4EM0B 2WWYA 4HF0A 4EJVA 3MEXA 5HVQC 3ZPLA 2Q44A 3WE3A 4HNXB 2IPQX 4AIHA 1U8RA 1WWZA 1S7AA 2HS5A 2M87A 1HW2A 2A4NA 2O03A 5EEHA 4L5JA 1YQAA 1TIQA 3CUOA 2VT2A 3R6SA 4G7ZF 1ULYA 3FMRA 3JVNA 4M74A 1DUXC 1LDJA 2EA2A 2IJLA 1AOYA 3P7NA 1ONVA 1TW3A 2QQAA 1M4GA 3CXPA 4RGSA 2EWNA 1B6AA 3BJ7A 2MD5A 2ZXVA 2QVOA 3RTRA 3PGPA 3ECOA 4YRHA 1NHAA 2B4DA 3T1BA 3I58A 4H6ZA 4BAYA 1FNNA 5ICFA 4KLWA 5DUKA 4OADA 1RI7A 3TCVA 1YG2A 2J8MA 5HDKA 4Y49C 4HLXA 4G7OF 1SD6A 3NE7A 4P55A 4HLYA 3T5XA 1H0MA 4H0EA 4RGRA 2CYYA 3BZ6A 2MH2A 4OOIA 4AB7A 1BIBA 2FEZA 3W91A 5DD8A 3TDUC 3JSPA 5F46A 3F8NA 4N0BA 2EJRA 2M8EA 3T9YA 1YW7A 4M6XA 4ONUA 2JEVA 2OA4A 2VODA 3GWZA 4QB9A 5DCMA 2P5LC 4PV6A 3IWZA 2M1BA 4O3MA 2ZXJA 2PEXA 1YREA 2FBIA 3KP5A 1MZBA 3CJNA 4B8XA 4A0ZA 1IRGA 4I49A 3U1DA 2R3SA 2PMHA 1TNSA 4AG9A 4JJXA 3G3ZA 1SFUA 1XB4A 2XAGA 1LVAA 5A2QK 2Q0YA 3KLOA 5CVUA 3KEQA 5K5QA 2VOPA 4IVNA 5BS6A 1Y7RA 5FB2A 3E5UA 2FXAA 4H6UA 2EFOA 5I0CA 3GUDA 1U3EM 4R87A 2VC0A 3ZZIA 1K7AA 3WODF 2BV6A 4KZTA 4OMZA 3HSEA 3GVAA 2DPUA 1P6RA 1Z05A 3EC4A 1B6BA 3DKWA 2ADUA 4A6EA 2JZYA 2O8XA 2OQRA 2BYVE 2REFA 1RZ4A 2DLLA 2DPDA 4RS8A 4CAWA 2P0WA 4LMYA 4OIRF 3IRRA 1J5YA 3VODA 3TFYA 1WQ2A 5JVTA 1R22A 1TTYA 4EM2A 2HYGD 3WTTC 1M4DA 4KOVA 1YK3A 2IT0A 5L3GA 1HW5A 4AVCA 5K1YA 4GYIA 5AIPA 1MJBA 1OYIA 4Z2YA 2Z11A 1ZRCA 2UXNA 4UHTA 1B4AA 1QZYA 3LD2A 3DPLC 2P4WA 3CTAA 3JUWA 5LRSA 1J7KA 4KIGA 1J2XA 1Z7UA 2CNMA 1G6NA 1KYWA 4ZBGA 3F22A 3FNCA 3GFMA 4KOTA 1SMTA 3SZPA 3CUQC 3FX3A 2VEZA 2HTSA 1I21A 3ISPA 1R5HA 5LHIA 1QZZA 4L9VA 3N97A 4IRHA 4WWCA 4MQVA 2GA1A 2JT1A 4K2EA 1TBXA 3FM5A 2Y48A 1I27A 3B02A 2O3FA 4Q4ZF 3RPUA 1HQCA 2ZNYA 2BGCA 3HRSA 4A0YA 2HGCA 4I01A 5KTDA 1UHMA 3COAC 2G3TA 2E7WA 3LA2A 3KLNA 4UA3A 3VB2A 2C27A 1P2FA 3QPTA 3VWEA 3WG9A 2BSWA 2XVCA 1P92A 2MLGA 1YS6A 1IN5A 4CRZB 1BI3A 4RB3C 1FX7A 1XN7A 2RN7A 3H4QA 2QLZA 2MH9A 1W7PB 2P8TA 4OIOF 3WR7A 4Q48A 3G8WA 3F5BA 1B87A 2D1VA 2Q4VA 2XHKA 1S8NA 2KRFA 4ESFA 1LEBA 2DO7A 5E1XA 1LEAA 2ZO4A 4XNHB 5DV5A 2IA2A 1NMTA 2JLMA 3WGHA 2V1DA 1KA8A 4ENMA 1O3QA 1RUNA 2FOKA 3VWDA 2XKOA 3RPQA 4KYWA 3JAMZ 3EO4A 3M9AA 2Q7BA 3DF8A 3K1NA 4LG0B 2WPWA 3DR6A 5E96A 4I02A 3BJOA 3OOPA 1S3JA 4PZJA 1FY7A 3BWGA 2NS0A 2Y0MA 1MJAA 2VBZA 3D3SA 5IB0A 5ISVA 2QUFA 4RB0A 2RC4A 2LSOA 2IW5A 3IC7A 1CF7A 1RUOA 3WU1B 3F21A 3GKRA 1HSTA 3F3XA 3RKYA 2X0LA 5LRRA 2KIUA 2JDDA 3ECHA 4G6QA 5BOXA 2V9VA 1O7FA 3TOBA 1QNTA 4JK1X 2P6EA 3FXTA 1B9MA 1USTA 3K69A 4B5PB 1H9GA 1OMIA 2NRAC 2ZW7A 4HBLA 4HZFA 1LJ9A 2ATRA 1L3LA 3JSOA 2D2WA 1XGSA 4BQAA 3U2RA 4RB2C 1MK4A 1ZREA 3HRTA 5F47A 4BYYA 3T8RA 3PQJA 1LB2A 2VQYA 1TQMA 4IJAA 5LGUA 5CYVA 1FBUA 2MLKA 3R0JA 4PDKA 3E6DA 5L3DA 4UVAA 2VBQA 1O3RA 5HLIA 4F0YA 3ULQB 3LA3A 1T6SA 3WGIA 1ODDA 2NAZA 4NB5A 3RYRA 5KTCA 1ZYRF 5H84A 1GXQA 1ZAOA 3R61A 2AJ6A 1I1GA 2EB7A 2R7DA 2UXXA 4KICA 1Q2DA 4LB5A 1R57A 4XPDB 3FWEA 1K78B 1XEBA 1IXSB 4EVIA 4MY3A 4EGYA 4MJ8A 1S29A 1S7KA 2P7VB 4ZZDA 4KOUA 4MY0A 3QP6A 4E8OA 2CNSA 4MEXF 1L0OC 1UFMA 5JPHA 2XKPA 3DXJF 4YGOA 3C3WA 4WCGA 1ZG1A 3OWCA 2KKOA 1UB9A 5FFZA 1PDNC 3QAHA 1R23A 1FLIA 3IKTA 2OBPA 1OKRA 2HUZA 3ZMTA 1B9NA 4IUSA 1DP7P 3S6KA 1ON1A 5C88A 4QC6A 1TQPA 4HAMA 2QYOA 1FWZA 4XSXF 2CO5A 1ZH5A 2JDCA 5K5OA 4ESJA 3SXOA 3CUQB 4UWJA 2OD5A 1R00A 2A6EF 3RKWA 1ZLKA 4PSXA 2NNYA 4GO1A 3W6SA 1ON0A 2FT0A 4RGUA 3QB8A 2ZW4A 1RIOH 1HKSA 4Y15A 5LEJA 1W7PA 1FYMA 4JBAA 4JXQA 4HV6A 1SD5A 1VKCA
chains in the Genus database with same CATH superfamily
