1MJBA

Crystal structure of yeast esa1 histone acetyltransferase e338q mutant complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
b'ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esa1 protein
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjbA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjbA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjbA02
1UHWA 1Z05A 3I59B 4ORFA 1ZGAA 4IHTA 2X7BA 3SXOA 4CO8A 1JGSA 4HF2A 1J59A 4HF1A 1MK4A 1ZLJA 1TLHB 3JVNA 1N71A 1IIDA 4UWJA 3F8FA 2PLYA 1Z6TA 4ZYHA 2F5DA 4LJZF 1XGMA 2KJBA 1R5GA 4NHJA 3K69A 4RGUA 1O57A 1SD6A 2HQNA 5LGUA 3BOQA 4LLNA 2R3SA 5HLHA 2OH1A 4QUSA 3HYIA 1R36A 4UVBA 4RS2A 2DBBA 2F2EA 3J7AO 4ETSA 2VT3A 1WI9A 3KEQA 5CVJA 3VODA 1DPUA 4KICA 2JTVA 2D4OA 3E5UA 3WG9A 1CF7B 4OAEA 1LVAA 3OWCA 4XPDB 3DEUA 1BC7C 4JLYA 3DSBA 2NNYA 2IT0A 1J4JA 4KVOE 3I54A 2R1IA 3TT2A 3C3WA 4AVPA 4RB2C 1QSMA 4KOTA 4HDUA 3R1KA 3RJPA 1CF7A 3RPUA 1DPRA 3WTZA 2C27A 2HQYA 3GWZA 3RPQA 3O3KA 3P9IA 2XAJA 4I01A 3FMRA 1I6XA 1P4XA 3BP8A 3PZJA 4ESFA 4WXDA 1K6OA 1RI7A 2R7DA 4M72A 2O61A 2PC1A 3H3ZA 3MZHA 3R0JA 1AWCA 2PSWA 3KP5A 5L3FA 2CNMA 1KU3A 2QECA 3Q5FA 3LFKA 5LHHA 1W7PD 2VE8A 4A6DA 2P7CB 4H0EA 5FVJA 4KIGA 2P8TA 5F47A 1J75A 4FX0A 1Z9UA 2IL4A 2DK8A 1STZA 2EUIA 3G8WA 5E1XA 4A6EA 1XGSA 3E5QA 1F9NA 4PGGA 2JZYA 2VBWA 2XHKA 3WTSC 2MLGA 3DQVC 4EM1A 4NB5A 4WK8F 3FIXA 4L8AA 2RV8A 5D8LB 1RUOA 4MNUA 2XASA 1QSRA 1G6NA 1FSEA 1ZGJA 3H3UA 2CO5A 2FEZA 4RB0A 5HDNA 5JHUA 3CUQC 3E97A 3ERED 4PK3A 3F3XA 2NNNA 1QBJA 1V4RA 5FO5A 5H20A 3SHPA 3RIRA 4I2OA 4K30A 3J81Z 1IB1E 4ZYEA 1S3JA 4HV6A 3WU0A 5DUIA 1KQ0A 2D1HA 4UWIA 2LF7A 3TO9A 4NXYA 1LDDA 4KMUX 3QOPA 4A5MA 2OQGA 2IVMA 3CUQB 3GO5A 3LSTA 4OMYA 5K5RA 2JPCA 4K2EA 1FY7A 4I7HA 4M74A 2WWYA 4IRHA 4GYGA 1O7LA 3F21A 4CRZB 5D5WB 4BMHA 3M8EA 3D5LA 2ZCWA 4HLYA 2A07F 2ZW5A 3GXOA 4MBUA 5ICGA 3M8FA 1BI3A 5K5OA 2G7UA 3ZMZA 2FMLA 1ZYRF 4BHBA 1P4NA 5BS6A 2P7VB 3V4GA 5HMNA 4GO1A 1FNNA 3E0KA 5ED4A 3FRMA 2HUZA 1KU9A 4OIRF 3FXRA 1EH7A 1ZHFA 2VONA 4B5PB 1FC3A 4E2AA 4LLLA 3VOEA 2DPUA 5L3BA 4AD9A 1FYKA 4E0AA 2A69F 1X3UA 1R00A 3T1BA 3LWFA 4RGRA 1UB9A 2Q8KA 1YO5C 2Z10A 4IUSA 3S6FA 4IJAA 5HS8A 2QZ8A 1UFMA 2Z33A 2YU3A 1FBUA 1KUVA 3R4KA 4RGSA 2Z9OA 2KIUA 5E17F 3CXPA 2FIWA 2B4DB 4KOWA 1GXPA 4JXRA 3VWDA 1WSUA 4EJUA 1KYWA 3DXJF 2GQQA 4OADA 1U8RA 1MJAA 2ZXVA 4KIBA 1DP7P 1QQIA 4U7DA 2F5FA 5FLXZ 3ZMVA 1I5ZA 1BOBA 4YFJA 3DV8A 3MAJA 4GGGA 3VFZA 3WU1B 1BIBA 2XAQA 2A61A 3HHHA 2GANA 2I00A 4I0BA 2DK5A 5DD8A 3PFIA 2ISYA 5LRRA 2VZYA 5ILVA 1QSNA 5CNPA 2W24A 2B0LA 4Z2YA 1ZH5A 2FSRA 2CQKA 1YK3A 3F0AA 5CLSA 1V3FA 4LUAA 2ZMEA 4LX9A 2HOEA 2KIMA 3W6SA 1P92A 2HGCA 3BPVA 1PU9A 5D8KB 2EWNA 3FYNA 4AVCA 2OAZA 2G3TA 3P2FA 3V8JA 3D0SA 2GE3A 1XSXA 5BOXA 4G94A 4MEYF 3M9AA 2F5IA 1YYVA 1ON1A 4UNOA 1RIOH 3FNCA 4RB1A 1ODDA 1J5YA 5ILSA 2I79A 1G3WA 3F8CA 2K02A 1JHHA 1T98A 3BDDA 2VODA 5F6FA 1HKQA 1HW1A 3DKWA 5FLXK 3V7CA 1J9IA 3I9SA 3MQ0A 2ESHA 2PFBA 3REOA 2CNSA 2BUEA 2YR2A 4KORA 3OV8A 4KOXA 1JXSA 2ISZA 1W5TA 2E7XA 2VEZA 4EVYA 3ZP5A 1Z4RA 2D2WA 2ZW4A 1SAXA 3HOSA 3S6KA 1BI2A 4G6DA 3KCCA 1IRGA 2WC2A 5H86A 2P5LC 5FD6A 2E1CA 1G3YA 2Y0MA 4ONUA 4KN4X 3QU3A 3KP4A 3DDDA 1U6MA 2MH2A 1LJ9A 4KOUA 4E8OA 2QYOA 3FHZA 1REPC 3TDUC 4Y17A 2BGCA 3PP9A 4JD6A 2OU2A 4CICA 1U5TA 4UVAA 5J6XA 2FS5A 1B9NA 1E2XA 3NRVA 4MHDA 5GCNA 1C0WA 2P5VA 2P0WA 1KQ9A 3C1DA 4EV0A 1B4AA 2EA4A 2G7HA 3EY5A 4UHTA 3R95A 4QBJA 3QPTA 2HDCA 4AIHA 4XBFA 2EFNA 3JSPA 3EUHA 1T6SA 4L5JA 2Y48A 2B4BA 3KLNA 4H6ZA 3M7GA 1O3RA 3W6KB 1HXDA 3ZZIA 3KP3A 4ZH4F 4LB6B 4WWCA 1IAWA 2QWWA 1BM9A 1A04A 1I1GA 3SFZA 1EH8A 4RB3C 2HV2A 3LA2A 2VBQA 3IWZA 1YG2A 4EJTA 3DP7A 2B5GA 1H0MA 2KIFA 3ML6A 4YGOA 5L3EA 3GFMA 4M85A 1I12A 1HKSA 1YW9A 4QLCU 2IJLA 2ZW6A 4M73A 4YFKF 2QIRA 2CY2A 3CLOA 1HW2A 1R1VA 2A6EF 4PSXA 5LLQA 2PQ8A 3BLNA 1XEBA 5BQTA 4CAVA 5DWMA 2XKPA 1OYWA 3VB2A 3QRFF 2FCKA 3Q9VA 2HQRA 5D5VB 3WTTC 1IYLA 1KUYA 3GF2A 1OMIA 2L4MA 4HV5A 1FT9A 2ZBKA 3KEOA 5TRDA 2EB7A 2C6YA 1QZYA 1T39A 4ZYDA 1FYLA 5AIPA 1KZFA 4XSZF 4AVAA 1XCVA 2W25A 1JE8A 2JDDA 3I3GA 2AE6A 1MDMA 2L3DA 4ENMA 3E5XA 3V7RA 1IICA 2J8RA 3NEUA 5I0CA 4FX4A 2GA2A 1B6BA 3TTHA 5L3GA 3C7JA 1YS6A 2V79A 2DI3A 2G0BA 1XGNA 4PZJA 3PQJA 3WTWC 2L01A 1ZLKA 4GXOA 2NS0A 4XPDC 3HTUA 3DF8A 2PDOA 1YVOA 2BL1A 5CVRA 4AG9A 1KA8A 3K0LA 2M45A 3G3SA 3J80K 2W84A 4KOYA 3TO6A 4CAXA 1R5HA 2ARHA 3WGIA 2MA3A 1IUYA 5CJ9A 3WTXC 2HZTA 5LEJA 1YIOA 4KVXA 1B87A 4A0ZA 1EV7A 5LGTA 4KZTA 4R9MA 3GLXA 4OIOF 5H6QA 2RDPA 4LGWA 2QLZA 1FYMA 2YSRA 3IWFA 3W6JB 5CVIA 4OINF 2FT0A 1YREA 5IT9K 2Y75A 2BEOA 3TO7A 4HQMA 3ZQ7A 1SD5A 5E20A 2QQBA 2ZFWA 2B3VA 3QP5A 3HUGA 3ELKA 2CNTA 2RNJA 3FXQA 2HFHA 4FD4A 2ZNYA 3H92A 5HOOA 3F72A 2VE9A 3U2RA 2VI7A 3L00A 2DAOA 3F5BA 2EFQA 2IA1A 2H09A 5K5QA 4MJ8A 4KLWA 5KVRA 4M9SA 3F6VA 2BE5F 3IRQA 2K7LA 4AG7A 4A0XA 3I58A 3KKWA 1K7AA 3FM5A 2P4WA 4BYYA 1W7PA 1CGPA 5AONA 4A12A 3MZYA 1HSTA 1Z1DA 2Q4YA 3MCZA 4NSQA 1KYZA 2P5KA 2QQAA 2NYXA 1UCRA 1I21A 2DU9A 3LD2A 3ZJ0A 3CO7C 5BPDA 1KU2A 4S05A 4U5YA 4I09A 2UZKA 2QUFA 4U0WA 2NRAC 2VOPA 3TOBA 3FF5A 4IPAA 3I53A 3P2HA 