1MJBA

Crystal structure of yeast esa1 histone acetyltransferase e338q mutant complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Esa1 protein
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjbA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjbA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjbA02
1FYMA 4YGOA 3RIRA 2HQRA 2XAGA 3IWZA 4WX9A 3RPQA 4HZFA 2M5WA 4I2OA 4U0YA 2ZW5A 4NQWA 1XGOA 2ZNYA 3B02A 1J75A 3FMQA 4EM1A 2F5CA 4OINF 3GX4X 1YREA 2DW4A 1IXCA 5DCMA 4IRHA 2A6EF 1WWXA 2GA1A 3V8JA 3NEUA 4I7HA 2FBHA 3HSFA 3ERED 2OD5A 2D1VA 4HF2A 2REEA 4RI1A 1P4AA 3ZP5A 1G3TA 1S8NA 2OQRA 2REFA 1U2WA 5CLSA 3E97A 1S3ZA 3FX3A 4U9YA 5H86A 1BI0A 3JSOA 1O57A 4HDVA 2FU4A 2PQ8A 5E1XA 3N7ZA 2HUZA 3P2HA 3ML6A 4HX8A 5KVRA 4QBJA 1JHFA 1SFEA 3V7SA 4YRHA 4WXHA 1T0FA 3LQQA 5F6FA 4WCGA 1TW2A 4K2EA 3C3WA 3G8WA 3HTUA 3I59A 1R00A 1RNLA 2H09A 2OU2A 3QPTA 3F0AA 1Y0UA 2D4OA 4IJAA 3HRSA 4ZZDA 3FXRA 1GXQA 2FE3A 3N4MA 3O3KA 1T39A 1REPC 2IA1A 1QGPA 3F8CA 3Q5FA 3I4PA 1R57A 1B9NA 4I01A 1SMYF 4BHBA 2BEIA 5D6FA 4EV0A 2FS5A 1HKSA 1P4XA 3HOTA 1LVAA 1O3RA 3K2ZA 1E2XA 4XNHC 4XBFA 2CSOA 4G9YA 4MEXF 5F46A 4I0BA 5JQ4A 1HBXG 1TLHB 5HS8A 3DR8A 5LEKA 2MBFA 4FHTA 3LA7A 1HSJA 3KETA 2ZW6A 3VWDA 1BC8C 1IN6A 1CF7A 3DQVC 1OKRA 1ZGAA 4P9UA 3BOQA 1M4DA 2I00A 4N0BA 1RUNA 2ACJA 1BBYA 1U78A 2P6SA 4KUMA 3RKYA 2F2EA 2KRFA 2HDCA 2QBYB 4E2AA 5LHIA 1U5TB 4FX4A 3ZMUA 2B3UA 2O28A 4AD9A 3AAFA 4G7ZF 1FBSA 2M1BA 3C7JA 1LDDA 4KMFA 4HLXA 1AOYA 4UWIA 2FXAA 2BV6A 3S6GA 4XSZF 2ESNA 3JSPA 4I98B 2ZJ2A 5LRSA 1EH7A 4RGRA 3F8BA 4IXAA 3RYOA 5E8GA 3W6XA 2HEOA 2CW0F 1B6AA 4RB2C 5BMZA 2HTJA 1SD4A 1XCVA 5J8FA 3LD2A 1LRZA 1Z4RA 2OB0A 5BS6A 1S6LA 1R7JA 3WU1B 1YX0A 4CO8A 3E5UA 2J5PA 1QSTA 1HQCA 3QB8A 2DAOA 2A68F 1UB9A 3ZQ7A 5ERIA 2AJ6A 2W85A 3IL2A 4H0EA 4PK2A 4F7ZA 4GXOA 1OZPA 4UWJA 1LEBA 1I6XA 4Q5SF 1ON1A 3IRQA 3KZZA 4UXNA 4P9FA 1IIDA 1D3YA 1W5TA 2K7LA 1RI7A 5CJ9A 3GO5A 1I1DA 1LEAA 3GVAA 2XGXA 4R57A 3R0JA 1FOKA 3V4GA 2HWVA 3ISPA 1B9MA 3T0YA 2B0LA 3L09A 1IRGA 3KKWA 4AIJA 4JXQA 1P6RA 4M72A 5K5RA 1SMTA 5ED4A 2WC2A 4UVCA 2WV0A 1U6GA 1CJWA 3G3ZA 3F8NA 2V9VA 2V1XA 3IKVA 4RS2A 1ZRFA 2LDUA 5DD8A 4R87A 3I71A 2KIMA 3FBUA 3VOEA 1WSUA 1FBQA 3U2RA 5ICGA 2HKXA 4RB1A 4KOUA 3COAC 4L8AA 3REOA 3T1BA 3W6KB 2BUEA 3ECHA 3DKWA 4CYDA 2VZZA 2A69F 2ATRA 1M4GA 4Q4ZF 1YIOA 2EJRA 2XHKA 4LG0A 3ZN1A 1S7AA 2P0WA 2DI3A 1K6OA 1FY7A 1NMTA 2AE6A 3LA2A 4BNCA 5ICEA 3GFIA 1IW7F 2DO7A 5F1RA 1MJBA 4KVXA 4Y13A 4I0AA 2Q4VA 4DNCA 3ZZIA 4EGYA 3F23A 3PFIA 4O3MA 4NXYA 4UUVA 2EFQA 4MJ8A 2RQPA 1LQ1A 3KP4A 4FD5A 4RGXA 1HW1A 3FMRA 2E7WA 2XAQA 3FF5A 1R58A 1S60A 5HS9A 1UFMA 4MHGA 4ETSA 2NYXA 5IB0A 1BOAA 2QVOA 2CY2A 3GFLA 1DP7P 1XMKA 1O3QA 4CRYB 4MY0A 2BE5F 5KTAA 3HSRA 4LK0F 1QO0D 2DPUA 5F64A 4M3SA 2OBPA 2PFBA 2JEVA 4B5PA 4I09A 1W7PA 1TQPA 3D5LA 3R95A 4B5OA 1MKMA 4R79A 4U0VA 4LD5A 4ZYDA 3P9KA 1ONVA 2VODA 3J7AO 1J5YA 4RS8A 3FRMA 1ZRDA 2P5LC 2BSWA 2Q8KA 4YFKF 4NEXA 3ROUA 1P0HA 2HYFA 3KE2A 3CXQA 2QLZA 2JLMA 2L02A 5E8IA 1LJ9A 3RI4A 1I1SA 2CNTA 1Y9WA 4HA8A 3F22A 2AS5F 1JXSA 3ECOA 1TNSA 4LJZF 5JHUA 3C18A 1LB2A 3ZMVA 1NSLA 3RDIA 4LLLA 4A6DA 4BAYA 1P2FA 4AVBA 4H6ZA 3EDPA 4Q48A 5LBQA 2K27A 4LK1F 1I21A 1ZG3A 2STWA 4NHJA 1KYZA 2EV0A 4AG7A 1WKMA 3KLNA 1FYLA 3Q9VA 2QENA 3GEZA 3EO4A 4RAYA 2XKOA 4G8XA 1S5KA 2PJPA 3P7NA 1Z05A 4QWQA 1IXRC 4GS4A 1PU9A 2HOEA 4M9SA 2NNNA 2YX4A 4ZZLA 3M8FA 5HS7A 1A04A 2KJCA 3W91A 3R96A 2VOPA 1XIXA 4A0XA 4KLVA 1J0RA 1USSA 5FD5A 2JTVA 5FGMA 4KYWA 3I5UA 5E1WA 2VE8A 3EXNA 5IT3A 2FMLA 4U0WA 3RKXA 4G7OF 4BHPA 1KA8A 3R0AA 2GZWA 3F8KA 4L0ZB 2QQAA 3BLNA 3DPTA 4MY3A 3F5BA 1KU3A 3WODF 3LA3A 3BJ6A 2VXZA 2P8TA 5EBVA 4XPKA 2XKPA 4MI4A 3S6HA 2PMHA 1KUXA 2Z0ZA 5E96A 2KIFA 1IAWA 1WQ2A 4OIOF 1D8JA 2NMTA 3K0LA 4II9A 3B73A 2O8XA 5ISVA 1KQ9A 2W24A 2GXGA 1HKTA 4YIIA 5AONA 4EVIA 2E1CA 3RTRA 4L0YB 1YLFA 3LODA 4CICA 2RDPA 4UVAA 1YS7A 1QSMA 2XAFA 3WGHA 2MC3A 4CDGA 2DQLA 5CVIA 4QVTA 1RO5A 3NE7A 1YG2A 1UFHA 1O7FA 2ETHA 4RB3C 4EMSA 2D45A 4KNYA 4OMYA 1F9NA 4CZZA 5DCMB 4B09A 1YR0A 2P6GA 3I58A 2FBIA 1F5TA 1SQHA 1EH8A 1O7LA 2ZW4A 3BPVA 4DQ2A 1GXPA 4HLYA 5DV5A 3F21A 3PGPA 2X7BA 4K30A 3J81K 2VBYA 2WPXA 1IF1A 5HDGA 1R5HA 3L7WA 3MEXA 2IA2A 4MQ9F 2P7VB 5BOXA 2M8EA 4GYGA 2KCWA 4O5VA 3DEUA 2H5MA 4L9JA 4LB6B 1OYYA 3SXOA 2HQNA 4I02A 4JLYA 4Q47A 1FP1D 3MCZA 4KMUX 3OV8A 1RZ4A 1J59A 1Y9KA 3R9FA 3MGDA 2FSWA 4KOYA 3HSEA 2C6YA 2O3FA 4OAEA 1M4IA 1VTNC 5HMNA 1L3LA 1FC3A 4L89A 2GANA 2R98A 2ADUA 2VBXA 4R9MA 1MGTA 3TO7A 1BC7C 5FVJA 4L5JA 5K5OA 3L9FA 3FM3A 3FXUA 2PG4A 3TQNA 4OIRF 3ZN0A 1WRJA 3UY5A 4A2UA 2H27A 4IHSA 4P5OA 2EFOA 2QQ9A 4HX4A 4AVCA 3GWZA 4HQMA 3QP5A 4IHTA 4XRFA 1W7PB 4L18B 4Y49B 1SD6A 2FIAA 4CRZB 2A3SA 5K1YA 1T2KA 2Q4YA 3KEOA 4M9XA 3R4KA 2GAUA 3PQKA 4AIHA 3CUQB 1W5SA 5AIPA 2OQGA 3ZMDA 4CXFA 2BBYA 1QQIA 4ESJA 3HRMA 1R1VA 5C82A 2VI7A 2DT5A 2MH2A 1B4AA 2YSRA 3WTZA 2QMLA 5DYMA 1PP8F 4ONUA 5F48A 1IZ1A 4U5YA 4M85A 3HTSB 2FMYA 2FE7A 1I12A 2ZFWA 3LFKA 3HHGA 4ASNA 2FNAA 3BJ8A 5A2QZ 2ARHA 3D2PA 2IP2A 2QECA 3I53A 1F1ZA 1YS6A 1XDUA 4MTDA 2R3SA 5D5XB 4KOSA 2DU9A 