4DZPA 4IHMA 1YW8A 4KN7X 4XRSG 4M9XA 1I1DA 1Z2IA 5E18F 2BUEA 1JKPC 2NYXA 5JHUA 3MKLA 1IIDA 2JBKA 3H8GA 3S9MA 1T8IA 2EBJA 1QQIA 2PJ7A 3JRFA 4UBRA 4KORA 3FKJA 1CT2I 3CDHA 1XCBA 3WHCA 1SGYI 1DTDA 1WJEA 5IOYA 3GZ5A 5J6XA 4U0YA 4NDLA 2M7AA 2O9LA 2EV5A 2M34A 3HTSB 3UY5A 2IS2A 5G20A 1IYKA 1DPRA 4PCQA 2P5KA 3KR4A 5BPDA 2L9VA 2WY8Q 4M73A 3VH9A 5HXDA 1WSUA 3UGIA 3VYRB 1OCRH 2XEIA 2KIMA 4C3IJ 4IOAF 1XS9A 4XIDA 1QPMA 1M1DA 3R5CA 4YFKF 1LR7A 4KA4A 1CPXA 2BOLA 3RZAA 3FXQA 4LB6B 3WTZA 4QIWN 1M4IA 2HDWA 7CPAA 5GPCA 2R7QA 1H9TA 1GYTA 1U6GA 3REOA 3UEJA 3KEYA 5H6RA 1DGWY 3A2KA 5D8NA 4TWEA 3OIOA 2CQ7A 5E1WA 3T8TA 2RFHA 4FCYA 1XMAA 1FBQA 4A3FJ 3LODA 1VQ5I 3NH5A 4BHBA 4XL9A 3BTLA 1QGPA 1P9QC 2PJ1A 4IHWA 3DBLB 2XAUA 3EY5A 1VQKI 2RGVA 3OYAA 5HNFA 3GXOA 1PVEA 2ZJ2A 5C44J 2V8HA 3TO6A 3RNZA 5CVVA 3VYSB 5IOZA 2V8GA 3C2BA 1OYVI 4IHTA 3O3KA 3SQNA 3NEUA 5L3FA 5FLVA 4UEEA 4KUBA 2MSYA 4AVBA 4PXBA 2WY7Q 3QOEA 4A95A 2XPVA 4EVYA 5GTHC 2AO9A 2KMPA 2HQYA 2VZYA 4ZDPA 1OR7A 2PVVA 3WC6A 1IJWC 1KU3A 4HV5A 1XGMA 5E3LA 1R1TA 4DYQA 1SGQI 2VXDA 4JQFA 4BJ5C 2V53A 5FROA 2CUEA 5J8CA 3K10A 5HLHA 1XPXA 4UXJA 1CJWA 2NSMA 1OMTA 3SI0A 4N9IA 2F3CI 3PP9A 1YYVA 2M30A 3MWMA 2LEOA 5K8OA 4HSRA 4JYKA 1OPCA 1Y0YA 4NFRA 1OFCX 1KU9A 3B3CA 4EV0A 2ENZA 2VL8A 2DT5A 1R7JA 4ASNA 1S3ZA 1W5TA 1Z3XA 3DLLF 5KK1A 2UWMA 4MI4A 4B5OA 4YELA 2V4JC 3HZJA 3I5UA 5J40A 1UAAA 1D8JA 5ELYA 1KQ0A 2HOAA 5J1YA 2V6CA 2ZXWH 4C3JJ 4UCNA 2HQ5A 4NJQA 4CYCA 5J4VA 3S1NJ 4KOXA 3OMYA 4MHPA 1V5EA 3K1MA 3TBIA 3AAFA 2ZENA 2EA4A 2GA2A 3S32A 4D9JA 3WTVC 1MBEA 3H8FA 4F6AA 4Y17A 3G71I 4IOCF 3K2KA 3J81K 2R7FA 4OIQF 2L01A 1BI1A 1BBYA 3KZYA 4HX7A 1HEEA 3GLLA 4H4KC 1UFHA 3IL2A 3CZ6A 2O8KA 4XMYA 4EJUA 1U78A 5FLXZ 2XUBA 2B63J 1P4AA 1WPKA 1A35A 4L18B 1L0CA 2R5ZA 2KZGA 2L54A 4UF4A 4B3XA 3R9GA 1E0EA 1IGBA 4KN4X 1XD7A 3E6MA 5GAHJ 3DKYA 3W6JB 3KETA 1AN1I 3D5RC 5FFXA 3PZJA 4KIBA 5FUVA 4U9YA 2C6PA 1WI3A 4OINF 4B09A 1EH7A 1ZG5A 1YJ9I 1Q2YA 3R95A 3IP4B 2GXAA 3ZQHA 3A02A 3J7AO 1AHDP 4HOBA 4CYOA 4ZYAA 3E2IA 3V42A 2SGEI 3TKYA 1E2XA 1ZLHA 1TZLA 2KLOA 4IF5A 1F2PA 2ZSHB 1EKEA 3OYKA 1YLOA 1ETKA 5LHHA 3EUAA 1D5VA 2L3DA 3HYIA 2EFQA 2F5DA 1HSJA 3T8WA 2W4SA 1F4KA 1PJUA 3OVOA 2EIKH 2FE3A 2IP2A 2R4GA 2B3UA 4CAFA 4HW0A 4XRMA 5LYLA 1BPNA 4GXHA 5J1QA 2DFIA 4CYQA 2M9HA 2YUUA 3K9TA 3MQ0A 2DA3A 2IGKA 4D5FA 5C4JJ 1VQPI 1JKQC 3H5AA 5D5VB 1FYLA 2EPFA 2EH3A 1NH3A 2E7XA 4FETA 3S1RJ 3KYDB 2AFXA 4A5NA 2NVTJ 3JRGA 3CF5F 1K7UA 2M2EA 3WE2A 1JHHA 3CD6I 1BOAA 2ZPAA 2W00A 3OS1A 4BE2A 5LD2C 2HKXA 4BS9A 4FAIA 2JA1A 3FXKA 1KMAA 3SI2A 2Z10A 4IL6C 3WC7A 3I53A 2HZTA 2LMDA 5FGMA 3SDBA 4ABZA 1O3TA 1QRYA 2PJ8A 2ZXIA 1P4NA 2FBHA 4P44A 3SJEA 2GVIA 2OH1A 2Q51A 2HYFA 2VI7A 2ZFWA 4ZGYB 2LTPA 3SFZA 1UCRA 4ZYEA 3KKWA 1FC3A 2K5CA 4A33A 3JCUC 1P4WA 3SFIA 1X19A 3FMQA 4UNOA 1R71A 4A3JJ 2Z3YA 2KMOA 4XSZF 4KSIA 2FCKA 4PSWA 2PR1A 4KOSA 4NGNA 4UVCA 2KFDA 2RNJA 5D4RA 2KL4A 2V1CA 4HF1A 3NQOA 2G0EA 2XROA 4AYBN 1KUVA 4V19K 4CH7A 3D2MA 4LLNA 2YX7A 4IZZA 1D0YA 2VC1A 1K78A 1YMEA 3CXSA 3LFUA 1TF9A 4IPAA 5F6FA 1U8BA 3IGRA 2JRMA 2GQQA 1KONA 2ZW5A 3D7DA 3D4UA 3RJPA 3HDDA 2CJSC 4IK2A 1K4JA 3PFEA 2XRNA 3B35A 1IOFA 4FD4A 1ZGAA 4QPOA 2YS9A 4GM5A 4IXAA 2A20A 3M4OJ 2G7UA 3CJQB 4RB1A 4B47A 3HRUA 1IB1E 4RA2A 5FKNA 4HQEA 2J8NA 1F9NA 1ON2A 4XOTA 2O5RA 3HGYA 3V7CA 3EFAA 4ZY0A 2P7CB 4N9HA 1R9TJ 4ANJA 2D4PA 4FASD 4NSQA 3V8KA 4W9YA 2YQPA 3BQYA 4JWPA 3R96A 2ME0A 1S7FA 1UHWA 2CH0A 1K4TA 2GZWA 3A0BC 2WCYA 3K9UA 2XAFA 3KE2A 4M3SA 5AIQA 2HU9A 2J5PA 1QSMA 4M71A 1XX6A 4FT8A 5B1AH 3SEQA 4A3IJ 3DQVC 2XF6A 3M8EA 2X6XA 3GLJA 4I99C 4F52A 3ABLH 3P2FA 2DBBA 4BY1J 1D3YA 1R3NA 4MBUA 3G1OA 2OZGA 2PSWA 1ZG3A 1AU7A 1Q1HA 4E7ZA 5HS9A 5IV0A 3ZMUA 3KCCA 2RQPA 2OTLI 1D0XA 1IF1A 1G3TA 4CHUA 2W48A 2GLFA 4NJRA 4DZJA 2WV0A 1X3UA 3M8FA 4AMLA 3JREA 5ERIA 5DEQA 1HCRA 2K9SA 1PYTB 2QA4I 3JTHA 5ILSA 3WTUC 1ZO0A 4C2TA 3VDXA 2RV8A 3QPHA 3HSFA 2VXZA 4F7ZA 4UEZA 1J0RA 3KY9A 3D5LA 4V2GA 4MFJA 2ZJQF 5HDGA 3W2WA 2NVYJ 1KGSA 5GADJ 3L00A 2MFZA 2HEOA 3I4MJ 3SJFA 5E96A 3CCRI 5D8KB 1O4XA 5TRDA 3M1EA 4R9MA 4LG0A 1G59A 3IO1A 4HNVA 4XLPF 4YRVA 4A3MJ 5DD4A 2Q2EB 4P9UA 2CIJA 2FE7A 2EWBA 3FEEA 1K4SA 4E1PA 2M45A 4HGUA 1OCPA 5B5EC 1G4DA 2LP0A 3OS0A 4AXVA 3KHXA 3OYJA 4XLFA 1X1DA 1BJAA 2Z5UA 4WP4A 4QPQA 4UWIA 4MGRA 2EV0A 3R9FA 3FF5A 2N52A 3B73A 1ZRDA 3OL3A 3AG2H 5DS0A 4KVOE 3WC5A 2VB6A 2FNAA 4ZH4F 4CGNA 3HLPA 2JA5J 3X2QH 2WVJA 3TDZC 4FD6A 1FT7A 2YNCC 4KNYA 1IV8A 3BG7A 2CUJA 3KP7A 1U6MA 1CM0A 3CDIA 5CVIA 5J8FA 2QZ8A 3LSKA 1XMKA 2E1NA 1PPFI 1RKWA 5FUXA 3NAUA 4W1UA 5GTIC 