1K79A 3BJOA 2PJPA 3KZYA 3ZMUA 3R9GA 4YRHA 1TTYA 4OLLA 5LHGA 3I71A 5DYMA 2EA2A 2XAGA 4NF1A 4CZZA 2G3AA 1YLFA 3EC4A 2KJCA 2O03A 1LNWA 4X5KA 3V7SA 2XVCA 2DQRA 2G9WA 3JTHA 2LSOA 2GXGA 4XRFA 4KUAA 3I5UA 4U0YA 5EBVA 3LA7A 5LRSA 4KOVA 2QM3A 3P7NA 1LEAA 2EJRA 5E96A 1FPQA 5E18F 2R98A 2MLKA 4AWXB 5KTCA 4HZFA 3ECOA 3WTYC 3ECHA 4EGYA 5JR3A 4HF0A 3R0AA 4HLXA 4ENNA 3EQLF 5DD4A 2V1UA 2JDCA 1FX7A 2PN6A 1L0CA 1YR0A 2RVCA 1ZRDA 5CYVA 3MWMA 2ATRA 3FWEA 1NSLA 2EK5A 3CXSA 4HNYB 1OYYA 2VBYA 5F64A 3JSOA 5J8CA 1GHEA 3I0TA 1Q1HA 3F8KA 1IZ1A 3U1DA 3M1EA 1FBQA 1LDJA 4XPLA 2AJ6A 1S7KA 2V6CA 2ACJA 3SZPA 2H27A 2MD5A 4CAWA 2CFXA 2Z3YA 3RI4A 1Z9CA 3R60A 4TV7A 1FBSA 2YPRA 1S7OA 2FNAA 1VTNC 4BNCA 4U0VA 2X0LA 4AIJA 4BAYA 1BI0A 4R3LA 2ZXJA 2R7FA 4R57A 2ZJ2A 4GS4A 1TNTA 5E1WA 2D4PA 2ZO4A 4EMSA 4U88A 4M9XA 3R61A 3MEXA 3GY9A 4HKFA 1I1DA 2OBPA 3TKYA 2HEOA 1O3TA 2FXFA 4FD6A 2DLLA 3WODF 3TE4A 5E8IA 1CJWA 1BOAA 1Y0UA 3DFGA 1JHFA 5DDGA 3GKRA 1IN4A 3GFJA 2OB0A 4CRYB 3KZZA 1QGPA 3Q9SA 4H89A 3N7ZA 2JSCA 2ZMEB 3R6SA 3SZTA 1NHAA 2UXNA 2XIGA 1LEBA 1BO4A 1L0OC 3I4PA 4BHPA 2YX7A 5LGNA 4MHGA 1B1BA 1RO5A 3QU6A 3DPTA 3OOPA 1HW5A 2CWEA 4P96A 1PP7U 3EDPA 2PG4A 3RYRA 4L5IA 4M3SA 3AAFA 5K1YA 2XAHA 4HNWB 1TQPA 4P9UA 4KVME 4MI4A 3LQQA 1HBXG 5AIQA 3F23A 2LKPA 3GVAA 2FXAA 4WCGA 4PDKA 3K1MA 1S5KA 4IRIA 3EETA 3V8IA 4Q47A 3ABUA 1AOYA 2P6SA 3E6MA 1HKTA 1ZG3A 1IXRC 3HRMA 3CUOA 1GVJA 5D5UB 1F4KA 5KK1A 4OMZA 1U3EM 2F5CA 3LODA 1U5TC 1H9GA 2Q04A 4UXNA 2VBXA 5LEKA 4Y49C 5ILUA 4KNYA 5H84A 4HA8A 1ON2A 4JQFA 1D5VA 3W91A 1IN7A 4PCQA 4R8HA 3HOTA 3IRRA 5HS9A 3EO4A 4J3GA 3LAPA 2STTA 4R3KA 1M4GA 3E6BA 2E7WA 3ZN0A 3HTSB 2XGXA 2NMTA 4QVTA 1SMYF 5D4SA 1OKRA 4F0YA 1U2WA 3FMQA 1P0HA 5JI6A 1U5TB 1S60A 2O8XA 2RGVA 4NQWA 5JFRA 2XRNA 2CW0F 3ZMSA 3E6CC 2XUBA 3KP7A 3EXNA 4Y49B 3KFWX 4Y13A 3F8NA 4EJVA 4A5NA 2PEXA 4M9ZA 5ICCA 1MGTA 1VHSA 1YW8A 2WTEA 4EM0B 1YFHA 1J7KA 4YFNF 1B59A 2K4JA 4M71A 2J8NA 2JPBA 2P6TA 1FOKA 2AS5F 2LNBA 4CDGA 4IRGA 2FMYA 1M1DA 1UHMA 3KP6A 2Q0YA 2D45A 2B3UA 4KYWA 1XSVA 5HS7A 3FZVA 3HSEA 3FX3A 1ZAOA 2B5GB 3ZPLA 2KKOA 2IRFG 2CGPA 3GYAA 1V0CA 5EEGA 2ZNZA 3G73A 1IN8A 4L9JA 4G8XA 2FE7A 4FT8A 2O6GE 3TGNA 2FBKA 3F6OA 3T9YA 4EJOA 4CGZA 1XMKA 3JAMZ 1BN5A 5BPIA 5TJJA 4ZBGA 1OZPA 5FGMA 3KP2A 3J80Z 1YTYA 3RYPA 1T2KA 2VQYA 4P55A 3O2PE 2GAUA 1FP1D 1BJAA 2YX4A 4L0YB 4HX8A 3V8LA 1S29A 4N0BA 4RGXA 4I49A 1UFHA 3WGGA 2R7HA 3EYIA 4ESJA 4R87A 4I98B 1SD4A 4I02A 4QC6A 2VXZA 4KMFA 3CDHA 4A2UA 2EFWA 1B9MA 5A2QK 1RZ4A 1F5TA 4NEXA 2REEA 5IT9Z 2DO7A 2VT2A 3KLOA 4ESBA 1MDMB 2UWMA 2E1NA 3QPHA 1D8KA 2OA4A 5JQ4A 1Y9KA 3ZMTA 1S3ZA 5JPHA 2OQRA 2K4BA 3GZ6A 3CO6C 2EVNA 4MEXF 2GWRA 2O0YA 1S6LA 1D3YA 5ICFA 1XF8A 2FRHA 4II9A 4EGZA 2FBHA 4FD7A 1T0FA 2HKXA 3ABTA 4GCVA 4RAZA 5DEQA 1YS7A 2J8MA 4KIFA 1FZPB 2R8VA 4ASNA 3FBUA 2M87A 3GZ5A 4BXUA 1RNLA 3HRUA 4WXHA 4HAMA 3JAMK 2W85A 1BC8C 4YIFA 2Z99A 2ZW7A 3RKYA 1R7JA 5HLIA 5HLGA 4N9HA 1G3TA 5EC4A 1U78A 3QAHA 3S6HA 1BBYA 3L7WA 2XAFA 2Z11A 2FL4A 1WWZA 5H6RA 3U9GA 2V9VA 3WR7A 3BY6A 4PGHA 1P4AA 3BZ6A 4U9YA 5DCMA 3B8GA 1XDUA 1D8JA 3I59A 2AXLA 4F6AA 3MGDA 2CYYA 2JEVA 4B8XA 4BQAA 3E3VA 4U9ZA 4Q4ZF 4O3MA 1RXTA 1WK4A 1M4DA 2ZPAA 3COAC 2O3FA 1Q2DA 1USSA 1H9TA 2DTRA 3QP6A 2HWVA 4UV8A 2PR8A 1W4MA 2Q44A 3GW2A 1S8NA 1XDSA 4Q48A 2HTSA 5D4RA 2QQ9A 3K1PA 2RQPA 2FU4A 3JTGA 2A68F 3FB3A 3IL2A 4RAYA 2L4AA 1Z6RA 1ON0A 1NMTA 2GA1A 1W7PB 1P6RA 1QNTA 4OIPF 2VC0A 2BBYA 1WWXA 4HOBA 3VEPA 2K27A 2EFPA 1J2XA 1E17A 3O6BB 2FA5A 4RS8A 2XKOA 4WXCA 4YG2F 4UA3A 2IA2A 5L3CA 2A3SA 4KN7X 1MKMA 1IRFA 1USTA 2RKHA 2COMA 1TQIA 3P9KA 1QSOA 2WPWA 1OR7A 3N97A 4BH9A 4IHSA 5ISVA 5ICEA 1Z91A 1IF1A 1ZN2A 2VN2A 2HYFA 1TNSA 2ELHA 5FD5A 2Q4VA 2A5YB 3N4MA 2EFOA 4G7HF 1WKMA 4UUVA 1YQAA 5F49A 3T8TA 5E8GA 1PUAA 1IXSB 2OD5A 3HIFA 2EV0A 4FD5A 4Q5SF 1R58A 2IPQX 2HKOA 4CHUA 1SFUA 4KUBA 2FIAA 1SD7A 3SXNA 4MTDA 4XSXF 2BSWA 4HW0A 3T5XA 2OZHA 2TDXA 3S2WA 3HSFA 1MD0A 2B58A 3IWGA 2XV4S 2KCWA 1NE9A 4OOIA 4M6XA 4G6QA 1R22A 1W5SA 1TBXA 2BV6A 1M44A 4ENJA 4HX7A 5D6EA 2ZKZA 2PR1A 1O7FA 1Y9WA 1G3SA 2OZUA 5HVQC 2HR3A 2PI0A 1IYKA 1BI1A 2GZWA 4P9FA 1FSHA 3B73A 2Q7BA 1PUEE 1KUXA 3HRTA 1EH6A 1ULYA 2A4NA 3C18A 2QENA 4L9NA 4IF4A 1J0RA 1ZG1A 1G4DA 2VC1A 4R1HA 4JBAA 4LMYA 3BJ6A 4UVCA 1B6AA 3BWGA 2ETHA 4KUMA 4N9IA 4OIQF 4JJXA 1IN5A 2HYGD 2F5EA 3HHGA 6PAXA 2VZZA 4H6UA 3B02A 1L3LA 1LB2A 2X4HA 1KU7A 3ZMDA 3LAJA 2DFIA 4G9YA 3IGRA 2M5WA 2LF8A 4I0AA 1WQ2A 4O6JA 3SXYA 1KQ8A 3NE7A 4EQQA 1R23A 3G3ZA 5D6FA 3TCVA 1U6GA 3F8BA 5CVVA 3KE2A 4L9TA 1TQMA 2J5PA 4RI1A 3CUQA 1XIXA 4KDPA 1R1UA 2PMUA 2OZ6A 3P9CA 4LD5A 3L9FA 5C88A 2Q0OA 3WE2A 1MZBA 4HBLA 4PV6A 2DXQA 5KTDA 3R9EA 4G7ZF 3WTVC 5JVTA 4HQEA 3C26A 4MY0A 2M30A 1Y7RA 2M1BA 4S04A 2DT5A 3DR6A 1XD7A 2Q2EA 1KGSA 4IXAA 2PBIA 1K78B 1SQHA 4Y15A 2JLMA 1YW7A 3BROA 2QVOA 2MC3A 3RTRA 4MTEA 4KA4A 1TW3A 1SFXA 3EYYA 5HDGA 3T8RA 2IA0A 4B5PA 2L54A 1RUNA 1BIAA 4F7ZA 3L09A 4CXFA 3L2CA 3RKXA 1LRZA 3J81K 3LA3A 3NQOA 1SFEA 5F46A 4ZZDA 3I64A 2XROA 2UXXA 1I27A 4P5OA 1K78A 4KLVA 5BMZA 1GHCA 2KRFA 5IB0A 2HTJA 2STWA 3K2ZA 4ENKA 2VOOA 1XE4A 1GXQA 