4G94A 2MLGA 3KZYA 3F8FA 3BJAA 1Z9CA 1N71A 1K4JA 4KUAA 3IHUA 5LEJA 5IV0A 2XV4S 2OZHA 3VODA 4KT5C 1B1BA 4LLNA 5AIQA 5KK1A 1YQAA 1F4KA 1ON0A 3TGNA 3P9IA 2CG4A 2IPQX 3CTAA 2Z10A 2JRTA 1WI9A 4U88A 4FD7A 3BZ6A 3EETA 3MZYA 1IYKA 1Z6RA 3J81Z 5GCNA 1QSOA 2Z99A 5DD4A 1G3SA 1MK4A 1S7NA 1LDKB 5IT9K 3HOSA 3P9CA 2FQ3A 4M74A 4Y49C 2VOOA 3CXSA 3MZHA 3LAPA 4JK1X 4ZH4F 1BM9A 1U5TC 5IX3A 2ELHA 2YX7A 5LHHA 4P96A 3PQJA 2OZUA 2MLKA 1QSNA 2E1NA 5K5QA 2DXQA 4MTEA 1J7KA 3HRUA 4PGGA 1B6BA 4EJVA 1Z91A 4OMZA 2A4NA 3JUWA 2D4PA 1FZPB 3WTWC 5JVTA 2YPRA 2GE3A 1P4WA 4KZTA 1XGSA 3FIXA 4KIBA 3ZJ0A 4LMYA 3TKYA 4XLPF 2PDOA 4G7HF 3MAJA 4L5IA 4XPLA 1JGSA 1PUEE 2H94A 2MH9A 1R1TA 1Z7UA 4ENKA 1SFUA 4Y15A 2GWRA 3SHFA 2LNBA 1IN5A 1HW2A 2M45A 2K86A 4R8HA 1FNNA 4ESFA 5HLHA 2KKOA 3EQLF 2FT0A 2DLLA 4FT8A 4HF1A 1O3TA 2QUFA 2RV8A 1ZG5A 2A5YB 4EJOA 1R22A 4AWXB 3ABTA 1NHAA 3DF8A 4PK3A 5D4SA 1W7PD 3D0SA 1XMTA 3GW2A 1GHCA 1YFHA 1ODDA 1HXDA 4A0YA 3R6SA 1JE8A 3Q9SA 3W6SA 3TOBA 2HS5A 4B5PB 2FOKA 2ZBKA 1O3SA 1QZZA 3VB2A 2VZYA 1IRFA 4IPAA 1YTYA 1RUOA 2ESHA 3WE2A 1MD0A 2RN7A 2RNJA 3DXJF 2FBKA 3KEQA 4N9IA 4WXCA 3GF2A 2EA2A 1I5ZA 3C1DA 2F5FA 3V8IA 3WU0A 2FIWA 3KFWX 5E18F 5JI6A 4AIKA 1DPRA 2CWEA 2ZO4A 1BIBA 5TJJA 1KZFA 2BGCA 5HVQC 1BI3A 2P7CB 3PP9A 1ULYA 2M87A 1R36A 2A6HF 4JXRA 2FCKA 2Z5UA 1R23A 3TOAA 2F5DA 4N9HA 1OR7A 3SQNA 2ZNZA 5E20A 2KIUA 1ZLJA 3DNSA 1D8KA 3KLOA 2FXFA 3JVNA 4ZYEA 1U6MA 2HQYA 2Q7BA 3T8TA 4KA4A 2VT3A 3CO7C 1BIAA 3QU3A 3R9GA 4HNXB 1ON2A 4CAWA 3C26A 3FHZA 4KORA 1XGMA 5CVVA 5E17F 1Q2CA 1WWZA 3MFKA 4KFCA 2BL1A 3T5XA 3ZMTA 2G7HA 4PV6A 4KVOE 1XB4A 3OWCA 5KTCA 3H3UA 4NF1A 2LF8A 1OMIA 2FRHA 2H6BA 4ZYHA 3M7GA 4MHDA 4O6JA 3GXOA 1HSTA 2IRFG 2XUBA 4P55A 5JR3A 4HOBA 5H20A 2FEZA 4L9TA 4HQEA 3E6BA 1Z4EA 2J8NA 4UA3A 2K4BA 2VQYA 1FPQA 2Y75A 1U8RA 1FWZA 4JD6A 1YW9A 1TW3A 4M71A 4LLGF 5FLXK 2Z9OA 3CUOA 4R3LA 3E6MA 4FX0A 1MZBA 1V4RA 5JPHA 3FXQA 4HKFA 1OYIA 3RYPA 2FF4A 4E8OA 1GVJA 2JZYA 1UCRA 1H9TA 4XNHB 4MBUA 5L3DA 1KUYA 1S7LA 3LSTA 4CGZA 1ZHFA 2BYVE 3EYIA 4GCVA 2EVNA 3FNCA 4KIGA 1IN7A 4WF2A 1ZLKA 2PN6A 2FNPA 2L4AA 3R60A 3D3SA 3TT2A 5FB2A 3V7CA 2ISYA 4S04A 4R3KA 1DPUA 1S29A 2GIVA 4MNUA 1OYWA 3MWMA 4GGGA 2WWYA 4NCZA 1ZREA 1TQIA 4TV7A 1G4DA 3LQRA 2J5OA 4WWCA 5A2QK 3G73A 1MJ9A 3W6JB 1SD7A 4A0ZA 1G3WA 2LSOA 2W57A 1LNWA 2EWNA 5ICFA 3I3GA 3QU6A 2PR1A 4XPDB 4YIFA 3IWGA 2K4JA 4QB9A 4XSXF 2BEOA 3QPHA 1WK4A 4L9VA 2V1UA 5H6RA 2I79A 2OZGA 2H6CA 5L3CA 2RVCA 4BMHA 3KP7A 2QZ8A 2EV5A 2NNYA 4PZJA 5F49A 3TFYA 5D5WB 1YO5C 4EQQA 4ZYGA 4CHUA 4ZBGA 3V7RA 4UVBA 1P4NA 2JDCA 1RXTA 3B8GA 4HV5A 1VHSA 3FB3A 5L3FA 3I64A 2VXKA 1IICA 2PR8A 4KOXA 2VN2A 2VBWA 1BI1A 3JTHA 5DUKA 4JWPA 1CM0A 3QAHA 4A12A 3TTHA 2O6GE 1U5TA 3FYNA 1NE9A 5C88A 1CGPA 2ISZA 5HOOA 4X5KA 2A07F 4EM2A 1PUAA 3WGGA 4CS0B 3SXNA 4M6XA 3FWEA 3IRRA 3BROA 4LFUA 1H0MA 3DV8A 4UHTA 1BI2A 2A61A 4G6DA 2Y48A 2STTA 3BY6A 3F3XA 3OOPA 1TBXA 3GYAA 4MQVA 4M6YA 4HF0A 3I54A 3DR6A 3GKRA 1QSRA 1Q2DA 2PRBA 1U3EM 2CNMA 1E17A 5LGUA 1UHMA 2R7FA 2K5TA 3IC7A 2CFXA 2R1IA 1FX7A 5HLIA 1S7OA 3DPLC 3T90A 2HKOA 1K78A 4CAVA 4FD6A 1D5VA 2VC1A 2DBBA 3TO6A 3CUQA 2R8VA 2CNSA 4KVME 1TTYA 4AVPA 2FL4A 3KP3A 3RYRA 4KN4X 5J6XA 3L2CA 2UWMA 1KU9A 4ON0A 2P5KA 2JPCA 5EEGA 3I0TA 2OA4A 3O2PE 2HFHA 2L01A 3GZ6A 2WPWA 3K1PA 5BPDA 3DDDA 2D1HA 1FYKA 3I9SA 2XRNA 1KUVA 2YR2A 1L0CA 1UHWA 3D2MA 4ENNA 1BN5A 1V0CA 4KOVA 1ZYRF 2IJLA 1K79A 2IVMA 3H3ZA 4FD4A 2OZ6A 3RKWA 2J8MA 3E6CC 4JBAA 3K9UA 4HNYB 4HYEA 2DTRA 4IF4A 1IB1E 4AVAA 3I59B 5KTDA 5FFXA 2MD5A 2RKHA 2QM3A 3ZPLA 2PBIA 4RB0A 5LRRA 2IA0A 1KU2A 3TDUC 4M9ZA 3BJ7A 1FT9A 3LAJA 2ZKZA 5ILSA 2B4DA 1T98A 3NRVA 4U7DA 5F47A 2XVCA 2PC1A 1SFXA 1T38A 5TRDA 3JAMK 3M8EA 3D8PA 4IF5A 4HX7A 3QOPA 3WR7A 3SHPA 5CVRA 3HYIA 2OH1A 3WTUC 4OIQF 3DSBA 5ICCA 2V6CA 1R1UA 3FMSA 4YFXF 2W84A 2GQQA 3O6BB 4A5NA 4EJUA 2CGPA 5HDNA 1TIQA 4LX9A 3CUQC 5CNPA 3TO9A 3J80K 1B59A 3GZ5A 4GO1A 2VE9A 3ZMZA 4I49A 3ZMSA 5H6QA 4WK8F 2K02A 5EC4A 2XASA 5LLQA 2Y0MA 2ZXJA 4R1HA 2DQRA 3V8LA 3N97A 1MJAA 3LWFA 2EUIA 4M73A 3GFMA 2VBZA 1EH6A 5ILUA 4QC6A 6PAXA 4BQAA 1Q2YA 1FSEA 1KYWA 3S2WA 5JFRA 2ZCWA 3JAMZ 1V3FA 2VONA 2F5EA 2P6TA 1M44A 1YLEA 3GYHX 3F8MA 1TNTA 3WTYC 3VFZA 3WTSC 2JDDA 4JJXA 3WTVC 3P2FA 4Y17A 2QBYA 2LKPA 2X4HA 5I0CA 1USTA 1I1GA 1DUXC 2O0YA 3H4QA 4S05A 1XMAA 2QYOA 4IRIA 4IRGA 2ZPAA 3PZJA 2EA4A 1ZRCA 5D6EA 1M1DA 4ORFA 1G6NA 2YU3A 1B87A 2X0LA 5CVUA 3KP6A 2DK8A 4G6QA 2QWWA 4KOTA 5EEHA 5DWNA 2VT2A 5FFZA 5L3GA 4EGZA 5D8LB 3SZPA 1HKQA 4PSXA 4XLNF 1R5GA 1QBJA 2P4WA 4NB5A 2CYYA 2VEZA 2XAHA 2AXLA 3G3SA 4AB7A 3T8RA 2R7HA 2J8RA 4HV6A 1AWCA 4GYIA 1MDMA 3SZTA 2O61A 1ZH5A 1YVKA 5LHGA 5HLGA 3V8KA 1K7AA 3WE3A 4BHCA 2IW5A 3S6FA 2W25A 4EVYA 3K69A 4UNOA 1KU7A 2TDXA 2COMA 3M9AA 2JPBA 2ZW7A 5L3EA 2JT1A 2Q44A 3EC4A 1IN4A 3GFJA 2B5GB 4LG0B 2Q2EA 2B3VA 2P5VA 3HUGA 1RIOH 2M30A 4RAZA 3E0KA 5BPIA 4OU0A 4EJTA 3RPUA 4RGSA 4RGUA 1XF8A 2EV6A 1ZN2A 3BP8A 2HR3A 2HYGD 3T9YA 1GHEA 2R7DA 2UZKA 3BDDA 4J3GA 3IWFA 3CJNA 4MEYF 2IL4A 3EFAA 2B58A 1EV7A 2DPDA 5H84A 4UBRA 2RC4A 5L3BA 2F5IA 2XIGA 5LGTA 4IUSA 3EUHA 1XN7A 