3JRIA 1FSHA 2VBWA 3FB3A 3N05A 2K5TA 3C7JA 3TO7A 4R76A 3RQ4A 4YFNF 3WTXC 4PXCA 4J01A 5HLGA 1FMWA 2KMUA 3TW7A 4CUGA 2L9SA 4L9NA 4XLHA 8CPAA 2PFBA 3BCBA 3MAJA 4LQGA 1MBGA 3FBNB 1VHSA 4P4JA 3A4CA 2HVSA 3TC8A 4FD5A 4FISA 3FH4A 3C18A 4BH9A 3LAJA 2WZNA 3FJUA 1KQ9A 3WT4A 1BMOA 4U0VA 4R3LA 1W4MA 5KNLA 4MHDA 2XEGA 2JA2A 2WSAA 3QWLA 2BZTA 3G73A 3R5AA 4XKVA 2PX9A 2FSRA 3IIBA 3IJ3A 1QO0D 1Y1WJ 4Q38A 3T90A 1Z91A 1QSNA 1LKXA 4A37A 1KZFA 2V26A 1GLNA 3ABTA 3ZOBA 2AHQA 1USSA 2QGUA 2V9KA 3P2HA 4OC5A 3W6XA 1ZKGA 3BG5A 3DSBA 1TT5B 3HUGA 1KYZA 1WCMJ 1M44A 4DOZA 2R7SA 4RAGA 2G0BA 2XAQA 4G1PA 2JW6A 3F6VA 3TP0A 1S5KA 4YFJA 1MNDA 3HHGA 5LYFA 2EK9A 2V8VA 5GP9A 2FOWA 4XOPA 3IU2A 3GTKJ 2V1XA 2QM3A 1W0TA 1A04A 3TE4A 1FOKA 4CS0B 3G3SA 2K40A 4MIMA 2VONA 4ZY2A 4FHTA 2VJ4A 5IB9A 3L7WA 1YW4A 2WUUA 1BUSA 1H8LA 3LWFA 4LIUA 4R57A 4A2ZA 4LQ6A 2E5ZA 1HKQA 4UFXA 3HTUA 1Z2LA 1YS7A 2LY2A 1OYYA 3LQQA 2JTVA 4QWQA 3R1KA 1TL8A 4LFUA 4MXUA 1WH7A 2E1MB 2E1OA 1VQLI 1RESA 2ELIA 3HC7A 3KQXA 2L7XA 3TJQA 4DUKA 1S7NA 3RIRA 1AKHA 2P6TA 2JK3A 4CGZA 2E2HJ 4G8XA 4AD9A 2CS3A 1MDMA 1UVFA 1SGDI 2FIAA 3F0AA 2AXTC 4WX9A 4L9JA 3S2WA 4YFXF 3DEEA 4KJZA 3CCUI 3TEDA 1S7EA 3DP7A 4IHYA 1YTYA 3FRMA 3OYNA 4NGQA 1F57A 3PEIA 3FBIB 3S6FA 1F1ZA 2H6BA 2ISYA 3WU2C 1FOWA 1F36A 3PFIA 4KVXA 3QWPA 5K5RA 3BJ6A 1Y6IA 3OY9A 1Q1VA 4PJLA 1FSEA 1PUFA 2CTBA 1JT0A 3VATA 4YWYA 1Z1DA 1MNMC 2ZW6A 5IX3A 2IQ6A 3A9LA 4P6YA 3DEUA 2GIVA 1Y9KA 1SFOJ 5DAEA 4BMHA 3I3GA 1SC7A 2ECBA 2NNNA 3DTEA 2VN2A 3L1PA 1K6OA 1YRNA 1CG2A 2AFOA 1XDSA 3BLNA 3WHBA 4L5EA 2LF7A 3AG4H 3R9EA 1OCOH 1ULMA 5LHGA 5KHDA 2WYRA 2LVSA 2F7VA 3KPHA 4OAYA 3MZYA 1IZ1A 1RC9A 1W36C 3OS2A 1FAQA 2B0LA 3MN2A 2R98A 3TP3A 1T2KA 1WK4A 1O57A 4OIPF 2ZEEA 4XLNF 4IHXA 2CMPA 3NARA 3F72A 3K6GA 4X1EA 2COMA 4FX0A 1W4RA 3VDPA 2FA5A 1XGOA 3BY6A 4M6YA 1Y8RB 1QSRA 2ID6A 3V4GA 3H3ZA 1LFWA 3R5DA 2LFBA 1Z7KB 1LVKA 3SXNA 1AWCA 2B5GA 2R7WA 3KP6A 2B3VA 3TFYA 4KIFA 4KOYA 2FBKA 3LNQA 2KIQA 3PNVA 3QYFA 4L5IA 4NHJA 4L9TA 1BA5A 1DQUA 2Y0SN 3FZVA 2C6YA 1NTCA 3L09A 3EUKL 4LIVA 1H8AC 4MPIA 2HB6A 2PJPA 3LQRA 1QU3A 2ZEGA 1Z0XA 2HPIA 2L9NA 3FXLA 4L0ZB 1MJ9A 2RAEA 3ZMSA 2ZMEC 1MD0A 1Z8LA 2MBFA 1WKMA 2R7TA 5CNPA 5LEKA 4I98B 1FARA 1ERDA 2JUCA 3BR6A 2FMYA 4LUAA 2K7LA 5GCNA 2CW8A 2HQNA 2KRHA 2ME6A 4C30A 4B4CA 3WTSC 3RYOA 5F0HA 1CT0I 1STZA 2K4JA 1MW7A 2NOJB 5J47A 3NA6A 4DBQA 4AIKA 1W3SA 4RUHA 3MZHA 3BR2A 4S04A 4XN3A 4PK2A 3VE5A 3MGDA 3GTJJ 1YX5A 4EWTA 3OL0A 2FU4A 5K8PA 2GXBA 3BR3A 2ANPA 3L2RA 1OZPA 1SGPI 4JD6A 4PGGA 3PQKA 2NVXJ 4BNCA 2A69F 3BG6A 3N7ZA 2ZOGA 4OU0A 4A69C 4ZZLA 1ETQA 2OAZA 4QUSA 4XNFA 4XRSA 2N17A 4EQQA 1WJCA 2IVMA 2Z2SB 1FZPB 5HH1A 4XICA 5EYRA 3I3LA 1BI0A 4I76A 2KDZA 1A6QA 3QTLD 1ITYA 3KZIC 1WJFA 3WU0A 3FXOA 2PCUA 4EMSA 2FSWA 1QVTA 2DCEA 1HF0A 2HTJA 3QPLA 3BJ8A 1P0HA 3F0CA 4M3BA 3WG7H 1EH6A 4XKCA 2LF8A 3BI1A 2V79A 4HKFA 2Z3OA 4ENNA 3PO2J 2J87A 5F1RA 3J7YJ 2R7HA 3KP3A 4IRGA 4YIIA 1UG0A 3DU5A 3KP2A 3CP2A 3R0AA 5E17F 2G9DA 1XSDA 3MN8A 3O6BB 3B6AA 4PUSA 1C0WA 4PK3A 4KLVA 3IRQA 4P4FA 4MLOA 2W24A 1W7PD 4BBRJ 3MKZA 4J00A 3DU6A 3QU6A 3Q5FA 1MH3A 5HDNA 1D1BA 3KASA 2ERWA 1ETVA 4Q47A 1QVUA 5E8GA 4LK0F 2LKXA 4CYPA 3Q0WA 3HUGB 3ZQCA 5FUYA 5IT3A 1T39A 2D4OA 2FIWA 2H94A 3M3YJ 2P81A 3Q9VA 3GF2A 2LNBA 2B58A 1WWXA 1LR8A 4A3GJ 2Z0ZA 4M9ZA 5E3PA 1DS2I 1J9IA 4ONWA 4M6VA 3OIPA 2K4BA 1RTQA 3J80Z 4Y7NJ 2KIFA 4YG2F 2R93J 5D6FA 2C6GA 5M5WJ 2E1MC 3Q3SA 1FP2A 1S7OA 1MBHA 4UIBA 2E5RA 3HM5A 4B10A 1WJBA 3BP8A 1GT0C 3CESA 3SZTA 4PXDA 1JGSA 3QAYA 1JUMA 2BVLA 2JWTA 3R4KA 3A01A 3K2ZA 2JSCA 1ZLIA 4R7MA 4B3AA 5A28A 1H88C 3H36A 3QU3A 1OBRA 3FC3A 3BHXA 4OC0A 3P9CA 3OYGA 4E1RA 1Z4RA 4KT6A 1P7IA 1NK3P 4A3EJ 1I1SA 2ZC2A 1CF7B 3H5ZA 3B8GA 2EVNA 2HQAA 1SD7A 2CUFA 4L9MA 3FBUA 1E17A 2BOAA 4QLCU 1BR1A 4PJ0C 2XPUA 5ILUA 2H27A 3CLQA 4KITB 2PRQA 5CPAA 3B3SA 4B48A 4XPLA 4HF2A 2J8RA 4M9SA 1B1BA 2Q43A 2FMLA 5EDNA 1W36D 1UMQA 1OLTA 2SGDI 3KFWX 5ICEA 3PM1A 3C2HA 2COBA 1MKMA 2BHYA 1NUBA 1Y0UA 3BTCA 2OTJI 3HH2C 4DJLA 2WGCA 2F4OB 