1MJBA

Crystal structure of yeast esa1 histone acetyltransferase e338q mutant complexed with acetyl coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
272
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVAILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism of the ESA1 histone acetyltransferase involves a self-acetylated intermediate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Esa1 protein
total genus 81
structure length 272
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mjbA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1mjbA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1mjbA02
2ACJA 4KUBA 2B0LA 4IRIA 5CVVA 1ON0A 2VC0A 2EWNA 3BDDA 2E1CA 1J59A 1SMYF 3LWFA 1KUXA 2J8MA 1HKSA 2FBHA 2STWA 1ON1A 3TKYA 4PCQA 2C6YA 4OIQF 2IPQX 1D3YA 3LAPA 2JRTA 4K2EA 4JLYA 1YQAA 3WTZA 4P55A 2Y48A 4ASNA 5DWMA 5DD4A 1XDUA 1AWCA 3BJAA 1QSNA 3IKTA 1DPRA 3BLNA 4KMUX 4G9YA 3SZPA 1HBXG 2HTJA 2UWMA 2L02A 2FSRA 3DV8A 4BNCA 3CTAA 2X0LA 2FIWA 4JXQA 2J5PA 2HEOA 1SD5A 2CNMA 1JXSA 2ZW5A 1YG2A 3GFMA 4J3GA 1HXDA 4XLNF 4U7DA 1EH6A 3M7GA 1M1DA 1GHCA 1FP2A 3EO4A 3KKWA 3ZN0A 4YFJA 3R9EA 3EUHA 5FVJA 4YFNF 1OR7A 3P2HA 3FBUA 1I6XA 2FNAA 2R7DA 3FM3A 3BZ6A 3R9GA 1YLFA 1R1VA 2JDCA 1G3WA 2PR8A 2OQGA 3SHPA 3N7ZA 2GXBA 3L00A 5IT9K 4EJVA 2KJBA 1J2XA 2BEIA 1BI3A 2F5CA 3L09A 2LKPA 3WTSC 1P0HA 4HF0A 4UA3A 1KU3A 2HGCA 2XAHA 1TW2A 3FIXA 4BHBA 2HS5A 2FCKA 3PZJA 1TNSA 3CUQA 4ESJA 3EY5A 1Q2YA 4KUMA 4M9ZA 2LF7A 4JJXA 3REOA 1R5GA 5DEQA 3WTTC 1ZN2A 3E0KA 2JEVA 4XSXF 3D3SA 3P9KA 3LODA 4B8XA 4BHPA 1Y9KA 4HYEA 4JQFA 1TIQA 2YU3A 4MEXF 3WU1B 5DD8A 1I21A 2OH1A 2VODA 4ZZLA 2REEA 2XAJA 2V79A 4Q47A 1QSOA 4FD7A 1BBYA 2R3SA 4E70A 3DFGA 2G3AA 5LGTA 2DO7A 4II9A 4MY3A 2CNSA 4PSXA 3FMQA 4RS2A 1TQMA 4MEYF 4Y49B 1TNTA 5F48A 5F64A 1ZREA 4MI4A 2QECA 3R6SA 3VWEA 5KTCA 4OIRF 1LVAA 2O3FA 4L0ZB 3RDIA 2P6SA 2QM3A 4P5OA 2EA2A 1LDJA 3B73A 2NRAC 4B5OA 1Z6TA 3IRQA 3FWEA 4M9SA 2KJCA 5F6FA 2K4JA 3U9GA 2IJLA 3I71A 4PGHA 2REFA 5BPDA 1KQ0A 1H9GA 3CDHA 3GFJA 1RUOA 4FD4A 4CAWA 2D45A 1W7PB 2DW4A 2ZW4A 4E0AA 2QMLA 2OD5A 4R3KA 4Y17A 3C3WA 4CAXA 2DAOA 3JSOA 2C27A 4KOSA 2EK5A 3I58A 2CY2A 3DP7A 3F23A 3HRSA 4ZYGA 3MAJA 1QQIA 3KEQA 2ZNZA 4HF2A 2E7WA 4LB6B 3BPXA 1MJBA 3LD2A 5CVJA 4ESBA 2F5FA 2H5MA 3LQRA 5HLIA 3GLXA 3ZJ0A 1G3TA 3H92A 2FT0A 3MWMA 3TO7A 2KIUA 3ELKA 5HS8A 3FXQA 4UVBA 4PZJA 1TBXA 3DEUA 2FBKA 1IZ1A 2HWVA 1PDNC 