3GYHX 3HRSA 1ZREA 3GEZA 4EJWA 1R1TA 4EVIA 2D1VA 5FFXA 3LQRA 4EM2A 1QO0D 2B4DA 2EV5A 2RN7A 2ADUA 4MY3A 1K4JA 5E1ZB 3R96A 3FM3A 4LLGF 4B5OA 4LFUA 2K5TA 2MH9A 1ZARA 3JW4A 2M8EA 3D3SA 4ZYGA 4KFCA 4L89A 3W6XA 1ZRCA 4ON0A 1FP2A 3QB8A 2DW4A 1DUXC 2P6GA 4JWPA 2BYVE 1R57A 4D0PA 3BJ8A 4WX9A 4KOSA 4XLPF 1Z7UA 3DR8A 2JT1A 4HYEA 2RC4A 3VWEA 1I1SA 1T38A 3CTAA 5DCFA 2FBIA 3PQKA 2FSWA 3ZN1A 3K9UA 4L0ZB 2DPDA 4G7OF 3TDZC 2CSOA 4LG0B 2GXBA 1XN7A 4M6YA 1XCBA 3S6GA 3FXUA 5HH1A 4AVBA 2Z5UA 4U7BA 3SQNA 1O3QA 3D2PA 1FWZA 1XGOA 2Z0ZA 5EEHA 2PRBA 4DNCA 5CVUA 4MQ9F 3KETA 1S7AA 1Q2CA 1XMAA 3CJNA 5ERIA 2J5OA 4LG0A 4KT5C 3MFKA 4R79A 2JRTA 1ZRFA 3K9TA 1ONVA 1YVKA 4XNHC 5FFZA 5DUKA 3GUDA 3TOAA 3IKVA 4WF2A 2BEIA 1IN6A 2P6EA 2WV0A 1SMTA 1F1ZA 4QB9A 3R9FA 1XMTA 1LDKB 2A6HF 1P2FA 4UV9A 5A2QZ 3F8MA 4LB5A 2FQ3A 3BPXA 4L18B 1TIQA 1O3SA 4NCZA 1YGHA 4XNHB 5LHIA 2QMLA 2NAZA 1MJ9A 4MGRA 3WE3A 4E70A 3BJ7A 3CXQA 3RYOA 4FHTA 1WRJA 1IXCA 3SHFA 1YX0A 2P6FA 2V1XA 4LK0F 1DDNA 3FXTA 2QBYB 3T0YA 4XLNF 2ESNA 1CM0A 1HSJA 2FF4A 3TFYA 3JUWA 4MQVA 5C82A 2W57A 4JK1X 4HNXB 5LBQA 3UY5A 3WTUC 2H6BA 3ULQB 2QBYA 1S7FA 1Q2YA 2FNPA 1QSTA 3EFAA 3E6DA 2IW5A 1Z4EA 2OZGA 1ZG5A 4DQ2A 3BJAA 4CS0B 3WGHA 3GFIA 4GYIA 4BHCA 5J8FA 2REFA 3ISPA 4PSWA 2H5MA 5F1RA 5DWNA 1LQ1A 4O5VA 5IX3A 2VXKA 1PDNC 5FB2A 4AIKA 3GFLA 3V8KA 5DV5A 4IVNA 3IKTA 1S7LA 5D5XB 2H6CA 2WPXA 1OYIA 3DPLC 2LDUA 3GX4X 1XSDA 2DQLA 1M4IA 2FE3A 3K1NA 1MJBA 2CG4A 5IT3A 2HS5A 4L9VA 4ZZLA 4CYDA 3PGPA 3IHUA 4IF5A 2VBZA 1VKCA 1HQCA 4PK2A 3TQNA 1IW7F 4A0YA 1FLIA 3T90A 2IP2A 3H4QA 5IV0A 1QZZA 1YLEA 3FMSA 4YIIA 5KTAA 4OU0A 3F22A 2PMHA 2K86A 2FOKA 4HDVA 4QWQA 1PP8F 4JXQA 2H94A 3RDIA 4XPKA 4HX4A 5HDKA 2MBFA 5F48A 1QPMA 3HSRA 3IC7A 4UBRA 4AB7A 4B09A 1XB4A 4LK1F 1P4WA 2V1DA 1S7NA 3DNSA 2O28A 2GIVA 3RKWA 4YFXF 3ROUA 2EV6A 3D8PA 5L3DA 3D2MA 1TW2A 2L02A 5DCMB 1OPCA
chains in the Genus database with same CATH superfamily
1UHWA 1Z05A 2KL4A 4C2MJ 3BJIA 1CQTA 3VH9A 3I59B 4ORFA 3FHNA 3BZCA 4PXEA 1ZGAA 5DS9A 1Y1BA 1QHHD 4IHTA 4G12A 3HDDA 2X7BA 3SXOA 3S32A 3BG3A 1JGSA 4CO8A 4MHPA 4HF2A 1J59A 2BOLA 4HF1A 1MK4A 5AG5A 1ZLJA 1D1BA 1TLHB 2O9LA 1ELLP 3FVLA 3JVNA 1N71A 1IIDA 2M2EA 2JA7J 4UWJA 3F8FA 2PLYA 1Z6TA 4ZYHA 3W2AA 1QU3A 3AG1H 2F5DA 4LJZF 1CT2I 1XGMA 2BW3B 1G8XA 2KJBA 2V8VA 1R5GA 3OIQA 3SZGA 4CCLA 4NHJA 4B6DA 4WJBA 4CAEA 3PB8X 4OVOA 3Q0WA 3FSYA 4O23A 3K69A 4RGUA 1O57A 5G20A 1SD6A 2HVRA 1F2PA 3NH8A 4IHYA 2GOMA 2HQNA 3CCMI 5LGUA 3BOQA 4DYCA 4LLNA 2R3SA 2VASA 2K9MA 4DW6A 5HLHA 2IGKA 2OH1A 2QQ0A 4XN0A 3HYIA 5EZHA 1R36A 3PBEA 4QUSA 4U87A 4UVBA 4RS2A 2DBBA 4C2ZA 2F2EA 4GXHA 3HZJA 4ZDPA 3J7AO 3K7AJ 4ETSA 2VJIA 2VT3A 3WU2C 1OR7C 2VQCA 5AG7A 1WI9A 3KEQA 5CVJA 2E35A 3VODA 1DPUA 1Q7LA 5DCMB 1WTJA 5GP9A 3FX6A 4KICA 1TZLA 1YJ9I 2JTVA 4MFEA 2VL8A 1A31A 2FQ4A 1UG0A 4GFBA 3E5UA 4D9JA 2D4OA 3TC8A 2QKLB 3WG9A 4NBQA 2M9HA 2QPOA 1W1WE 1SANA 3K4KA 1CF7B 1HJAI 4OAEA 2LMDA 1LVAA 2BHZA 1LANA 1ZG8A 3OWCA 2B7EA 4XPDB 3B2YA 3DEUA 5J47A 3OYGA 3OYEA 1BC7C 1MBHA 4JLYA 2Z3MA 3DSBA 2NNYA 2IT0A 2SGQI 1J4JA 4KVOE 3KASA 4OKOA 3I54A 1IY7A 4A3MJ 2ZOGA 3HM5A 2R1IA 1O4XA 3TT2A 3C3WA 4OAYA 2EK9A 4AVPA 4RB2C 1QSMA 4KOTA 4HDUA 3R1KA 4KSAA 3RJPA 2RNGA 4GDFA 2Y2ZA 4IOAF 3K4NA 5JHFA 1CF7A 3RZAA 3K4BA 3RPUA 1DPRA 4CCKA 2DT6A 3WTZA 4E7JA 1YHQI 3HOUJ 1GYTA 4W97A 4UB6C 1KMAA 3GWZA 1TT0A 3RPQA 2C27A 3O3KA 4F3QA 2JXDA 4F93B 3P9IA 4KITB 2VPRA 2CJSC 2XAJA 4I01A 3FMRA 3A0BC 1I6XA 1P4XA 1H0ZA 1ZELA 3KQXA 1T33A 4YU9A 4I99C 2L9NA 2ELKA 3OYAA 1OYVI 4A3JJ 2A05A 3BP8A 1JUSA 3DTIA 3PZJA 4ESFA 4WXDA 4OC4A 5FUWA 1K6OA 1RI7A 1SVOA 2R7DA 1WJBA 4M72A 2O61A 5C4JJ 2PC1A 4P4BA 4NGRA 1SGYI 1ULMA 3H3ZA 3MZHA 2NS8A 4XLAA 1TWFJ 2KDOA 3R0JA 1AWCA 3OSFA 3QODA 3ZQLA 3B7IA 3WC5A 2PSWA 3KP5A 5G21A 1XPXA 5L3FA 2CNMA 2H8WA 1PUFA 1KU3A 2QECA 3T8WA 5J1QA 4FD5A 3Q5FA 3LFKA 5LHHA 1W7PD 1WJEA 3I56I 2VE8A 2X6OA 4A6DA 3JRCA 2P7CB 1PJUA 4BDZA 1FOWA 4H0EA 4KIGA 5F08A 1YTPA 5GADJ 5FVJA 4B12A 4C2XA 1IV8A 2P8TA 1LFBA 4A3EJ 5F47A 1J75A 4FX0A 4A3DJ 4J19A 1Z9UA 2DK8A 1STZA 2IL4A 2EUIA 1MMSA 3A9LA 3G8WA 5E1XA 2Y9YA 1XGSA 4A6EA 4CAFA 3E5QA 1F9NA 1WVRA 4PGGA 5LFAA 1P9QC 1AHDP 5C4XJ 2KRCA 3SDGA 4KS9A 2JZYA 2VBWA 1Z2IA 2XHKA 3WTSC 2F3CI 1Z7KB 2ICWG 3KEYA 3BTJA 3CMEI 2V9PA 1K4TA 1IUFA 2MFZA 1IW4A 2CJJA 4D5FA 2XPWA 3BR3A 2MLGA 4BU2A 2QSGX 2J87A 2H1LA 3DQVC 2CQQA 4EM1A 4NB5A 4WK8F 3GIUA 2NXNB 5KAFC 3ABLH 1NUBA 1NXUA 4LIVA 3FIXA 2RV8A 5D8LB 3CXLA 4L8AA 1OCOH 2OCEA 1RUOA 2GKVA 1CPXA 4MNUA 2XASA 2DTZA 1BR4A 1ZGWA 2DMQA 1QSRA 1G6NA 2LY1A 3OYIA 4JX5A 1FSEA 2GKRI 1ZGJA 3H3UA 2CF4A 3KY9A 2EZLA 3KR5A 2CO5A 2FEZA 3FBNB 4RB0A 5JH9A 1D1AA 4BQOA 5HDNA 2IBDA 5JHUA 3CUQC 3E97A 3ERED 1A5JA 3F3XA 4PK3A 2NNNA 2PJ3A 1QBJA 1MBKA 1ORKA 1V4RA 3OS0A 1PCEA 4IK2A 5FO5A 4YIRX 5H20A 2SGFI 2F4IA 3TW7A 3SHPA 3OS2A 2FD5A 5FLVA 3RIRA 2I3CA 4MCRA 1TBNA 3N05A 1FTTA 4I2OA 1HEEA 4K30A 3J81Z 2WV1A 4AYBN 2ANPA 1IB1E 4ZYEA 1S3JA 3I3LA 4HV6A 3WU0A 5DUIA 3J7YJ 4AM3A 3A03A 1KQ0A 1Y8FA 3QAYA 1X12A 2D1HA 3QYBA 3H9QA 5J40A 1QPIA 4NC7A 4FE7A 2ELIA 2LF7A 1K61A 2NSMA 4UWIA 3TO9A 1NK3P 