1MJBA

Crystal structure of yeast esa1 histone acetyltransferase e338q mutant complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esa1 protein
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjbA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjbA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjbA02
4R8HA 1BI0A 3KZZA 2FMYA 3H3UA 4AVCA 5K5QA 1ZG3A 3I54A 2ESNA 4XNHC 2L4MA 2QZ8A 3REOA 3V7CA 4G7HF 4EM0B 4S05A 4ESJA 3BJ7A 2D4OA 3ZMTA 1U78A 3EUHA 1YS6A 1ZAOA 2V6CA 1R22A 4LB6B 3V8LA 2JZYA 2PQ8A 2PC1A 3JSPA 3OV8A 4KMUX 5F6FA 4IRGA 3TO7A 3KP5A 5F46A 4M73A 2HR3A 2HTSA 2M45A 4KIGA 2OBPA 3DXJF 3GEZA 4A12A 4NEXA 1XGMA 3WG9A 3DPTA 2ZKZA 1GXQA 1WI9A 4U0WA 2IA1A 1OKRA 1KU3A 4ZYHA 1FBSA 3SQNA 1STZA 4HDVA 1J5YA 2DO7A 4A0YA 2FE3A 2IW5A 4HLYA 2BYVE 1ZREA 2M30A 2H6BA 1BC8C 4L9VA 1HSJA 2R8VA 1S7KA 4RB2C 3FF5A 1O3TA 3ZQ7A 1TBXA 2EJRA 3TDUC 4U5YA 2FBIA 1ON0A 4AVPA 2O8XA 4ETSA 3K1PA 4HV5A 2UXXA 3LSTA 3GWZA 4ENMA 2RN7A 3GXOA 1R58A 4O6JA 2NS0A 1SFUA 3WTYC 1T39A 1VKCA 4L0ZB 4F7ZA 3ZJ0A 1OPCA 1DPUA 4HOBA 3K9UA 2FQ3A 4A5MA 1QO0D 2VE8A 4QWQA 2DK5A 3F21A 4B5PB 3U2RA 5HS8A 4H6UA 5IB0A 5L3DA 1L0OC 4UVAA 5F47A 2EV6A 5DDGA 4XPLA 2EVNA 2ZFWA 1S7OA 5IT9Z 5EBVA 2PDOA 5JFRA 4IRHA 5E1ZB 4BQAA 3Q9VA 3RYPA 3GVAA 4EM1A 2ZJ2A 3IHUA 4CAWA 4IVNA 2GE3A 3WTZA 5F64A 4JLYA 3K0LA 4UUVA 3QPHA 1H0MA 3WTVC 1YLFA 2VN2A 2V79A 4RB0A 4P9UA 1ZRFA 4X5KA 2DAOA 1DPRA 3VODA 4M6XA 2P4WA 3TT2A 2QMLA 4YFJA 4YFKF 2VQYA 1B6AA 3ERED 5DD8A 4UVBA 1LDJA 3W6JB 1REPC 2KCWA 2JTVA 2ISZA 1B87A 3CUQB 5JVTA 2ADUA 4PGGA 1T38A 4JD6A 4OLLA 3LQRA 4CZZA 2JRTA 1FLIA 4UV9A 4KDPA 1BI3A 1L3LA 2ZW7A 4R3LA 5HLIA 4U9ZA 3RJPA 4KIBA 1DP7P 5IV0A 2LNBA 1I1DA 2PR8A 3H4QA 2R3SA 3FMSA 1U6MA 2R1IA 2LF8A 4J3GA 1W5TA 1BO4A 2NNNA 1ZARA 3U1DA 2G7UA 3TQNA 1HW1A 2FL4A 3B8GA 5LGTA 2IRFG 4NB5A 1Z6TA 4XPDB 4QB9A 1EV7A 1JGSA 5HS7A 3EDPA 4M9SA 1LVAA 3E6CC 1YVOA 3WGIA 2HOEA 3G8WA 1B6BA 2V1UA 1UHMA 4WWCA 4WK8F 3R1KA 3T0YA 4NCZA 4RI1A 2UWMA 4U0YA 3TFYA 2H27A 5K1YA 4NSQA 3CO7C 1YTYA 4MY3A 3JVNA 4LB5A 2LDUA 4L9JA 1U5TA 3T1BA 3K1NA 4YIIA 3C3WA 1VHSA 2EWNA 2FIWA 5CVJA 2XGXA 5DUIA 4AG9A 3VWEA 1OYYA 1ZG5A 1S3ZA 3BJ6A 2OQRA 3HRSA 3U9GA 4B09A 1B9MA 1ZLKA 4HF2A 3E3VA 1HXDA 3I0TA 1YO5C 1S7LA 3R4KA 3WTSC 2VODA 3WGGA 2HWVA 2GAUA 3VFZA 3FX3A 3TKYA 4A0XA 2M1BA 3L2CA 4N9HA 4R3KA 2M8EA 1NE9A 4FD5A 4CAVA 2D1HA 2FNAA 1T0FA 3HSFA 5K5OA 1ZG1A 2XKOA 3HRTA 2EB7A 3GLXA 3R9FA 2P7CB 3RIRA 5HH1A 2GWRA 3CJNA 1DUXC 5CVIA 5CVRA 1BI1A 1FYMA 2STTA 3EC4A 4KNYA 4MHGA 4KN7X 2Z9OA 2F5FA 3TDZC 3G3ZA 1TNSA 2EFPA 5JPHA 4II9A 1HW5A 2Z11A 2HZTA 1R1UA 3K9TA 2REEA 3FYNA 1LQ1A 1YK3A 1P4NA 3WU1B 1YS7A 1RI7A 4F0YA 5ICGA 1QSRA 2BE5F 1V0CA 2DFIA 2AXLA 1Q1HA 3RDIA 2XASA 2FSRA 3ULQB 2RGVA 3KP7A 1L0CA 4AVBA 2EFQA 2R7FA 4ZBGA 1OR7A 2A69F 1DDNA 4KUBA 1I27A 3AAFA 4GO1A 1HSTA 3M9AA 2VXKA 4L8AA 4XBFA 2YX7A 1R00A 4UWIA 1Z9UA 4I49A 1I6XA 2EFOA 3TTHA 4LD5A 5HS9A 1S6LA 4AIHA 1M4GA 3HHGA 3FWEA 1Z4RA 3TE4A 1X3UA 2JPBA 1IXCA 1XMAA 2R98A 2FIAA 2I79A 2ARHA 3V7SA 2Q0YA 2QQ9A 1KUXA 1R5GA 1ZYRF 5JQ4A 4ENKA 3EQLF 1FX7A 4P5OA 4U9YA 2EA4A 4IF5A 2W84A 1LNWA 2B0LA 2REFA 2VT2A 2M87A 3IWFA 3E5UA 1XB4A 1UFMA 1U2WA 3R96A 2QM3A 1KQ0A 5LRSA 3GO5A 4ZZLA 3GFIA 3LWFA 1M44A 2F5EA 2VZYA 1YIOA 5D8LB 4D0PA 3V8JA 3ZN1A 4I02A 2Y48A 1J59A 3FZVA 4PDKA 4LFUA 2V9VA 3IC7A 1QGPA 3DEUA 2FF4A 4P55A 1JHHA 3ZMSA 2QBYA 1QPMA 5DV5A 3EYYA 2A07F 2VT3A 4F6AA 3MGDA 2DTRA 3IRQA 5JI6A 2Q4YA 1P4AA 3KETA 1K6OA 3FMQA 2F5CA 2O28A 2ZNYA 2VONA 1H9TA 4M85A 4DQ2A 2EV5A 2O0YA 4LK1F 3DNSA 5JHUA 1K4JA 4MQVA 4A0ZA 1I5ZA 4IHTA 3ABUA 3ABTA 1Z9CA 2QUFA 1S60A 4EJUA 4NF1A 4KLWA 4E70A 6PAXA 3J81Z 3IL2A 3HSEA 1O57A 2UZKA 1P0HA 1F1ZA 2BUEA 3VEPA 4YRHA 4M9ZA 1O7FA 2DPDA 4PSWA 3FMRA 1FPQA 2O03A 1KU9A 3R9GA 3EO4A 4EVIA 2EK5A 3WODF 4Y13A 1I1SA 4M6YA 1F9NA 5FB2A 3F0AA 2P6TA 4FT8A 4LUAA 3JAMK 4YFNF 5ILVA 3SXOA 2K4JA 2P5VA 1G6NA 2FMLA 5J6XA 5KVRA 1ZHFA 4KVME 5TJJA 1BN5A 5CVUA 2O3FA 3V7RA 2VZZA 4P9FA 2Z33A 4RAZA 4GYGA 4CRYB 1Y7RA 4RGRA 1CF7A 5A2QK 1KZFA 3F72A 2DQLA 2A3SA 5FD6A 5BQTA 3E6BA 3GZ5A 1XCBA 4AD9A 2WV0A 1MDMA 1I21A 4M74A 1U5TC 3KCCA 1YW7A 3JW4A 1PDNC 4EJTA 1W7PA 1FP1D 3W6SA 2GA1A 3ZP5A 1S29A 2JT1A 4EMSA 5FLXZ 1XF8A 3R0JA 3G3SA 2FU4A 1W5SA 3CXSA 1LEAA 4KOXA 4ENNA 2Z5UA 1U5TB 4XSXF 1XCVA 4EGZA 1OYWA 5HLGA 1GXPA 3DV8A 3KP4A 1R36A 1KQ8A 4R87A 1LDKB 4HV6A 2WC2A 2JEVA 4ZYEA 5L3CA 4LX9A 1TW2A 3RYRA 2OZ6A 2ZMEB 4KVXA 2QQBA 4U7DA 3PFIA 1SMTA 1XSXA 4Y17A 1TQMA 1T6SA 3GFJA 3P2HA 1FP2A 4OU0A 4PSXA 4AIJA 1R1TA 1FYLA 2KJCA 1B1BA 1SMYF 3T8RA 4HX7A 3CXPA 4UV8A 5CLSA 4KOSA 2C27A 3QOPA 1S3JA 5D5XB 3KLOA 4OADA 2X7BA 2CYYA 2CWEA 2HQRA 5J8CA 3MZYA 3IKVA 2F5DA 1TQPA 3BROA 3P9IA 5D5UB 3KE2A 4WXDA 5DD4A 2Q04A 3K69A 5E8GA 2ZW5A 1P2FA 2XIGA 3CTAA 3O6BB 3F22A 3UY5A 3GF2A 2ZBKA 3J7AO 1J9IA 2B3VA 3FRMA 1G3SA 3MZHA 5IX3A 4DNCA 2G0BA 1XGOA 1D8JA 3COAC 3BDDA 2GA2A 3NEUA 4GYIA 2XROA 4I0AA 1IN4A 4PZJA 2W85A 1KU7A 1IXRC 4KUAA 4AG7A 2Y75A 4IF4A 2Q8KA 4CRZB 2Q7BA 4HYEA 3NQOA 1S8NA 1Y9KA 4OOIA 2ACJA 3QAHA 3JUWA 2Z0ZA 2JLMA 2GZWA 4KORA 3FXRA 4HQEA 5H86A 