4BH9A 1IUYA 3NQOA 2QIRA 1C0WA 2VC0A 2V1DA 4U9ZA 4U7BA 1QZYA 2O03A 5DWMA 5E1ZB 2B5GA 4UV9A 2HZTA 4LB5A 4EJWA 3F6OA 2NS0A 5FD6A 2P6FA 3MQ0A 4A5MA 4B8XA 2KJBA 2L54A 2WTEA 5DDGA 1IYLA 2CO5A 1VKCA 1PP7U 5DEQA 2EK5A 2Q04A 5HH1A 4YFNF 2GXBA 1YVOA 3JW4A 3FZVA 4OOIA 4KOWA 4UV8A 1YYVA 1H9GA 4BYYA 5ILVA 4H6UA 1MDMB 2HV2A 2XROA 4F0YA 4ENJA 4YFJA 2G3AA 3WTXC 3E3VA 3SFZA 3L00A 1KQ0A 4HAMA 5DUIA 3H92A 4QLCU 4PGHA 1XE4A 2NRAC 4NSQA 2Z3YA 1T6SA 2GA2A 3VWEA 1XSDA 3RJPA 3TCVA 2FA5A 3R61A 4D0PA 5D4RA 3IGRA 2D2WA 5CYVA 3J80Z 3E5QA 2EB7A 2QQBA 3ELKA 3E6DA 1XCBA 5IT9Z 3DFGA 3K1MA 1ZG1A 2P6EA 1YGHA 3GUDA 4JQFA 1SAXA 4E70A 2VBQA 3QP6A 2IT0A 3E5XA 4A6EA 1XDSA 1JHHA 1BJAA 3TDZC 4AG9A 1S7FA 5BQTA 5D5UB 2ZMEB 1PDNC 4Z2YA 2LF7A 3QRFF 1Z6TA 1XEBA 4OADA 1YW7A 2FSRA 4EM0B 3EY5A 1QNTA 2UXNA 3WG9A 1I27A 3JTGA 1S3JA 4PDKA 3CO6C 3WTTC 4YG2F 1BO4A 3GLXA 3WGIA 4IVNA 4PSWA 4E0AA 1OPCA 2G7UA 5DCFA 3CLOA 1ZGJA 2Z33A 3VEPA 1XSXA 3F6VA 1KQ8A 2Z11A 3GY9A 3FM5A 1FSHA 1Z1DA 2PSWA 2L3DA 4MGRA 4ENMA 3U1DA 3TE4A 1IXSB 1TQMA 3BPXA 4OLLA 2EFNA 1IN8A 2MA3A 5CVJA 4WXDA 4HNWB 2DK5A 2UXXA 4HW0A 1KGSA 2E7XA 3M1EA 1YW8A 1Q1HA 5FLXZ 5HDKA 1W4MA 1J4JA 3K9TA 1XSVA 3R1KA 2C27A 3FXTA 3S6KA 2PLYA 1J9IA 4KICA 2HGCA 4XPDC 1X3UA 5D8KB 2RGVA 3HIFA 2G3TA 1XGNA 3ABUA 4H89A 2PI0A 1FP2A 3IKTA 1QPMA 4KLWA 1LDJA 4LGWA 1HW5A 1G3YA 4KIFA 4KN7X 3CXPA 4PCQA 2PMUA 3BJOA 1ZAOA 2V79A 1DDNA 1STZA 2L4MA 3HHHA 1Y7RA 2G9WA 2ZXVA 2B4BA 3F72A 4LUAA 3R9EA 3CDHA 4CAXA 2JSCA 4OIPF 1XD7A 4QUSA 2DFIA 2XAJA 3KP2A 1L0OC 4L9NA 5J8CA 2G0BA 2HTSA 3KP5A 3KCCA 4KDPA 1YK3A 1Z9UA 5FO5A 4ESBA 2EFPA 2ZMEA 2PEXA 4HBLA 1P92A 3K1NA 3DP7A 5D5VB 3BWGA 1FBUA 4BXUA 4F6AA 2CQKA 3HRTA 3EYYA 1BOBA 1K78B 3SXYA 5LGNA 3U9GA 2EFWA 2B4DB 4HDUA 1ZARA 1CF7B 1S7KA 2NAZA 2OAZA 2Q0YA 3ULQB 1SD5A 1FLIA 1J2XA 4KUBA 2Q0OA
chains in the Genus database with same CATH superfamily
1FYMA 4YGOA 1IOIA 4XLHA 2E71A 2HQRA 2XAGA 2I5UA 2M2EA 3IWZA 3RIRA 3RPQA 2KZVA 4WX9A 2GM4A 4HZFA 2CMPA 1DE4C 3UKGA 2M5WA 4I2OA 3CJQB 2A5WA 2VB6A 1TL8A 3ZRGA 2N71A 4U0YA 3LSPA 1AKHA 3I3LA 1WHUA 5F0CA 3CC4I 2ZW5A 4NQWA 3CCRI 1XGOA 4XLCA 2ZNYA 3PDNA 4P4DA 3B02A 1WH5A 1J75A 2BXYA 3PFOA 1TKFA 1IO2A 3FMQA 1NTCA 4EM1A 5J1RA 2A20A 2F5CA 4OINF 4CCOA 3GX4X 1YREA 4XK4A 1U5KA 2DW4A 3FHNA 1IXCA 5DCMA 4IRHA 2A6EF 4QPQA 3M07A 1WWXA 4FQGA 2QKLB 2GA1A 2UV1A 5DTDA 3V8JA 3NEUA 4P4IA 4I7HA 2OF7A 2FBHA 3S15J 4B14A 3CD6I 3HSFA 3L1PA 2QGUA 1TWGJ 3ERED 3FKJA 2LRDA 5GP9A 5LYFA 2OD5A 2D1VA 4HF2A 2R7TA 1YOVB 2LG4A 2ZC2A 2E1MB 4BDZA 2REEA 1Z7LA 4KOXA 1U9OA 2HVRA 1P4AA 4CUGA 1A2ZA 1S5LC 3ZP5A 1VQ8I 1G3TA 1S8NA 2OQRA 1OMUA 3F0CA 3HG9A 1SEUA 2REFA 4MHPA 3RNZA 1TBNA 5EG0A 1U2WA 2FOWA 3E97A 5CLSA 3FX3A 4PJ0C 5KCMA 3OYLA 1S3ZA 4U9YA 1BI0A 3KL9A 5H86A 3JSOA 1MIJA 1X2MA 1CE3A 1O57A 2CUFA 4HDVA 2FU4A 2PQ8A 2LTPA 5E1XA 3N7ZA 2HUZA 3P2HA 3ML6A 2QKMB 4IK2A 2WSAA 4HX8A 5KVRA 4RUHA 2KP6A 4UEEA 1JHFA 4QBJA 1SFEA 3FIWA 3V7SA 4YRHA 3OIOA 1T0FA 4WXHA 3LQQA 5F6FA 1K4TA 4F92B 4WCGA 1TW2A 2Q2EB 2DA5A 3ZQCA 4M3DA 4K2EA 3C3WA 3KQXA 3G8WA 4B6ZA 1XTAA 3HTUA 4CA0A 2ICWG 1KONA 3I59A 2ABZA 1R00A 2GOXB 1RNLA 3TMOA 2V77A 1GYTA 2H09A 2OU2A 3QPTA 3D7FA 3F0AA 4ZTJA 1Y0UA 5D8NA 1ULKA 4IJAA 1UELB 1TWHJ 1ZTRA 2D4OA 1I3AA 3HRSA 4ZZDA 3S9LA 2NS7A 1K7UA 2E2HJ 3FXRA 1TUSA 1GXQA 2XGEA 4F52A 1OCTC 1POGA 2FE3A 2OCCH 2R7VA 3ZQFA 3O3KA 2X48A 3OOUA 3N4MA 1T39A 2HOTA 1X2NA 1REPC 5IP9J 2IA1A 1QGPA 3F8CA 3Q5FA 2F3CI 5CQEA 4MHZA 3I4PA 1Y39A 3FXOA 1X1CA 1R57A 1B9NA 4DZJA 4I01A 4CYNA 5HXDA 1SMYF 4BHBA 1JT0A 2BEIA 5D6FA 4XLFA 4EV0A 2OUMA 3GCMA 5EZHA 3K4CA 2K9SA 5GPAA 2FS5A 4Z65A 1V5EA 1EF4A 1HKSA 4BDYA 1P4XA 3HOTA 1LVAA 2GVIA 1O3RA 3K2ZA 1E2XA 4XNHC 4A3FJ 4XBFA 2CSOA 4PXEA 3GUXA 1HLVA 4G9YA 3J7ZI 4MEXF 5F46A 4I0BA 5JQ4A 2IJZA 3IIBA 4PK4A 1HBXG 1RKTA 1TLHB 3RBUA 5M5WJ 1ZK8A 4M3GA 5HS8A 1ZGWA 3DR8A 2IXSA 5LEKA 3PJRA 2W1OA 2OD1A 1VZ0A 2MBFA 3S93A 4FHTA 1OCPA 1HSJA 3LA7A 3KETA 4LG3A 2B5GB 2ZW6A 3VWDA 1BC8C 1XS9A 1MMDA 4OVOA 1IN6A 1CF7A 2UVOA 1BR4A 2X52A 3DBHB 3DQVC 2KMUA 2ZJRF 2R92J 1OKRA 1XFOA 4I99C 3Q0WA 1ZGAA 4P9UA 3BOQA 4B47A 1WGCA 4N0BA 1RUNA 5F27A 2ODDA 5EX3A 3WABA 2ACJA 1BBYA 1U78A 2CQXA 2AFUA 2H1LA 1MSFC 1ORKA 2MFZA 2DFFA 2P6SA 4KUMA 2BW3B 3RKYA 3LSKA 2DA6A 1VQ9I 1IOFA 2V1CC 2F2EA 2KRFA 4RBOA 1W36C 5J47A 2HDCA 2QBYB 3OYHA 4E2AA 5LHIA 2I3CA 1U5TB 4FX4A 3ZMUA 2EZKA 2BOAA 2B3UA 1PJRA 2O28A 2VKHA 4AD9A 3AAFA 1OMTA 1H88C 2AFMA 4G7ZF 4BD9A 1FBSA 4XN3A 4OIWA 2M1BA 3C7JA 2NVTJ 1LDDA 4KMFA 4HLXA 1S7EA 2QEXI 1AOYA 3W6VA 2XGDA 3L2NA 4UWIA 1VF9A 2FXAA 5HNFA 1SFKA 1XMXA 2BV6A 1XX6A 4X6AJ 2YNEA 4XSZF 4LIVA 4NGSA 3S6GA 2JA2A 2ESNA 1B8IB 2DODA 4I98B 3JSPA 4F91B 1AU7A 5LRJA 2ZJ2A 5LRSA 2EK8A 1SGEI 3C2HA 1EH7A 4RGRA 3C2BA 2LY2A 3BG3A 2WY7Q 4FETA 3F8BA 4IXAA 3IAS2 2QSHX 3ZCOA 4PXDA 4YELA 1PPFI 5E8GA 3RYOA 3W6XA 1EA3A 1VQNI 2HEOA 2CW0F 2Z3LA 1B6AA 4RB2C 3IU2A 5BMZA 4L5EA 3HKZA 4FE4A 2HTJA 1XC5A 1SD4A 2HXOA 1DGWY 4XKWA 5FUXA 3SDGA 1XCVA 5J8FA 3LD2A 3TEDA 2DJIA 1FOXA 1LRZA 1Z4RA 4YEJA 5BS6A 2OB0A 2ERWA 1S6LA 1R7JA 4BJ5C 4JZ0A 1OLTA 2OTJI 3WU1B 1E3HA 