3KHXA 3GUXA 4MFDA 4NXYA 1LDDA 1D0YA 2XB0X 2ZJRF 3HOVJ 4KMUX 5EZGA 4B6ZA 1XTAA 4OC3A 1HCRA 3QOPA 4A5MA 2MD0A 3K4CA 2OQGA 2IVMA 2CFOA 2AFMA 3CUQB 5FJ8J 3GO5A 1R71A 3R5BA 5G22A 3LSTA 4OMYA 1MMAA 5K5RA 1X19A 3CQZJ 4JCVE 3VATA 1WPKA 1PTRA 2JPCA 4K2EA 1FY7A 3HBLA 3QQAA 3LSPA 2DA4A 3FEEA 4FKDA 1MSFC 5FKKA 2WZNA 4I7HA 4M74A 2WWYA 4IRHA 4GYGA 1VQ5I 2OR4A 2KISA 3D7FA 1O7LA 3F21A 4CRZB 5D5WB 2JZMA 1FEXA 4BMHA 2X85A 3ONQA 1XX6A 3PEIA 3M8EA 4B43A 1SGQI 4A94A 3D5LA 4KSFA 3DLLF 2V9KA 2ZCWA 2M3AA 1CGJI 4HLYA 2F5VA 1YRNB 2JW6A 4BBHA 5EYRA 4UEFA 2XF6A 2XDVA 2A07F 2WY8Q 3GXOA 2ZW5A 3BT9A 5ICGA 4HKFA 3M8FA 4MBUA 3HL2A 2ABZA 1BI3A 5IP9J 2OTJI 3ZQIA 1HDLA 5K5OA 2XAUA 2G7UA 2OTLI 3DU5A 2HPIA 3ZMZA 2FMLA 1ZYRF 4BHBA 3S15J 1P4NA 5BS6A 2P7VB 3V4GA 5HMNA 4GO1A 2Q2EB 1FNNA 1ULKA 4P44A 3E0KA 1IDZA 5ED4A 3FRMA 1VGYA 2HUZA 1KU9A 5IOYA 4OIRF 3GTOJ 3FXRA 1YQEA 3MKLA 1EH7A 2AFUA 2DJNA 1ZHFA 2VONA 3CDXA 2BY3A 4B5PB 4P4EA 1FC3A 4E2AA 2KZVA 1F43A 4LLLA 3IJ3A 3VOEA 2DPUA 4MFZA 5L3BA 1Y6IA 4AD9A 2HXIA 1FYKA 3JRDA 4MXUA 4E0AA 4NFRA 2A69F 1X3UA 1R00A 3T1BA 3FECA 2JSPA 4XNFA 3OYBA 3LWFA 4RM3A 4UIAA 4RGRA 5FUYA 1UB9A 3X2QH 3B35A 3RO0A 2Q8KA 2QSHX 3L1PA 1YO5C 2Z10A 4B11A 1RKWA 3S2DJ 3IP4B 4IUSA 4UXIA 4EFDA 2H8RA 2EWBA 3S6FA 1XMXA 4R8FA 4IJAA 5HS8A 2QZ8A 1ELMP 1UFMA 5EX0A 1EJ9A 2Z33A 2YU3A 3LSGA 4XONA 1XA6A 1FBUA 3FMCA 3ZOBA 1KUVA 2L9SA 3R4KA 4RGSA 2Z9OA 4I76A 5LRKA 2KIUA 5E17F 3CXPA 5FLMJ 2JA8J 1LUJB 2FIWA 3PO3J 2B4DB 5J4YA 1SVLA 2R7WA 1ZQ3P 3K4LA 3M07A 1YSJA 4KOWA 4C7IA 2CW8A 1GXPA 3W6VA 2R7UA 4JXRA 1WSUA 3PBBA 2HZDA 3VWDA 4EJUA 1KYWA 1HEVA 2N1AB 3DXJF 2GQQA 2ZEEA 4OADA 1U8RA 3LL7A 4C3IJ 1MJAA 3NE8A 4HNTA 2ZXVA 4KIBA 1BMOA 1EF4A 1DP7P 1QQIA 1I39A 5B1AH 2F5FA 4IQ4A 4U7DA 3CCVI 1MMDA 1WJ5A 1X4OA 3G1OA 4RA2A 1BOBA 5F04A 1I5ZA 3VSKA 5IYBJ 3ZMVA 5FLXZ 3RZDJ 4YFJA 3DV8A 3MAJA 4Y7NJ 1ZG9A 4GGGA 4RMNA 1IRZA 1VHOA 5GAHJ 2ZXHA 1WJAA 3UEJA 3VFZA 4ZTFA 3WU1B 1BIBA 3OOUA 2VUMJ 9WGAA 2PVWA 3IFEA 2XAQA 4B10A 3MD2A 4B13A 2A61A 2KCXA 3HHHA 4RLFA 2F4MB 1CSOI 5EDNA 2GANA 2I00A 4I0BA 2DK5A 2PCUA 3CESA 5DD8A 2WUUA 2CMPA 2WAEA 2M0MA 3PFIA 4EVYA 3UOEA 1K7TA 2LREA 2ISYA 3SDBA 2X3TA 5D29A 1U5KA 5E3PA 5LRRA 4ANJA 4XKBA 2VZYA 3I4NJ 3OYDA 3M8JA 1E3PA 3NAUA 5IOZA 5ILVA 1QSNA 2W24A 2B0LA 4Z2YA 3WHBA 1ZH5A 2FSRA 5CNPA 2CQKA 1R79A 3H0DA 1GV5A 2JUGA 1YK3A 2X9DA 1IG7A 3F0AA 5CCLA 4DGWB 2W82A 2VIXA 4F92B 3UNGC 5CLSA 4BJ6C 1V3FA 4Z65A 1EA3A 4LUAA 4C2YA 2ZMEA 3G2BA 4IHXA 1FNOA 2E1OA 1Y7EA 4LX9A 2HOEA 5M3FJ 2X6XA 1JI8A 2KIMA 3IO1A 1ARLA 4BEHA 3NWSA 3KX2A 5DM6F 3TW6A 3W6SA 1P92A 2HGCA 1CP6A 3BPVA 4NGSA 1PU9A 5D8KB 1LAMA 2CQ7A 2EWNA 4E7HA 3FYNA 1F2OA 4CYPA 4AVCA 2WCYA 2LVSA 2OAZA 2G3TA 3P2FA 2A5WA 3V8JA 1CP7A 2POKA 1HLVA 4QTRA 3M4OJ 3ISZA 3D0SA 2E73A 2GE3A 1XSXA 5BOXA 2CW7A 4G94A 4MEYF 2AFWA 3M9AA 4X1EA 3PNVA 5DAEA 1S20A 2F5IA 1YYVA 1QVUA 2HQAA 1ON1A 3M1CA 2L9VA 4E7KA 1F57A 4UNOA 1RIOH 3QYFA 2FVGA 1LR9A 4RB1A 1B72B 1BW5A 3BTLA 3FNCA 1BA5A 1ODDA 5HVHA 1J5YA 4RAFA 1D5YA 1H8AC 4LQ6A 3RZOJ 2JEWA 2DA5A 5ILSA 2I79A 2E1MC 3TJQA 1G3WA 4F55A 4MPIA 1Z21A 1Z77A 4CGNA 3BG7A 3F8CA 2AO9A 2VQHA 4F9UA 2K02A 3BCBA 1JHHA 4CYOA 2E2IJ 3JRIA 2G0EA 1T98A 3BDDA 2VODA 3VARA 4M3GA 5F6FA 3Q0VA 4YELA 1VQ9I 4BE2A 3SJEA 1HKQA 1ITYA 2Z3OA 1HW1A 2YNEA 3DKWA 4ZC3A 3SFIA 5FLXK 2DMNA 1YW4A 3V7CA 1J9IA 2M7AA 3I9SA 3MQ0A 2JVGA 2Y0SA 2ESHA 2PFBA 3QWPA 3REOA 4RBOA 2CNSA 2CIJA 3BI1A 2BUEA 4A3KJ 1YW6A 2AQFA 2E5ZA 3D4UA 2YR2A 1MMNA 2LKSA 2K3PA 3OV8A 3Q3SA 1DS3I 4KORA 4KOXA 2YU9J 1JXSA 4M6HA 4N4OB 2ISZA 1W5TA 2E7XA 3FBIB 2MSYA 2E1MB 2NU3I 5E3NA 1GLNA 3S8PA 3ZP5A 1H89C 2VEZA 1IU8A 2N17A 1Z4RA 1K7VA 2D2WA 3UR3C 3RNZA 2DOFA 2ZW4A 1SAXA 5M5WJ 2GLFA 3WC7A 3HOSA 1DQUA 1D0ZA 3S6KA 1BI2A 2HXOA 4G6DA 3KCCA 1TWGJ 2MABA 1IRGA 2WC2A 3VYUB 3PIPF 5H86A 2P5LC 1S72I 5JGFA 5FD6A 2E1CA 3B3SA 1G3YA 2Y0MA 1MBJA 2JA2A 4KN4X 4ONUA 5FKLA 5AGEA 3KP4A 3QU3A 2PJ6A 2DOEA 3O8GA 2ZENA 3DDDA 1U6MA 3FXKA 2MH2A 5GTHC 3PUFA 2L2OA 1LJ9A 1PJRA 4ITVA 1JKQC 4KOUA 4A30A 1FMWA 4E8OA 2QYOA 2LG4A 3FHZA 1QZEA 4BXFA 1REPC 2R5ZB 2KPMA 1Q1VA 1I3QJ 3TDUC 3KIOA 4Y17A 2BGCA 4UFWA 3PP9A 4JD6A 2OU2A 4CICA 5LRGA 1U5TA 4UVAA 5J6XA 2FS5A 3PRTA 4FWUA 2DCEA 1B9NA 3WHCA 1MNDA 3CCUI 1X4SA 3IU2A 1E2XA 3NRVA 4MHDA 5GCNA 2COBA 5JLWA 1LFWA 1C0WA 2P0WA 2P5VA 4FASD 3HUVA 1KQ9A 4ABZA 3C1DA 2XF7A 2DOAA 2LEOA 4EV0A 4XMYA 1CE3A 1B4AA 2EA4A 2G7HA 3TEDA 2E19A 3EY5A 5HXDA 4UHTA 5FKMA 3R95A 3QPTA 3BG5A 2I5UA 4AIHA 2CRGA 2HDCA 4QBJA 2KMOA 2DODA 2DN0A 4XBFA 3KGQA 2HOAA 1NSAA 2EFNA 4ZTJA 3JSPA 3EUHA 1T6SA 4L5JA 2Y48A 2B4BA 3PDNA 3KLNA 4H6ZA 3M7GA 3UKGA 1O3RA 1J09A 4RUHA 4UB8C 3W6KB 4CSWA 1HXDA 4LIUA 3LWUA 3ZZIA 3KP3A 2DB6A 4ZH4F 3OYFA 2OPTA 4LB6B 3D7HA 3JTKA 3G6EI 2OF7A 4WWCA 1IAWA 1UUCA 2QWWA 2UVOA 4OIDA 1BM9A 1A04A 3CP8A 4LOCA 1I1GA 3SFZA 1TOTA 2BVLA 1EH8A 4RB3C 4A69C 1I3AA 4II3A 2HV2A 3LA2A 3UGDA 2XPUA 3IWZA 2VBQA 1MW7A 1YG2A 4EJTA 3DP7A 1X10A 2FNFX 1JJ8C 3UEYA 1H0MA 2KIFA 1KZHA 3ML6A 2IS4A 5L3EA 2B5GA 4YGOA 5LYIA 3GFMA 4B3AA 4Q36A 3CPAA 1RFHA 4HGUA 4FETA 1Z5RA 4M85A 1I12A 1HKSA 2ROWA 1X1CA 1YW9A 