5HDNA 4YG2F 1BOAA 5H6QA 2STWA 3Q9SA 3J80K 2P6EA 1D5VA 4H0EA 3GW2A 4RB3C 1G3TA 2QQAA 1W4MA 2FS5A 4QLCU 3S6GA 1UCRA 4N9IA 3W6XA 3QB8A 2L3DA 3LAJA 4YFXF 2VEZA 1SD7A 3EETA 3E5QA 3CO6C 1R57A 4HNXB 3DKWA 1GVJA 1F5TA 4FX0A 4BMHA 3CUQC 4I01A 3RKYA 4CYDA 4BXUA 5DUKA 2A68F 1YLEA 2IPQX 1P6RA 4HF1A 2COMA 3QU3A 1FYKA 3TCVA 3RKXA 3KZYA 1MJAA 1HQCA 1KUVA 5FFZA 3PP9A 2QWWA 3F8BA 1XSVA 5HVQC 3I5UA 2MBFA 2ZXVA 4GGGA 5AONA 1XIXA 4G8XA 4L0YB 2QBYB 4L9NA 1XEBA 4FD6A 4FD7A 1E2XA 4G7ZF 4XPDC 1ON1A 2FNPA 2O61A 2B4DA 2H09A 1ZRCA 3QP6A 2ETHA 2XAQA 1QBJA 3GFMA 1RUNA 3FIXA 4Z2YA 1IN6A 2WPXA 3BP8A 4BHBA 3L00A 1ULYA 5LGUA 5F48A 4AIKA 1IRGA 2VBWA 3SZPA 4HA8A 2CG4A 3SHFA 1PU9A 3DR6A 1KYWA 5FD5A 2EFWA 1RXTA 5E17F 3D2MA 3WTUC 4MHDA 1ZRDA 2L54A 4RGUA 2H5MA 4OIQF 4A6DA 1LB2A 2FCKA 3M7GA 4PK3A 1YFHA 3HTUA 4KYWA 4Q48A 3WE3A 3QRFF 3MAJA 5LRRA 4EM2A 2HFHA 1SD4A 2QLZA 4KIFA 4ESFA 1HW2A 2PMUA 1WSUA 1QNTA 5D4RA 1OZPA 1OYIA 3WE2A 5F1RA 5D5VB 2NRAC 3HSRA 4Q5SF 3H3ZA 1KYZA 2Z10A 3IWZA 3LAPA 2FSWA 1HKSA 1MJBA 4ESBA 2KIFA 2A5YB 1YX0A 2A4NA 3F6VA 3IRRA 1IIDA 1IYKA 3N97A 1Z91A 2I00A 3F8FA 4L5JA 3ELKA 1XGSA 4BNCA 1WQ2A 2ZNZA 1BOBA 4JQFA 2FRHA 3I58A 4ONUA 3WTXC 1CF7B 3SFZA 1ZH5A 1IN8A 2E7WA 3E6DA 3ML6A 1P92A 3BJ8A 2HUZA 4LMYA 2ZO4A 2P0WA 2G3TA 1MDMB 3F6OA 4KMFA 4KVOE 4KZTA 4E8OA 1R1VA 4A5NA 4ZH4F 1T2KA 1W7PB 2DI3A 3HUGA 1NMTA 2XAHA 2RV8A 2MA3A 2BEOA 3FM5A 3BJOA 3GZ6A 2R7HA 2HYFA 2OB0A 3RPUA 5H20A 2JSCA 2ZW4A 2BL1A 2BEIA 3S6KA 2NYXA 2KIMA 2B5GA 4CDGA 2D4PA 4MTDA 1VTNC 5CJ9A 3DQVC 2OH1A 5GCNA 1Z05A 3E6MA 2P6SA 5D8KB 1SAXA 4L9TA 4XLNF 2Z3YA 4LK0F 5ICCA 2NMTA 3JTHA 5E20A 1Z1DA 3TO6A 1YW9A 4HQMA 4FD4A 4S04A 2MC3A 4L89A 4LLGF 1SD5A 4MBUA 2L01A 1MZBA 3I59A 1O7LA 2BV6A 2P8TA 2VBXA 3LODA 2M5WA 2YPRA 3DSBA 1RIOH 2HDCA 2F5IA 4HZFA 1J2XA 1HKQA 1MKMA 5HOOA 1K78A 3V8KA 1NSLA 2NNYA 4EQQA 4QUSA 4NQWA 4HBLA 1MGTA 5KTAA 2E1NA 2D45A 5L3GA 4M72A 4HX4A 1TIQA 2Z99A 1QSOA 1V4RA 3KEOA 3ZMDA 2JDCA 3M8FA 3O3KA 3BJAA 4MNUA 1YQAA 3SZTA 4IXAA 2DW4A 2KKOA 2ZW6A 5C82A 2Q44A 2QECA 1YG2A 2OAZA 1J75A 4MTEA 1J4JA 5DCMA 1CGPA 2XVCA 2GXGA 3MQ0A 2EUIA 3MCZA 1USTA 2HEOA 1I1GA 2AS5F 3CUOA 3JTGA 1KUYA 3MEXA 1LDDA 5J8FA 2ZXJA 4I7HA 2DLLA 3EY5A 1P4XA 3HHHA 2QYOA 1FSHA 4IHSA 1Q2YA 1GHEA 4I2OA 4KOUA 3DF8A 4AB7A 4U88A 4OAEA 4WX9A 4JJXA 4JBAA 2IA2A 4KOVA 1SFEA 2KIUA 2MLGA 1ZGAA 3BPXA 4G94A 3N7ZA 2HYGD 2LKPA 1TW3A 1M4IA 3V8IA 3S6HA 2RNJA 4CHUA 2MH9A 1WRJA 2V1DA 2W57A 1Y9WA 2BGCA 1G3WA 5FO5A 3FNCA 3LA7A 3LQQA 1XE4A 1K7AA 4WF2A 4JWPA 3GKRA 5ERIA 1PUEE 1XN7A 3I9SA 1FC3A 5LHIA 1PP8F 3DPLC 2IT0A 3DDDA 3B73A 4G6QA 1SQHA 1IICA 4EVYA 1JXSA 3VWDA 4JXQA 3WR7A 3SXNA 2D1VA 2QENA 2VC1A 4LJZF 1C0WA 4WXHA 4QBJA 4EGYA 1YW8A 3I71A 2P6GA 2LSOA 1U8RA 4HF0A 2DU9A 1LEBA 2X0LA 1EH8A 1WK4A 4O3MA 2K86A 2CY2A 3IKTA 1O3QA 2A61A 4AWXB 1P4WA 5H84A 1S7AA 5HLHA 3ROUA 1ODDA 3M8EA 5CVVA 2HV2A 2B4DB 2VBZA 3B02A 1D3YA 2DK8A 4GCVA 2CNMA 4UXNA 3GYHX 5L3FA 1FNNA 3T8TA 2GXBA 4XRFA 4YGOA 2HGCA 4RS2A 5AIPA 5HDGA 4EV0A 5A2QZ 1XDUA 5L3EA 1F4KA 4KOTA 4KOWA 2VOOA 2F2EA 3T9YA 3T5XA 1GHCA 3P7NA 4OMYA 2Q2EA 1IUYA 3PZJA 1IF1A 4GS4A 1A04A 3HOSA 4KN4X 4L18B 5L3BA 2BSWA 4JXRA 3ECHA 2PEXA 4FX4A 3KKWA 5C88A 3K2ZA 3MWMA 3F3XA 5CNPA 2HQYA 3L9FA 2ESHA 4UHTA 2W24A 3C26A 4IRIA 4CGZA 3TOAA 1B9NA 3KP6A 1RUOA 2CO5A 2PI0A 2AJ6A 1O3RA 1FBUA 2PR1A 4B5OA 3W91A 4PGHA 5FLXK 3ZMZA 1G4DA 1MK4A 4NXYA 5ILUA 4OIPF 2CNSA 3KP2A 1JE8A 2MLKA 1XD7A 2E7XA 3I3GA 5FGMA 1BI2A 1XMKA 1D8KA 1ONVA 5LHGA 4XNHB 2K7LA 2UXNA 2EA2A 3BPVA 3VB2A 1XSDA 3BY6A 2MH2A 1TTYA 3IWGA 2P5KA 3SXYA 4RGSA 5DYMA 4KT5C 5D5WB 1FSEA 3ZN0A 3LA3A 4UWJA 5D6FA 5BS6A 2GIVA 4E2AA 3PGPA 4AVAA 2K4BA 1TQIA 1YGHA 1BIBA 2MD5A 2IP2A 4BAYA 4KLVA 1BBYA 2B5GB 4ZYGA 3F8CA 5JR3A 3NRVA 5EC4A 3ECOA 3WTWC 3MFKA 1USSA 2ELHA 1Z4EA 4LGWA 3RPQA 3EFAA 2P6FA 2D2WA 4M71A 2RKHA 2XRNA 4BYYA 4Q4ZF 1AOYA 2IA0A 4L5IA 3J80Z 3I59B 2DPUA 3BLNA 5KTCA 2H94A 5TRDA 1Q2DA 2PMHA 1FT9A 2FXAA 1IAWA 2KJBA 4G6DA 2DBBA 2H6CA 1WWXA 3P9CA 2PSWA 2P5LC 3Q5FA 1JHFA 3R6SA 4EJWA 1K78B 1M4DA 2C6YA 4A6EA 1YYVA 4MJ8A 3I53A 2PG4A 4N0BA 1YR0A 5BPIA 2OZHA 2A6EF 3PQKA 2PLYA 1O3SA 5HMNA 2J5OA 5IT9K 3R95A 4Y15A 3BZ6A 4RGXA 4WCGA 1E17A 4G7OF 2YR2A 3S6FA 4E0AA 2XKPA 1QSNA 3F8KA 5F49A 2HQNA 3FHZA 4UVCA 2G9WA 1CJWA 5I0CA 4ENJA 1G3YA 3EYIA 1YREA 1R7JA 1PP7U 3TOBA 5DCMB 2IJLA 3HYIA 5H6RA 5HDKA 5EEGA 2L4AA 1IN7A 2OA4A 1U6GA 2B4BA 5BPDA 1BM9A 1RNLA 5E18F 4IUSA 4BHCA 4FHTA 1J7KA 2FEZA 4CXFA 2O6GE 4MEYF 3VOEA 5BOXA 2G3AA 3RKWA 2HKOA 3HRUA 3C7JA 3K1MA 4P96A 2WPWA 1HBXG 1TNTA 2NAZA 3KFWX 4IJAA 3TGNA 4LG0A 3N4MA 4HKFA 1V3FA 2E1CA 2PFBA 4RAYA 3S2WA 2FBKA 5ED4A 3W6KB 3P2FA 4TV7A 3ISPA 3E5XA 3TO9A 2QIRA 1XGNA 2FE7A 1OMIA 2VE9A 1LRZA 3NE7A 4Q47A 2GANA 4PCQA 2GQQA 4M9XA 4RB1A 2W25A 2DT5A 1QSMA 1FBQA 4KA4A 5ICFA 2XUBA 5ICEA 1Y0UA 1XDSA 4MGRA 1S7NA 4QVTA 3ZZIA 1R23A 1Z6RA 2CW0F 2ISYA 4JK1X 3ZPLA 2X4HA 1KU2A 1I12A 3E0KA 3KP3A 5CYVA 3FXQA 4OMZA 3KEQA 1FWZA 1B59A 2VBYA 1EH7A 5LHHA 1KGSA 1IW7F 4R57A 3WTTC 3D0SA 2FBHA 1H9GA 5DWMA 3T90A 2RC4A 3F8NA 2CQKA 4YIFA 2CGPA 3RTRA 2PN6A 2ZMEA 2OD5A 