3VSLA 1Z7LA 5L3EA 1TOTA 3QP5A 6PAXA 2GAUA 1Z6TA 4BE1A 3HKZA 4RI1A 1KU2A 4E7JA 4F0XA 2F5CA 3GX4X 3ZP5A 2ARHA 1O3SA 1I50J 1MMGA 4MQ9F 2KJCA 1UG2A 2L7MP 1SMYF 4DYRA 1VQMI 2ACJA 3P9KA 2BEIA 4BD9A 2JPCA 1MNEA 1UZCA 4RGXA 2OCEA 4ZYHA 3OYLA 3GFIA 3MMYB 3OV8A 3BG3A 5FUWA 2FD5A 1X10A 4E7SA 5FD6A 1CBXA 1ELMP 3HB9A 2P6SA 3DKXA 1HXDA 2ROWA 2ORWA 2WAFA 3FSYA 1MH4A 5HS7A 2QBYA 4ZYQA 1W5SA 2EK8A 3BT9A 3OYMA 1IY7A 1G8XA 5AONA 3BDDA 1X4PA 3ASOH 4X6AJ 1TUSA 4A5MA 3S1MJ 3ERED 1CQTA 2VE8A 5J1RA 5DUIA 1LPQA 2O0YA 4MFPA 2EV6A 2E71A 3B7IA 2EUIA 3TTHA 2EILH 2M8GX 2BUSA 2DKVA 5DWMA 3DFGA 1RRJA 3O8GA 2X6YA 4IEJA 1S6LA 2VPLA 1ELLP 4Y49B 2ZEDA 2E34A 2A61A 2MW8A 2CQQA 3OR1C 4BEHB 5EG0B 1SD4A 1LFUP 5JHWC 2KHMA 4EM1A 1HOMA 2F5IA 4NEXA 3ZMZA 4R8FA 5FJ8J 4PFPA 2A3SA 5L3BA 2H09A 2QECA 3HOUJ 2OF7A 2REEA 1ZHFA 4JX4A 4J3GA 4R8HA 5KAIC 2CWHA 2PJCA 2DQRA 3KZWA 4TV7A 3DTIA 2O4HA 3M07A 1XX5A 2XF5A 2YU3A 1T08B 1TNTA 3OL4A 4KOWA 2YSRA 4HNWB 1I3QJ 2W25A 1TWFJ 2A5WA 2I3CA 1WRJA 2IS4A 3H0DA 2H8RA 3SHPA 2CSOA 1TBRR 3RSNA 5F0FA 2IRFG 3IHUA 3MCZA 4MTEA 5IP9J 2PIZA 3PB4X 3KEOA 1R58A 2GWRA 3CMYA 3A1YA 2FQ4A 2IA0A 1QBJA 1G3YA 3L9FA 1YU6C 2CNTA 1PU9A 1VHEA 4HYEA 4I6ZA 1IYLA 5D5XB 1BJZA 3Q0UA 1IV6A 1PCEA 2Z33A 3PUFA 4BHCA 1IG7A 2QVPA 1IN6A 1MBKA 3W6KB 1VIXA 4A32A 5ICCA 2Q2EA 2P5VA 4HNYB 4HPSA 2LYCA 2YX4A 5FKMA 5HMNA 1V4RA 2GFQA 2FQ3A 3V8LA 3SJGA 3RI4A 2E1CA 1BI2A 2IJZA 3VARA 3LSHA 1BO4A 1TBQR 1RNLA 2IXSA 3PIPF 3UFFA 1AUGA 4KMUX 1UELB 5D6EA 2GU2A 5D5WB 4MHNA 5BMZA 4JZ0A 5EF6A 2PMUA 1BC7C 2I79A 3OYDA 1YITI 2EK5A 4IRIA 1OYWA 3DNSA 2MYSA 1Z5RA 1YR0A 1RKTA 3RQIA 1X3WB 2Y2ZA 1JXSA 1Y1VJ 2VQGA 2DU9A 2UZKA 1XE4A 3HOYJ 3ROUA 1MSEC 4MCSA 4R3KA 2IGOA 3F8CA 1IXRC 3CCJI 4LK1F 1WH5A 4YIRX 1Y0RA 2QYVA 2HV2A 5IT9Z 3PBEA 2M5WA 2CG4A 2R5YB 2VKEA 3VPRA 1FTTA 1I12A 2QEXI 2PIYA 4N4NB 3BXMA 5ILVA 2L4AA 2ZEOA 2BW3B 2IMOA 4M6IA 2I00A 3IH3A 2CV1A 2PC1A 5LBQA 2LRDA 5H20A 4CZCA 1DP3A 1Y56A 2HFHA 2YPRA 5F49A 5E3OA 3ZQQA 1ZG9A 1OISA 1JJ8C 4JCVE 3RYPA 4EGZA 5FLXK 4I09A 4DYCA 1B59A 4EEFG 4F55A 2AFZA 2R8VA 3LSRA 2YU9J 1S7LA 4KDPA 1Y8FA 1U5TC 3IAM2 3N4MA 2MC3A 5F64A 4KUAA 3GEZA 2KPMA 4B5PA 1LFBA 3JRAA 1G3SA 1U5TA 3RPUD 1VZ0A 4ON0A 1V0CA 2ETHA 3I64A 3EETA 4UVBA 4B1RA 3MEKA 1I5ZA 1F5TA 1W0UA 3S15J 3T0YA 1Z4EA 4HA8A 1OQYA 2DOFA 3PB6X 5GAEJ 1TT0A 2ZJPF 1R1UA 2EZKA 1XJOA 1XSVA 5CVRA 4GGGA 5EEAA 2V6EA 1YIJI 3CDXA 3H35A 3DPUA 1JI8A 3PB8X 3AG3H 5THWA 2MABA 2V1UA 2JA6J 9ANTA 1FBSA 3F6OA 3UR3C 4BXXJ 2QWWA 1K7TA 1U0JA 2Z99A 2KMQA 3OXLA 2K9QA 4XQFA 4JLYA 2E35A 3OSGA 2E73A 1QSOA 4BXUA 1SEUA 1Z21A 3ASNH 3H3UA 5EEGA 3GTGJ 3FMCA 4R79A 3AL0C 5JFRA 2VBYA 2VJIA 2AXLA 2ICWG 3OXFA 2ZEPA 1GVJA 4YU9A 1A31A 5K7FA 1YIOA 4GXOA 4L0YB 1TWGJ 2DJIA 3LSMA 4XPKA 2M3AA 3SXYA 2V1NA 3TOAA 5CQGA 3IU1A 1TKFA 3S9LA 3H92A 4J19A 2Y0SA 2HNHA 1XGNA 5DM6F 1KUXA 2DA2A 5LGTA 1MBJA 1YW9A 2ZNZA 4KISA 4I7HA 2JBJA 5BWAB 2K02A 3A0HC 3AL0B 5EGOB 4OLLA 5E1ZB 3KP4A 1XC5A 1MSFC 1IDZA 1CPSA 5DCFA 2K27A 4CDGA 5HVGA 1IN8A 4QSHA 4E7KA 3SZGA 2M4KA 2LY1A 4MEYF 2Z1DA 4F3QA 5EC4A 1R5ID 3KL9A 4BJ6C 1QPIA 4UY8I 2J5OA 1G3WA 3CCEI 4BE0A 1BOBA 4BDYA 1MT1A 3GB0A 2KQRA 2VPRA 4O5VA 4OAEA 2SGQI 1JGGA 2IA1A 2LC2A 3CO7C 3UOEA 4ZYDA 1EE3P 4Q5SF 1XFOA 3RKXA 4Y33A 1SVOA 3LSGA 4UEFA 1JWQA 2EO8A 4ZC3A 1T38A 1WZ2A 2NOGA 1DPUA 2CWFA 2PJRA 2W85A 3DR8A 3I59B 3V8IA 2BY0A 1EV7A 4IKFA 1JHFA 2R5ZB 1M1EB 4OMYA 3H5RA 2D1HA 2TRTA 2XB5A 4PJMA 3RDIA 1PCAA 1CGJI 1LDDA 3D0SA 4PPZA 4CO8A 1XCVA 3PFOA 2ZJRF 1D1CA 2R1IA 2B7EA 4BACA 1RFHA 3TQNA 3BCAA 3WGGA 2XEFA 3G2BA 4FTHA 2X4HA 2LOOA 2BBYA 2F2EA 4Y4RA 4HSTA 3EYYA 3ZQGA 3ZXSA 4ZTFA 1UHAA 2ZKZA 3ABKH 3HPHA 1PP7U 2VXKA 3KR5A 3QOPA 4EJWA 2QQEA 1IN7A 4LX9A 4RN7A 2GOXB 3PFYA 4IF4A 1FPQA 4ITVA 4KT5C 4WK8F 1YRNB 2CQKA 2B8TA 2ABZA 3F8KA 1NE9A 3JAMK 1UWYA 2L7KA 1BN5A 2NS7A 2KT0A 2OZ6A 2QSFX 3KYCB 3P9IA 3QODA 2CW0F 2PLYA 1M8BA 1Q7LA 3TT2A 1IAWA 2XRLA 1POGA 2VJJA 3W6VA 4E2AA 1EF4A 4C2UA 4XKWA 4UXIA 1IO2A 1IICA 3JTKA 3V7ZA 1N75A 5J3LA 2OQGA 5LRJA 