1A36A 4QLCU 4XL9A 2IJLA 2L7XA 4M73A 4YFKF 2ZW6A 1Y1VJ 2QIRA 2CY2A 2QGUA 5I4MA 1B8IB 2RREA 1R3NA 3CLOA 2J9AA 1HW2A 4TNUA 4YEJA 3D1NI 3KI9A 1R1VA 3CF2A 2A6EF 4PSXA 5LLQA 2PQ8A 3BLNA 2HPMA 5HLTA 1XEBA 2DA3A 5BQTA 4CAVA 5DWMA 3KZIC 3SGBI 2XKPA 1OYWA 3VB2A 2X6WA 3QRFF 2FCKA 3GB0A 4UY8I 3Q9VA 2HQRA 5D5VB 4ZDLA 3WTTC 1FT7A 2I10A 5IY5H 5G1ZA 5FROA 2VKEA 2CTCA 1HOMA 4BS9A 1IYLA 1OJLA 2QKMB 4BQQA 1KUYA 1MBEA 1OMIA 2L4MA 3GF2A 3LFUA 4HV5A 1Z8XA 2RQQA 3FF3A 4RN7A 1FT9A 3IC1A 4MRIA 3OR1C 2ZBKA 4JP0A 1JUPA 2HVQA 3KEOA 3DEWA 1PVEA 2EB7A 4J00A 2QQ8A 5TRDA 2C6YA 2OUMA 2KDZA 2JVHA 4F52A 1QZYA 1T39A 1AU7A 2NOJB 4ZYDA 1FYLA 5AIPA 1KZFA 4XSZF 2RFHA 4XICA 4AVAA 2PVVA 3E59A 2PJ8A 4LITA 1UELB 2FOWA 4H4KC 1XCVA 4X3RA 2W25A 4Y52J 3VWBA 1JE8A 3JRAA 3H5AA 2JDDA 2YGWA 3PIOF 1V55H 3I3GA 1XS9A 2VJJA 1TUSA 1Z0XA 2ELJA 2AE6A 2O5RA 3HLPA 1MDMA 2L3DA 4ENMA 2A20A 3CJTB 3E5XA 3HEFA 3V7RA 4AC0A 3L2VA 1TURA 1IICA 2LH9A 2J8RA 2KT0A 3NEUA 3OXLA 5IP6A 5I0CA 4FX4A 1Y1WJ 2GA2A 1B6BA 1DS2I 3DLAA 2E5NA 1MBGA 4UCPA 3TTHA 3TMOA 3C7JA 5L3GA 2VPLA 3FH4A 1YS6A 2V79A 2W4SA 2PIZA 3F9KA 4G1PA 1VQMI 2R7QA 4R7MA 4JX4A 2DI3A 4C9YA 2G0BA 1XGNA 4PZJA 1TKFA 3CPXA 3PQJA 2JUCA 3WTWC 1Z2LA 2HDWA 2L01A 3QYEA 1ZLKA 1MH4A 4GXOA 3H9GA 2NS0A 4XPDC 3HTUA 4D7NA 5FRMA 3DF8A 2PDOA 1NTCA 1YVOA 2BL1A 5CVRA 4P4DA 5E3OA 4AG9A 1KA8A 3K0LA 4C7HA 2ME0A 4PK4A 2M45A 5M5XJ 2BUSA 1JT0A 2W84A 3J80K 3G3SA 2EIKH 4KOYA 3TO6A 2CV1A 4CAXA 1R5HA 1SEUA 2M8GX 2SGDI 2ZSHB 2ARHA 4E1RA 3WGIA 4EEFG 2X6YA 2IMOA 2MA3A 1IUYA 4UXHA 5CJ9A 1BUSA 2L0KA 1K6YA 3WTXC 1AA7A 2HZTA 3BR5A 5LEJA 3VYTB 1YIOA 4KVXA 1XC5A 1B87A 4A0ZA 1EV7A 5LGTA 2CUJA 4KZTA 1BJZA 3GLXA 4R9MA 4OIOF 3J7AY 5H6QA 2RDPA 2E36A 2JK3A 4LGWA 2QLZA 1FYMA 2YSRA 3IWFA 3S1MJ 4QIWN 3W6JB 5KCMA 5LD2C 1R4NB 5CVIA 4OINF 2FT0A 3SEQA 2WA0A 3UGIA 1ZTRA 1GV2A 1YREA 3TX8A 2NVXJ 2XSDC 5KHDA 5IT9K 2Y75A 1Z8TA 2BEOA 4FBEA 2QSFX 3TO7A 2Z3PA 3D7DA 4HQMA 1LVKA 3ZQ7A 1SD5A 5E20A 1V1HA 2QQBA 2ZFWA 2WAFA 4XR6A 4D7MA 4PXBA 2VQGA 4PXDA 2B3VA 3QP5A 2R5YB 3HUGA 3ISXA 4OMEA 4B47A 4IHWA 3ELKA 2CNTA 2RNJA 2KMRA 2WB1A 3FXQA 3VPRA 1VIXA 2HFHA 1PUFB 2AFZA 2F6CA 2KHMA 2VKHA 2ENNA 4FD4A 3K6GA 2ZNYA 3H92A 5HOOA 3W2WA 3F72A 2VE9A 4WP4A 1WGCA 3U2RA 1IOIA 2VI7A 3L00A 2DAOA 3A01B 3F5BA 1ZG7A 2EFQA 2IA1A 1WFXA 2H09A 5K5QA 2R7RA 1LR7A 1M1EB 2CTBA 4KLWA 4MJ8A 1P9ZA 1SFOJ 5KVRA 2JYYA 4M9SA 1IY5A 4NGPA 3F6VA 2BE5F 4BY7J 2ZFUA 2NVYJ 2V1CA 1LAPA 2R5YA 3IRQA 2EILH 2K7LA 3CC4I 4IQJA 2Q43A 3B4VC 2Q1ZB 4MFJA 3ASNH 4BXXJ 2DPSA 4RDUA 3AL0C 2XC7A 4UF4A 1YLOA 4UA3A 2PJ7A 4AG7A 4ZJZA 4A0XA 2Q7SA 3WT4A 3I58A 3OIPA 2PJ1A 1K7AA 3KKWA 3FM5A 5M3MJ 4M3EA 3MKYB 2P4WA 4PJ0C 3K2AA 4RAGA 4CZCA 4BYYA 1W7PA 1CGPA 3A01A 5AONA 2X1EA 4A12A 3MZYA 1HF0A 1XMBA 1V5FA 2LC2A 4OAZA 1HSTA 1T56A 1Z1DA 1AYEA 2Q4YA 3MCZA 2CXAA 4NSQA 1KYZA 1UHSA 2P5KA 3K4MA 3D68A 2QQAA 4LQGA 2XEFA 2NYXA 1UCRA 1I21A 3NFZA 1SGEI 2LP0A 3CJRB 2DU9A 1S7EA 2V7FA 1WH7A 1IC8A 1ERDA 1FOXA 5TGTA 3LD2A 3ZJ0A 2DKVA 1Y8RB 3CO7C 2VL1A 5BPDA 1KU2A 4S05A 4A31A 4U5YA 2BVMA 3OL4A 1JTXA 1LKXA 4I09A 1K4SA 2EIJH 2UZKA 1PTQA 2QUFA 4U0WA 2NRAC 2VOPA 2WYRA 3AL0B 2ZOFA 3TOBA 5LYLA 1H88C 3FF5A 4IPAA 3I53A 5E3LA 1X58A 1K79A 3P2HA 3QOEA 3BJOA 3VYRB 2PJPA 1DP3A 3GLJA 3KZYA 3ZMUA 2VKDA 4YRHA 3R9GA 3DKYA 3B3CA 5KNLA 1TTYA 2CQXA 2LD5A 4OLLA 1FMVA 2QCOA 5J1YA 5IYCJ 5JVGF 2HI3A 1VQ7I 5LHGA 3I71A 2JQ7A 2M7BA 5DYMA 4CGMA 2HOTA 2XSJC 4G6TB 1VQ6I 2GKTI 2IS1A 2EA2A 2ORWA 1H8LA 2XAGA 4NF1A 2CWFA 2ZXIA 4CZZA 4C68A 4ZY2A 3GCMA 2G3AA 1YLFA 3EC4A 2CH0A 3GZNB 3D7GA 2KJCA 2O03A 1R0RI 2M5XA 5EMIA 1DU6A 4K3NA 2GREA 3U21A 1LNWA 1NK2P 5F1JA 4DYRA 4X5KA 4ZX9A 4UUTA 2HB6A 3VSLA 3V7SA 3H1CA 2XVCA 3GTKJ 2DPTA 1V54H 2LB7A 2DQRA 5IB9A 2G9WA 3JTHA 2LSOA 2BHYA 2GXGA 4XRFA 3H5ZA 2K9LA 5CQEA 3KR4A 4EMEA 3I4MJ 4KUAA 4C3JJ 2XEGA 4BACA 1YI2I 3I5UA 3DWLE 1VFCA 3GTMJ 2DYRH 3OL3A 4NJRA 2O4HA 1Y39A 4U0YA 3JRBA 5EBVA 1RKTA 3LA7A 3MN8A 5F0CA 1HDPA 5LRSA 4KOVA 3S9MA 2QM3A 1YU6C 3S9LA 3KQZA 3OMYA 3P7NA 1LEAA 2EJRA 4DYQA 5M5YJ 4DYOA 5E96A 3DBRB 1TC3C 1FPQA 2V77A 2C6CA 5E18F 3EUKL 2R98A 4C30A 2MLKA 4AWXB 3KYDB 5KTCA 4HZFA 3FEDA 3ECOA 3WTYC 3ECHA 4P1WA 1WGXA 3BG9A 2ZC2A 5F09A 1YX3A 4EGYA 5AG4A 2EIMH 2ORVA 2C6PA 1WHUA 5JR3A 3H9JA 4HF0A 3R0AA 3W2VA 4HLXA 4ENNA 4B3XA 2WVJA 3EQLF 2DIPA 3QTLD 5DD4A 2V1UA 2X1DA 4A3BJ 2JDCA 4BJTA 1FX7A 1PPFI 3HOWJ 1POGA 1X3WB 2PN6A 1L0CA 1YR0A 2RVCA 1ZRDA 5CYVA 3MWMA 1N13A 2ATRA 3FWEA 1NSLA 2EK5A 1VF9A 2Q51A 5CPRB 3CXSA 4HNYB 3CMYA 1OYYA 2VBYA 3S1QJ 5F64A 3PB6X 3JSOA 5J8CA 5CQGA 1GHEA 1OMUA 1VQLI 2HC9A 3QNVA 3I0TA 1Q1HA 2QA4I 5EX3A 3IH3A 3F8KA 1BPNA 1QRYA 1CPSA 1IZ1A 3U1DA 2K5CA 3M1EA 1FBQA 1LDJA 3OYMA 2IJZA 3QWLA 2PJBA 4XPLA 3S3NA 2AJ6A 1S7KA 4MFQA 2V6CA 2ACJA 5D8NA 2HNHA 3SZPA 2H27A 2MD5A 4CAWA 3BR1A 2CFXA 2Z3YA 3RI4A 2PRQA 4TWEA 1IGBA 4OC5A 1Z9CA 2PJ2A 3R60A 3D5RC 4TV7A 3L2QA 2HVSA 1FBSA 2XB5A 2YPRA 1JGGA 1S7OA 2K9SA 3D66A 4A2ZA 3HJEA 2FNAA 1VTNC 4BNCA 1X2MA 2X0LA 4U0VA 4AIJA 1X4PA 5GTIC 2CUFA 5EGOB 4BAYA 1DU0A 1BI0A 3CCQI 3OYJA 2F8HA 4R3LA 2ZXJA 1AKHB 4ZGYB 5K8PA 2LK2A 4E4HA 2CWHA 2E2JJ 