1YX0A 4CO8A 3E5UA 2J5PA 1QSTA 1HQCA 1K7VA 3QB8A 3LWUA 1MBJA 2VJJA 1TZLA 2DAOA 2A68F 3WU2C 5FLMJ 2CWGA 2DOEA 1AMPA 4F93B 1TIHA 3ZQQA 4PJJA 1UB9A 3ZQ7A 3B3TA 2XPVA 4R8FA 3DEWA 5ERIA 2W85A 4D7MA 3IL2A 2AJ6A 1S20A 4HG2A 1LUJB 4H0EA 1WJDA 4PK2A 5IB9A 4F7ZA 2KL4A 4GXOA 3AL0C 1H8LA 1OZPA 4UWJA 3CCUI 1LEBA 1I6XA 4Q5SF 2DYSH 1ON1A 1ETWA 3IRQA 2J9AA 4BXFA 5AG4A 3KZZA 4UXNA 4P9FA 1IIDA 1S9HA 4OC1A 4P10A 1YSJA 3JREA 1D3YA 1W5TA 2K7LA 3M8JA 3KZWA 3IUOA 1RI7A 5CJ9A 2E5RA 4XKBA 3GO5A 2R7WA 1UVGA 1LEAA 1I1DA 2DT6A 1K7TA 3GVAA 2XGXA 4R57A 3R0JA 1FOKA 4IHXA 1HJAI 4Y52J 3V4GA 3IEHA 2HWVA 3ISPA 4C2XA 5A27A 1GV2A 2BHYA 2KPMA 4EMEA 1B9MA 1A6IA 3BG7A 3T8WA 3T0YA 1XJOA 2Q43A 1MMNA 4B48A 1QMUA 5HODA 2B0LA 3ABMH 5DS0A 3L09A 2VIXA 1IRGA 1QHGA 4AIJA 3KKWA 4JXQA 3PL8A 1P6RA 2LEOA 4M72A 1HDQA 5K5RA 5I4MA 1SMTA 5ED4A 2WC2A 2CV2A 4UVCA 1JKRC 4KJZA 2WV0A 1U6GA 3HOZJ 1CJWA 3G3ZA 3F8NA 4G6TB 2V9VA 2V1XA 3IKVA 4RS2A 1ZRFA 2LDUA 5DD8A 3BJIA 3K2KA 3UEYA 4R87A 3I71A 2KIMA 1GDTA 3FBUA 3VOEA 1SGRI 1WSUA 1FBQA 1X3ZB 3U2RA 2MD0A 2CU7A 5GAGJ 5ICGA 2HKXA 5IY5H 1OQYA 4RB1A 3COAC 4BE0A 3TP0A 3REOA 1SC7A 1B72B 3A03A 3T1BA 2ZEOA 3W6KB 2BUEA 3W2AA 3ECHA 3DKWA 3FXJA 3ABLH 1ZKGA 5F04A 1W5CC 4KSFA 4CCLA 3P5JA 4CYDA 2V1NA 3IU1A 3CXLA 4D5FA 4NJRA 2VZZA 1ZG7A 2A69F 2ATRA 5K8MA 1M4GA 2JMWA 4Q4ZF 1ZG9A 2ZEEA 1YIOA 2EJRA 2XHKA 4LG0A 4CPAA 3ZN1A 3FSXA 5FKKA 1S7AA 1MMSA 4MFKA 3LFUA 2HB6A 2P0WA 1ZG8A 2DI3A 3ZQHA 1BMOA 5EGOB 1K6OA 1BPNA 1FY7A 1TF8A 1NMTA 2AE6A 3Q0UA 2ZJQF 1ENHA 3LA2A 2HPMA 2Y31A 4IX7A 2JVGA 5ICEA 4NUBA 3GFIA 4BNCA 1IW7F 2DO7A 4FISA 4CRZB 4MRIA 5F1RA 1MJBA 4KVXA 4Y13A 1E3OC 2PRQA 2Y0SN 3L2UA 4I0AA 2Q4VA 3PEIA 3CT9A 4DNCA 3ZZIA 4EGYA 2ZEMA 3F23A 3PFIA 4O3MA 5F1JA 4L9MA 3S9MA 4LITA 4UUVA 2ORWA 4NXYA 2EFQA 1FNOA 1VNDA 4MJ8A 4P45A 1BJZA 2LBFA 2ODFA 2Z2SB 2WAQA 2RQPA 3AKZA 4BACA 1LQ1A 3N5FA 3HOWJ 3IH4A 2WADA 3KP4A 4U87A 4FD5A 4X3RA 4RGXA 1HW1A 3FMRA 3O8GA 3A9LA 2E7WA 2XAQA 2CV1A 2E1MC 2V6EA 3FF5A 3L2WA 4E6KG 1V54H 2DJNA 2ME6A 2NU0I 5DM7F 1R58A 1S60A 3GLJA 5HS9A 1UFMA 2I10A 4MHGA 2DOFA 3MZ8A 1R5ID 2EK9A 4NGTA 4ETSA 2NYXA 5IB0A 1BOAA 2PJ6A 2QVOA 4EATA 2CY2A 3PBEA 3GFLA 1OR7C 1S72I 1DS2I 1DP7P 2JA7J 1XMKA 2HU9A 1O3QA 2W0TA 4CRYB 2J9RA 3D66A 2X6XA 4MY0A 5E3QA 4EEFG 2BE5F 2XF6A 2JYYA 5KTAA 3HSRA 4LK0F 3VSLA 2R0QC 3OYBA 4KSAA 1QO0D 2DPUA 5F64A 4UIAA 4M3SA 2V9PA 3VYSB 3TX8A 4D9JA 3L2RA 2XEFA 4PXCA 2OBPA 2PFBA 2JEVA 4B5PA 4I09A 1W7PA 4ZYAA 1TQPA 1TOTA 1BR2A 3MEKA 3D5LA 3R95A 2GKTI 4B5OA 2FD5A 1MKMA 2FNFX 4R79A 2TRTA 5JHWC 1WJAA 4U0VA 4LD5A 4ZYDA 5JVGF 4BL0B 4QPOA 3G4SI 3OXFA 3P9KA 1ONVA 2GBYA 3Q3SA 2VODA 3J7AO 2GIZA 1YRNB 2YNDA 1J5YA 4RS8A 3FRMA 1ZRDA 2P5LC 4NGPA 3S8PA 2BSWA 2Q8KA 1E3PA 1Z0XA 2DFHA 4YFKF 5B3SH 2HVSA 4NEXA 2VQHA 4FBEA 3ROUA 1WPKA 2MW8A 2CV0A 2XEGA 4BGDA 1P0HA 1QVUA 3HM5A 4BBRJ 3OVOA 2HYFA 3KE2A 1LVKA 3CXQA 2QLZA 3VDPA 4GRIA 2JLMA 2LYCA 2L02A 5E8IA 3OS0A 4V2GA 1MBFA 2IS1A 1LJ9A 1Q1VA 3RI4A 1Q9BA 3IV5A 1I1SA 5A28A 2CNTA 1Y9WA 4HA8A 3F22A 2JUCA 2HC9A 2FX0A 3PBBA 4UFWA 2AS5F 1JXSA 3ECOA 1TNSA 4LJZF 3RCOA 1X12A 2SGEI 5JHUA 2CTBA 2RIJA 1R6RA 3C18A 4KSIA 2YNCA 3M4OJ 1LB2A 3ZMVA 1JKQC 3VYRB 3TBIA 1NSLA 3BR2A 2L0KA 4LLLA 3RDIA 4A6DA 1P2FA 4BAYA 2PJ1A 4AVBA 4H6ZA 3EDPA 1T08B 3FXKA 4NC6A 1JUSA 4Q48A 1UMQA 5GTHC 4MCSA 3ZOBA 1A35A 5LBQA 4X0GA 4P4FA 4J01A 2K27A 3FVLA 2YQPA 4LK1F 1I21A 1LAPA 3D7DA 3PB8X 1ZG3A 2STWA 3B6CA 1R71A 1KYZA 2EV0A 4NHJA 3M3YJ 4AG7A 2LY1A 4PPZA 2PJBA 1WKMA 3KLNA 4CYOA 3PFYA 1FYLA 3Q9VA 5B1AH 2QENA 3GEZA 4IHMA 3EO4A 4RAYA 4M6HA 2XKOA 4G8XA 1S5KA 5C44J 1K83J 3SEZA 4ZY1A 2PJPA 2NU4I 1Z05A 3P7NA 4QWQA 1IXRC 1HDLA 1FMVA 4GS4A 3ZXSA 1X4SA 1HA8A 1XMBA 1PU9A 1F2OA 2HOEA 4M9SA 2NNNA 2YX4A 1MH4A 3H5AA 2GOMA 5FKOA 4ZZLA 1UUCA 3PB4X 3M8FA 5HS7A 3BCAA 1A04A 2KJCA 1NG6A 3W91A 3R96A 3PFEA 2VOPA 4GI3C 2M8GX 1XIXA 4BUPA 2GFQA 4C9YA 2M0MA 4A0XA 4KLVA 2H8WA 3B3CA 1J0RA 3NWTA 2QQCA 1USSA 2F4OB 5FD5A 2JTVA 3KHZA 1B72A 3DU5A 5FGMA 1NG7A 2ZEFA 4KYWA 7CPAA 2KHMA 4MCPA 1IU8A 3I5UA 3DKXA 3TW6A 5E1WA 2VE8A 4JP0A 4A3CJ 5IT3A 2F7VA 2FMLA 3EXNA 4C2YA 4U0WA 3JRBA 3RKXA 3CCSI 1ZR4A 3H0DA 4BHPA 1W36D 1KA8A 4G7OF 3IWWA 3A01B 1SGDI 3R0AA 3VDXA 5KAFC 2GZWA 5IP6A 5FKLA 3LSJA 3F8KA 4L0ZB 2QQAA 3BLNA 4CCKA 3DPTA 1KBFA 2KFDA 2V53A 4MY3A 3F5BA 1KU3A 3WODF 3LA3A 5IYDJ 4X2TA 3BJ6A 2VXDA 1NUBA 1TF9A 1YW6A 2VJ5A 2VXZA 2P8TA 5EBVA 4XPKA 2DMTA 2XKPA 3PSFA 4JX4A 4MI4A 3S6HA 3W2WA 3L2VA 2PMHA 1OCCH 1KUXA 2Z0ZA 1RETA 2DT7B 2DKVA 2NVUB 5E96A 3FEDA 4DBRA 2KIFA 2J87A 2CIJA 2XDVA 3SYTA 2ZENA 4BS9A 1IAWA 4G1PA 1WQ2A 3V42A 1SGYI 4OIOF 1D8JA 3FISA 2NMTA 3FJUA 3K0LA 2PIYA 4II9A 2FQ4A 3OYDA 3OYCA 3B73A 3KEYA 2O8XA 4XR6A 5ISVA 4BKXA 1KQ9A 2W24A 2GXGA 1R4MB 1UG2A 3FK7A 1HKTA 4YIIA 5AONA 4EVIA 1PUFB 1V5GA 1MBGA 4PXBA 2E1CA 3RTRA 1D0XA 4L0YB 4CGMA 1LAMA 1YLFA 4UIBA 4C68A 3QQAA 3GTOJ 3LODA 3KPHA 4N4OB 4CICA 2RNGA 2RDPA 3PUFA 1YS7A 4UVAA 2GXAA 2CJJA 5J1QA 1QSMA 2XAFA 3WGHA 2OR4A 3HZJA 2MC3A 2FVGA 4CDGA 2DQLA 5CVIA 4QVTA 1RO5A 4NGMA 1Y1BA 1FTZA 3NE7A 1YG2A 3E1SA 2L7XA 4AU7A 1O7FA 1UFHA 2ETHA 4B13A 