2Z3MA 4ENKA 2FL4A 4HX8A 5KTAA 4PGHA 2WADA 1U9NA 2L8EA 4ZYGA 3VYTB 4UUSA 5DYMA 1IW4A 3RZDJ 2B5GB 3CPXA 4U0WA 1LNWA 4NUBA 5CJ9A 4N4OB 2RQQA 2Q4ZA 4BBSJ 3HOSA 3BJAA 4A38A 1V3FA 5C4XJ 2JEWA 1NSLA 2BEOA 3F23A 2X1EA 2M0CA 5H6QA 3FSXA 5HI7A 2OOTA 4U9ZA 4G9YA 5E79C 1K79A 3JW4A 4CCKA 1IXCA 4IQJA 4R1HA 3E5XA 4CSWA 4FX4A 4CYNA 4IHSA 4AU7A 2WA0A 3ZMDA 2QIRA 2JQ7A 3S2HJ 2DXQA 3DCFA 3KI9A 4MMOA 4Y52J 2OZHA 1VQNI 1PTRA 3D67A 4XNHC 1T33A 3LA7A 1XSXA 1QZEA 3FX6A 1YX3A 4Z6YA 3LAPA 1V1HA 3WTWC 5E3QA 3FVLA 5JQ4A 3BPXA 1ZTRA 3MFKA 2R7VA 3W3CA 1F2OA 5IYDJ 2NU4I 3K4LA 2X52A 2WV1A 4HDUA 3GO5A 3WTYC 1B72A 3KZZA 5ED4A 4QVTA 2KCXA 4A3BJ 1XMXA 3MKYB 3FIXA 3EXNA 4CA0A 3H9JA 1LANA 4P4IA 4II9A 2A68F 1H0ZA 3J81Z 1LDKB 1ZN2A 2JVHA 3ABUA 3BI0A 3CCVI 4MNUA 1RPWA 4B12A 2CRGA 5D8LB 1YE9A 2KCWA 3IFEA 3FDYA 4E7LA 4KS9A 4NCZA 3FHNA 1P4XA 2HZDA 2EIJH 3PSFA 4P10A 4CCMA 1IU8A 3C1DA 3LSJA 1YVKA 1GV5A 3HKZN 1FOYA 4CYDA 5A2QZ 4GDFA 3LOCA 1ULNA 2VZZA 1FP1D 2A6HF 3H8EA 3CO6C 1GHCA 3GOXA 3VEPA 3HGGA 1U5TB 3FXRA 5HOOA 1VQ8I 1WFXA 2PBIA 1EA3A 2DQLA 1HDUA 4LLGF 3KHZA 2R7OA 4MTDA 3I71A 2QQ8A 3ZN1A 3SGQI 2WTEA 1I6XA 1T0FA 4F91B 3IWGA 1NG6A 1T95A 3IWFA 4B11A 2WPXA 4ZX8A 1T98A 3HHHA 4H89A 4AG7A 2PR8A 2VKHA 3V8JA 1GDTA 3JRCA 2X3TA 3HOTA 2EZHA 2XAHA 5IYCJ 1BR4A 2LB7A 3VDUA 2VL1A 3PBBA 5FRMA 3NWSA 3U1KA 1CSOI 1KWMA 4BXFA 1Z9CA 5D4SA 2HXIA 2KDOA 5HODA 2B4DB 4X3RA 2X7BA 4CAXA 5H2FC 1YHQI 1KBEA 2Q0OA 3DEWA 3EUHC 2M5XA 3K4MA 2RDPA 4P1WA 1IRZA 3I1UA 3NRVA 1PP8F 2GXGA 4RAFA 3AFHA 4M85A 2HVQA 5BPIA 4ZDOA 1Z3YA 5CVJA 2XIGA 5BQTA 5C3EJ 2CU7A 3TX8A 4Z65A 2I5UA 4M3DA 4BY7J 4HDVA 2HC9A 1QHHD 4RS2A 2A5YB 5B3SH 3ZGKA 3ML6A 2JPBA 4IX7A 3OYBA 1SFKA 3D7GA 3RAMA 2DI3A 4BKXA 2L7FP 3GY9A 5EGOA 3ZJ0A 4UV9A 1WJAA 4JXRA 5CKTA 4NC7A 1BW5A 3S9NA 3HXLA 4LD5A 5J1UA 3K0LA 2OUMA 1SFEA 3K4JA 4Y13A 2PJ3A 3K70C 4YIFA 4ZTJA 1K7VA 2FNPA 2ESNA 2RVCA 2OB0A 3TL4X 4HNTA 2TDXA 4G7HF 5IT9K 2LDUA 1Y9WA 3HSRA 1ZG7A 3MKWB 1VI0A 5F48A 2PI0A 3I4NJ 4NXYA 3E3VA 1R4NB 4FQGA 3U21A 1B8IA 3A03A 1KUYA 2NS8A 3E6CC 4A0XA 2GANA 3LWUA 1BIAA 1TKHA 4X5KA 2C6CA 2AFWA 1JE8A 2QPOA 1OCCH 3J80K 4MHYA 3UKGA 2DK5A 4E70A 5EX3A 3DDDA 2IS1A 2AFUA 1U2WA 2K9NA 1OR7C 3LL7A 5JM6A 2PE3A 2DTRA 5JLWA 2QKMB 3GFLA 4UIAA 4MFZA 3CCMI 1RETA 3L2QA 2HDCA 1D8KA 3E5QA 5E3RA 3R5BA 4UUVA 5EX0A 3F8FA 3I0TA 3I54A 5DM7F 4I2OA 4XPDC 2FF4A 1JKOC 2HPMA 1CGPA 3EUHA 2VOOA 1VQ4I 4GYGA 1XA6A 1LAMA 1R6RA 1A2ZA 4A30A 3HRMA 3DPTA 1IRFA 1WTJA 2ZELA 3SJMA 2QBYB 2B4BA 1WI9A 2IS6A 2DT7B 2H1LA 2OJED 1YVOA 2BL1A 1PUEE 3V7RA 2DIPA 4RM2A 2CY2A 2H6CA 3O2PE 3L2CA 3ZQFA 1MMSA 1YSJA 4DBRA 3I9SA 1R36A 2L4MA 4S05A 5TJJA 1YLFA 2A6TA 4PJNA 2JUGA 4A3KJ 2JXDA 3LACA 3RO0A 1XTAA 2DK8A 1RR7A 3S93A 2IEKA 2DYSH 1KQ8A 3FMSA 3K7AJ 4CYCB 1IUYA 1PTQA 2BVMA 3GTLJ 4CICA 4R6TA 2F5EA 5CLSA 1YLEA 2RKHA 5EG0A 4ZI6A 1IN4A 1SQHA 2YUSA 5K7HA 2WC2A 3GW2A 1CP6A 4W97A 2F8HA 4U88A 2VKVA 1XF8A 4KUMA 4NGRA 4CRYB 1HDLA 3Q9SA 2CGPA 4KMFA 1BPMA 2LY9A 4NGPA 2E19A 4WXDA 5JI6A 1R79A 2E5NA 2LD5A 3U9GA 2RB7A 2XAJA 1JUSA 3CLOA 1ZQ3P 2NU1I 2VE9A 1GUUA 2Z16A 3IUOA 2LR8A 3BZKA 1NXUA 3E0KA 1APLC 4CAVA 2Q4YA 3CC4I 4D5CA 4A3LJ 4A24A 3I4PA 2Q04A 1J59A 2P6AC 4LJZF 4MRIA 5E20A 1S60A 1GHEA 1X1CA 3ZRGA 4A2UA 1Z6RA 2VUMJ 1ZARA 4F8ZA 3PRTA 3OSFA 1K83J 3G1LA 1N71A 2POKA 2QENA 4C2ZA 2Q1ZB 5AG5A 4G94A 2R7ZJ 4ESBA 1LE8B 2BE5F 5EBVA 2DAOA 2LH9A 3CUQA 4D7MA 4AIJA 3HG9A 1SVLA 4A31A 3VFZA 5BNGA 1J4JA 1Z77A 2X6WA 2XV4S 2O28A 4CCLA 4DIQA 2DA1A 4NF1A 1TLHB 3ZQIA 3RZOJ 3BTIA 1LRZA 4C2YA 5D5UB 2OZUA 2VLAA 4A93J 4WXCA 4OKOA 4DNCA 5IP6A 4E7HA 1BC8C 2K9HA 4GI3C 4RAYA 3IH2A 2P6FA 4XBFA 2HQRA 3QRFF 1LR9A 3FM3A 3CC7I 1EH8A 2QSGX 2F5FA 4RAZA 4NQWA 2E36A 1TC3C 2W1OA 3EQLF 3PNTA 1HKTA 3D7FA 3PB7X 5FO5A 3DWLE 3S17J 3VWBA 2A07F 1TWCJ 4BQNA 4HRIA 5LRGA 4CGMA 2ZMEB 2FRHA 2STTA 1Z9UA 5E8IA 2CF4A 2JN6A 3WABA 3F8BA 1HDPA 2QQ9A 3C2GA 1QSTA 2H5MA 4M72A 4U87A 2D45A 4CPAA 3I9V2 3FXUA 1Y39A 2XGXA 1FYKA 2PN6A 2FNFX 4MFQA 4C2MJ 4NBQA 1M8CA 2V8DA 2QMLA 2JRTA 