2R7FA 3CCJI 1TGSI 4V2FA 4R57A 3IWWA 2ZJ2A 4PFPA 2ZMEC 4GS4A 1TNTA 2Y31A 3SYTA 2VRWB 3IU1A 5E1WA 2D4PA 2UV1A 2ZO4A 3HGYA 2XPVA 5JLXA 4U88A 4EMSA 1W0TA 3C2BA 4M9XA 3R61A 3A2KA 3MEXA 5TISC 1VDDA 4WWVA 1SFKA 1UVFA 3PNTA 1ENHA 2R0QC 4A3FJ 1I1DA 1Y0RA 3GY9A 1APLC 2BY2A 2EZHA 2OBPA 3TKYA 2HEOA 5EGOA 2R4GA 1O3TA 2FXFA 4FD6A 2DLLA 3WODF 4XQFA 4M6GA 2V8DA 3TE4A 5E8IA 2EZIA 5THWA 4HSRA 1CJWA 1N78A 4XLCA 1BOAA 1Y0UA 3DFGA 4NGNA 1VQPI 1JHFA 2KFDA 4MIMA 3IH2A 5DDGA 3OSGA 3GKRA 1IN4A 3GFJA 2PMZA 3HKZA 4XOTA 2OB0A 3VDXA 4CRYB 3KZZA 2NU0I 1QGPA 3Q9SA 1JKRC 2K40A 1R5ID 3N7ZA 4H89A 3SI2A 2JSCA 3ZCOA 1M8BA 2ZMEB 2VXDA 3R6SA 3LNQA 3SZTA 1HC8A 1NHAA 3KPHA 4BEHB 1JQGA 2KRHA 1ETVA 3L2UA 2UXNA 2XIGA 5LYDA 1LEBA 1BO4A 1DGRM 2XEJA 1L0OC 1A2ZA 1K83J 3V42A 3I4PA 4BHPA 2YX7A 5LGNA 4OIWA 1MSEC 1I50J 1BLLE 4MHGA 4PXCA 2V53A 2P6AC 1CHOI 1B1BA 3DPUA 1RO5A 4OC1A 2K9NA 3LSHA 3DPTA 3OOPA 3QU6A 5A28A 1W36C 4XK4A 1HW5A 2CWEA 4P96A 1PP7U 1OVOA 3EDPA 1OCTC 2PG4A 3RYRA 4L5IA 4M3SA 3AAFA 5K1YA 4E7ZA 2XAHA 4HNWB 1ETQA 3TP0A 1JTYA 1QQ9A 2O53A 1TQPA 1U0JA 4P9UA 3CMMA 4KVME 4MI4A 3LQQA 1HBXG 5AIQA 3OVOA 3F23A 3JRGA 3BXMA 2LKPA 3OYHA 3H8EA 4E6KG 2XRCA 2X51A 3GVAA 2FXAA 4WCGA 2PJ0A 2E5RA 3PO2J 4PDKA 4DIQA 2QQDA 1ZO0A 3SEZA 3K1MA 1S5KA 4B14A 2CQNA 4MFKA 4W1UA 4IRIA 3EETA 3V8IA 4EWTA 4Q47A 4KISA 1TP4A 4M3FA 3E0JB 3ABUA 3K70D 1AOYA 2P6SA 3D67A 4E7SA 3R5DA 3E6MA 3EUAA 1HKTA 1ZG3A 1HPTA 4XRMA 4R6TA 1ETKA 1IXRC 1UJ8A 2K9QA 3HRMA 5IYDJ 1VZ0A 3CUOA 1GVJA 5D5UB 1F4KA 4ZYQA 2CU7A 4OMZA 5KK1A 1U3EM 2F5CA 1AN1I 1RPWA 1RC9A 3LODA 3S1RJ 1U5TC 1H9GA 2Q04A 4UXNA 1CT0I 1X2NA 4Y33A 2VBXA 5LEKA 1YX5A 2N52A 3NA6A 2ID3A 4X6AJ 2XF5A 4Y49C 5ILUA 4KNYA 3TBIA 5H84A 3DCFA 4HA8A 3DBLB 4XRSA 1ON2A 4JQFA 1D5VA 3W91A 1IN7A 4PCQA 3FSXA 4R8HA 3HOTA 3IRRA 5HS9A 1AMPA 3EO4A 1CG2A 3LMSA 4J3GA 3LAPA 3OS1A 3OYNA 2X52A 5FUVA 2KP6A 2STTA 1FARA 2H1KA 2G9DA 4R3KA 3EUHC 1M4GA 3E6BA 2E7WA 3ZN0A 5J1UA 3HTSB 2QYVA 1IO2A 2XGXA 3KHZA 2UZ3A 2NMTA 1W4RA 5H2FC 2NU4I 2ECBA 2WAQA 4E7LA 4QVTA 1SMYF 5D4SA 2PE3A 1OKRA 4F0YA 2LOOA 1U2WA 2QQEA 1JWQA 4UCMA 1UG2A 3FMQA 5DTDA 1P0HA 4XRSG 1U5TB 5JI6A 1S60A 2O8XA 2RGVA 4CGLA 5K7HA 4NQWA 1YJNI 1OBRA 1A6IA 5JFRA 2XRNA 2CW0F 3ZMSA 1UMQA 2L5QA 2XUBA 3KP7A 3E6CC 2Z2SB 2RB7A 4XN3A 3EXNA 4Y49B 1N77A 5J1RA 3KFWX 4Y13A 3A1YA 4HNUA 3BI0A 3F8NA 4EJVA 2ZEPA 2DYSH 4AUXA 4A5NA 4Q38A 2PEXA 4M9ZA 4MHYA 5ICCA 1MGTA 1VHSA 4UIBA 1Y8QB 1YW8A 2WTEA 4EM0B 1YFHA 3FKJA 1J7KA 4YFNF 1B59A 3K2KA 3RKQA 2K4JA 4M71A 2ZELA 2J8NA 3B3WA 2JPBA 2P6TA 1FOKA 2AS5F 4Q7AA 3SI0A 3V7ZA 4RLQA 3MZ8A 3BC8A 1SAUA 2LNBA 4CDGA 4P4FA 3PUBA 4IRGA 2FMYA 5FUXA 2L7MP 1M1DA 1UHMA 3KP6A 2Q0YA 1Z8WA 4Y3OA 2D45A 1KONA 2L7KA 2B3UA 2ZB9A 2QVPA 3B6AA 4KYWA 1XSVA 1TL8A 1ZR2A 2DMPA 4BGDA 2LRDA 3DKXA 4JX6A 4DBRA 5HS7A 3EPZA 5GAGJ 1WGTA 3U1KA 4XORA 3FZVA 3HSEA 3FX3A 1ZAOA 3AG3H 2B5GB 3ZPLA 2KKOA 2IRFG 2CGPA 4QPQA 1TF9A 1V0CA 1XOVA 3GYAA 5EEGA 2ZNZA 3JRHA 1UHAA 3G73A 1IN8A 4L9JA 2ODDA 5FRNA 1TKJA 4G8XA 4F9VA 3S17J 4FT8A 2FE7A 2KMQA 2O6GE 3TGNA 4L9MA 2FBKA 3F6OA 2ERWA 2IXSA 1LOKA 3T9YA 3ESWB 4AIDA 4EJOA 3CP2A 3CC7I 1XMKA 4CGZA 4DUKA 3JAMZ 1BN5A 3IEHA 3IH4A 2CV2A 5BPIA 3UGLA 4PJNA 3TP3A 5TJJA 2Y0SN 4ZBGA 3CCEI 3IV5A 1OZPA 5FGMA 1DE4C 2OVOA 2EK8A 3ZQHA 3KP2A 3J80Z 1Y56A 3RYPA 1YTYA 1T2KA 1HA8A 4MHZA 2QEXI 2VQYA 4P55A 5EJCA 2R7VA 3O2PE 2GAUA 2CUEA 5K7FA 1FP1D 1BJAA 4BUPA 4PFOA 2YX4A 5F0FA 3FIWA 4L0YB 4HX8A 2A6TA 3V8LA 1ARMA 2LY2A 1T0FC 2VKVA 2GVIA 1S29A 1ACIA 4N0BA 4RGXA 2ZXWH 2CWGA 5CPAA 3DU6A 4I49A 4MHNA 3MMYB 1UFHA 3BR6A 1CBXA 3DGVA 3WGGA 4ZY0A 2R7HA 3EYIA 2NOGA 2YNCC 1OQYA 4DOZA 2GXAA 4ESJA 4R87A 3F0CA 4I98B 1IDYA 2WGCA 1SD4A 4I02A 4QC6A 1D1CA 2VXZA 4KMFA 3CDHA 4A2UA 1B9MA 2EFWA 5A2QK 3VYSB 1RZ4A 1FJLA 1F5TA 1GDTA 2REEA 3CT9A 4NEXA 5K8MA 5IT9Z 1FAQA 5GPAA 2DO7A 4HG2A 2VT2A 3KLOA 5E79C 4ESBA 3ZQCA 1MDMB 2UWMA 1TBOA 2E1NA 2AHQA 3QPHA 1D8KA 2OA4A 3G1LA 3E2IA 4MY0A 5JQ4A 3GTJJ 2JA1A 2Z16A 1Y9KA 4RM2A 3L2NA 2LYCA 3ZMTA 3BHXA 1TF8A 1S3ZA 5JPHA 3OYCA 2I8DA 2OQRA 3C2GA 2K4BA 3GZ6A 3CO6C 2R7TA 1SGDI 1SGPI 3OXGA 2EVNA 2ZSIB 3WC6A 2JMWA 4MEXF 4IAVA 2GWRA 2O0YA 1S6LA 2DFFA 2JA5J 1D3YA 3OYKA 3PJRA 1BR2A 1HDUA 1YE9A 5ICFA 1XF8A 2R93J 2N71A 2FRHA 4Y4RA 1KBFA 4II9A 1WJCA 4EGZA 1VQOI 2JRMA 2FBHA 3CDIA 3GMEA 2OCCH 5DM7F 4CCJA 4FD7A 2L7FP 3ABMH 2YQPA 1I6HJ 1T0FA 2HKXA 3ABTA 4GCVA 4RAZA 5DEQA 4BQNA 4HNVA 2LKXA 3CLQA 4A39A 1YS7A 2J8MA 4KIFA 1FZPB 2R8VA 3FK6A 4QPOA 3S14J 2B0UC 4ASNA 3FBUA 2M87A 3GZ5A 4BXUA 1WI3A 1RNLA 4IL6C 3HRUA 4CA0A 2YNCA 2ZEOA 4WXHA 1YITI 3RBUA 4HAMA 3JAMK 2W85A 1BC8C 4YIFA 2Z99A 2ZW7A 1T95A 3RKYA 1R7JA 4M3BA 5HLIA 2NVTJ 3HOZJ 1M4LA 5HLGA 4N9HA 1G3TA 4D5CA 5EC4A 1U78A 1LFPA 3QAHA 3GTPJ 2R7XA 3S6HA 3PFOA 1BBYA 1Q9BA 3L7WA 5BNGA 2XAFA 2BXZA 2Z11A 2DA6A 2FL4A 3BTIA 1A6QA 1WWZA 5H6RA 3MVPA 3NARA 3U9GA 4X8IA 4A95A 3FXJA 2V9VA 3WR7A 4C3HJ 4DJAA 4BBSJ 4UUSA 1M8CA 3BY6A 2V1CC 4PGHA 1OISA 3GBGA 1P4AA 5HVGA 3BZ6A 4U9YA 5DCMA 4B44A 2ZJPF 3B8GA 1XDUA 4BBRJ 1D8JA 3I59A 2AXLA 5E3QA 4F6AA 3MGDA 1PYVA 5F0HA 3JREA 1G2HA 3L2RA 2EO8A 4PQAA 3MEKA 