4RB3C 4EMSA 2D45A 4KNYA 4OMYA 2V8GA 1F9NA 5HLTA 1ZELA 3KR4A 3OXLA 3FMCA 3KZIC 3MKYB 3S16J 5IYCJ 4CZZA 1K61A 1UAAA 5DCMB 2Y2ZA 4B09A 3FBIB 1EE3P 2EQRA 3I58A 4XOTA 1YR0A 4NC7A 1AA7A 1P7JA 2FBIA 1F5TA 1SQHA 3KIOA 2C1CA 1EH8A 3AFHA 2Y9ZA 1O7LA 1HDDC 2ZW4A 1X58A 5E3NA 3BPVA 2QQ0A 2NSMA 3SDBA 4DQ2A 4N4NB 2K9LA 1GXPA 4HLYA 1SFOJ 4R76A 4EWTA 1U9NA 5DV5A 2HZDA 3F21A 1Y6IA 3PGPA 2LH9A 2V26A 5DM6F 2X7BA 3J81K 4K30A 2VBYA 4RAFA 2WPXA 1IF1A 3BCBA 1JUPA 4BQNA 1KBEA 5HDGA 2DMPA 2CWHA 1R5HA 4Y33A 1JGGA 2VL8A 3L7WA 3B3VA 3MEXA 2M0CA 1JKOC 2IA2A 4MQ9F 2FJ1A 2P7VB 4JOMA 5CPAA 5BOXA 1A31A 1CP6A 3CLQA 2M8EA 4E1RA 5CCLA 4GYGA 1RFHA 2KCWA 1RESA 4O5VA 3JRIA 3DEUA 3LSMA 5M3FJ 3CJTB 3RZDJ 1BPMA 2G9DA 3K4MA 4L9JA 2H5MA 4A93J 4W9YA 4Q38A 4JYWA 4LB6B 1WGTA 1OYYA 3SXOA 1X4OA 2HQNA 3PSIA 2ROWA 4I02A 4BE2A 4JLYA 4Q47A 1FP1D 3MCZA 4KMUX 3OV8A 3TL4X 2R5YB 1LCPA 2ANPA 1RZ4A 2MYSA 1J59A 1Y9KA 3IAM2 3KX2A 1H0ZA 3MGDA 3R9FA 2FSWA 2DA1A 3S3OA 1T8IA 3S32A 4KOYA 3HSEA 4PFOA 2C6YA 1TBQR 4AIDA 4B10A 2O3FA 2YGWA 4UFXA 3HGYA 1BLLE 3ZQLA 4OAEA 3J7YJ 1M4IA 1VTNC 4A3IJ 4F8ZA 1L3LA 5HMNA 1FC3A 1XOVA 4UUSB 1TC3C 4L89A 2GANA 2R98A 1A6QA 4S0HB 1QZEA 3HGGA 4B11A 3VYUB 2ADUA 2VBXA 2LR8A 4R9MA 1MGTA 1F43A 3TO7A 1BC7C 5FVJA 1QHHD 1WJEA 4L5JA 5K5OA 3L9FA 2WCYA 4XM3A 4E7LA 3FM3A 5K7ZA 3OYMA 3U1KA 4IHYA 3FXUA 4YWYA 2PG4A 3TQNA 3R5AA 4NJQA 1OCRH 2DN0A 4OIRF 3ZN0A 3OYIA 3VH9A 4NBQA 2QVPA 1WRJA 3QYBA 4LOCA 3K6GA 3JRAA 3SEKC 3UY5A 4A2UA 2H27A 4IHSA 4P5OA 5AGEA 1T0FC 4M3FA 2PX9A 5EX0A 2EFOA 2QQ9A 4HX4A 4AVCA 3GWZA 4HQMA 3QP5A 4P4EA 4IHTA 2MABA 2DMUA 4XRFA 3NARA 4QTRA 1W7PB 2N1AB 4L18B 4MFJA 4Y49B 1SD6A 2I8DA 4CCNA 4B6DA 2FIAA 2A3SA 2M3AA 3O8HA 4BE1A 2VKVA 4E7IA 5K7HA 3VSKA 2GLFA 5K1YA 2PJ5A 1RC9A 5EMIA 4A32A 4A30A 1T2KA 4A24A 3OL4A 1UG0A 2Q4YA 2ZOFA 1OFCX 3KEOA 4M9XA 3R4KA 2GAUA 3PQKA 4AIHA 1P9ZA 3CUQB 1W5SA 2R7UA 2KRCA 5AIPA 1TKHA 2PJ7A 2OQGA 3BR0A 3ZMDA 1P9GA 4CXFA 2KT0A 2LLKA 2BBYA 4ZX9A 1QQIA 4ESJA 3HRMA 2O7OA 5EG0B 2YUUA 1R1VA 5C82A 2F4IA 1V1HA 2VI7A 1LR9A 2DT5A 2MH2A 5EEAA 1B4AA 2YSRA 3WTZA 2QMLA 5DYMA 4F3QA 4WP4A 3RZOJ 4DGWB 1PP8F 4LUAA 4XORA 4ONUA 5F48A 2WB1A 4XOPA 2OVOA 3RPUD 1IZ1A 2P6AC 4U5YA 1Y56A 3H36A 4M85A 4UCNA 3WC6A 1D5YA 1IW4A 3HTSB 2FMYA 2FE7A 3CZXA 1I12A 3CPAA 2EBIA 1BW6A 3ONQA 2ZFWA 3GTPJ 4AMLA 5ELYA 1T33A 3LFKA 3HHGA 3HJEA 2Z3OA 2XB5A 2ZOGA 2DOAA 4A3LJ 2XAUA 3WC7A 4ASNA 5C3EJ 2FNAA 3BJ8A 1EKEA 4DOZA 5A2QZ 4XN0A 2JA1A 2ARHA 3D2PA 3SJEA 2W82A 2IP2A 3H1CA 1IUFA 2QECA 3I53A 1F1ZA 4RA2A 1YS6A 1FOWA 1XDUA 4V19K 4MTDA 2VASA 1FMWA 2R3SA 4ZY2A 5D5XB 4GFBA 4KOSA 2DU9A 4G94A 2MLGA 3KZYA 4KT6A 3F8FA 3A0HC 4HNVA 3IFEA 4CCJA 1IDYA 3BJAA 3UGDA 1IGBA 3ERMA 2SGQI 1Z9CA 1OCOH 4OC2A 4UCMA 1N71A 4EFDA 3JRGA 1K4JA 2LBFB 2DIPA 1IY6A 4KUAA 3IHUA 5LEJA 5IV0A 2XV4S 2OZHA 3F9KA 1WJCA 3VODA 3PNVA 4KT5C 4Z6YA 3BG9A 1B1BA 4B43A 4OC4A 4CGPA 3BR3A 4LLNA 5AIQA 3MKLA 1ELLP 5KK1A 4Q7AA 5GAEJ 1YQAA 3UNGC 1F4KA 5F0FA 1ON0A 2P6GA 2ELKA 2WB1N 4MFDA 3P9IA 3TGNA 3AG3H 3K7AJ 4UXJA 2CG4A 2IPQX 3CTAA 4JYKA 3BLYA 3R5BA 2Z10A 4QSHA 2WUUA 5LFAA 2JRTA 2C6PA 1WI9A 2JXDA 4U88A 4FD7A 3GIUA 3BZ6A 4A33A 3NH8A 3EETA 1ARLA 3MZYA 4C30A 1IYKA 4OC0A 1T95A 1Z6RA 2IGOA 1U8BA 3J81Z 1UVFA 2BVMA 2QA4I 1QSOA 5GCNA 3W2VA 3DLLF 2PJ3A 4II2A 5FUVA 2Z99A 5DD4A 1JQGA 4HPQA 1G3SA 2BY0A 1AN1I 5CBMA 3B35A 1MK4A 1S7NA 1LDKB 1X4PA 1YU6C 1R4NB 2VI6A 5IT9K 1YMEA 1JUMA 3P9CA 3HOSA 2O8KA 1G2HA 2FQ3A 3H9QA 4RDUA 4M74A 2N8GA 4A3GJ 4Y49C 2VOOA 3S1MJ 3CXSA 3VYTB 1G59A 4C3HJ 3LAPA 3MZHA 4CZCA 4JK1X 4ZH4F 1BM9A 1U5TC 5IX3A 1XX5A 2ELHA 2JWTA 2YX7A 4E7KA 5LHHA 1M4DA 2O4HA 4P96A 1X1BA 1ELMP 3CCYA 3CZ6A 5TISC 1XBUA 3PQJA 2OZUA 3QYFA 2LC2A 2MLKA 1WH7A 1QSNA 2E1NA 5K5QA 1WGXA 3OYNA 4A31A 3OL0A 2W4SA 3BZCA 1FAQA 2DXQA 3I56I 3NH5A 4MTEA 1J7KA 1M1EB 2M7AA 3HRUA 4PGGA 1B6BA 2WA0A 3KGQA 4O23A 6CPAA 1X1AA 4EJVA 3IP4B 1Z91A 1Z5RA 4AXVA 2DCEA 2OV7A 2F6CA 5KNLA 2W48A 5G20A 2O5RA 2Y69H 4OMZA 1IY7A 2A4NA 2RFHA 3H5RA 3JUWA 3BG5A 1FZPB 2D4PA 3WTWC 4FKDA 5JVTA 2YPRA 2GE3A 3SGBI 1JTYA 1P4WA 4LQGA 4PQAA 4RLFA 4KZTA 1XGSA 4CYCB 3FIXA 3N05A 3S9NA 4KIBA 3ZJ0A 3C2GA 5F08A 3I4NJ 3D7HA 4DJLA 4LMYA 2RQQA 3TKYA 4XLPF 4E7ZA 2PDOA 2XB0X 3MAJA 1SANA 3CESA 4G7HF 4L5IA 1QPIA 2SGPI 3KYLA 1AYEA 4XPLA 4NFRA 1JGSA 3E59A 1PUEE 2H94A 2MH9A 1R1TA 1Z7UA 3JRFA 4ENKA 1SFUA 3D1NI 3JCUC 4YIRX 2KMQA 4Y15A 3B7IA 2GWRA 3HDDA 3TP3A 1ETYA 1Z8LA 3SHFA 2LNBA 1IN5A 3K4NA 4IOAF 2DA7A 1HW2A 2M45A 2K86A 4HRIA 2AFWA 4R8HA 1FNNA 4ESFA 4F55A 5HLHA 3FX6A 2KKOA 2Q1ZB 3EQLF 4D7NA 3G1OA 2FT0A 2DLLA 1GLNA 2JRMA 3OWTA 1PCAA 4FT8A 5IOYA 3GTQJ 4HF1A 1O3TA 2QUFA 5J4YA 3A2KA 2BOLA 2RV8A 3PRTA 1ZG5A 2A5YB 4EJOA 1R22A 2R5ZA 4AWXB 3ABTA 1NHAA 2DMQA 3DF8A 5D4SA 2CF4A 4PK3A 1MBKA 5GTIC 1W7PD 1SVMA 3D0SA 2E5ZA 1XMTA 3GW2A 2ME0A 1V5FA 1IG7A 1GHCA 1YFHA 1ODDA 1HXDA 4A0YA 3R6SA 1MSEC 4XRMA 1WCMJ 4P1WA 3J7AY 2DEAA 1JE8A 3Q9SA 3TJQA 2VJIA 3W6SA 3QWPA 3TOBA 4JX6A 2HS5A 2NOGA 4BXXJ 4B5PB 2FOKA 3GZNB 4A94A 2ZBKA 3JR9A 3CF5F 1O3SA 3S1RJ 1QZZA 3VB2A 2VZYA 1IRFA 4IPAA 1UHSA 2L9RA 4FTHA 1YTYA 1RUOA 1X3WB 1XPXA 