4OC1A 3B2YA 4L8AA 2BXYA 2MG4A 2EQRA 2LUYA 1CP7A 3JTGA 3BPVA 4UCPA 2DW4A 1IUFA 2ZBKA 3S6HA 1Q2CA 2BW3A 4MO7A 4P9FA 2UVOA 4OWRB 2MD0A 1X1PA 1RO5A 2YNCA 3GTPJ 3GZ6A 1TKJA 1VTNC 2WAEA 1ORKA 2EFPA 1Y7EA 4QBJA 2VT3A 1A6IA 5HVFA 3BOQA 4KSFA 2CXAA 2XDVA 1YJNI 5C82A 2X6OA 4C68A 5DCMB 2OU2A 2K86A 5ICGA 4ETSA 3MVPA 4G6DA 3M7GA 4U7DA 4E7IA 2PRBA 3CXQA 3AG1H 1LOKA 1IOIA 2CQNA 3FISA 1BR2A 2O61A 1TQIA 2HVRA 2DPTA 4GFBA 5HNHA 1ZGJA 2Y31A 2C1CA 4HQMA 4U5YA 3FECA 2KRCA 3S8PA 2CJJA 5DDGA 1SGRI 4BGDA 3VYUB 2ELHA 1ZGWA 4A3DJ 4MHGA 2N71A 1PUAA 4IQ4A 4A12A 2ISZA 4IHVA 1EJ9A 2CTCA 4AVAA 4XLAA 4OC4A 3G6EI 2EINH 5DWNA 2DMQA 4E0AA 1IW7F 1R5GA 2JA7J 2RREA 1B72B 1BM9A 2KJBA 3OWTA 3DBRB 1J09A 2G9WA 4CCOA 3CXLA 4UUTA 3ZCOA 2VKDA 4C7HA 3H0GJ 2CFXA 5M3FJ 4L89A 3KQZA 2FS5A 1FYBA 2PJ5A 3R60A 2BY2A 3MRUA 2XRCA 1V1IA 2HXOA 4OIWA 1TBOA 4F9UA 4EATA 2DDAA 3E6BA 3D66A 1GXPA 2NU0I 2DOEA 4P96A 2G3AA 1WVRA 1JQGA 4WXHA 2GE3A 5HS8A 4DQ2A 4MCQA 2K9LA 2HOEA 4WF2A 4HX4A 4ENJA 4CZZA 3S6GA 3OYIA 1TW2A 4MFDA 2ESHA 3GLXA 2AS5F 4OC3A 3SHFA 2AFSA 1SFXA 5FD5A 3JRBA 3SJXA 2Z9OA 5L3CA 4O23A 4UCMA 1RR8C 4AVPA 2PG4A 1HBXG 1J75A 3VSKA 4I0BA 2FUG2 4U7BA 4AYBA 2O6GE 3IKVA 4HG2A 4AWXB 2JMWA 2E2JJ 2GREA 4IAVA 1Q9BA 1JUPA 1X2MA 2X1DA 2Q8KA 2W57A 4D7NA 3GYAA 2Y75A 2EFNA 1DS3I 4WJBA 4XKBA 1ZRFA 5CCMA 3C26A 3HOXJ 3ZMVA 1LQ1A 2H1KA 1SVMA 5CQEA 5LRKA 3V38A 4S0HB 1O7LA 3ZN0A 1AYEA 4M6HA 3ZQ7A 1HA8A 1OCZH 2DOAA 2N8GA 2TCTA 2G7HA 2KISA 4EJOA 3EYIA 2ODDA 1D1AA 1IY6A 2PJRB 4OMEA 4P5OA 1HDQA 3ELKA 1NSAA 5GPAA 4KVME 2XPWA 3PUBA 3BR5A 3JRHA 1YX0A 3D8PA 3ONQA 2HKOA 2NYQA 3NWTA 2XASA 2DFFA 5M5YJ 3JR9A 2ZCWA 4UXNA 3D2PA 5HVHA 4BHPA 5DS9A 1WGCA 3CCQI 3GMEA 4CXFA 3V7SA 1S72I 2NMTA 1FMVA 5JHFA 2GIZA 4RLFA 1YO5C 2LBFA 2A05A 1DDNA 2I8DA 3LSTA 3SGBI 2HR3A 4FD7A 3QQAA 2FJ1A 1MDMB 5FVJA 2EFWA 3I59A 1YJWI 3GFJA 1X2NA 3SEZA 4CCJA 3SEKC 4I0AA 3GYHX 4E4HA 3CPAA 1XIXA 4XRFA 3ISZA 3FHZA 1U5KA 1MBFA 1WJ5A 4GCVA 3TO9A 4LOCA 5AG4A 1OJLA 1FT9A 3HIFA 2XGCA 1FJLA 2Z3KA 4NGTA 4AM3A 3A01B 4BQQA 4AC0A 2L0KA 2Z3PA 1R4MB 3FEDA 2MA3A 4KFCA 2YNEA 2HWVA 4RM3A 3LFKA 4OP4A 4DW6A 3E97A 5H86A 5KVRA 2O53A 1LE8A 2Y30A 3CMEI 1MGTA 3K1PA 3F8MA 2PDOA 4K30A 1U9OA 1QHGA 1XMTA 2AE6A 5EJCA 1KU7A 4A6DA 3HOWJ 1RXTA 1HW1A 3I55I 2QQBA 1VF9A 2JJ7A 2X48A 4LGWA 3TGNA 3NH4A 2W84A 2IL4A 2XF7A 2CWEA 2WBMA 3OOUA 3LSIA 1MMDA 5K8NA 5F1JA 1ZLJA 5F08A 1REPC 2YR2A 4LLLA 1PJRA 5JR3A 1YFHA 1NK2P 1YGHA 2FXFA 4D0PA 2P6GA 3H9GA 1ARLA 1Z67A 3ABMH 5LLQA 1CGII 1P9ZA 4ORFA 3OYFA 1I6HJ 3CCYA 1TWAJ 3FK7A 2LKPA 2L02A 1XRYA 2DXIA 3FYNA 2EIMH 2BHZA 4B14A 2ZMEA 4O6JA 1A5JA 1N78A 2HOTA 1R1VA 2DFHA 4UV8A 4EJTA 1E3PA 3EDPA 1JJ6C 2KP6A 2DMUA 2PQ8A 2STWA 1SAXA 1JT6A 4JP0A 3VOEA 2PVWA 3BROA 2AQEA 1XDUA 3DV8A 2VBXA 5LGNA 4GS4A 4EM0B 4SGBI 1T56A 2WWYA 2DYRH 2VASA 4HF0A 1X1BA 4EJVA 4RBOA 9WGAA 3MEXA 4JOMA 3K70D 2ZSIB 5HVQC 2CFOA 3S3OA 3B3TA 3ISXA 3IV5A 4BINA 4NC6A 3E1SA 3ZPLA 2Q44A 1HC8A 3WE3A 1SGEI 4HNXB 2IPQX 4AIHA 1U8RA 1WWZA 1S7AA 2HS5A 2M87A 2WAQA 1HW2A 3GTQJ 2A4NA 3DLJA 1T0FC 2DA4A 5CBMA 2O03A 2DMNA 4EFDA 5EEHA 4L5JA 1YQAA 1TIQA 1TURA 3SDGA 2ODFA 3CUOA 2VT2A 3R6SA 4G7ZF 1ULYA 5G21A 3IH4A 3FMRA 3JVNA 5JH9A 1UHSA 4M74A 1E3OC 1DUXC 1LDJA 2EA2A 3H1CA 2IJLA 1AOYA 2ELJA 1I3AA 3P7NA 3RCOA 1JTXA 1VFCA 5M5XJ 1TGSI 4X0GA 1ONVA 1TW3A 3CZXA 5E3NA 3UGLA 3SI1A 2IBDA 3CQZJ 1K6YA 4B44A 5IP7J 4UB6C 2QQAA 2UV1A 5KAFC 1M4GA 2ZEHA 3CXPA 4F92B 3K4KA 4Y3OA 1X58A 4RGSA 3GIUA 2EWNA 2LK2A 1B6AA 4ZX9A 3BJ7A 2MD5A 4G6TB 2GKTI 5CPRB 2ZXVA 3PDNA 1ENHA 1S9HA 4MFKA 2QVOA 5DTDA 1XOVA 1OMUA 4XK4A 3RTRA 3ECOA 3L2WA 1X4SA 3PGPA 3DBHB 4YRHA 1QMUA 1NHAA 2OV7A 3T1BA 2BY3A 2HOSA 5FRNA 2B4DA 2GBYA 2XGEA 2QQCA 3GZNB 3I58A 2PJAA 2B9SA 4H6ZA 4BAYA 3CP8A 3L2VA 1FNNA 5ICFA 4KLWA 2NXNB 5DUKA 4OADA 1RI7A 3NE8A 4FE7A 5G1ZA 3TCVA 3GCMA 1YG2A 3S16J 2J8MA 5HDKA 3D5SC 2MGQA 1BL0A 3J7ZI 1XBUA 3QNVA 4Y49C 4CGOA 4HLXA 4ZDLA 4G7OF 1SD6A 3NE7A 4P55A 4HLYA 3ZQLA 3T5XA 1H0MA 1V54H 2KMRA 4H0EA 3NFZA 4RGRA 4E6KG 2CYYA 