1QQIA 3H92A 1Q2CA 4KICA 2J8NA 3OOPA 3HRMA 4HDUA 5E8IA 2DXQA 1SFXA 3FXUA 4LLNA 2YX4A 1IYLA 2A6HF 4OINF 5IT3A 3C1DA 3V4GA 5D6EA 1PUAA 4BHPA 4ORFA 5E96A 1FOKA 4WXCA 4I0BA 5LGNA 5KK1A 3IGRA 4K2EA 1AWCA 1SD6A 2IVMA 1IXSB 1Z7UA 4BH9A 5LLQA 5LBQA 1HKTA 1IB1E 2J8MA 2V1XA 2B3UA 2J8RA 2OZUA 4ZZDA 2VI7A 2LF7A 4HW0A 4LLLA 4KFCA 2RVCA 5K5RA 2B58A 3WGHA 4CICA 4HX8A 2CNTA 4B8XA 3R61A 2FOKA 4XPKA 3OWCA 2K27A 2QVOA 1FZPB 4OIOF 4A2UA 1EH6A 1T98A 4CS0B 3I64A 3GFLA 2WWYA 4RS8A 1U3EM 2XAGA 3GY9A 1B4AA 2KRFA 4CO8A 2K02A 4R79A 1J0RA 3FB3A 4B5PA 1KQ9A 5ISVA 1ZLJA 1IRFA 2JDDA 1UB9A 3F23A 4UBRA 1BC7C 1MJ9A 1QZZA 4HAMA 3ZMUA 4Y49C 2ZPAA 2JPCA 4ASNA 1S7FA 4R1HA 5LEKA 1ZGJA 3FXTA 4KUMA 2XHKA 3GYAA 4IPAA 2PBIA 4QC6A 1R5HA 2ZCWA 1XMTA 1N71A 4EJOA 2FA5A 3QU6A 3F5BA 3DFGA 3QPTA 3RI4A 4Y49B 3QP5A 4HLXA 1FY7A 4I98B 1UFHA 4M3SA 2CSOA 2CFXA 3ZMVA 4EJVA 2XAFA 5D4SA 4U7BA 4I09A 1NHAA 2RQPA 3HTSB 2PRBA 5DEQA 1K79A 2VXZA 1CM0A 2XV4S 2PJPA 3D5LA 3D8PA 3CXQA 4OIRF 2YSRA 4UNOA 1WKMA 5AIQA 2XAJA 3E97A 2EV0A 1QSTA 2R7DA 3CUQA 3LFKA 5FFXA 3F8MA 3G73A 2P7VB 4PV6A 2Y0MA 1IN5A 1ZN2A 1YVKA 2OZGA 2OQGA 1WWZA 3D2PA 2FT0A 1BJAA 3HOTA 5E1XA 4H6ZA 2FXFA 2Q4VA 4HNWB 2YU3A 4XLPF 2HS5A 2VOPA 2BBYA 3DR8A 4HNYB 4MQ9F 3LA2A 2ATRA 4NHJA 3I4PA 2OU2A 3P9KA 1RZ4A 4XSZF 5BMZA 3BOQA 4ON0A 2G7HA 1W7PD 3R60A 5LEJA 3PQJA 4PK2A 3FM3A 3GX4X 3SHPA 4MY0A 2HTJA 3WU0A 5FVJA 1BIAA 1KA8A 3M1EA 1UHWA 3JAMZ 2EFNA 4R9MA 3J81K 5KTDA 1LJ9A 1M1DA 3EXNA 3RYOA 3BWGA 1MD0A 1TLHB 3JSOA 2HKXA 3CLOA 4GXOA 1S5KA 2VBQA 1IZ1A 1ON2A 5DCFA 4MEXF 2K5TA 4H89A 2J5PA 4ZYDA 2IL4A 3FBUA 4LG0B 3HIFA 4UA3A 3L09A 3C18A 4MI4A 2L02A 3CDHA 4U0VA 4CAXA 3D3SA 3KLNA 3R0AA 5ILSA 2VC0A 3O2PE 2TDXA 2AE6A 3L7WA 2WTEA 2Q0OA 4G9YA 1QZYA 2DQRA 4O5VA 4KOYA 2RDPA 3DP7A 5EEHA 3R9EA 3GUDA 5DWNA 5E1WA 4K30A 1RO5A 3LD2A
chains in the Genus database with same CATH superfamily
4IO9F 2W00A 4R8HA 1BI0A 3KZZA 4I76A 2FMYA 3H3UA 4AVCA 4QPOA 5K5QA 1ZG3A 3I54A 1TWCJ 4B44A 4X8IA 4B12A 2ESNA 3CMAI 1CBXA 2L4MA 2QZ8A 3REOA 3V7CA 4G7HF 2KMQA 4XNHC 4EM0B 4S05A 4RLQA 4ESJA 2M3AA 4FKDA 3BJ7A 2D4OA 5K8PA 3ZMTA 1U78A 1QHGA 3EUHA 2C1CA 4MFQA 1YS6A 2EQRA 1ZAOA 2A20A 1F2PA 2CRGA 2V6CA 4DJAA 1R22A 4LB6B 3KHZA 1BMOA 3V8LA 1N77A 2JZYA 2XEGA 3L2RA 2PQ8A 2PC1A 3CD6I 2ID3A 3EPZA 3LMSA 3OYAA 3JSPA 3LSHA 4C2XA 3OV8A 4KMUX 2E60A 3UEYA 5F6FA 4IRGA 4IZZA 3TO7A 3IUOA 3KP5A 1JTXA 5F46A 3OL4A 4M73A 2V1CA 2HR3A 2HTSA 2HOAA 2M45A 4KIGA 2OBPA 4V2FA 3DXJF 5KHDA 3FSYA 2VQGA 4FUUA 3MMYB 5LRGA 2IS4A 3GEZA 4A12A 1IW4A 4NEXA 2Q4ZA 1XGMA 1LUJB 2HDWA 3WG9A 3DPTA 3BI1A 3JRDA 2ZKZA 1GXQA 1DS2I 2XRLA 1WI9A 2KRHA 4U0WA 2QQ8A 2QA4I 3G1LA 3CJRB 4E1PA 2IA1A 4EWTA 1WJ5A 1OKRA 1MBEA 2K3FA 3VDPA 3B6AA 2DMUA 1KU3A 1TBRR 3HOVJ 1OBRA 4ZYHA 1FBSA 3SQNA 1STZA 4AU7A 2L9VA 4HDVA 3OYHA 2DB6A 1J5YA 2DO7A 4A0YA 2LY9A 4A33A 2FE3A 2IW5A 1I3AA 4HSTA 2BYVE 4HLYA 1OMTA 1W36C 1ZREA 2M30A 2H6BA 2CTCA 1BC8C 3QNVA 4L9VA 3FVLA 1G8XA 1HSJA 4P45A 1IJWC 4F92B 2R8VA 1HLVA 1NK2P 3BZKA 1YI2I 1S7KA 2Y69H 4RB2C 3FF5A 2GXAA 1O3TA 2RB7A 3ZQ7A 1TBXA 5TGTA 2EJRA 1Y8QB 3TDUC 2QJ8A 3BI0A 4U5YA 2FBIA 4CCKA 1ON0A 4AVPA 3VYUB 2ZJPF 4OAZA 2O8XA 2E5ZA 3NA6A 4DYCA 4ETSA 2AO9A 2V4JC 1TT0A 2C6CA 1ETXA 3K1PA 1V5GA 1QA6A 2HOSA 1QPIA 2JVHA 4HV5A 2OTJI 2PVVA 3KL9A 1AYEA 2UXXA 2R92J 2Z3KA 3LSTA 3GWZA 1XS9A 4CA0A 2V77A 4GM5A 3OYIA 4ENMA 5F04A 4Q38A 2RN7A 2PJAA 2CWHA 1B8IB 3GXOA 4CCLA 5J4VA 1R58A 3H5AA 4PJNA 4O6JA 2R7RA 2NS0A 1SFUA 2E2IJ 2ZOGA 3A9LA 3TW7A 2CQNA 2MD0A 1YRNB 2HC9A 3WTYC 3LL7A 5E79C 1T39A 1H8AC 2IS1A 3R5CA 1W5CC 1VKCA 2EILH 2HYJA 3A03A 4L0ZB 4F7ZA 5HI7A 3D7DA 3LACA 3ZJ0A 1VQ9I 3FHNA 1OPCA 4UF4A 1DPUA 4HOBA 2DYRH 2CV2A 1YLOA 2FQ3A 2ZFUA 4A5MA 1QO0D 3K9UA 5G20A 3RBUA 2VE8A 4QWQA 2DK5A 1X2MA 1TWAJ 3F21A 2DTZA 4A3MJ 4B5PB 4A2ZA 3U2RA 4MHZA 5HS8A 4H6UA 2PJBA 1W4RA 5IB0A 5L3DA 2IGKA 1L0OC 4UIBA 4UVAA 1CSOI 5F47A 3T8WA 5DM6F 2EV6A 3GBGA 5DDGA 4XPLA 2EVNA 2ZFWA 1S7OA 4XK4A 3S3NA 5IT9Z 1ULMA 5EBVA 1X4SA 2YNEA 3S9MA 4CGPA 1NG6A 2PDOA 3U1KA 5JFRA 2IBDA 4PXCA 1JUMA 5LYFA 4IRHA 3HOYJ 5E1ZB 1OCRH 2ELIA 1LFPA 4CCOA 2LRDA 1IDZA 4BQAA 3Q9VA 4NNJA 3L2QA 2PIYA 3H5RA 2VB6A 2YGWA 2NSMA 3RYPA 3GVAA 2PJ0A 4EM1A 2NS8A 2ZJ2A 1ZR4A 2C6GA 3IHUA 1Z8XA 4CAWA 4IVNA 4GI3C 2GE3A 2PJ5A 3WTZA 4B10A 5F64A 4B3XA 3S17J 4CYCB 4JLYA 3K0LA 2K40A 2JBKA 4UUVA 3QPHA 1DS3I 4FBEA 2HNHA 2IGMA 2AFSA 1HDUA 1H0MA 3H0GJ 3WTVC 1YLFA 2VN2A 3SI2A 2HOTA 2V79A 4RB0A 4P9UA 1ZRFA 4X5KA 2DAOA 1DPRA 2L0KA 3VODA 3SGQI 4XORA 1VF9A 2KMOA 4M6XA 2P4WA 2V8HA 3DKXA 1CQTA 2SGFI 3B6CA 2CUEA 1FTZA 2QMLA 3TT2A 1WGCA 2Z3LA 4PJMA 3OY9A 2JUGA 1FOWA 2EZHA 4YFJA 2VKHA 1JKRC 1LVKA 3MKWB 4LG3A 3IV5A 4YFKF 2VQYA 1B6AA 3G71I 1KWMA 3ERED 1R49A 1JTYA 5DD8A 4UVBA 1LDJA 3SEQA 3HOWJ 3BCAA 3CQZJ 3W6JB 1REPC 2JTVA 2KCWA 2XPWA 1D1AA 2ISZA 1B87A 3S8PA 3CUQB 5JVTA 4B13A 2ADUA 2WB1N 4PGGA 1WJBA 1T38A 3AL0C 5J1RA 1VHEA 4JD6A 4OLLA 3LQRA 4CZZA 2L7KA 3LOCA 4OC4A 2F5VA 2JRTA 2NVTJ 1FLIA 4UV9A 3TP0A 4KDPA 1U5KA 1BI3A 2JYYA 1L3LA 4IHYA 2XSDC 2ZW7A 1T08B 3IAS2 3BQYA 2ENNA 2WUUA 4R3LA 5HLIA 2JJ7A 2O4HA 4U9ZA 