1ZQ3P 2ESHA 2LY9A 3WE2A 1MD0A 1SVOA 4CCMA 2RN7A 2RNJA 3DXJF 2H8RA 2FBKA 3KEQA 4N9IA 3OS2A 3RZAA 4B3XA 4WXCA 3GF2A 2EA2A 1I5ZA 1PCEA 3C1DA 7WGAA 3BG6A 2F5FA 3V8IA 2XGCA 3WU0A 2FIWA 4C3JJ 3KFWX 5E18F 3FEEA 3TW7A 5JI6A 4AIKA 1DPRA 2AQFA 2CWEA 2RB7A 2ZEHA 2CQQA 3LSGA 1SAUA 2ZO4A 3FK6A 4TWEA 2HOAA 4NC8A 1VGYA 5CCMA 4OC5A 3WC5A 2B7EA 1R9TJ 2KCXA 1BIBA 5TJJA 3H35A 1KZFA 2BGCA 5HVQC 3PUBA 1BI3A 2P7CB 1IJWC 4IKFA 3GOXA 3PP9A 2QYVA 1VQLI 1ULYA 2M87A 2X1EA 1R36A 2ZXHA 3LNQA 2A6HF 4JXRA 5EF6A 2FCKA 2IQ6A 2Z3NA 4L8AA 2Z5UA 1R23A 4Y3OA 2F5DA 3TOAA 1FARA 2ECCA 1IRZA 4N9HA 1OR7A 1GT0C 3SQNA 2ZNZA 5E20A 2KIUA 3CC2I 1ZLJA 3DNSA 1D8KA 4RM3A 3KLOA 1IY5A 2FXFA 2Z3PA 3JVNA 4KITB 4ZYEA 1IV8A 1U6MA 2HI3A 2HQYA 2JBJA 2Q7BA 1KWMA 3T8TA 3OYFA 4KA4A 2CUZA 2VT3A 3IWEA 3CO7C 5E3RA 1BIAA 3QU3A 3R9GA 4HNXB 2AFXA 1F57A 2CXAA 1ON2A 3BI1A 4CAWA 3HUGB 1LKXA 3C26A 3FHZA 2PJ0A 2AQEA 3K10A 1XGMA 5CVVA 2K3PA 5HI7A 4KORA 5K8PA 2M9HA 5E17F 4MFLA 1Q2CA 4NQWB 1ETQA 1WWZA 3MFKA 1DS3I 4KFCA 4BEHB 5B66C 2BL1A 3H8FA 2V7FA 2PCUA 3T5XA 4IOCF 5J40A 3ZMTA 2G7HA 4A3EJ 4Y4RA 4PV6A 4C2TA 2CQNA 4KVOE 1R49A 1XB4A 3OWCA 1I6HJ 4IEJA 2E19A 2PJ4A 5KTCA 3QPSA 4LIUA 1N25A 4UY8I 1VQMI 1TWCJ 3H3UA 4AYBA 4NF1A 2DF5A 2LF8A 1OMIA 4UCPA 2FRHA 2ENZA 3JRUA 1T56A 2H6BA 4ZYHA 3M7GA 2PVWA 2WYRA 4O6JA 3GXOA 1V1IA 3UR3C 4MHDA 2K9NA 1HSTA 2JK3A 2IRFG 3PNTA 2XUBA 4P55A 5JR3A 4M3EA 4HOBA 5H20A 4A3KJ 3PIPF 1O4XA 3FF3A 3VATA 2FEZA 2LMDA 4L9TA 3VPRA 3ZGKA 3GLLA 4HQEA 1LFWA 4ZI6A 1GV5A 1TBOA 3KR5A 3A4CA 3U21A 3E6BA 1Z4EA 2J8NA 2LKXA 5E3PA 4UA3A 2K4BA 2JW6A 2VQYA 1FPQA 3ABKH 2Y75A 1U8RA 4II3A 1FWZA 4JD6A 1VQOI 1YW9A 3SJFA 1TW3A 4M71A 1ITYA 4LLGF 5FLXK 1NXUA 2Z9OA 5AG6A 3CUOA 4R3LA 3E6MA 4FX0A 1MZBA 1V4RA 1W4RA 2JBKA 5JPHA 2K40A 2CUJA 3FXQA 1RTQA 4HKFA 1OYIA 2LREA 2ZXIA 2FF4A 1Y1VJ 3RYPA 1WFXA 4M6IA 4E8OA 4TNUA 3QODA 1GVJA 4UF4A 1LE8B 5AG5A 1WTJA 2JZYA 1UCRA 3G6EI 4A37A 4XQFA 2AO9A 2X6OA 4BQOA 1H9TA 1M8BA 4MBUA 3RQ4A 2X85A 4ZJZA 5L3DA 1JI8A 3X2QH 1KUYA 2M4KA 3CDLA 2C6CA 3HLPA 4DYOA 1S7LA 3LSTA 2DA3A 1IGNA 3LMSA 4P4JA 5J4VA 1CHOI 3OYJA 1ZHFA 2BYVE 1RRJA 3EYIA 4CGZA 1NK2P 4NDLA 2KLOA 3OMYA 2QSGX 4XRSG 4GCVA 3K2AA 2EVNA 3FNCA 1R43A 4KIGA 1IN7A 4WF2A 1ZLKA 2PN6A 2FNPA 2PJ8A 2L4AA 3DTKA 3R60A 3D3SA 3TT2A 5FB2A 3V7CA 2ISYA 3ZQIA 1WKXA 4S04A 3IH3A 1EJ9A 1TWAJ 2B0UC 5G1ZA 4R3KA 1QU3A 1DPUA 1S29A 2GIVA 3A01A 4MNUA 1OYWA 3A0BC 3MWMA 2O9LA 4GGGA 4UXHA 1D1AA 2WWYA 1KZHA 1IV6A 3LSHA 3PB7X 4NCZA 3H9GA 4DYQA 1ZREA 1TQIA 4TV7A 3AG2H 4XONA 3OIPA 1G4DA 3LQRA 2J5OA 4WWCA 1N78A 4AC0A 3OR1C 5A2QK 3G73A 3OXGA 1MJ9A 2ZELA 3W6JB 4OKOA 1SD7A 4A0ZA 1VDDA 1G3WA 4ZC3A 4AUXA 5HNHA 2LSOA 2IGKA 2W57A 3RKQA 1LNWA 2EWNA 2KIQA 5ICFA 1LPQA 3I3GA 3QU6A 3MKWB 2PR1A 4Y7NJ 4E1PA 3IO1A 4XPDB 4MCRA 4YIFA 4GXHA 1ARMA 2XC7A 1OBRA 3NE8A 3HOUJ 3IWGA 4MCQA 2K4JA 4QB9A 3FBNB 4XSXF 3CCLI 2WAQN 4V2FA 2BEOA 1AHDP 1FJLA 3BQYA 3QPHA 1WK4A 2SGDI 5IP7J 2Z1DA 1X1DA 1G8XA 4L9VA 2V1UA 4BINA 3KYCB 5H6RA 2I79A 2OZGA 1WZ2A 2H6CA 3KI9A 4PJLA 5L3CA 2RVCA 5K7FA 3LACA 4OC3A 1IDZA 2PJAA 4BMHA 2F5VA 3KP7A 2QZ8A 1Z21A 2Y0SA 1YJWI 1XRYA 2EV5A 2NNYA 3JRHA 3K4KA 4PZJA 4H2KA 5F49A 2L7ZA 2EZLA 2R7RA 3TFYA 5D5WB 1YO5C 2BY3A 5FUWA 2ECBA 3E0JB 4EQQA 4ZYGA 2SGFI 4CHUA 2H1KA 4ZBGA 3V7RA 4UVBA 2PJRB 1P9QC 4KISA 1NSAA 1P4NA 1RXTA 2JDCA 3B8GA 4JCVE 3RO0A 4HV5A 2EPFA 1VHSA 3FB3A 5L3FA 3I1UA 3I64A 2VXKA 1IICA 4C2UA 2PR8A 2EZIA 2VN2A 2VBWA 4XKVA 1BI1A 3JTHA 5DUKA 4JWPA 5E3OA 2L7MP 1JJ8C 1CM0A 3QAHA 3MVPA 4A12A 3SGQI 3TTHA 3S3NA 2X51A 2VQCA 2O6GE 3W3CA 2WAFA 2JVHA 1U5TA 3FYNA 4H4KC 4J00A 1NE9A 5C88A 1CGPA 3DBRB 2ISZA 5HOOA 4UUSA 1TGSI 4X5KA 2A07F 4EM2A 4CH7A 3CJRB 3G2BA 3IH2A 2K5CA 1PUAA 2Y30A 4ZDLA 3WGGA 2ZEPA 4F9UA 1WJBA 1D1BA 3K4JA 3NH4A 3D00A 4CS0B 3SXNA 4C2MJ 2MGQA 4ZX8A 4UEFA 1JT6A 2GKVA 4M6XA 1DP3A 3TC8A 3FWEA 1GUUA 3IRRA 3FXMA 3BROA 3PM1A 4LFUA 1H0MA 5KAIC 1YTPA 3DV8A 4UHTA 1Z8WA 1BI2A 2A61A 4G6DA 3OY9A 2Y48A 3MD2A 1MW7A 2STTA 3BY6A 3EUAA 4G12A 2YS9A 2R7QA 3F3XA 3DLJA 3OOPA 2VPLA 2ZMEC 1TBXA 3S3MA 4C7HA 2E35A 2EWBA 3GYAA 2GREA 2Z16A 5JM6A 2ZEGA 4MQVA 4M6YA 4HF0A 3I54A 3DR6A 3GKRA 3I9V2 4IO9F 1QSRA 4MFEA 1Q2DA 2PRBA 1U3EM 2CNMA 3H0GJ 9WGAA 1E17A 5LGUA 1UHMA 2VQLA 1U0JA 4MPIA 3VE5A 3CF2A 2A6TA 1CX8A 2M7BA 3IC1A 1Z3XA 2R7FA 2K5TA 3IC7A 1ETXA 2CFXA 1VHEA 2R1IA 3BT9A 3KHXA 3QPLA 3OS1A 1FX7A 5HLIA 1S7OA 2AFSA 3DPLC 3T90A 2Y9YA 3V7ZA 5JHFA 2HKOA 1K78A 4CAVA 4FD6A 1D5VA 2VC1A 1V55H 4BQQA 2DBBA 3TO6A 3CUQA 2JJ7A 2R8VA 1YLOA 2CNSA 4KVME 1WVRA 3HUVA 1TTYA 4AVPA 5J1UA 2FL4A 1YI2I 3KP3A 3HPHA 4KN4X 3RYRA 3AG1H 5J6XA 5E79C 3L2CA 4A3MJ 2QQDA 2UWMA 2PJCA 3CDXA 3SJXA 1KU9A 4ON0A 2P5KA 2JPCA 2VQGA 5EEGA 2NYQA 3I0TA 2OA4A 3S14J 3O2PE 2O53A 2HFHA 2L01A 5EDNA 2L2OA 3GZ6A 2WPWA 3K1PA 5BPDA 4CYPA 4HSTA 3DDDA 2LFBA 2D1HA 1HEVA 1FYKA 3ASOH 1YQEA 3I9SA 2XRNA 3OR2C 1KUVA 2YR2A 4DYCA 1L0CA 1ETOA 1UHWA 3GMEA 2GU2A 3D2MA 4ENNA 1MH3A 5CKTA 1BN5A 1V0CA 4KOVA 2DDAA 1ZYRF 3HPGA 2IJLA 2IVMA 4J19A 1K79A 3I4MJ 3H3ZA 2QF7A 4DJAA 2OTLI 2OZ6A 1ETVA 4UXIA 2V8HA 1FIAA 2FUG2 3RKWA 4I6ZA 2VKEA 3S2DJ 1BW5A 