3NH8A 2MC4A 3BZ6A 4BU2A 3S3MA 2MH2A 2QKLB 4OOIA 3D7HA 4AB7A 1BIBA 2FEZA 3W91A 5DD8A 3CJTB 3TDUC 4G12A 1ACIA 1KBFA 1P7JA 3JSPA 2D5VA 5F46A 3F8NA 2W0TA 4EMEA 4N0BA 4CGLA 4FBEA 6CPAA 4RMNA 3QYEA 1VQ7I 4MCPA 2EJRA 2M8EA 3OIQA 4FE4A 4PFOA 3T9YA 1YW7A 4M6XA 3I56I 3BC8A 1P9GA 1ZG8A 3LMSA 3H3VK 2JEVA 4ONUA 3CCSI 3KIOA 4A39A 4CCNA 2OA4A 2FVGA 4MFEA 2VJ5A 3K4CA 2VODA 3E59A 5HQ8A 4PJJA 1ARMA 1Y1BA 2R7RA 4NC8A 1S5LC 2M0MA 1X3ZB 3GWZA 4ZY1A 2RNGA 4QB9A 2DODA 5DCMA 4B43A 3M1CA 4PK4A 2P5LC 4PV6A 5C88A 3IWZA 2M1BA 1R0RI 1YW6A 4O3MA 1DGRM 2ZXJA 1B8IB 3MZ8A 1UUCA 4MHZA 1FOXA 1ULKA 1JKRC 2PEXA 4XORA 1M4LA 1XBTA 2DMTA 1W5CC 2DEAA 1YREA 2FBIA 2O7OA 2F4MB 2F5VA 5D29A 3KP5A 2OCCH 1MZBA 3CJNA 4B8XA 4RLQA 4A0ZA 1H89C 1IRGA 4JYWA 4TNUA 3S1QJ 4OIDA 1WGXA 2DN0A 2K3PA 3GBGA 4JX6A 2R3SA 2PMHA 3U1DA 4I49A 1TNSA 1TBNA 4AG9A 5IY5H 4JJXA 1SGNI 3DTKA 3G3ZA 2QCOA 2F4IA 3G4SI 5JVGF 1XB4A 2XAGA 1LVAA 5A2QK 1ETOA 2Y69H 1SFUA 3J7AY 2Z3LA 4M6GA 4FWUA 4Q36A 3ESWB 3KLOA 2OVOA 5CVUA 1Y8QB 5HLTA 2Q0YA 4P4DA 4WWVA 3KEQA 1D0ZA 4DGWB 5K5QA 2VOPA 4IVNA 4C3HJ 5BS6A 1CE3A 1Y7RA 2Y9YA 4CGPA 5FB2A 3E5UA 4K3NA 2FXAA 2ZOFA 4H6UA 1SANA 1IRXA 3LMMA 2EFOA 4BL0B 2CWGA 5I0CA 3GUDA 1U3EM 4R87A 1G2HA 2VC0A 3ZZIA 1K7AA 2ZFUA 5EMIA 3WODF 1AMPA 3GUXA 3PIOF 1OVOA 2DMPA 2BV6A 4KZTA 1TWHJ 2N1AB 4OMZA 3CF2A 3HUVA 1VQ6I 3HSEA 1TIHA 2IGMA 2Q7SA 3GVAA 2DPUA 1P6RA 1Z05A 3EC4A 2F48A 4HNUA 1HPTA 4V2FA 1B6BA 3DKWA 2E60A 2ADUA 2L9RA 5FKKA 1W1WE 4A6EA 3SYTA 1A36A 3IEHA 2NU2I 2L2OA 2JZYA 2O8XA 2X51A 1VQOI 3B3VA 5FLMJ 2OQRA 2BYVE 5EZHA 1AKHB 2REFA 1RZ4A 1V5GA 4NNJA 3TW6A 2DLLA 2DPDA 4RS8A 4CAWA 4A3CJ 2P0WA 3RKQA 4LMYA 4OIRF 2PJ0A 4XR6A 3HL2A 3IRRA 1J5YA 3VODA 2ARPF 1WQ2A 5JVTA 2BCOA 3MD2A 1R22A 4BEHA 3KGQA 4UFWA 1TTYA 2VRWB 3E0JB 4EM2A 1Y1CA 1HEVA 2V77A 2OR4A 2HYGD 3BR1A 3WTTC 3PL8A 1M4DA 4KOVA 4YEJA 1YK3A 1CT4I 1TF8A 2QQ0A 3IC1A 2ELKA 2IT0A 3BJIA 5L3GA 1HW5A 2X9DA 4AVCA 3K4BA 2PMZA 4NQWB 2JZMA 4BDZA 3IWEA 3BZCA 1GV2A 4GYIA 5AIPA 5K1YA 1MJBA 1OYIA 5F0CA 2EZIA 5F04A 4Z2YA 3UGDA 1HDDC 2XC7A 2Z11A 1ZRCA 3OR2C 2UXNA 2DA7A 4UHTA 2YGWA 2IGNA 1CHOI 1B4AA 1QZYA 2CV2A 3LD2A 3B6CA 3FKIJ 4JX5A 1MIJA 4MFLA 1LUJB 3B3WA 3DPLC 1VNDA 2P4WA 4QTRA 4II2A 5J4YA 3CTAA 3JUWA 5LRSA 1J7KA 2GOMA 3FXMA 2QSHX 4KIGA 2M4GA 1J2XA 1Z7UA 2RIJA 5AG6A 4HPQA 2CNMA 1G6NA 1KYWA 4ZBGA 3F22A 2M7BA 3FNCA 1YQEA 3GFMA 4KOTA 1SMTA 3SZPA 3CUQC 3FX3A 2VEZA 2HTSA 3UEYA 1I21A 3GTOJ 3PNYA 3ISPA 1R5HA 5LHIA 4II3A 3CC2I 3D00A 3PJRA 1QZZA 4L9VA 3BTJA 4BJTA 4H2KA 2UZ3A 2KZVA 2PJ9A 3GTMJ 3N97A 1MMAA 2H8WA 2LREA 2WB1A 4IRHA 2PJ2A 4WWCA 2V9PA 4MQVA 3K4NA 2GA1A 1QA6A 2DA6A 2JT1A 1TXRA 3PB9X 2V1CC 4HEA2 5FKLA 4P4EA 1LFPA 1V5FA 2OC6A 4K2EA 3HOVJ 2XSDC 1XG1A 2JYYA 2JVGA 4XLCA 4NGMA 1TBXA 3FM5A 3L2UA 3D1NI 4PQAA 2Y48A 4UUSB 5JLXA 2ENNA 5A27A 2DPSA 3DR6A 1V55H 4OAZA 1Z8XA 3FF3A 1I27A 3S3NA 4MCRA 1WJDA 1UJ8A 3B02A 1VGYA 2O3FA 5LYDA 4Q4ZF 3RPUA 4P4BA 1HQCA 2ZNYA 2BGCA 3HRSA 4A0YA 2GM4A 4DYOA 2HGCA 4I01A 1YI2I 1R49A 1ETXA 5E3MA 4X2TA 2DJNA 5KTDA 1WHUA 1UHMA 3CMAI 3COAC 2G3TA 2E7WA 3LA2A 5B1BH 3KLNA 1ETYA 3JRDA 4UA3A 3VB2A 2ID3A 4B6ZA 2C27A 4RDUA 2X1CA 1P2FA 3QPTA 3VWEA 1FTZA 3WG9A 2BSWA 4IO9F 2XVCA 1LCPA 1P92A 5KCMA 2MLGA 2PJ4A 1YS6A 3O8HA 1IN5A 3CJRB 1CX8A 1ZR4A 2L7ZA 3OXGA 2R5YA 4CRZB 1X4OA 3ERMA 4Q7AA 4B6DA 2QF7A 1BI3A 1Z8WA 4RB3C 1FX7A 2I10A 1XN7A 4AUXA 1WKXA 2RN7A 4BUPA 3H4QA 3HJEA 2QLZA 3RU0A 2Z3NA 2MH9A 3TMOA 1W7PB 2P8TA 2GKVA 2R92J 4OIOF 3WR7A 4Q48A 4AVZA 3G8WA 1K61A 3F5BA 1B87A 2D1VA 2Q4VA 2XHKA 1S8NA 2DFEA 2KRFA 4ESFA 4C2XA 1LEBA 2DO7A 2SGFI 2K9MA 3FIWA 5E1XA 1LEAA 2ZB9A 4OVOA 2ZEFA 4PXEA 4C7IA 2ZO4A 2XB0X 3S2DJ 2E2IJ 4XNHB 2LG4A 1KZHA 2JA8J 5DV5A 2IA2A 4DJAA 1IC8A 1NMTA 2JLMA 3CT9A 3WGHA 2V1DA 5JGFA 2IAIA 2K85A 3CCLI 1KA8A 4ENMA 4UB8C 1O3QA 2FOKA 3G1MA 1RUNA 1Y0NA 2F6CA 4M3FA 2R0QC 2J9RA 4P45A 4M3GA 5FKOA 1VDDA 2EZLA 3VWDA 5G22A 2XKOA 3RPQA 4ZJZA 4XM3A 1GVDA 4KYWA 3JAMZ 1N13A 3EO4A 2LBFB 2AFMA 3M9AA 4CAEA 1Z8TA 2WAQN 2Q7BA 5F09A 1VQ9I 7WGAA 