3RJPA 3DBRB 3OYLA 4KIBA 1DP7P 3CC7I 3WABA 5IV0A 2XF5A 2LNBA 1I1DA 2V6EA 5GTHC 2PR8A 3H4QA 1EA3A 2R3SA 3FMSA 2IS6A 3H1CA 1U6MA 4NGPA 2R1IA 2LF8A 4PFPA 2QYVA 4J3GA 5DTDA 3HBLA 2OD1A 1W5TA 2DT6A 1BO4A 2NNNA 1ZARA 3U1DA 4N4OB 4PJLA 4BINA 3GIUA 4Y33A 4E7SA 2G7UA 2SGEI 3TQNA 1HW1A 1Z8WA 2FL4A 3B8GA 5LGTA 2GM4A 1APLC 2IRFG 4Q36A 3CJQB 3O8HA 4NB5A 3CPXA 1Z6TA 1BR4A 4XPDB 3IWEA 1TP4A 4QB9A 4XL9A 3UGIA 2CTBA 3PBEA 5HXDA 1EV7A 2CJJA 1TC3C 1JGSA 4KS9A 5FKKA 5HS7A 2Z3MA 3EDPA 4M9SA 1IDYA 3GTKJ 1LVAA 3KYDB 2XSJC 3E6CC 3UGLA 1VQLI 1IY7A 4XLFA 1YVOA 3WGIA 2HOEA 3CF5F 2QKMB 4D7NA 4J00A 1VQ4I 3G8WA 1B6BA 1GVDA 1H8LA 3GLLA 2V1UA 1GV5A 3CT9A 1UHMA 3FXKA 4WWCA 2F3CI 4WK8F 5FUWA 1X2NA 1H0ZA 2QPOA 3R1KA 1OMUA 2NOGA 3OR2C 3T0YA 1Y6IA 3RPUD 4A95A 4NCZA 4BKXA 1HCRA 2UWMA 2ODDA 4RI1A 4U0YA 1Y56A 2DA6A 2KPMA 4BQNA 2H27A 3TFYA 3H35A 5K1YA 4NSQA 4XQFA 3CO7C 1YTYA 4MY3A 5K8OA 3JVNA 1RFHA 4SGBI 4LB5A 2LDUA 4L9JA 3BJIA 1U5TA 3T1BA 3K1NA 2LKSA 4YIIA 3C3WA 1VHSA 2EWNA 2FIWA 5CVJA 2HB6A 1W36D 5GAEJ 2XGXA 1ZELA 2VXDA 5DUIA 4BBRJ 3HOZJ 3HDDA 3TX8A 3CCVI 3DU6A 3VWEA 4AG9A 2M4GA 2BY1A 1OYYA 3S14J 1Z8LA 2NU0I 2AFXA 1ZG5A 4IHWA 5EGOB 1FEXA 4UXIA 3B4VC 1T8IA 1IY5A 3OYFA 3GTMJ 3K70C 1S3ZA 3BJ6A 2BXZA 2OQRA 3FXJA 3HRSA 3U9GA 2KMRA 4B09A 4JZ0A 1B9MA 1ZLKA 3RQIA 3VE5A 4HF2A 1U9OA 1Y1CA 3E3VA 3G2BA 1Z8TA 4E7HA 1HXDA 3I0TA 4RA2A 2VKVA 1WJDA 1DQUA 1YO5C 2IXSA 3DPUA 2ENZA 1S7LA 4C2TA 2XEIA 3ABMH 3R4KA 3WTSC 4E4HA 2VODA 3WGGA 1R6RA 2HWVA 4X0GA 2GAUA 2XGEA 4MFDA 3VFZA 3JRCA 3FX3A 3TKYA 2FNFX 4UB6C 5CPRB 2ZC2A 4A0XA 3ZQIA 4DZPA 3B3SA 3ASOH 5EX3A 2M1BA 2LG4A 3EUHC 5HLTA 2JN6A 3BR5A 4MPIA 3L2CA 3EUKL 3Q0UA 4N9HA 4R3KA 2M8EA 1NE9A 4FD5A 4P10A 1LFBA 4C7IA 4CAVA 2DFFA 2D1HA 2FNAA 1T0FA 3HSFA 5M5YJ 1S9HA 4RM2A 5K5OA 2ZEDA 4H2KA 1ZG1A 3VATA 3L2VA 2RNGA 2R7QA 2XKOA 3HRTA 2EB7A 3GLXA 3R9FA 2WADA 3RIRA 2P7CB 5HH1A 2GWRA 1Q7LA 2ZEHA 3V38A 3CJNA 1DUXC 5CVIA 3PL8A 5CVRA 1BI1A 3PJRA 4C9YA 1FYMA 1DE4C 2STTA 3EC4A 4KNYA 3D66A 4MHGA 1SGYI 4X3RA 5K7ZA 4KN7X 1K61A 2Z9OA 2F5FA 4ZY2A 3TDZC 4II2A 3G3ZA 2B8TA 1TNSA 2EFPA 4C30A 5JPHA 1WJFA 1NSAA 3BLYA 2ZXIA 4II9A 1HW5A 2Z11A 3R5DA 2LY2A 2HZTA 1R1UA 3A0HC 3K9TA 2K9LA 4BEHA 3BR1A 2OUMA 2REEA 3FYNA 1BR2A 6CPAA 2WAEA 1LQ1A 2WB1A 2K9QA 1YK3A 1Q9BA 1D0ZA 1P4NA 3WU1B 2RFHA 1YS7A 1RI7A 1MBHA 2DOEA 4F0YA 5JM6A 2QGUA 5ICGA 3CPAA 1QSRA 1CGJI 2BE5F 1V0CA 5AG6A 2DA2A 2DFIA 2AXLA 4IEJA 1RRJA 1Q1HA 3RDIA 1KMAA 2XASA 2FSRA 3ULQB 2R7XA 2RGVA 3KP7A 1UWYA 4XLHA 3S3OA 1L0CA 4AVBA 2EFQA 2R7FA 1P7JA 2HQAA 4ZBGA 1LFWA 3CZXA 3OIPA 1OR7A 3AG2H 3SJEA 2A69F 1SVLA 1DDNA 4KUBA 2KQRA 1I27A 3AAFA 4UEEA 3K2AA 4GO1A 1HSTA 3M9AA 2VXKA 4L8AA 4XBFA 2HXIA 1D1BA 2YX7A 1R00A 5GAHJ 4UWIA 3L2NA 4L5EA 3S9LA 1D1CA 2UV1A 4KSIA 3FEEA 1Z9UA 2LOOA 4I49A 2DPSA 1I6XA 2EFOA 2W48A 4MO7A 5FUXA 1VQ6I 3TTHA 4LD5A 1XOVA 3CDXA 5HS9A 4A3BJ 4MCQA 2PMZA 1MBJA 3H3VK 3SJXA 1S6LA 1WH7A 4FE7A 4AIHA 1M4GA 2ZEGA 3D00A 1BLLE 1YSJA 2O5RA 1OJLA 3QTLD 3HHGA 3FWEA 2EH3A 1Z4RA 3TE4A 1X1BA 4BACA 1X3UA 4HNTA 2JPBA 1P9GA 1IXCA 1XMAA 4NBQA 4PXBA 4IL6C 1U0JA 2R98A 2ID6A 1JJ6C 2FIAA 2I79A 2ARHA 1VIXA 2NOJB 3V7SA 3K4MA 2QQ9A 3IP4B 2N17A 1KUXA 2Q0YA 4S0HB 1R5GA 1ZYRF 5JQ4A 2ZSHB 4LITA 4ENKA 1M8BA 3EQLF 1VHOA 2SGQI 1FX7A 2Q51A 1JUPA 4P5OA 1WJCA 2EA4A 2I5UA 2Z3NA 3FX6A 4IF5A 2E1MC 4U9YA 2K9HA 2W84A 4P44A 1LNWA 2ZELA 2B0LA 3G6EI 2LY1A 1ETQA 2REFA 4W1UA 2VT2A 2XB5A 2QEXI 3BXMA 2M87A 3VYTB 3IWFA 2W4SA 3E5UA 4BE1A 4O23A 1XB4A 1EF4A 3VH9A 1X1AA 1UFMA 1U2WA 1Y0RA 2EO8A 3R96A 2QM3A 1KQ0A 1RESA 3GO5A 4ZZLA 5LRSA 2QKLB 3LWFA 3GFIA 2KDZA 1M44A 1BW5A 3NH5A 5EX0A 2F5EA 2R5YA 2VZYA 1NTCA 5G1ZA 1YIOA 4Y3OA 2L7ZA 2DXIA 4XKBA 5D8LB 4AM3A 4BBSJ 3OYEA 2NU2I 5M5WJ 4D0PA 5KAIC 3V8JA 1WZ2A 3ZN1A 4I02A 3NE8A 2Y48A 1J59A 3FZVA 1I39A 3H5NA 4PDKA 4LFUA 1AHDP 2V9VA 3IC7A 4LIUA 4Y4RA 1QGPA 3DEUA 5JVGF 1ZG8A 2FF4A 4PXEA 4P55A 1JHHA 3ZMSA 5LD2C 4F0XA 2QBYA 1QPMA 4KT6A 1H88C 1XFOA 3MN2A 3CCMI 2B9SA 3A01A 5DV5A 4N4NB 2XGDA 1CT0I 2KMPA 3EYYA 2A07F 1WJEA 1DP3A 2VT3A 2ZXHA 4F6AA 3MGDA 2DTRA 2L7XA 2QVPA 3E0JB 2M0MA 3IRQA 1AN1I 4NGRA 5JI6A 1Z21A 3PM1A 1NSLA 4PFOA 4UCNA 3GOXA 3BQZA 2BY2A 1CX8A 1Z0XA 3I55I 2Q4YA 1P4AA 3KETA 1KONA 1XA6A 1ZGWA 3DEWA 2XAUA 3ZXSA 5IY5H 3FMQA 1K6OA 3HGYA 2F5CA 1MMGA 1RKTA 4KISA 4EMEA 1IRXA 1CP7A 2O28A 3QPLA 2ZNYA 2CUZA 2VONA 1AUGA 1E3OC 1H9TA 4M85A 4DQ2A 2YNDA 2NXNB 2EV5A 2O0YA 4LK1F 3DNSA 5GAGJ 4HSRA 5JHUA 1YIJI 1K4JA 3FSXA 5CPAA 3BG6A 4MQVA 3UKGA 4A0ZA 1Y8FA 1I5ZA 3IH4A 2DMQA 5CQGA 4IHTA 2JK3A 1LOKA 3ABUA 3ABTA 2E34A 1CPXA 3CMMA 4HNUA 4BDYA 1Z9CA 2QUFA 3K70D 3SZGA 4EJUA 3BTLA 1F2OA 1S60A 2LTPA 1GV2A 2G9DA 2JA6J 4E70A 2YNCA 2V26A 7WGAA 4KLWA 6PAXA 2KRCA 3J81Z 2HXOA 2V1NA 3IL2A 2E5RA 3HSEA 1O57A 2UZKA 1P0HA 1F1ZA 4U87A 4A37A 2LBFA 2BUEA 2NVQJ 4J01A 4MHNA 5K8MA 3VEPA 4YRHA 1WI3A 2A6TA 4M9ZA 1O7FA 5C3EJ 2DPDA 3PBBA 2OF7A 4PSWA 1SAUA 1JT0A 3FMRA 4TNUA 3OVOA 3B35A 1DGWY 4XRSG 3W2VA 2WSAA 5GTIC 2ZEPA 1FPQA 3B3WA 5LYIA 4D9JA 2O03A 1KU9A 3Q0WA 2H8RA 3M3YJ 3EO4A 5DS0A 4ZX8A 3R9GA 4EVIA 2PX9A 1CT2I 1JQGA 3PNTA 2EK5A 3WODF 