3HUGB 2DEAA 1CGII 1XFOA 2CYYA 2JEVA 2V8HA 4B8XA 5K8NA 4BQAA 3E3VA 2IS2A 4U9ZA 2W48A 1ZR4A 2V26A 4Q4ZF 4O3MA 1RXTA 1M4DA 1WK4A 1QA6A 3COAC 2ZPAA 2O3FA 2V1NA 5F27A 2BW3A 4FTHA 1Q2DA 4YWYA 1USSA 4FQGA 2ZEGA 3K10A 4ZYAA 2DTRA 1H9TA 3QP6A 2HWVA 4UV8A 2PR8A 2GM4A 1W4MA 2Q44A 3GW2A 4S0HB 1S8NA 1XDSA 4E1PA 2X1CA 4Q48A 2QJ8A 2HTSA 3S3OA 5D4RA 1FYBA 3DBHB 2QQ9A 5FKOA 3JR9A 3K1PA 2ZEMA 1WJDA 2RQPA 2NVUB 4UXJA 3B3VA 2FU4A 3JTGA 4XLFA 1EKEA 2A68F 3FB3A 3PSFA 4M6VA 5EG0B 3IL2A 1VQ8I 2MYSA 1TXRA 4RAYA 2L4AA 4BY1J 2M34A 3KZWA 1HDQA 1JKPC 1Z6RA 1WKXA 3VDPA 3CMAI 3S93A 4E7IA 1NMTA 1ON0A 2E71A 1W7PB 1P6RA 2GA1A 3OIOA 1ETOA 1QNTA 4PJLA 3FC3A 1P9GA 2LR8A 2M4GA 3PSIA 2K85A 4OIPF 2Q4ZA 4A24A 2VC0A 3FJUA 1LR8A 2BBYA 1WWXA 1ETXA 4HOBA 3VEPA 4MFPA 4KJZA 1E0EA 4A37A 3RPUD 2K27A 2EFPA 3HPGA 4IZZA 1J2XA 3H0GJ 4OWRB 4CGPA 1E17A 1RETA 4NGQA 3O6BB 2FA5A 1W5CC 4B1RA 3GOXA 4RS8A 2IGOA 2XKOA 4WXCA 2YUSA 3P5JA 1VI0A 2JN6A 3JCUC 2AFSA 5EG0A 4AYBA 2DMUA 2IA2A 4YG2F 3ABKH 5L3CA 2A3SA 3JRFA 2BY1A 4KN7X 1E3OC 1MKMA 3GTLJ 1IRFA 1USTA 2RKHA 1QMUA 2COMA 1TQIA 3P9KA 5BWAB 1TWCJ 1QSOA 1IY6A 1Z67A 2WPWA 2EPFA 1Y1CA 2PJCA 2BY0A 1OR7A 3N97A 4BH9A 3IAS2 2NU1I 1YIJI 4IHSA 4MCPA 5ISVA 5HODA 2BOAA 2DXIA 2GLJA 5ICEA 4NGMA 1Z91A 3G4SI 2GU2A 1IF1A 1ZN2A 3DLJA 2GFQA 2VN2A 2HYFA 1P7JA 1XX5A 1LCPA 1TNSA 2ELHA 1X1AA 5FD5A 2AXTC 2LBFB 5A27A 3AKZA 2Q4VA 1W0UA 4A3LJ 2A5YB 3N4MA 2JA6J 2EFOA 4G7HF 1WKMA 4UUVA 4P6YA 1YQAA 4IO9F 3HOXJ 5F49A 1GVDA 5E8GA 3T8TA 3HG9A 1PUAA 4ZX8A 1IXSB 2OD5A 3HIFA 2EV0A 1S9HA 2Z1DA 1U8BA 4Q5SF 1ULNA 2CS3A 3CJQB 1NH3A 1R58A 3I1UA 2IPQX 3BR2A 2K3FA 2HKOA 2B8TA 1U9OA 2XGEA 4CHUA 1SFUA 1IV6A 4KUBA 4A32A 2FIAA 1SD7A 3SXNA 4JYWA 4MTDA 4XSXF 2BSWA 4BE0A 4HW0A 3T5XA 2OZHA 2VJ4A 5B1BH 5B66C 2TDXA 4CYCB 2DFEA 2IAIA 3HSFA 2LBFA 3S2WA 3HC7A 4UFXA 1MD0A 1PYTB 2B58A 2EH3A 3IWGA 2XGDA 4A93J 2M0CA 5HI7A 1BAVA 2XV4S 2WB1N 1ZLHA 2KCWA 1NE9A 4OOIA 1E3HA 4G6QA 4M6XA 1R22A 1W5SA 1TBXA 2VI6A 1X1DA 1TIHA 2BV6A 1M44A 4UCNA 4FUUA 1V1IA 3IAM2 4ENJA 1LPQA 1QVTA 4CYQA 2ECCA 4HX7A 2O7OA 1FOYA 5D6EA 1MIJA 1OFCX 2ZKZA 4CYCA 1WZ2A 2NYQA 3HXLA 2PR1A 4CYNA 2KZGA 2JBJA 1O7FA 3AG4H 4HSTA 3SGQI 1Y9WA 1DGWY 1G3SA 3ZXSA 2OZUA 2RAEA 5HVQC 2HR3A 1X74A 2W00A 2PI0A 2DMTA 1IYKA 1BI1A 2GZWA 4P9FA 1FSHA 3B73A 5AG6A 2Q7BA 3DEEA 5C3EJ 4BJ5C 1PUEE 1KUXA 3HRTA 1EH6A 1TWHJ 4BL0B 2KQRA 1ULYA 3SJMA 1AKHA 1W3SA 5HNHA 5JHWC 1R4MB 1R49A 2A4NA 4IHMA 2DF5A 3GLLA 5B5EC 2YNDA 3C18A 1Y0NA 2QENA 4IF4A 4L9NA 3CF5F 1J0RA 3H3VK 1ZG1A 2R7SA 2SGPI 3OR2C 4XM3A 4HEA2 1G4DA 2Z3LA 4A33A 2VC1A 1XRYA 4R1HA 4JBAA 4LMYA 4I6ZA 4ZI6A 3BJ6A 4UVCA 5DS0A 1B6AA 1SC7A 3BWGA 2ETHA 4KUMA 4N9IA 4OIQF 2J9RA 4JJXA 3NWTA 2EQRA 1IN5A 2HYGD 2F5EA 3W3CA 2IQ6A 4B48A 3HHGA 6PAXA 2VZZA 4H6UA 3B02A 1L3LA 1LB2A 1KBEA 5K8OA 3LSIA 2X4HA 4UEEA 4DZJA 1KU7A 3WG7H 3S1NJ 4ZY1A 3ZMDA 2XEIA 1TT5B 3LAJA 1S5LC 3FXMA 2DFIA 4G9YA 5LYFA 3PB9X 4F8ZA 3IGRA 2M5WA 2LF8A 4I0AA 4PJJA 5CBMA 1WQ2A 2IGMA 3FISA 4O6JA 3SXYA 3LSRA 1R9TJ 4EQQA 1KQ8A 3NE7A 1R23A 2DDBA 3G3ZA 2O8KA 4DJLA 5D6FA 1XBTA 3TCVA 1U6GA 1EE3P 3F8BA 5CVVA 2X48A 3KE2A 4L9TA 3CC2I 1T08B 3H5RA 3V38A 2MC4A 2DT7B 4F91B 1TQMA 2J5PA 4RI1A 3CUQA 1XIXA 4KDPA 1R1UA 2PMUA 2OZ6A 2TCTA 3P9CA 1TKHA 2Z3NA 4JOMA 1BPMA 3H5NA 1MMGA 4LD5A 3BQYA 3L9FA 4NC6A 5C88A 1XG1A 2Q0OA 3WE2A 1XJOA 3ZQFA 1MZBA 1NG7A 4HBLA 2WSAA 4PV6A 3OXFA 1GUUA 2DXQA 5KTDA 2W0TA 3R9EA 4G7ZF 2VLAA 1YRNA 3WTVC 2V4JC 1OLTA 3FDYA 4CUGA 3N5FA 1OCRH 5JVTA 2VB6A 4HQEA 1DTDA 2XGCA 2M30A 3H35A 1Y7RA 1CT4I 2M1BA 5K7ZA 2PIYA 4S04A 2DT5A 3IIBA 4ONWA 1Y0YA 3DR6A 2TRTA 4DZPA 1XD7A 1OCCH 1BR1A 4XLHA 3PM1A 2ARPF 2Q2EA 1KGSA 4HPQA 2PBIA 3BLYA 4IXAA 1K78B 2AFXA 1SQHA 1JUMA 4Y15A 2JLMA 1YW7A 2HU9A 3SJFA 2WBMA 3BROA 2QVOA 4Z6YA 2MC3A 4MMOA 3RTRA 1AUGA 4MTEA 2AFOA 3RCOA 4KA4A 1TW3A 1SFXA 3EYYA 5HDGA 2F48A 2IA0A 3BTCA 3T8RA 2L54A 1RUNA 2ME6A 5J4VA 4B5PA 3MRUA 4CH7A 3PL8A 1BIAA 3FK7A 4F7ZA 4BE1A 3L09A 4CXFA 3MKWB 3RKXA 3L2CA 1LRZA 5J3LA 3J81K 1YMEA 3LA3A 3LSKA 3NQOA 5HQ8A 2E34A 1SFEA 5HVFA 3HOYJ 5F46A 2UUZA 1YJWI 3BZKA 1IJWC 3PNYA 3K70C 4ZZDA 3I64A 2XROA 2UXXA 1I27A 4P5OA 3BCAA 3LACA 3G1MA 1K78A 4KLVA 4P4IA 5BMZA 2GIZA 1GHCA 4XKCA 2KRFA 5IB0A 2HTJA 2STWA 3K2ZA 4ENKA 1VHEA 2VOOA 4NDLA 1BW6A 4KSIA 1XE4A 1GXQA 3CCYA 3HGGA 4GRIA 3GYHX 3HRSA 9ANTA 3RSNA 1UVGA 1TWAJ 1ZREA 2PJ5A 3GEZA 5GAEJ 4EJWA 1V5GA 4NC8A 3D5SC 3FKIJ 2V6EA 1ZLIA 1QHGA 1R1TA 4EVIA 2D1VA 1WH5A 2BXYA 5FFXA 3LQRA 1RRJA 2R92J 4EM2A 2QF7A 4AXVA 1QO0D 2B4DA 2EV5A 2RN7A 2ADUA 4MY3A 1K4JA 4GI3C 3M3YJ 4CPAA 7CPAA 5E1ZB 2R7OA 3R96A 3FM3A 3FXOA 2L8EA 4LLGF 4B5OA 4P45A 1KWMA 4LFUA 3AG2H 2K5TA 2MH9A 1ZARA 4FCYA 3JW4A 2B63J 2M8EA 2ZEFA 2EINH 2CUZA 3D3SA 4ZYGA 4KFCA 1TBQR 3PB4X 4L89A 4BINA 4R76A 3W6XA 3OWTA 2M4KA 2C1CA 3R5CA 3CD6I 1ZRCA 2W1OA 3FXLA 1FP2A 2Y30A 4ON0A 2DW4A 3IUOA 1A35A 3QB8A 3LOCA 1DUXC 4V19K 3H36A 2P6GA 3HH2C 4JWPA 2BYVE 1R57A 3B3TA 1G59A 4D0PA 5EF6A 4WX9A 3BJ8A 4KOSA 3R5AA 3ZQQA 4XLPF 4HRIA 4MCQA 2P81A 2K9HA 1Z7UA 1WCMJ 5JM6A 3RQ4A 3DR8A 2YS9A 2OV7A 1VQ4I 2JT1A 3LSMA 2RC4A 4HYEA 4C2TA 3O8HA 3ZRGA 