1CBXA 2J8MA 1OCZH 4JBAA 3E6CC 3BR1A 3K9UA 4RLQA 1CT2I 2KMRA 4E4HA 4HNYB 4HYEA 2DTRA 2V9KA 3BR6A 4IF4A 4CSWA 3HL2A 1SGPI 1X1PA 1IB1E 3LMMA 2PJ9A 3BI0A 3I59B 2OC6A 4AVAA 2DA4A 5KTDA 5FFXA 3K4BA 2MD5A 1Y8RB 2RKHA 2HVQA 2QM3A 2I00A 3ZPLA 2PBIA 4RB0A 1MBEA 5LRRA 1LR8A 2JQ7A 4AVZA 1Y7EA 5FJ8J 2IA0A 1X74A 3M1CA 1Z8XA 4NNJA 1KU2A 3TDUC 5JLWA 4M9ZA 5FROA 2QQ8A 3BJ7A 1FT9A 1XG1A 4CGLA 3ZQGA 4BY7J 1VIXA 3LAJA 2ZKZA 1Y0YA 5ILSA 2B4DA 1T98A 4JX5A 1NK3P 3NRVA 2DXIA 4U7DA 3BTLA 5JLXA 3B2YA 5F47A 1VQ7I 4NGRA 4MHNA 4R7MA 2F48A 2XVCA 2UUZA 4OWRB 2DPTA 2PC1A 1Z77A 1SFXA 2LB7A 1X19A 1T38A 5TRDA 2CW8A 3JAMK 3M8EA 3D8PA 3PO2J 4IF5A 4HX7A 5M5XJ 4CGOA 3QOPA 3WR7A 1LFUP 3S17J 3SHPA 4XIDA 5CVRA 3VDUA 3HYIA 2OH1A 1DU0A 4YU9A 3SI1A 1TURA 2KQRA 5E3LA 3WTUC 4OIQF 4HGUA 5ICCA 3CPXA 3DSBA 2V6CA 1R1UA 4ABZA 4AM3A 1YIJI 1YJ9I 1Y1WJ 3FMSA 2XEJA 4YFXF 2W84A 3CDIA 1ZLHA 2GQQA 4WJBA 2NS8A 3O6BB 4RI1A 2EIMH 5CPRB 4A5NA 3UGLA 1P7IA 2EIKH 8CPAA 3DEEA 1UZCA 4EJUA 2CGPA 2CW7A 5HDNA 2PJRA 3FECA 1MNMC 1CGII 1CSOI 1TIQA 4LX9A 5EZGA 1MMGA 1FYBA 3CUQC 5CNPA 3TO9A 3J80K 1B59A 1FTTA 3GTGJ 3GZ5A 3NFZA 4GO1A 2VE9A 5JGFA 1I50J 3ZMZA 2E2JJ 5IOZA 4I49A 3ZMSA 4F0XA 5H6QA 4E7SA 2IAIA 4WK8F 2QQEA 4DUKA 2K02A 5EC4A 2XASA 1LFPA 1IRXA 1D0ZA 2Y0MA 5LLQA 1CG2A 3HXLA 2ZXJA 3G1MA 3BZKA 3DBLB 5FKMA 4R1HA 2DQRA 3V8LA 3N97A 1YITI 1AUGA 4A3DJ 1MJAA 3HEFA 2VUMJ 3JTKA 3LWFA 5FRMA 4SGBI 2EUIA 4M73A 3B4VC 2XSJC 2X1DA 4ZTFA 3GFMA 5J3LA 4ANJA 1VQKI 2VBZA 1JKPC 1EH6A 3OYKA 4DYRA 5ILUA 1RPWA 2E34A 3LOCA 3GTKJ 4QC6A 6PAXA 3CMMA 5GADJ 2ZSHB 2AXTC 4B12A 5LYIA 4BQAA 1Q2YA 1FSEA 1KYWA 4IZZA 3S2WA 1CP7A 1ETKA 2K3FA 1B8IA 1Z7KB 1TBRR 2RAEA 1PYVA 4UUTA 5JFRA 3H8GA 3ISZA 1Z3YA 2ZCWA 3JAMZ 2L5QA 1V3FA 2VONA 2IBDA 2F5EA 1QRYA 2P6TA 2ARPF 5AG7A 2Q51A 1M44A 1YLEA 1W0TA 3QNVA 2JA6J 2XSDC 3PNYA 1QA6A 3GYHX 3WHBA 5G21A 3F8MA 2BUSA 2BVLA 1Z2LA 2JEWA 3RAMA 1TNTA 2V4JC 3DWLE 4BU2A 1JJ6C 4F9VA 3WTYC 4UFVA 4CAEA 2BY1A 4MMOA 4HNUA 3VFZA 4FUUA 3R9EA 3WTSC 2F8HA 5DS9A 1Z67A 2V1CA 3FC3A 3PB6X 5G22A 2JDDA 1IC8A 3WTVC 4JJXA 4MFQA 1ULNA 4MIMA 2YU9J 2IMOA 1HCRA 4RM2A 3P2FA 4Y17A 4I76A 2QBYA 2M5XA 2A05A 4ZYQA 1X10A 2DTZA 2LKPA 2X4HA 1CQTA 1USTA 1I1GA 4RAGA 1DUXC 2X3TA 5I0CA 2O0YA 3H4QA 4S05A 3EUKL 2HDDA 4A3JJ 3PIOF 1XMAA 2QYOA 1TT0A 3SEQA 4IRIA 4IRGA 3QWLA 2ZPAA 2CWFA 2PE3A 1UHAA 3CCQI 1TWFJ 4XICA 1QVTA 3PZJA 2EA4A 5LD2C 1ZRCA 2VPRA 2WAEA 2N52A 3PB9X 4MFZA 3EUHC 1ZR2A 1NH3A 1K4SA 5D6EA 1I3QJ 1ZO0A 1M1DA 2MG4A 2F4MB 1CT4I 4ORFA 1G6NA 2YU3A 3ZR8X 4DZPA 2X0LA 1B87A 5CVUA 3KP6A 2DK8A 4G6QA 1UJ8A 2QWWA 1APLC 3H8EA 1AKHB 1FOYA 4C7IA 1OVOA 2ZB9A 4KOTA 3DU6A 5EEHA 5DWNA 4C2ZA 2VT2A 4XL9A 5FFZA 5L3GA 4EGZA 1W3SA 1I39A 5D8LB 3SJGA 3SZPA 3GTJJ 2XRCA 1HKQA 3DKYA 4PSXA 2V8VA 4FASD 1XBTA 4XLNF 1R5GA 1QBJA 2P4WA 4FCYA 4NB5A 2CYYA 3D68A 1JTXA 2KMPA 3HOVJ 2L7KA 1PJUA 2VEZA 2XAHA 4RMNA 4HSRA 2AXLA 2IGNA 3BQZA 2LOOA 2RREA 3CP8A 1N75A 3G3SA 1LE8A 3VARA 2XRLA 3T8RA 2KDZA 2R7HA 4AB7A 2J8RA 4HV6A 1AWCA 1MNDA 2EILH 2DYRH 2YUSA 3CP2A 4GYIA 3QYEA 1Z8TA 3OYAA 1MDMA 2XPUA 3SZTA 2KDOA 4IHVA 2O61A 2LK2A 1ZH5A 3A02A 1YVKA 5LHGA 2ORVA 5HLGA 3V8KA 1VFCA 2IS6A 1K7AA 3D4UA 2POKA 1HOMA 3WE3A 1QQ9A 2CQ7A 4BHCA 2IW5A 5EYRA 2KISA 1SGQI 3S6FA 1OISA 3GBGA 4OAYA 3V38A 1KMAA 4K3NA 2W25A 3BTCA 1VI0A 4EVYA 3K69A 4UNOA 1Y8FA 1KU7A 2TDXA 2OPTA 1A5JA 2COMA 4CYQA 1YHQI 3DGVA 2AFOA 1BA5A 3M9AA 5F0HA 2JPBA 2L9VA 2ZW7A 5L3EA 4XMYA 2JT1A 2QPOA 2VRWB 2Q44A 4A2ZA 1PVEA 3EC4A 1IN4A 3GFJA 2BHZA 2R7ZJ 1ERDA 4LG0B 4IQ4A 4B1RA 3L2QA 1Y0NA 1PTQA 2Q2EA 2B3VA 2P5VA 3HUGA 1DTDA 1RIOH 2DA2A 2M30A 4RAZA 1TT5B 2ENNA 3DCFA 1LOKA 3E0KA 3CMYA 3K70D 5BPIA 4OU0A 4EJTA 3RPUA 4RGSA 4B44A 5GAHJ 4RGUA 3LL7A 1XF8A 2WGCA 3UEJA 2EV6A 1ZN2A 3BP8A 4B3AA 3D7GA 2HR3A 4IL6C 2MSYA 2HYGD 2OJED 4BEHA 2BY2A 5C4JJ 3HOXJ 2R5YA 4W1UA 1VQPI 3T9YA 3D5SC 3HOYJ 1GHEA 3IJ3A 2WV1A 2AHQA 4BY1J 2R7DA 2UZKA 3BDDA 4HEA2 4A3BJ 4J3GA 3IWFA 3CJNA 2R7SA 4LQ6A 4MEYF 3AG4H 2CUEA 3GTLJ 2IL4A 3EFAA 2XF5A 2PIZA 1BL0A 4MHYA 5BNGA 2B58A 3B3SA 4M3BA 1EV7A 2V8DA 2DPDA 2R5ZB 5H84A 1DQUA 4UBRA 2RC4A 3JRDA 3BC8A 5L3BA 3WHCA 1HEEA 2F5IA 2XIGA 1UWYA 4IHWA 4MXUA 5LGTA 2N17A 4IUSA 3EUHA 2NU3I 3NAUA 5HVHA 2VL1A 1XN7A 1YE9A 2IGMA 4BH9A 2CRGA 3OSFA 1PYTB 1IUYA 5TGTA 5J1YA 3NQOA 4X8IA 2QIRA 4OIDA 1C0WA 2VC0A 3DTIA 2V1DA 1F36A 1ULMA 4U9ZA 4U7BA 4E7JA 1ACIA 3CCMI 2WVJA 1QZYA 3D67A 3MN2A 2HDWA 4XLEA 1JWQA 1TKJA 2O03A 1Y1CA 2DPSA 4GM5A 5K8NA 2HQ5A 1N77A 2VKDA 5DWMA 2XF7A 5E1ZB 4HPSA 3S1NJ 2B5GA 4UV9A 2HZTA 2BZTA 4LB5A 2JZMA 3E7LA 4EJWA 3F6OA 2HXIA 4PUSA 3MKZA 2D5VA 2K9HA 1YW4A 2NS0A 1RKWA 5FD6A 2P6FA 3MQ0A 4A5MA 4DW6A 1W1WE 1BUSA 4B8XA 2E60A 2OCEA 3H3VK 2KJBA 1YJNI 2L54A 2WTEA 5DDGA 2WBMA 1IYLA 2OOTA 2CO5A 1HDPA 1VKCA 1PP7U 4M6VA 5DEQA 2EK5A 2Q04A 2BW3A 5HVFA 2K9MA 2ZJPF 2B9SA 5D29A 5HH1A 1J09A 4YFNF 4IQJA 2GXBA 3JW4A 1YVOA 3FZVA 4OOIA 1R3NA 4KOWA 4UV8A 3SI2A 1Q7LA 4P44A 2NXNB 2TCTA 2G0EA 2BO9A 2VLAA 1YYVA 3HBLA 1H9GA 4FE7A 4BYYA 5ILVA 3CC7I 4H6UA 2DFEA 5FLVA 2LP0A 3G1LA 1MDMB 2HV2A 2XROA 2NVXJ 1CPXA 3OL3A 2HQAA 5E3MA 4UEZA 4F0YA 