4Y13A 1WPKA 1IRZA 2X85A 3OS0A 1I1SA 1Z2LA 4M6YA 2NVYJ 1F9NA 4BDZA 5FB2A 3F0AA 1IOFA 4A69C 2P6TA 3LNQA 4X6AJ 4FT8A 2IGOA 5IYBJ 4LUAA 3WC5A 3JAMK 1VFCA 5IYCJ 3KR4A 4YFNF 3FECA 5ILVA 2YUUA 3SXOA 2K4JA 2KHMA 5IP7J 1Y1BA 3D68A 3BT9A 2P5VA 1G6NA 2FMLA 5J6XA 4F9VA 5KVRA 1ZHFA 3D5RC 4KVME 1YHQI 5TJJA 4WWVA 2VJJA 3RU0A 3A2KA 1BN5A 3RSNA 2VLAA 1PTRA 5CVUA 3UFFA 2O3FA 5BNGA 3BHXA 2R7OA 3V7RA 2VZZA 2NU3I 4P9FA 2PJ2A 2Z33A 4RAZA 3JRHA 1IG7A 1R5ID 4UFVA 4GYGA 5B1AH 3N05A 2DA1A 3OYCA 2R93J 4CRYB 2CW7A 4E7ZA 1MT1A 5A27A 2NYQA 3MD2A 2FOWA 1Y7RA 4RGRA 4II3A 1CF7A 1HA8A 4G1PA 1Y8RB 5A2QK 1KZFA 3F72A 2DQLA 4RM3A 2A3SA 2M2EA 4BD9A 4NFRA 5FD6A 5J1UA 4F91B 5BQTA 3E6BA 3GZ5A 1XCBA 2KISA 4AD9A 5FKLA 2WV0A 1MDMA 2HVRA 1I21A 1YW6A 4M74A 1U5TC 2CU7A 3SJGA 3KCCA 1YW7A 1HDQA 4CCJA 3H5ZA 1ZR2A 2CW8A 2VJ5A 4OVOA 4WJBA 3JW4A 3A1YA 1PDNC 3J7AY 3KR5A 3IAM2 4EJTA 3ZR8X 4Y7NJ 2CQ7A 1W7PA 1FP1D 3LSMA 3W6SA 2ZMEC 2GA1A 1QQ9A 3ZP5A 1S29A 2JT1A 4EMSA 3HB9A 5FLXZ 1XPXA 1XF8A 1K6YA 2KZVA 3R0JA 1LCPA 3G3SA 2FU4A 1W5SA 4IHVA 2SGDI 1LEAA 3CXSA 1HDLA 2E71A 4KOXA 4ENNA 3WC6A 4IQJA 4BXFA 4YIRX 5E3RA 2Z5UA 5IYDJ 1U5TB 4XSXF 1XCVA 4EGZA 1OYWA 1XX5A 5HLGA 3HPHA 3KYLA 1GXPA 2DJIA 3DV8A 1KBFA 3I1UA 3PFOA 2Q7SA 3KP4A 1R36A 1KQ8A 4R87A 1LDKB 4ZTFA 4HV6A 2VJIA 2WC2A 1ZLHA 4CGOA 2JEVA 4P1WA 4ZYEA 5L3CA 1SGNI 2X1DA 3SFIA 5KNLA 4LX9A 1TW2A 2LEOA 3RYRA 2OZ6A 2ZMEB 4KVXA 1X3WB 2QQBA 4U7DA 3PFIA 1SMTA 3FXLA 1XSXA 4M3EA 4Y17A 1TQMA 1T6SA 4OWRB 3G1MA 1WH5A 3S16J 3GFJA 3P2HA 1FP2A 4UIAA 4OU0A 4PSXA 1OQYA 4YEJA 4AIJA 2IAIA 2BHYA 1R1TA 2UUZA 5F27A 1FYLA 2HDDA 1ZTRA 2KJCA 4XIDA 4R76A 4ZYQA 2JXDA 1ZO0A 3NH8A 3OL0A 1B1BA 1SMYF 4I6ZA 3T8RA 2K3PA 4HX7A 3HH2C 1T0FC 4IHMA 1R0RI 1HPTA 3FF3A 3CXPA 5K8NA 4UV8A 5CLSA 1IY6A 4KOSA 2C27A 4P4DA 3QOPA 1S3JA 5D5XB 2DMNA 3KLOA 4JYWA 4OADA 2DOAA 2X7BA 4ABZA 2CYYA 2Y9YA 1ENHA 2CWEA 2HQRA 4G6TB 2M4KA 5EYRA 2XF6A 5J8CA 3UGDA 3MZYA 5CQEA 1B72A 3IKVA 1CGII 4XN0A 2RREA 1EJ9A 2F5DA 1TQPA 3GB0A 3BROA 3CP8A 3P9IA 5D5UB 3KE2A 4WXDA 5DD4A 2POKA 2Q04A 3K69A 4PK4A 5E8GA 2ZW5A 1QVTA 5F1JA 1P2FA 3D4UA 2N71A 2XIGA 2XC7A 3VYRB 3VSLA 4C3IJ 1YJWI 3CTAA 3M1CA 3O6BB 5BWAB 3F22A 2MC4A 2EBJA 3UY5A 3GF2A 2ZBKA 3OSGA 4M6GA 2WY8Q 4B43A 3OYMA 3J7AO 1J9IA 2B3VA 2XDVA 3FRMA 1XBUA 1A31A 4AUXA 1G3SA 3MZHA 3IH3A 4DNCA 2G0BA 1XGOA 4A38A 3JR9A 1A2ZA 5IX3A 4W97A 1D8JA 1OFCX 1MSFC 3COAC 4A3EJ 3BDDA 2GA2A 3NEUA 4GYIA 4I0AA 4BJ5C 4JX5A 4EEFG 2XROA 1IN4A 4PZJA 1KBEA 1MNEA 2W85A 1KU7A 1IXRC 1MBFA 4KUAA 5JGFA 4BEHB 3MKYB 3PNVA 4AG7A 2Y75A 4IF4A 2QQCA 2Q8KA 1HDDC 3FH4A 2Q7BA 4CRZB 1UMQA 4OIWA 4HYEA 1MNMC 2VQLA 3NQOA 1S8NA 3VDUA 4OOIA 1Y9KA 2PJ8A 2ACJA 4M6HA 3QAHA 4XN3A 3JUWA 2Z0ZA 4NUBA 1PCAA 5E3PA 2JLMA 1GYTA 1K7VA 1BW6A 3S1QJ 4C3HJ 2GZWA 4KORA 3FXRA 1TL8A 5DM7F 4HQEA 2COBA 3S2DJ 5H86A 2JA5J 5HDNA 3DTIA 5AGEA 3KX2A 4YG2F 4EFDA 4CAFA 3G4SI 1BOAA 2WGCA 5H6QA 2STWA 3Q9SA 3J80K 2P6EA 2EZLA 2MG4A 5C44J 4H0EA 1JGGA 1D5VA 2NS7A 3GW2A 5EJCA 5E3NA 1G3TA 4RB3C 1CE3A 2QQAA 1W4MA 2FS5A 5THWA 4QLCU 3S6GA 5IPAA 2MYSA 1UCRA 3QPSA 4N9IA 3FXMA 3W6XA 4NGSA 3ABLH 3QB8A 3MZ8A 2L3DA 1JI8A 4XLAA 3TEDA 3LAJA 4YFXF 4R8FA 2R7WA 2VEZA 4D7MA 1SD7A 1PYTB 4CGNA 5FKMA 3RAMA 2AFUA 3EETA 3E5QA 1H89C 3CO6C 5M3FJ 1R57A 4C2MJ 2JA1A 2LREA 2ORVA 1T95A 4HNXB 3DKWA 1GVJA 1F5TA 4FX0A 4BMHA 1YQEA 3CUQC 2K9MA 3KY9A 4I01A 3RKYA 4CYDA 4BXUA 2CJSC 5DUKA 4DJLA 1Z2IA 2A68F 4BL0B 1YLEA 1IUFA 1IV6A 2B63J 3WC7A 2IPQX 1N13A 2I8DA 1P6RA 4M3DA 1VQ8I 4HF1A 2FUG2 2COMA 3A0BC 3QU3A 1X58A 1FYKA 3TCVA 4A3IJ 4NC7A 3RKXA 3ZQGA 3KZYA 3SDBA 4XR6A 2NU1I 2CUJA 4ANJA 2R5YB 1MJAA 1HQCA 3TMOA 1KUVA 3GMEA 5FFZA 3PP9A 2QWWA 3F8BA 2GKTI 4M6IA 5E3MA 1XSVA 5HVQC 4BY1J 2H1KA 2EBIA 3I5UA 2MBFA 2ZXVA 4GGGA 1Y0NA 1NK3P 5AONA 1XIXA 2IJZA 4G8XA 2LLKA 3PSIA 1HC8A 3D7HA 3KQZA 4L0YB 1TGSI 2QBYB 2E36A 1UVFA 1ACIA 4L9NA 1UAAA 1XEBA 4ZI6A 4FD6A 2EIKH 1E2XA 4FD7A 4G7ZF 3VDXA 1BPMA 1ON1A 2FNPA 2O61A 3FDYA 1M4LA 4XPDC 2BY3A 2MW8A 2B4DA 1P7IA 1XMXA 2VPLA 2H09A 1TBNA 3OWTA 1ZRCA 3C2GA 2ETHA 2XAQA 3QP6A 1QBJA 3GFMA 4HRIA 4UY8I 1TKJA 1BR1A 1RUNA 1HOMA 3FIXA 1V54H 4Z2YA 2GFQA 1IN6A 3JRGA 2WPXA 3BZCA 3BP8A 2DA4A 4BHBA 3L00A 4HNVA 1ULYA 5LGUA 4CUGA 4C2UA 4OMEA 5F48A 5ELYA 4AIKA 1IRGA 1UG0A 2VBWA 3MKZA 5IOYA 2E73A 3BTJA 1AMPA 3FK6A 3SZPA 4HA8A 2CG4A 1CHOI 3SHFA 1PU9A 3DR6A 1KYWA 1ZK8A 2LK2A 5FD5A 2X3TA 4Z65A 2EFWA 1RXTA 1I3QJ 3OSFA 5E17F 1R3NA 4RN7A 3VYSB 4QIWN 1SGEI 2Z3OA 3WTUC 3D2MA 4MHDA 1ZRDA 2L54A 4RGUA 2V8VA 1SGQI 3IO1A 3FIWA 2H5MA 4OIQF 4A6DA 1CG2A 3KQXA 3CCQI 5G22A 5GPAA 3CXLA 1LB2A 2FCKA 3M7GA 4JX4A 4PK3A 3SI0A 2C6PA 4OC0A 1YFHA 2JQ7A 3M07A 4Y52J 3HTUA 3ZOBA 2LBFB 4Q48A 4KYWA 9WGAA 4G12A 3WE3A 3ZQLA 1ZLIA 4MCPA 2ZJQF 3NAUA 3QRFF 3HM5A 3MAJA 2JA8J 5LRRA 4EM2A 2HFHA 5EZGA 3HPGA 1SD4A 2QLZA 4KIFA 4CPAA 5E3OA 4ESFA 1HW2A 2PMUA 1WSUA 1YITI 1LR7A 1QNTA 2VQHA 2ABZA 2FX0A 5D4RA 1OZPA 1OYIA 3WE2A 2AFMA 2VRWB 2HI3A 2HPIA 3RQ4A 4M6VA 1BPNA 5F1RA 3GTLJ 2D5VA 1SEUA 5D5VB 5FRMA 4OAYA 3HKZN 3HSRA 2NRAC 4Q5SF 3H3ZA 1KYZA 2R0QC 2Z10A 3IWZA 3LAPA 2FSWA 1HKSA 5JHWC 3DU5A 1MJBA 