5AGEA 3DF8A 2Y9ZA 3K1NA 4LG0B 2LKSA 2WB1N 2ZXHA 2B0UC 2WPWA 4I02A 1FEXA 1X74A 3BJOA 3OOPA 1S3JA 4PZJA 4AIDA 2XEJA 5TGTA 1FY7A 3BWGA 2NS0A 2Y0MA 1MJAA 2VBZA 2VIXA 3D3SA 5IB0A 5ISVA 4LG3A 2PJBA 2LLKA 2QUFA 2VQCA 1NG7A 2RC4A 4RB0A 2LSOA 2NU3I 2IW5A 3OYHA 1FNOA 1XMBA 2ECCA 3IC7A 2R7XA 1I39A 1CF7A 1RUOA 3B4VC 4M3EA 3WU1B 3F21A 4F9VA 4X8IA 2UUZA 2ORVA 1OCTC 3GKRA 3OYCA 1QQ9A 2FX0A 1HSTA 1JTYA 3F3XA 3UNGC 3RKYA 2X0LA 5LRRA 2KIUA 1N25A 2JDDA 3ECHA 4G6QA 5BOXA 2V9VA 3K2AA 3HEFA 2GLJA 3CMMA 1O7FA 3TOBA 1QNTA 4D1QA 4JK1X 3ZR8X 2P6EA 1ZR2A 3FXJA 4FUUA 2BO9A 3FK6A 4C9YA 3FXTA 1B9MA 3M8JA 1HLVA 2VQLA 1USTA 3K69A 5TISC 4B5PB 1H9GA 1OMIA 2NRAC 3BG9A 1YTPA 2ZW7A 1DU6A 4HBLA 4HZFA 4FKDA 1LJ9A 2ATRA 5IYBJ 1L3LA 4XONA 3HOZJ 5K8MA 3JSOA 2D2WA 2PMZN 5I4MA 1XGSA 4BQAA 3U2RA 4RB2C 1MK4A 3E7LA 3HRTA 1ZREA 1R43A 1X12A 5F27A 5F47A 1AA7A 3T8RA 4BYYA 2HYJA 1MMNA 3PQJA 3D68A 2CW7A 4GRIA 5CCLA 2NVQJ 1LB2A 2VQYA 1TQMA 1IY5A 4IJAA 5LGUA 5CYVA 1FBUA 1YOVB 2MLKA 3R0JA 4PDKA 3KYLA 2GLOA 2DTZA 1BAVA 4KSAA 1WGTA 3H5NA 3OYEA 3E6DA 1DE4C 3F9KA 2GKRI 3HBLA 5L3DA 3QYBA 4UVAA 2K3FA 5M3MJ 2VBQA 3N5FA 1O3RA 5HLIA 1FIAA 3ULQB 1N77A 1VHOA 4F0YA 5AG7A 3LA3A 1T6SA 3WGIA 1ODDA 2NAZA 4F93B 2W82A 4NB5A 3RYRA 5KTCA 2QQDA 1TP4A 4A94A 1ZYRF 5H84A 1GXQA 1ZAOA 3R61A 2AJ6A 5K7ZA 1I1GA 3PSIA 3S14J 2EB7A 2R7DA 2UXXA 2VQHA 4KICA 1Q2DA 5LYIA 4LB5A 1R57A 4XPDB 3FWEA 3L2NA 1K78B 1XEBA 1IXSB 3QPSA 3DLAA 4EVIA 1SAUA 3LSPA 4EGYA 4MJ8A 1S29A 3EPZA 2CV0A 4MY3A 1S7KA 1PYVA 3PO3J 2P7VB 4ZZDA 2YNDA 4KOUA 2DF5A 3BR0A 1F43A 1BLLE 4MY0A 3CDLA 3JRUA 1IDYA 3IAS2 3QP6A 4E8OA 2HI3A 1UVGA 2EBIA 2CNSA 4MEXF 3IWWA 1L0OC 1UFMA 2HDDA 1E3HA 5JPHA 2XSJC 2QJ8A 2XKPA 1BW6A 3DXJF 1FIPA 4YGOA 3C3WA 1X1AA 2CUZA 3DGVA 3KX2A 4WCGA 1ZG1A 3BLYA 2KKOA 3OWCA 1UB9A 5FFZA 3RBUA 1PDNC 3QAHA 1R23A 2L5QA 1FLIA 4UXHA 3IKTA 2OBPA 1OKRA 5B66C 2HUZA 3ZMTA 1B9NA 4IUSA 1DP7P 3S6KA 1ETWA 3W2AA 1ON1A 2XGDA 3P5JA 4LITA 4XN0A 5LFAA 1TQPA 2W7NA 2X85A 1D5YA 2R7UA 4QC6A 4XLEA 2CQXA 2V7FA 3HPGA 4HAMA 2DDBA 3W2VA 1ZK8A 2PJ6A 1LAPA 2QYOA 2BY1A 1FWZA 2OPTA 4XSXF 3AKZA 2CO5A 1ZH5A 1IGNA 2JDCA 4NGSA 5K5OA 5EZGA 4ESJA 3SXOA 3CUQB 2BXZA 2AQFA 4UWJA 2OD5A 1R00A 2A6EF 4PSXA 3RKWA 2VI6A 1ZLKA 2NNYA 4GO1A 2J9AA 2ZEMA 3Q0VA 3W6SA 1ON0A 4OC2A 1ZELA 3BQZA 2SGPI 2JSPA 4RGUA 5GAGJ 2FT0A 3QB8A 2ZW4A 5IPAA 1RIOH 1S20A 1HKSA 4Y15A 4BQOA 1W7PA 5LEJA 2DB6A 2NVUB 3H9QA 1DU0A 2OD1A 4B13A 1FYMA 2DT6A 4JBAA 1HJAI 1PUFB 4JXQA 4UFVA 4HV6A 1SD5A 4BBHA 1VKCA 2DA5A
chains in the Genus database with same CATH topology
1YW8A 4KN7X 1I1DA 4M9XA 5E18F 2BUEA 2NYXA 5JHUA 1IIDA 1QQIA 4UBRA 4KORA 3CDHA 1XCBA 3GZ5A 5J6XA 4U0YA 3HTSB 2EV5A 3UY5A 5G20A 1IYKA 1DPRA 4PCQA 2P5KA 5BPDA 4M73A 1WSUA 2KIMA 1QPMA 1M1DA 4YFKF 4KA4A 3FXQA 4LB6B 3WTZA 1M4IA 1H9TA 1U6GA 3REOA 5H6RA 5E1WA 3T8TA 1XMAA 1FBQA 3LODA 4BHBA 1QGPA 3EY5A 2RGVA 3GXOA 2ZJ2A 3TO6A 5CVVA 4IHTA 3O3KA 3SQNA 3NEUA 5L3FA 4KUBA 4AVBA 4A95A 4EVYA 2HQYA 2VZYA 1OR7A 1KU3A 4HV5A 1XGMA 1R1TA 4JQFA 5J8CA 5HLHA 1CJWA 4N9IA 3PP9A 1YYVA 2M30A 3MWMA 1OPCA 1KU9A 4EV0A 1S3ZA 2DT5A 1R7JA 4ASNA 1W5TA 5KK1A 2UWMA 4MI4A 4B5OA 1D8JA 3I5UA 1KQ0A 2V6CA 4UCNA 4KOXA 3K1MA 3AAFA 2GA2A 2EA4A 4F6AA 3WTVC 4Y17A 3J81K 2R7FA 4OIQF 2L01A 1BI1A 1BBYA 3KZYA 4HX7A 1UFHA 3IL2A 4EJUA 1U78A 5FLXZ 2XUBA 1P4AA 4L18B 1L0CA 2L54A 3R9GA 4KN4X 1XD7A 3E6MA 3PZJA 3W6JB 3KETA 5FFXA 4U9YA 4KIBA 4OINF 4B09A 1EH7A 1ZG5A 1Q2YA 3R95A 3J7AO 4CYOA 4HOBA 3TKYA 1E2XA 4IF5A 5LHHA 1D5VA 2L3DA 3HYIA 2EFQA 2F5DA 1HSJA 1F4KA 2IP2A 2FE3A 2B3UA 4CAFA 4HW0A 2DFIA 4CYQA 3K9TA 3MQ0A 5D5VB 1FYLA 2E7XA 4A5NA 3WE2A 1JHHA 1BOAA 2ZPAA 2HKXA 2Z10A 3I53A 2HZTA 5FGMA 1O3TA 1P4NA 2FBHA 2OH1A 2HYFA 2VI7A 2ZFWA 4ZGYB 3SFZA 1UCRA 4ZYEA 3KKWA 1FC3A 4A33A 1P4WA 3FMQA 4UNOA 2Z3YA 4XSZF 2FCKA 2PR1A 4KOSA 4PSWA 4UVCA 5D4RA 2RNJA 4HF1A 3NQOA 2XROA 1KUVA 3D2MA 4LLNA 2YX7A 2VC1A 1K78A 3CXSA 4IPAA 5F6FA 3IGRA 2GQQA 2ZW5A 3RJPA 1K4JA 2XRNA 4FD4A 1ZGAA 4IXAA 2G7UA 4RB1A 3HRUA 1IB1E 4HQEA <