4ZDPA 4ENJA 2NU2I 4YFJA 2G3AA 3WTXC 3E3VA 2ELJA 3SFZA 2PMZN 3L00A 1KQ0A 2R7XA 1WJ5A 2ZSIB 1VQ5I 2P81A 4HAMA 4GDFA 2M4GA 1N13A 4A39A 4KS9A 5DUIA 5LYDA 3R5DA 3H92A 4QLCU 4PGHA 1XE4A 2KZGA 2NRAC 4NSQA 2Z3YA 3SI0A 1T6SA 2GA2A 3Q0VA 4PJNA 3UFFA 2EBJA 3ESWB 3VWEA 1XSDA 2XPWA 3RJPA 3DTEA 3RSNA 3CMAI 3BXMA 1ZLIA 5B1BH 3TCVA 2FA5A 5IYBJ 5M3MJ 3OIQA 1M4LA 3R61A 1M8CA 4D0PA 1FIPA 5D4RA 1HDUA 3FXLA 4MO7A 3VWBA 2D2WA 3IGRA 4Q36A 3OYGA 2BCOA 1YRNA 5CYVA 2Q7SA 3J80Z 3E5QA 3DPUA 1MBHA 3CMEI 2EB7A 2QQBA 2EH3A 4BJ6C 2GLJA 3H5ZA 4RN7A 3ELKA 3H9JA 3E6DA 1Y0RA 1XCBA 5IT9Z 3DFGA 2EIJH 3MN8A 2M34A 2ELIA 3FH4A 2QJ8A 3K1MA 1ZG1A 2P6EA 3QOEA 1YGHA 3GUDA 2VJ4A 1D0YA 4X1EA 4CAFA 1Z2IA 4JQFA 1SAXA 1VQ6I 2HPIA 3H5NA 3PO3J 4E70A 4XKCA 3MRUA 2VBQA 3BTJA 1FEXA 2YNCC 5LRGA 3QP6A 4ZY0A 4FAIA 2IT0A 4A38A 3E5XA 2JA5J 4BBSJ 4A6EA 1XDSA 1JHHA 3SZGA 2Z3MA 1BJAA 2HOSA 3AL0B 2NOJB 1CT0I 1Y8QB 3S6KA 3TDZC 4AG9A 1WI3A 1S7FA 5BWAB 5BQTA 2PVVA 2E5NA 5D5UB 3QTLD 3OYEA 2ZMEB 1PDNC 4B4CA 4Z2YA 1MT1A 1F2PA 3KASA 2LF7A 4MFPA 1D1CA 3EPZA 3E2IA 2CJSC 4WWVA 2UZ3A 2L8EA 2E1OA 5EGOA 3QRFF 1Z6TA 2LKSA 2HNHA 5F09A 1XEBA 4OADA 2E73A 1YW7A 1TP4A 2FSRA 2X6WA 2K9QA 3MMYB 3A1YA 4EM0B 5HVGA 2IS4A 2LUYA 1E0EA 3EY5A 1QNTA 2L9NA 4C3IJ 2LVSA 2UXNA 3WG9A 3SJMA 4ITVA 2B8TA 2DB6A 1HF0A 1I27A 3JTGA 4P4BA 1S3JA 4PDKA 3CO6C 3S1QJ 4CYCA 2Q4ZA 3JRCA 1VQ4I 4A69C 3WTTC 1TXRA 5DAEA 3BTIA 3GB0A 5FKNA 3CQZJ 1OJLA 4YG2F 2W7NA 4UB6C 3WG7H 1R0RI 3FKIJ 5H2FC 3HC7A 4R6TA 2QCOA 1LR7A 1BO4A 3GLXA 3WGIA 1GVDA 3LSIA 3I55I 4IVNA 4XRSA 4PSWA 3CCEI 4E0AA 1LANA 2EZHA 1OPCA 4DIQA 2G7UA 4P6YA 4XNHB 5DCFA 3CLOA 1ZGJA 5GPCA 4OMEA 2Z33A 3VEPA 1XSXA 2Z3KA 2MC4A 2CS3A 3F6VA 5JH9A 2ID6A 1KQ8A 1H89C 4IAVA 4CGNA 3ISXA 2BXZA 2JSPA 1MMAA 2IS2A 1K6YA 4M6GA 2X6YA 2Z11A 3UGIA 1OYVI 3GY9A 2DDBA 3FM5A 1FSHA 2PMZA 4HNTA 2R93J 1Z1DA 2PSWA 2L3DA 4MGRA 2QSFX 5KHDA 4ENMA 3U1DA 3KY9A 1IXSB 2CTCA 3TE4A 1TQMA 3CCJI 3BPXA 5CQGA 3CCVI 2JA8J 4OLLA 5M5YJ 4DBQA 2EFNA 1IN8A 2MA3A 2ZFUA 5CVJA 3QAYA 4NGQA 4WXDA 4XNFA 4HNWB 2DK5A 2R7OA 3NWSA 2UXXA 4HW0A 2E2IJ 1KGSA 3FDYA 4XLAA 2E7XA 3M1EA 4BJTA 5LYLA 1YW8A 4PFPA 4E7HA 1FT7A 1Q1HA 2WZNA 5FLXZ 4FWUA 1MNEA 5HDKA 1SGNI 4PJMA 5THWA 1W4MA 1J4JA 3K9TA 3S2HJ 1XSVA 4UB8C 4A95A 2PJ2A 2X1CA 3RU0A 1CPSA 3HKZN 3R5CA 2CFOA 3R1KA 4FD4A 1SVLA 2C27A 3FXTA 3DLAA 2PLYA 1J9IA 4KOUA 4OAZA 2DMNA 4KICA 5FRNA 2HGCA 4XPDC 5K8OA 1X3UA 5D8KB 2RGVA 5LRKA 2IEKA 4MLOA 5B5EC 3HIFA 2G3TA 1CGJI 1XGNA 2EINH 4ZDOA 2AFZA 2W00A 1RR7A 3ABUA 1DU6A 4H89A 2PI0A 1FP2A 3IKTA 1QPMA 2C6GA 1A36A 4KLWA 1LDJA 4LGWA 1HW5A 2XEIA 1G3YA 3KQZA 4KIFA 5FUYA 4KN7X 1BAVA 1VHOA 1DGRM 1PUFA 3CXPA 2JUGA 5IPAA 4PCQA 2ID3A 3BJOA 3D5RC 1ZAOA 2PMUA 2V79A 1HPTA 1STZA 1DDNA 2GKRI 2L4MA 4YRVA 3ASNH 1HC8A 3HHHA 1Y7RA 2G9WA 2ZXWH 2ZXVA 3SFIA 3F72A 3K70C 2B4BA 5EJCA 2KMOA 3B3WA 2X9DA 2NVQJ 3BR5A 2LD5A 2K85A 3CDHA 4CAXA 2L7FP 3GTMJ 2JSCA 4D1QA 3B6AA 4OIPF 1XA6A 4AYBN 1W0UA 1XD7A 9ANTA 4QUSA 2DFIA 2XAJA 3KP2A 1L0OC 2E36A 4L9NA 5J8CA 4D5CA 3BHXA 3G71I 3RQIA 2G0BA 2L9SA 2HTSA 3FSYA 3KP5A 3KCCA 4KDPA 2COBA 1YK3A 1Z9UA 5FO5A 4ESBA 2EFPA 2ZMEA 3K4LA 2PEXA 2CH0A 3UOEA 3LSRA 2KRHA 4HBLA 2WY8Q 2NU1I 1P92A 2NVYJ 2GLOA 3K1NA 2HYJA 3DP7A 4W97A 5D5VB 3BWGA 1PTRA 1WJFA 1FBUA 4ZGYB 4BXUA 4F6AA 1LFBA 2CQKA 3HRTA 3EYYA 3OSGA 5C4XJ 5HQ8A 1BOBA 3WT4A 4BBHA 1K78B 3SXYA 2R4GA 5LGNA 3U9GA 2EFWA 2B4DB 4HDUA 1ZARA 1CF7B 1YX5A 1YX3A 1S7KA 2NAZA 2OAZA 2Q0YA 3ULQB 4ONWA 1BR1A 2EO8A 1H8AC 2ZEDA 3NA6A 1SD5A 2B63J 1R79A 4QIWN 3HB9A 1FLIA 1J2XA 3HH2C 4OP4A 2JN6A 4NGNA 1RR8C 4KUBA 2Q0OA 3KYDB
chains in the Genus database with same CATH topology
1FYMA 4YGOA 3RIRA 2HQRA 2XAGA 3IWZA 4WX9A 3RPQA 4HZFA 2M5WA 4I2OA 4U0YA 2ZW5A 4NQWA 1XGOA 2ZNYA 3B02A 1J75A 3FMQA 4EM1A 2F5CA 4OINF 3GX4X 1YREA 2DW4A 1IXCA 5DCMA 4IRHA 2A6EF 1WWXA 2GA1A 3V8JA 3NEUA 4I7HA 2FBHA 3HSFA 3ERED 2OD5A 2D1VA 4HF2A 2REEA 4RI1A 1P4AA 4B14A 3ZP5A 1G3TA 1S8NA 2OQRA 2REFA 1U2WA 5CLSA 3E97A 1S3ZA 3FX3A 4U9YA 5H86A 1BI0A 3JSOA 1O57A 4HDVA 2FU4A 2PQ8A 5E1XA 3N7ZA 2HUZA 3P2HA 3ML6A 2WSAA 4HX8A 5KVRA 4QBJA 1JHFA 1SFEA 3V7SA 4YRHA 4WXHA 1T0FA 3LQQA 5F6FA 4WCGA 1TW2A 4K2EA 3C3WA 3G8WA 3HTUA 3I59A 1R00A 1RNLA 2H09A 2OU2A 3QPTA 3F0AA 1Y0UA 2D4OA 4IJAA 3HRSA 4ZZDA 3FXRA 1GXQA 2FE3A 3N4MA 3O3KA 1T39A 1REPC 2IA1A 1QGPA 3F8CA 3Q5FA 3I4PA 1R57A 4CYNA 1B9NA 4I01A 1SMYF 4BHBA 2BEIA 5D6FA 4EV0A 2FS5A 1HKSA 1P4XA 3HOTA 1LVAA 1O3RA 3K2ZA 1E2XA 4XNHC 4XBFA 2CSOA 4G9YA 4MEXF 5F46A 4I0BA 5JQ4A 1HBXG 1TLHB 5HS8A 3DR8A 5LEKA 2MBFA 4FHTA 3LA7A 1HSJA 3KETA 2ZW6A 3VWDA 1BC8C 1IN6A 1CF7A 3DQVC 1OKRA 1ZGAA 4P9UA 3BOQA 1M4DA 2I00A 4N0BA 1RUNA 2ACJA 1BBYA 1U78A 2P6SA 4KUMA 3RKYA 2F2EA 2KRFA 2HDCA 2QBYB 4E2AA 5LHIA 1U5TB 4FX4A 3ZMUA 2B3UA 2O28A 4AD9A 3AAFA 4G7ZF 1FBSA 2M1BA 3C7JA 1LDDA 4KMFA 4HLXA 1AOYA 4UWIA 2FXAA 2YNEA 2BV6A 3S6GA 4XSZF 2ESNA 3JSPA 4I98B 2ZJ2A 5LRSA 1EH7A 4RGRA 3F8BA 4IXAA 3RYOA 5E8GA 3W6XA 2HEOA 2CW0F 2Z3LA 1B6AA 4RB2C 3IU2A 5BMZA 2HTJA 1SD4A 1XCVA 5J8FA 3LD2A 1LRZA 1Z4RA 2OB0A 5BS6A 1S6LA 1R7JA 3WU1B 1YX0A 4CO8A 3E5UA 2J5PA <