1V1HA 4ESBA 2ERWA 5EDNA 1IO2A 2KIFA 3CDLA 2A5YB 1E3HA 2MSYA 3OOUA 1YX0A 1EKEA 3F6VA 3IRRA 3CCSI 1IIDA 2A4NA 3VWBA 3PNYA 2EPFA 3N97A 1Z91A 1IYKA 2I00A 3PEIA 4A3DJ 4A39A 3WU2C 3F8FA 3LSPA 1W3SA 4L5JA 2V8DA 4MMOA 1XGSA 3ELKA 4GDFA 1FIAA 4BNCA 1WQ2A 2ZNZA 2BO9A 2WCYA 1BOBA 3DLAA 5EG0A 4JQFA 2OPTA 2FRHA 3I58A 4DYQA 4OIDA 4ZDLA 3HEFA 3FKIJ 2W7NA 4ONUA 3WTXC 1CF7B 4XM3A 3SFZA 1ZH5A 1IN8A 3BR3A 2E7WA 2W0TA 2ECBA 3E6DA 4DBQA 3ML6A 1ZG7A 1P92A 3BJ8A 2HUZA 3WT4A 3PB9X 2CMPA 4OC2A 4LMYA 2P0WA 2ZO4A 4X1EA 2G3TA 1MDMB 4BGDA 3F6OA 4KMFA 4KVOE 2AFWA 1WGTA 2ZEOA 4KZTA 4E8OA 1R1VA 4A5NA 4ZH4F 1T2KA 1K4TA 1R4MB 1W7PB 2DI3A 3KPHA 3IFEA 5AG5A 1SVMA 3IEHA 3HUGA 1NG7A 1NMTA 2XAHA 2V1CC 3CMEI 2RV8A 2MA3A 2BEOA 3FM5A 2PJ3A 5J1YA 2WAFA 3BJOA 3U21A 1SGRI 2X48A 1POGA 2DN0A 3GZ6A 1IC8A 2OR4A 2R7HA 2HYFA 3I9V2 1U8BA 2V8GA 2OB0A 1O4XA 1TKFA 5D29A 2J9RA 2KIQA 4RLFA 3RPUA 1LKXA 1OCOH 2TCTA 2JSCA 5H20A 1KZHA 2BL1A 2ZW4A 4CZCA 3CCEI 2BEIA 3IC1A 3S6KA 2NYXA 2IQ6A 2KIMA 3CMYA 2B5GA 2RIJA 4CDGA 2D4PA 4MFJA 4MTDA 2ICWG 1VTNC 1AKHA 4ZDOA 1VGYA 5CJ9A 3H9QA 3DQVC 5FLMJ 2OH1A 4P4EA 5GCNA 1Z05A 3E6MA 2P6SA 4CGMA 2KP6A 1Q1VA 2W1OA 5D8KB 4DGWB 4C68A 2ELKA 5LRKA 1DTDA 4ITVA 4QSHA 4ZC3A 1ARMA 1SAXA 3DLJA 4L9TA 4XLNF 2R4GA 2Z3YA 4LK0F 5ICCA 2NMTA 3JTHA 5E20A 1Z1DA 3TO6A 1Y7EA 1YW9A 4HQMA 4FD4A 4S04A 1N78A 2MC3A 4BU2A 1MNDA 4L89A 4LLGF 2Z1DA 1X1DA 1SD5A 4MBUA 3QOEA 3CC2I 2L01A 3CC4I 1IU8A 1MZBA 3I59A 1O7LA 2BV6A 2P8TA 2VBXA 4FTHA 2MFZA 3MKLA 3N5FA 3LODA 4FASD 3K2KA 5IP6A 3M4OJ 2CWGA 2M5WA 2YPRA 3DSBA 2R7ZJ 4NGTA 2CV0A 4DUKA 1RIOH 2HDCA 4FISA 1ULNA 1LAMA 2F5IA 4ZX9A 1R43A 4HZFA 1J2XA 1B72B 3PB4X 4MIMA 1HKQA 1MKMA 2V7FA 2AHQA 2EINH 2XF7A 5HOOA 1K78A 3V8KA 4NJRA 3FBIB 2NNYA 4EQQA 2ZJRF 1UVGA 2Z2SB 4MHPA 4NQWA 4HBLA 4QUSA 4YU9A 2Y0SN 1MGTA 4RDUA 5KTAA 2E1NA 2D45A 3S1NJ 5L3GA 4DYRA 3W2AA 4ZY0A 1TBQR 1WKXA 2GOXB 1RR8C 1XMBA 3Q3SA 4M72A 4HX4A 4H4KC 3OXGA 4E7JA 4MFZA 3FKJA 4BQQA 1TIQA 5M3MJ 3K4JA 2KT0A 1LR9A 2Z99A 1YX3A 1FOXA 1QSOA 3X2QH 3ZCOA 4MFKA 1OCTC 3VPRA 1V4RA 3KEOA 3ZMDA 3ZQQA 2BW3A 3BR6A 3PIPF 3SJMA 4XLCA 3PO3J 2JDCA 2KLOA 2L7MP 2F7VA 4ZGYB 5KCMA 3M8FA 3JRFA 2UVOA 3O3KA 3BJAA 4MNUA 3ZQCA 2VL8A 1YQAA 2L5QA 3SZTA 2DFHA 2R7TA 3LSIA 3OYNA 4IXAA 3DTKA 3SGBI 2O53A 3FK7A 2DW4A 2KKOA 2YUSA 2ZW6A 5C82A 3D1NI 4HPQA 2Q44A 1YG2A 2ECCA 2OAZA 1J75A 2QECA 9ANTA 4YWYA 4MTEA 1J4JA 5DCMA 1CGPA 1GLNA 2XVCA 3WHCA 4NGQA 2GXGA 3MQ0A 2EUIA 3MCZA 1J09A 1USTA 2LFBA 3ASNH 3LMMA 2HEOA 2V9KA 1I1GA 2AS5F 3CUOA 2EZIA 4BUPA 3JTGA 3MEXA 3OIQA 2HVSA 1LDDA 5J8FA 1KUYA 2ZEFA 3QAYA 2I3CA 2ZXJA 2VL1A 4RAGA 3RZAA 3S1MJ 4I7HA 3GUXA 2DLLA 3KZWA 3EY5A 1P4XA 3HHHA 5FRNA 1X19A 1TOTA 4XKCA 3FJUA 2QYOA 1FSHA 4IHSA 1Q2YA 1ZQ3P 2Y31A 1GHEA 4LIVA 4I2OA 5E3LA 1NXUA 4KOUA 3DF8A 3W6VA 3C2HA 3CZ6A 4AB7A 3WHBA 1Y0YA 4U88A 4MCRA 4OAEA 2VKEA 4WX9A 2Y9ZA 4JJXA 4JBAA 2IA2A 2JVGA 4E1RA 3V7ZA 4KOVA 1SFEA 4CYQA 1V5EA 2KIUA 2MLGA 5B3SH 3CCRI 2ZOFA 1ZGAA 3BPXA 2P81A 2KFDA 3VARA 5J1QA 4JOMA 5AG7A 4G94A 3N7ZA 2HYGD 2JZMA 2LKPA 4A3FJ 1TW3A 3PSFA 3HG9A 1M4IA 3V8IA 1XTAA 3B7IA 1QZEA 3S6HA 2RNJA 4UEZA 1V5FA 4CHUA 3L2WA 4XNFA 2ANPA 2BVLA 1S7EA 2MH9A 2E2HJ 1WRJA 2QSGX 4MFLA 2V1DA 4I99C 3MEKA 2W57A 1Y9WA 3A4CA 2BGCA 1G3WA 5FO5A 3FNCA 3LA7A 3LQQA 4JP0A 1VQPI 1XE4A 2JRMA 3DLLF 1K7AA 4WF2A 2E19A 3VSKA 3ISXA 2PE3A 4JWPA 2PRQA 3GKRA 2DKVA 3ISZA 1R4NB 4XMYA 3BG5A 1R71A 5ERIA 3G1OA 1PUEE 1XN7A 3I9SA 1FC3A 3JCUC 5LHIA 1PP8F 2EIJH 5HODA 4AVZA 3DPLC 2IT0A 3DDDA 2DA3A 4A93J 2E5NA 2JSPA 3B73A 4G6QA 4NC6A 1SQHA 3GTGJ 1IICA 4EVYA 2OTLI 1MMAA 1JXSA 3VWDA 4JXQA 1PPFI 3LSRA 3WR7A 1V1IA 3SXNA 2D1VA 2QENA 4CYNA 2FQ4A 3K7AJ 2VC1A 4LJZF 3NH4A 2OC6A 3BTCA 3K4LA 1C0WA 5EZHA 4A3KJ 4WXHA 3ZQFA 4EGYA 1YW8A 3CCYA 3I71A 4QBJA 2P6GA 2LSOA 1U8RA 2OV7A 2WZNA 4HF0A 2DU9A 2DDBA 1LEBA 2X0LA 3GLJA 1EH8A 1WK4A 4O3MA 2BZTA 2JA7J 2K86A 3WG7H 1LAPA 1ZKGA 4KSFA 2CY2A 3IKTA 1O3QA 4UCMA 2A61A 2K9SA 5CCMA 4AWXB 3LSGA 1P4WA 2EIMH 1I50J 5K7HA 5H84A 4BXXJ 1S7AA 4UB8C 3OXFA 5HLHA 3ROUA 1ODDA 1SC7A 1X4PA 4DYOA 2GIZA 3M8EA 5CVVA 4CSWA 2B4DB 1Z3YA 5HNHA 2HV2A 3RNZA 2VBZA 2E35A 3B02A 4FE4A 4PUSA 1QU3A 1D3YA 2DK8A 4GCVA 2K85A 4C7HA 2CNMA 4UXNA 3GYHX 5J47A 1X1PA 1LPQA 2DIPA 3PB7X 2DYSH 3BC8A 3S93A 5L3FA 3Q0VA 2CF4A 1FNNA 3T8TA 2GXBA 2CQQA 3P5JA 4A94A 3HOUJ 3IU2A 4PJJA 5A28A 4XRFA 1WJAA 2BHZA 3MRUA 4YGOA 2HGCA 4RS2A 5AIPA 5HDGA 1QRYA 4CH7A 3CJTB 4EV0A 2CH0A 5A2QZ 1MIJA 1XDUA 1OCCH 2DMTA 4XRSA 2H8WA 5L3EA 4E7IA 1F4KA 2J87A 4KOTA 1YX5A 1ERDA 1MH3A 4KOWA 4ONWA 3TC8A 1IGNA 3FISA 4NF1A 1D5YA 3FBNB 2VOOA 2F2EA 2EK9A 3RCOA 2ORWA 3T9YA 1VQOI 3T5XA 1GHCA 1VQNI 3P7NA 4OMYA 2Q2EA 1IUYA 2LUYA 3PZJA 4IK2A 1IF1A 4GS4A 1A04A 1MMDA 3HOSA 2AXTC 1CPSA 4KN4X 2OOTA 4L18B 2Z16A 5L3BA 1JKPC 1FT7A 2BSWA 4R6TA 4JXRA 3GZNB 5GP9A 1FTTA 2AFZA 3ECHA 2PEXA 3K4CA 5CKTA 4FX4A 5F09A 2L2OA 2L9NA 5JHFA 3ZGKA 3LSKA 3I4MJ 4PJ0C 3KKWA 5C88A 3K2ZA 3MWMA 3F3XA 5HQ8A 5CNPA 5HVHA 2HQYA 3KIOA 3L9FA 2E1OA 2ESHA 2BOAA 3KASA 2QQEA 5EMIA 4UHTA 2W24A 2CIJA 3C2BA 3HOXJ 2PIZA 3D5SC 3C26A 2PJ7A 4IRIA 3PO2J 4CGZA 3TOAA 