2C6GA 2DA7A 4M6IA 4OC2A 3VWEA 1I1SA 1T38A 2WY7Q 3CTAA 1ETWA 5DCFA 2FBIA 2LLKA 3PQKA 2FSWA 3ZN1A 3K9UA 4FAIA 4L0ZB 2L7ZA 2DA2A 4B4CA 2DPDA 4G7OF 3GTQJ 1Z8LA 3BR0A 3TDZC 2JWTA 5ELYA 2CSOA 4LG0B 2GXBA 1XN7A 1K7UA 2MGQA 4M6YA 3GTGJ 3LMMA 4LG3A 4CCNA 5C44J 3VDUA 1XCBA 3H8FA 1LFUP 1VQKI 3S6GA 3H8GA 2HYJA 2DA1A 3FXUA 5HH1A 2HQYA 5CCMA 2HOSA 3SI1A 2KMUA 3JRUA 1ZKGA 3DTEA 4PJMA 4AVBA 2Z5UA 4U7BA 3SQNA 1O3QA 3D2PA 1FIAA 4BD9A 3S3MA 1FWZA 1RESA 1XGOA 2Z0ZA 5EEHA 3VE5A 1N75A 2PRBA 4V2GA 4DNCA 5CVUA 1X1PA 1SGRI 4MCSA 4MQ9F 3KETA 1S7AA 5KAIC 1P7IA 3BG6A 1Q2CA 1F36A 1OCZH 1XMAA 3J7ZI 3CJNA 2GLOA 1IRXA 2OC6A 4NQWB 2PMZN 3HKZN 2ZEHA 5ERIA 5IPAA 3BQZA 2BZTA 2J5OA 4LG0A 3RAMA 3S16J 4MFLA 2GBYA 4KT5C 3MKZA 4A3GJ 3MFKA 2E2HJ 3UFFA 4R79A 3IWEA 3QPLA 4IEJA 2F7VA 2DDAA 2JRTA 1U9NA 3DTKA 3MN2A 3I55I 1ZRFA 3K9TA 1ONVA 1YVKA 2MW8A 3SEKC 1XBUA 4XNHC 1WJFA 3ZQGA 4N4NB 2ENZA 5FFZA 5DUKA 4IX7A 1BL0A 1TBRR 1MH3A 3HB9A 4X0GA 3GUDA 6CPAA 4A3CJ 1X3ZB 4MLOA 2VJ5A 5FKNA 1W36D 2LFBA 1R6RA 1B72A 3TOAA 3IKVA 4WF2A 2BEIA 1IN6A 2AQEA 2P6EA 4OP4A 2WV0A 1SMTA 1F1ZA 4QB9A 2MG4A 3R9FA 1XMTA 4SGBI 1LDKB 3OYLA 2A6HF 4IKFA 1P2FA 4AVZA 2CV0A 2KLOA 2NS7A 4UV9A 5A2QZ 2BO9A 2PJRB 4P10A 3F8MA 2ZEDA 4IHVA 1N25A 5CKTA 2FQ3A 3LSJA 4LB5A 3BPXA 4L18B 2XRLA 1TIQA 3CZXA 5E3RA 3ERMA 1O3SA 4XKWA 4NCZA 2HDDA 1ZK8A 1YGHA 4XNHB 7WGAA 5LHIA 1RTQA 2NAZA 2QMLA 4X2TA 1RR7A 1MJ9A 2VQLA 4MGRA 3WE3A 4E70A 2Z3KA 3BJ7A 3HPHA 1IOFA 3CXQA 4FHTA 3RYOA 1WRJA 4XKVA 3NH4A 1IXCA 2QQCA 4NGTA 8CPAA 3SHFA 2IS6A 1YX0A 2P6FA 2NU2I 4NUBA 2V1XA 2F4OB 1CX8A 4LK0F 1DDNA 5HNFA 2PJRA 4CCMA 3FXTA 2QBYB 3T0YA 3QPSA 1YOVB 4XLNF 1VNDA 2OJED 3K4JA 2ESNA 1CM0A 3RU0A 1HSJA 1JJ6C 2FF4A 1V5EA 2ID6A 3TFYA 3KYCB 3JUWA 2L9RA 2OD1A 4MQVA 3A02A 1RR8C 5C82A 2W57A 3E7LA 2FX0A 2FUG2 4JK1X 4F0XA 4H2KA 4HNXB 2DFHA 5LBQA 1UZCA 2KMPA 2Y9ZA 3WTUC 3UY5A 2WADA 3G71I 3SJGA 2H6BA 3ULQB 4UFVA 2QBYA 1S7FA 1OMTA 2R5ZA 3ZGKA 1Z3XA 4PUSA 1Q2YA 3Q0UA 2GOXB 4P4JA 4CGOA 2FNPA 1QSTA 1FTZA 3EFAA 1MBFA 3E6DA 2IEKA 4II2A 3S9NA 1OCPA 3OY9A 2V8GA 2IW5A 1Z4EA 2OZGA 1ZG5A 2NVQJ 4DQ2A 4GM5A 3BJAA 4CS0B 1Z3YA 2ODFA 2KIQA 3WGHA 4W9YA 2WAQN 4ZDOA 1R43A 3GFIA 4GYIA 4BHCA 5J8FA 3S2HJ 2OOTA 5B3SH 4D1QA 2EBIA 2REFA 3ISPA 4PSWA 2YUUA 3PFEA 3RQIA 1PCAA 2H5MA 4NNJA 5F1RA 5DWNA 4MO7A 1SVMA 2EBJA 1LQ1A 1LE8B 2JBKA 4O5VA 3TL4X 3CCRI 5IX3A 1HDDC 2SGEI 1PDNC 5FB2A 4AIKA 3GFLA 2VXKA 3V8KA 3AFHA 2R7ZJ 5DV5A 4IVNA 4XIDA 3IKTA 3L2WA 2W7NA 1VQNI 1S7LA 3NH5A 5IP7J 5D5XB 2H6CA 3C2HA 1UWYA 2WPXA 1OYIA 3CZ6A 2PJ4A 3DPLC 2LDUA 3A0HC 3GX4X 1IGNA 1XSDA 2B9SA 2DQLA 1M4IA 2FE3A 2Y69H 2IGNA 1MJBA 3K1NA 1JT6A 4BDYA 2CG4A 5IT3A 3E1SA 4XOPA 5E3MA 2HS5A 4L9VA 4ZZLA 4CYDA 1SGNI 1Z7LA 3KL9A 4BKXA 2PJ9A 3PGPA 3IHUA 4IF5A 4EATA 2VBZA 2DJIA 3B6CA 1LE8A 1VKCA 4IOCF 1HQCA 4PK2A 4CCOA 3TQNA 1IW7F 3A4CA 4A0YA 4FE4A 1FLIA 2BCOA 3SJXA 3CCLI 3T90A 2IP2A 2LY9A 4YRVA 3H4QA 5IV0A 1QZZA 4M3DA 1YLEA 1MNEA 4DBQA 3PB7X 2D5VA 3FMSA 4YIIA 3D00A 1NG6A 2PJAA 4A3IJ 5KTAA 4OU0A 4JZ0A 1X1BA 1MT1A 3F22A 2LUYA 4FISA 2PMHA 2K86A 1T8IA 1B8IA 2FOKA 4HDVA 4UEZA 2E60A 4PPZA 4QWQA 1PP8F 4AMLA 3KYLA 2JJ7A 4JXQA 2H94A 3RDIA 4XPKA 4HX4A 3I9V2 5HDKA 2MBFA 1UAAA 2EZKA 2ZJQF 5F48A 4A38A 3PFYA 1GT0C 2FJ1A 1QPMA 1FIPA 3HSRA 3C26A 4OC0A 3IC7A 4UBRA 4AU7A 4QSHA 4AB7A 3OL0A 4B09A 1XB4A 4JYKA 4C2UA 4KT6A 4LK1F 1P4WA 4NJQA 2V1DA 1S7NA 3DNSA 4XLEA 2O28A 5EEAA 2GIVA 2RIJA 2PX9A 3RKWA 5GPCA 1JKOC 3ZR8X 4YFXF 2HQ5A 4J01A 4HPSA 3ROUA 4UUSB 2EV6A 5LRJA 3D8PA 3ASOH 4L5EA 2LTPA 5L3DA 3CDLA 1TW2A 2L02A 3D2MA 1D0XA 3WABA 1ETYA 2N8GA 1MNMC 1OPCA 3CCSI
chains in the Genus database with same CATH topology
1UHWA 1Z05A 3I59B 4ORFA 1ZGAA 4IHTA 2X7BA 3SXOA 4CO8A 1JGSA 4HF2A 1J59A 4HF1A 1MK4A 5AG5A 1ZLJA 1TLHB 3JVNA 1N71A 1IIDA 4UWJA 3F8FA 2PLYA 1Z6TA 4ZYHA 2F5DA 4LJZF 1XGMA 2KJBA 1R5GA 4NHJA 4CAEA 3K69A 4RGUA 1O57A 5G20A 1SD6A 2HQNA 5LGUA 3BOQA 4LLNA 2R3SA 5HLHA 2OH1A 4QUSA 3HYIA 1R36A 4UVBA 4RS2A 2DBBA 4C2ZA 2F2EA 3J7AO 4ETSA 2VT3A 5AG7A 1WI9A 3KEQA 5CVJA 3VODA 1DPUA 4KICA 2JTVA 2D4OA 3E5UA 3WG9A 1CF7B 4OAEA 1LVAA 3OWCA 4XPDB 3DEUA 1BC7C 4JLYA 2Z3MA 3DSBA 2NNYA 2IT0A 1J4JA 4KVOE 3I54A 2R1IA 3TT2A 3C3WA 4AVPA 4RB2C 1QSMA 4KOTA 4HDUA 3R1KA 4KSAA 3RJPA 1CF7A 3RPUA 1DPRA 3WTZA 2C27A 2HQYA 3GWZA 3RPQA 3O3KA 3P9IA 2XAJA 4I01A 3FMRA 1I6XA 1P4XA 3BP8A 3PZJA 4ESFA 4WXDA 1K6OA 1RI7A 2R7DA 4M72A 2O61A 2PC1A 3H3ZA 3MZHA 3R0JA 1AWCA 2PSWA 3KP5A 5G21A 5L3FA 2CNMA 1KU3A 2QECA 3Q5FA 3LFKA 5LHHA 1W7PD 2VE8A 4A6DA 2P7CB 4H0EA 5FVJA 4KIGA 4C2XA 4B12A 2P8TA 5F47A 1J75A 4FX0A 1Z9UA 2IL4A 2DK8A 1STZA 2EUIA 3A9LA 3G8WA 5E1XA 4A6EA 1XGSA 4CAFA 3E5QA 1F9NA 4PGGA 4KS9A 2JZYA 2VBWA 2XHKA 3WTSC 2MLGA 3DQVC 4EM1A 4NB5A 4WK8F 3FIXA 4L8AA 2RV8A 5D8LB 1RUOA 4MNUA 2XASA 1QSRA 1G6NA 1FSEA 1ZGJA 3H3UA 2CO5A 2FEZA 4RB0A 5HDNA 5JHUA 3CUQC 3E97A 3ERED 4PK3A 3F3XA 2NNNA 1QBJA 1V4RA 5FO5A 5H20A 3SHPA 3RIRA 4I2OA 4K30A 3J81Z 1IB1E 4ZYEA 1S3JA 4HV6A 3WU0A 5DUIA 1KQ0A 2D1HA 4UWIA 2LF7A 3TO9A 4NXYA 1LDDA 4KMUX 3QOPA 4A5MA 2OQGA 2IVMA 3CUQB 3GO5A 5G22A 3LSTA 4OMYA 5K5RA 2JPCA 4K2EA