1MMNA 1B9NA 2F4MB 3KP6A 1RUOA 4AMLA 1WVRA 2CO5A 4XOPA 4V19K 2PI0A 2AJ6A 2LMDA 1O3RA 1FBUA 1JT6A 3PUFA 2PR1A 1DGRM 4B5OA 1RPWA 1FIPA 3W91A 1HDPA 1QHHD 2G0EA 4PGHA 3F9KA 1PYVA 2M0CA 3W2WA 5FLXK 3ZMZA 1G4DA 1OVOA 4FQGA 1FOYA 5ILUA 1MK4A 4NXYA 2O8KA 5DS9A 4OIPF 2CNSA 3KP2A 5K7FA 3K4KA 3I3LA 1LE8A 1OCPA 4P4IA 1JE8A 2MLKA 1XD7A 1Z7LA 2E7XA 2LKXA 3I3GA 3PB8X 5FGMA 1BI2A 3K4BA 5EG0B 4NGNA 2KCXA 5JH9A 1XMKA 5CBMA 1D8KA 1ONVA 3OYJA 3DKYA 4JYKA 5LHGA 4XNHB 1X12A 2M8GX 2K7LA 1YJ9I 2UXNA 1MBKA 1BL0A 1MW7A 2EA2A 5HNFA 1A5JA 3BPVA 1MSEC 1XX6A 3B3VA 4MHYA 3VB2A 1XSDA 3BY6A 1JKQC 2MH2A 3IWWA 1TTYA 4DZJA 4C2ZA 4UUSA 3IWGA 5FUVA 2HU9A 2I10A 2P5KA 3SXYA 3H36A 4RGSA 2X6OA 5DYMA 2TRTA 3BR0A 1N25A 4F9UA 3HUGB 4B6DA 4OC3A 4KT5C 5D5WB 1FSEA 3QODA 3ZN0A 2KL4A 3LA3A 3TW6A 4UWJA 5D6FA 5LYLA 1ETVA 3QYEA 5BS6A 1OLTA 2ROWA 3S3MA 2GIVA 4M3GA 4E2AA 3PGPA 4AVAA 3NARA 2MGQA 2K4BA 2K5CA 4C2YA 3NWTA 1TQIA 2WA0A 1BIBA 5F08A 4UXJA 1YGHA 2F4IA 2AFOA 2MD5A 1NH3A 2MABA 2IP2A 4BAYA 4XICA 3CCUI 4KLVA 4RUHA 3OIOA 5FLVA 1BBYA 3OYBA 1ZG9A 2B5GB 4ZYGA 1TF9A 1AKHB 1OR7C 3F8CA 3BG7A 5JR3A 5JLWA 2E2JJ 2DA5A 3NRVA 2NVUB 5GPCA 2HVQA 5EC4A 2ZB9A 1X4OA 3ECOA 2QQDA 3WTWC 3MFKA 1S5LC 3AG3H 1USSA 2ELHA 3AG4H 4E6KG 1Z4EA 5J40A 4LGWA 2DPTA 3RPQA 2JUCA 1JKOC 3EFAA 2P6FA 2D2WA 2OCCH 4MXUA 4M71A 1TWHJ 2JWTA 2RKHA 2XRNA 4BYYA 4Q4ZF 4XKVA 1AOYA 2IA0A 4BE0A 1K4SA 1F57A 2GBYA 4L5IA 3OS1A 2FVGA 3J80Z 2GU2A 2XEJA 1JWQA 4QPQA 3I59B 3BG3A 2DPUA 3GTPJ 2YQPA 3BLNA 5KTCA 2H94A 4JCVE 5TRDA 1Q2DA 2PMHA 1TKHA 5B66C 2DEAA 1Z3XA 1FT9A 2FD5A 2FXAA 1IAWA 2KJBA 4G6DA 5DAEA 2DBBA 2H6CA 5J3LA 1WWXA 3P9CA 1PUFA 4UFWA 2PJRA 2X9DA 3QWLA 1UG2A 1VQMI 2F8HA 3J7YJ 1JUSA 5H2FC 2PSWA 2WYRA 4AXVA 2JW6A 4C3JJ 4EATA 2P5LC 3Q5FA 5AG4A 1JHFA 3R6SA 1FYBA 4EJWA 1K78B 4P4BA 1M4DA 3W3CA 2C6YA 4NQWB 4A6EA 5LFAA 5B1BH 1FARA 1ETKA 2L9RA 2ZENA 1V55H 1YYVA 5EEAA 3V42A 4MJ8A 3I53A 2HPMA 2PG4A 1K83J 3IU1A 4N0BA 1Z67A 4DIQA 2XPVA 1YR0A 5BPIA 2GVIA 2A6EF 2OZHA 4UCPA 3PQKA 5E3QA 2PLYA 1O3SA 2OJED 4F93B 5HMNA 2BW3B 2V9PA 2J5OA 3OL3A 5IT9K 5FROA 3R95A 3ONQA 4LQGA 4Y15A 4OP4A 3BZ6A 4RGXA 4WCGA 4D5FA 1E17A 2CWFA 4G7OF 2YR2A 3S6FA 4E0AA 2XKPA 1QSNA 3I4NJ 1TIHA 3F8KA 3B3TA 1FMVA 4HEA2 2LP0A 2LB7A 5F49A 2HQNA 4OKOA 3FHZA 1RKWA 2VJ4A 2X6WA 2R7VA 1P9QC 4UVCA 2G9WA 2X1CA 1ITYA 4CCNA 1G2HA 3KEYA 1CJWA 5I0CA 2VKDA 4ENJA 4A30A 1G3YA 3EYIA 1YREA 1R7JA 1PP7U 4RMNA 3TOBA 1DU6A 5DCMB 2IJLA 4XKWA 3HYIA 5H6RA 5HDKA 2BUSA 2CQXA 2Z3PA 5EEGA 1FNOA 2L4AA 4FETA 1IN7A 4AC0A 2OA4A 3RZOJ 4BQOA 2N1AB 4ZJZA 4FAIA 1U6GA 2PJ1A 3PDNA 2XRCA 3IJ3A 2B4BA 5BPDA 2ODFA 2NVXJ 1W0UA 1BM9A 1TWFJ 3SEZA 4A24A 4Q7AA 1RNLA 2R7UA 5F0FA 5E18F 4BHCA 4A3CJ 1OYVI 4IUSA 1FJLA 4FHTA 1J7KA 2FEZA 4AIDA 1WCMJ 4A3GJ 3A01B 2IS2A 4IAVA 2SGPI 4CXFA 2O6GE 2RQQA 4UXHA 4MEYF 3VOEA 1ULKA 5BOXA 3S2HJ 2GREA 2G3AA 1YE9A 3RKWA 2HKOA 3GTJJ 3HRUA 2DDAA 2VI6A 3C7JA 3K1MA 4P96A 4V2GA 1HEEA 2WPWA 4UEFA 1HBXG 2N52A 4P4JA 1TNTA 2YNCC 1FMWA 5J4YA 3DEEA 2O7OA 2NAZA 3KFWX 2X6YA 4IJAA 3TGNA 2KZGA 4LG0A 3N4MA 2UZ3A 4HKFA 1V3FA 2E1CA 2PFBA 3ZQHA 4RAYA 3S2WA 2FBKA 5ED4A 2CXAA 1HJAI 3K6GA 2XPUA 4MFEA 3W6KB 3GTQJ 5F0HA 1SGPI 3P2FA 4IOAF 1IGBA 4TV7A 4BJTA 3ISPA 3E5XA 3TO9A 3SEKC 3AL0B 4MRIA 2QIRA 2XGCA 5FJ8J 4ZYAA 4OC1A 3ESWB 3QWPA 3RO0A 4GFBA 2LVSA 1XGNA 2FE7A 1GUUA 3SJFA 1OMIA 4NDLA 3CCLI 2QSFX 2X1EA 2R5ZA 2VE9A 1LRZA 3UR3C 4A3LJ 1SFKA 3QQAA 4E7LA 3NE7A 3DTEA 2GKVA 4Q47A 2GANA 4PCQA 3FMCA 1MH4A 2BXYA 2GQQA 2PMZN 4M9XA 4RB1A 2R7SA 2W25A 4P4FA 2DT5A 1QSMA 1I6HJ 1N75A 2M5XA 1FBQA 2PCUA 4KA4A 5ICFA 3KI9A 2XUBA 4DBRA 5ICEA 1SANA 2B0UC 1Y0UA 1A6QA 1XRYA 1XDSA 4MGRA 1RR7A 4XLEA 2PVWA 2GOMA 1S7NA 1Z77A 4QVTA 3ZZIA 1R23A 4M3FA 3HC7A 2WY7Q 2M7AA 2XB0X 4ZDPA 1Z6RA 3KZIC 2CW0F 2ISYA 4JK1X 1Y39A 3ZPLA 2ELJA 2H1LA 5GADJ 1Z7KB 4NGMA 3CDIA 3GCMA 2X4HA 3HGGA 3KYCB 1KU2A 1YU6C 1I12A 3E0KA 3H8FA 2FJ1A 1UELB 3KP3A 8CPAA 1XC5A 2WBMA 5CYVA 4NC8A 4YRVA 2PJ9A 3FXQA 4OMZA 3AG1H 3KEQA 1R9TJ 1FWZA 4CYPA 1ARLA 1B59A 2VBYA 4A31A 1EH7A 5LHHA 4GXHA 2N8GA 3KGQA 1YTPA 1KGSA 2JEWA 3CP2A 1IW7F 4HG2A 4R57A 3WTTC 1CT4I 3D0SA 2FBHA 4KSAA 4MLOA 3F0CA 3H9JA 3TL4X 1H9GA 3JRIA 5DWMA 3T90A 2RC4A 3F8NA 2CQKA 3DBHB 2X51A 4YIFA 2CGPA 3QYFA 3RTRA 2OVOA 2PN6A 2KDOA 2ZMEA 5JLXA 1TF8A 2OD5A 1GT0C 3JRBA 1QQIA 4IOCF 3PB6X 5I4MA 1X10A 2NU4I 3H92A 1Q2CA 1IV8A 4KICA 2J8NA 3E59A 3OOPA 5FKOA 3OMYA 3HRMA 4HDUA 4PQAA 5E8IA 1SVOA 4L9MA 3E2IA 2DXQA 1SFXA 1BUSA 2PJ4A 3FXUA 4LLNA 2YX4A 2Q2EB 1IYLA 2A05A 2A6HF 2RAEA 4OINF 1TWGJ 3TJQA 5IOZA 3FEDA 5IT3A 3NFZA 3D67A 3C1DA 3JRUA 2CS3A 3V4GA 4P6YA 4X2TA 2ME6A 5D6EA 3I56I 2QSHX 1PUAA 1JJ8C 4BHPA 3CF2A 4B3AA 4RBOA 4ORFA 4MFPA 2ME0A 5FUYA 5E96A 1FOKA 4WXCA 2LC2A 2F48A 4BY7J 4I0BA 3H8EA 1UJ8A 3K10A 4BJ6C 5LGNA 3LFUA 3HJEA 3OYGA 1QMUA 1F36A 5KK1A 1PJUA 3IGRA 5LRJA 4K2EA 1AWCA 1SD6A 2IVMA 2EWBA 4DOZA 1IXSB 1Z7UA 3CESA 2BCOA 4BH9A 4KJZA 5LLQA 5LBQA 1HKTA 4A32A 3IH2A 5IB9A 1IB1E 2J8MA 4BBHA 1D0XA 2B7EA 2DMPA 2V1XA 3OXLA 3EUAA 1TXRA 4PPZA 2GKRI 1XG1A 5CCLA 3D7FA 4B11A 3JTKA 2DJNA 4LQ6A 2B3UA 3LWUA 4XOTA 4HPSA 2J8RA 2OZUA 3BCBA 3LSJA 4BS9A 3FXOA 4ZZDA 3GTOJ 2VI7A 2LF7A 2WAQN 4HW0A 4YELA 4LLLA 4KFCA 1IOIA 2RVCA 1T33A 5K5RA 2B58A 3WGHA 2LD5A 4R7MA 5TISC 4B48A 4CICA 1WFXA 4HX8A 1LE8B 1T56A 2CNTA 4B8XA 1B8IA 3R61A 3BR2A 2FOKA 4XPKA 4BE2A 2CUFA 1Z5RA 1ORKA 3OWCA 1ETWA 2K27A 2QVOA 3OR1C 1GDTA 2J9AA 1FZPB 4OIOF 3K4NA 4A2UA 1UHAA 2LYCA 1EH6A 1T98A 3QYBA 1YRNA 5LYDA 3I64A 1VI0A 4CS0B 3MVPA 3GFLA 2WWYA 4RS8A 1U3EM 1WTJA 2XAGA 5B5EC 3GY9A 1E3PA 4AYBN 5G21A 1B4AA 2F4OB 2KRFA 4CO8A 1EE3P 4ZTJA 4XONA 2K02A 3FC3A 3CCJI 3H0DA 1LFUP 4R79A 2P6AC 1J0RA 3OS2A 3FB3A 4B5PA 2ZEEA 4F8ZA 1KQ9A 5ISVA 3B3CA 4UUSB 4CAEA 2CV1A 1ZLJA 1IRFA 2JDDA 1UB9A 3F23A 4UBRA 1VQKI 7CPAA 4D5CA 1MJ9A 2DFEA 1BC7C 2EK8A 1QZZA 4HAMA 3ZMUA 4W9YA 3PIOF 2V53A 2ARPF 4Y49C 4B14A 2ZPAA 2X52A 2JPCA 3MN8A 4ASNA 2Q43A 3JREA 1S7FA 2Y2ZA 5HVFA 2ZXWH 4R1HA 5LEKA 4F3QA 1ZGJA 3B2YA 2JBJA 4KUMA 2XHKA 1UUCA 3FXTA 3GYAA 4IPAA 2PBIA 4QC6A 1MMSA 3E7LA 2F6CA 1TBOA 2IMOA 2BY0A 1R5HA 2ZCWA 3S1RJ 5F0CA 1N71A 4EJOA 1XMTA 2PJCA 4CGLA 4HGUA 3SYTA 3HL2A 2FA5A 2DCEA 4F52A 1AU7A 3ZRGA 3D7GA 3QU6A 3F5BA 3DFGA 3QPTA 1HEVA 4NJQA 3RI4A 4Y49B 3QP5A 2WVJA 4HLXA 3J7ZI 2YS9A 2LR8A 1FY7A 1WHUA 1LR8A 3CLQA 4DW6A 3S9NA 4I98B 1NUBA 1UFHA 3PFYA 4M3SA 2CSOA 4CYCA 2CFXA 3ZMVA 4EJVA 2PJ6A 2XAFA 1DU0A 2X6XA 3SI1A 1Y1WJ 5D4SA 4U7BA 3R5BA 1XBTA 4I09A 2IEKA 1NHAA 2RQPA 3HTSB 2IGNA 2M7BA 4QTRA 2PRBA 5DEQA 1K79A 3HKZA 1UHSA 2VQCA 2VXZA 4ZY1A 1PVEA 3M8JA 1CM0A 2BVMA 1U9NA 3BTIA 2XV4S 5KAFC 3DCFA 2PJPA 3H9GA 1M8CA 1RC9A 3D5LA 3D8PA 4CYOA 1G59A 2L7FP 3CXQA 2WV1A 4KITB 4OIRF 1LANA 2YSRA 4UNOA 3PRTA 1WKMA 5AIQA 1TURA 2L9SA 1VNDA 1PUFB 2XAJA 2PJRB 3SDGA 3E97A 2EV0A 1QSTA 4F55A 3R5AA 2R7DA 3CUQA 5M5XJ 2JMWA 3LFKA 1XJOA 4K3NA 4B6ZA 5FFXA 3BG9A 2Q1ZB 3F8MA 3TP3A 2E1MB 1A35A 3G73A 2P7VB 4PV6A 1SGDI 1K7TA 3DBLB 2K9NA 1VQ7I 2Y0MA 4B47A 1IN5A 2XEFA 1ZN2A 2EZKA 1FAQA 1YVKA 1W1WE 2O9LA 2OZGA 2OQGA 3OYKA 1F43A 1WWZA 2HZDA 3D2PA 2FT0A 3KHXA 4D1QA 1BJAA 3L1PA 3HOTA 4B4CA 2CFOA 1CP6A 5E1XA 2JA2A 3HZJA 5C4XJ 1PCEA 4H6ZA 4PXDA 1E0EA 1YW4A 3ERMA 2FXFA 2AQEA 3A02A 2Q4VA 4HNWB 2BOLA 2YU3A 4XLPF 1TT5B 5FKNA 2HS5A 4IQ4A 2VOPA 3PUBA 2BBYA 4IKFA 3DR8A 3HXLA 4Z6YA 4HNYB 1RETA 3UNGC 3IIBA 4MQ9F 3LA2A 2ZEMA 4FCYA 2ATRA 4NHJA 1OISA 1ELLP 2VUMJ 3H8GA 1D0YA 2OU2A 3I4PA 3AFHA 1RZ4A 3P9KA 4XSZF 5BMZA 1BAVA 1ELMP 4JX6A 2GLOA 1UZCA 3BOQA 1MBGA 4ON0A 2G7HA 1WGXA 1W7PD 3R60A 1RTQA 5LEJA 3PQJA 3AKZA 2QQ0A 4PK2A 2VIXA 3HLPA 3FM3A 3ABKH 3GX4X 3HUVA 2YU9J 3SHPA 4MY0A 2VPRA 3PFEA 2HTJA 1PTQA 3OYDA 1X1CA 3WU0A 5FVJA 1BIAA 3E1SA 1BJZA 1KA8A 3M1EA 3S32A 1UHWA 3JAMZ 1X3ZB 2DOFA 2QF7A 5HVGA 2WAQA 2EFNA 3L2UA 3J81K 4R9MA 1W0TA 4J19A 5KTDA 1LJ9A 1M1DA 1M1EB 3EXNA 3RYOA 2ZSIB 4MCSA 3BWGA 1MD0A 4RAFA 4A3JJ 1TLHB 5D8NA 1QVUA 3JSOA 1VZ0A 3DWLE 2HKXA 3UEJA 1S72I 3CLOA 1VQ5I 5IP9J 1VDDA 2GLFA 4GXOA 1S5KA 2VBQA 1IZ1A 2GLJA 1ON2A 5DCFA 4CCMA 2M34A 4B1RA 4MEXF 3NWSA 2K5TA 2DF5A 2DT7B 4WP4A 3DGVA 2DA7A 5C4JJ 2QCOA 4H89A 3TBIA 2HQ5A 2KMUA 4AYBA 2DODA 2J5PA 4ZYDA 2IL4A 1A36A 3FBUA 1SFOJ 4LG0B 1BA5A 3HIFA 5EGOA 1S20A 1YJNI 2A5WA 4UA3A 3L09A 4M3BA 2VASA 3C18A 4MI4A 1PJRA 2L02A 2M9HA 2W82A 3O8GA 3CDHA 2OCEA 1A6IA 1TZLA 2LH9A 2Y0SA 4U0VA 4TWEA 4CAXA 3D3SA 4LOCA 4XRMA 3KLNA 3R0AA 2AQFA 5ILSA 2VC0A 1TUSA 1YMEA 2R5ZB 3RZDJ 4FWUA 3O2PE 2TDXA 1YOVB 1X74A 1P9ZA 3JRAA 1Y1VJ 2AE6A 2L8EA 3L7WA 4UFXA 2WTEA 2Q0OA 4G9YA 4IHXA 4IX7A 3S15J 1HF0A 3UOEA 1QZYA 2DQRA 4O5VA 4E7KA 1ETOA 4KOYA 4OC5A 4UUTA 2RDPA 3DP7A 1ETYA 1OCZH 2Y30A 4GRIA 5EEHA 5EF6A 3RKQA 1K7UA 3R9EA 3GUDA 5DWNA 5E1WA 1AA7A 4K30A 1RO5A 3LD2A 1R79A
chains in the Genus database with same CATH topology
4R8HA 1BI0A 3KZZA 2FMYA 3H3UA 4AVCA 5K5QA 1ZG3A 3I54A 4B12A 2ESNA 4XNHC 2L4MA 2QZ8A 3REOA 3V7CA 4G7HF 4EM0B 4S05A 4ESJA 3BJ7A 2D4OA 3ZMTA 1U78A 3EUHA 4MFQA 1YS6A 1ZAOA 2V6CA 1R22A 4LB6B 3V8LA 2JZYA 2PQ8A 2PC1A 3JSPA 4C2XA 3OV8A 4KMUX 5F6FA 4IRGA 3TO7A 3KP5A 5F46A 4M73A 2HR3A 2HTSA 2M45A 4KIGA 2OBPA 3DXJF 3GEZA 4A12A 4NEXA 1XGMA 3WG9A 3DPTA 2ZKZA 1GXQA 1WI9A 4U0WA 2IA1A 1OKRA 1KU3A 4ZYHA 1FBSA 3SQNA 1STZA 4HDVA 1J5YA 2DO7A 4A0YA 4A33A 2FE3A 2IW5A 4HLYA 2BYVE 1ZREA 2M30A 2H6BA 1BC8C 4L9VA 1HSJA 2R8VA 1S7KA 4RB2C 3FF5A 1O3TA 3ZQ7A 1TBXA 2EJRA 3TDUC 4U5YA 2FBIA 1ON0A 4AVPA 2O8XA 4ETSA 3K1PA 4HV5A 2UXXA 2Z3KA 3LSTA 3GWZA 4ENMA 4Q38A 2RN7A 3GXOA 1R58A 4O6JA 2NS0A 1SFUA 3A9LA 3WTYC 1T39A 1VKCA 4L0ZB 4F7ZA 3ZJ0A 1OPCA 1DPUA 4HOBA 3K9UA 2FQ3A 4A5MA 5G20A 1QO0D 2VE8A 4QWQA 2DK5A 3F21A 4B5PB 4A2ZA 3U2RA 5HS8A 4H6UA 5IB0A 5L3DA 1L0OC 4UVAA 5F47A 2EV6A 5DDGA 4XPLA 2EVNA 2ZFWA 1S7OA 5IT9Z 5EBVA 2YNEA 4CGPA 2PDOA 5JFRA 4IRHA 5E1ZB 4BQAA 3Q9VA 2YGWA 3RYPA 3GVAA 4EM1A 2ZJ2A 3IHUA 4CAWA 4IVNA 2GE3A 3WTZA 4B10A 5F64A 4JLYA 3K0LA 4UUVA 3QPHA 1H0MA 3WTVC 1YLFA 2VN2A 2V79A 4RB0A 4P9UA 1ZRFA 4X5KA 2DAOA 1DPRA 3VODA 4M6XA 2P4WA 3TT2A 2QMLA 2Z3LA 4YFJA 4YFKF 2VQYA 1B6AA 3ERED 5DD8A 4UVBA 1LDJA 3W6JB 1REPC 2KCWA 2JTVA 2ISZA 1B87A 3CUQB 5JVTA 2ADUA 4PGGA 1T38A 4JD6A 4OLLA 3LQRA 4CZZA 2JRTA 1FLIA 4UV9A 4KDPA 1BI3A 1L3LA 2ZW7A 2WUUA 4R3LA 5HLIA 4U9ZA 3RJPA 4KIBA