2O6GE 3C7JA 2DXQA 2A07F 4YIFA 4EQQA 3QU3A 2QZ8A 2BL1A 3EC4A 1Z1DA 4RGUA 2BGCA 1HW2A 2JPBA 4AG9A 3TGNA 3V7RA 2M1BA 3R4KA 3E5XA 3HHHA 1Q2CA 2VOPA 1SAXA 4BMHA 5FO5A 1L0CA 1YS6A 1W5TA 4AVCA 2I79A 3VWDA 2FA5A 3CJNA 5HMNA 2FRHA 4IRHA 4NEXA 3DQVC 2VBWA 2XROA 3BP8A 1BI1A 4MJ8A 2CSOA 4BH9A 1ZRCA 5E1XA 1EH7A 3DF8A 3EDPA 2Q7BA 1CGPA 2ZJ2A 3J80K 2HUZA 2JLMA 4OLLA 2ESNA 3R1KA 4LK0F 5KK1A 4ZZDA 4QVTA 3I3GA 4ZH4F 2GQQA 3T9YA 4EGZA 4DQ2A 3EYYA 3F8CA 4IJAA 1DDNA 2LNBA 3E3VA 2PN6A 1XMAA 3ROUA 5D5UB 1XSVA 3DKWA 2Y0MA 1YFHA 1CF7A 1K6OA 1RNLA 3HRUA 2PDOA 1FYKA 3GF2A 1U6MA 4L9TA 2D1HA 2OQRA 4A0YA 5LGNA 5C88A 1LJ9A 2V6CA 4U7BA 1E17A 2AXLA 3WU0A 5D6EA 3GYHX 4HX7A 1GXQA 3R96A 2OU2A 1KQ9A 1WWZA 4YIIA 1J9IA 4EJUA 1YREA 4Y13A 4CRZB 2CGPA 4OIPF 3F8MA 2ARHA 4YGOA 1B1BA 3JAMZ 4I49A 1XE4A 2EFPA 3D5LA 1G4DA 1QSTA 3RI4A 3S6KA 1ULYA 2PEXA 1KQ8A 2TDXA 3SHFA 2A61A 4N9IA 4RB1A 2NYXA 2EA4A 2F2EA 1YLEA 4MY0A 3IWFA 2ESHA 2GANA 2L4AA 3C18A 2P6FA 1P6RA 2JSCA 4BYYA 2B58A 4BXUA 5FLXK 3PQKA 4X5KA 4MNUA 1Q1HA 2L01A 2KIFA 3DSBA 1WKMA 3F8FA 2VZYA 3GYAA 2G3TA 2B3UA 2YPRA 3IKVA 1GXPA 3CUQB 4LLGF 2B4DB 4CHUA 2PLYA 1FP1D 3HYIA 1V4RA 3E6BA 2HQNA 1UHWA 4N0BA 5IB0A 1E2XA 3PP9A 1FY7A 2OBPA 3B8GA 1XGMA 5CLSA 1QNTA 1YX0A 3FMSA 4EVIA 3Q9VA 3RPUA 3D2PA 4QUSA 2AS5F 2JPCA 4M9XA 3GW2A 2B4BA 4K30A 1T0FA 4LMYA 4HX4A 3F21A 2EUIA 3J81Z 2VT2A 4WXHA 5IT3A 4XPDC 1YVKA 1IYKA 1D5VA 4KMFA 5D6FA 3SXYA 4I01A 2IL4A 3HOSA 1I5ZA 2HYGD 3VOEA 3ZMDA 2P6GA 1Z4RA 3EXNA 5JI6A 5L3BA 1JGSA 4H89A 2VE9A 4JXRA 1B4AA 3KP2A 2CQKA 2W57A 3CXSA 3HSEA 1ZG1A 5JVTA 2ZXJA 5LHHA 1IAWA 2ZXVA 1S7LA 1KUVA 5FB2A 2I00A 1KUYA 2MLGA 1YW9A 3ISPA 4ZBGA 4HLYA 5TRDA 4ENMA 1NE9A 3ECHA 3DNSA 2EB7A 1RI7A 2IRFG 1R57A 1R1UA 3MCZA 4Y15A 2J8RA 3S6GA 1T39A 2GAUA 4ZYEA 4P9UA 1MK4A 1XGSA 1M4GA 4CRYB 3KEOA 6PAXA 2VXKA 4WF2A 4KLVA 2VI7A 1O3QA 5LHIA 2HKXA 1IRGA 3ZQ7A 1FBUA 1EH8A 5DWNA 4EJWA 2DT5A 3F6OA 2RNJA 2R98A 2AE6A 2GE3A 2P5VA 4R79A 1MJ9A 1OYIA 1N71A 2D1VA 2VBQA 4KT5C 1VKCA 2J8NA 4UHTA 2PI0A 3HTUA 1IUYA 4ZYHA 4MBUA 3TO6A 2ZO4A 1XGOA 4RI1A 2YR2A 2R1IA 3CUQC 3T8RA 1OPCA 5A2QK 4G7OF 3E97A 4FT8A 1DUXC 2OA4A 4G7ZF 1BN5A 2X7BA 4A6DA 2HV2A 3R95A 1ZHFA 2A5YB 2ZPAA 1XSDA 3TOAA 2M30A 4HF1A 1MD0A 4OINF 4I02A 3JTGA 3SXOA 1O3RA 1FLIA 4NF1A 1VTNC 2A68F 4WCGA 1G3SA 4LLLA 1YIOA 2Z9OA 4ENNA 2IA1A 1XDSA 4D0PA 4UNOA 3I0TA 3OWCA 2OZGA 4YG2F 1RUNA 2HFHA 3HSFA 3FHZA 4G6QA 4KOTA 1FPQA 4F6AA 3MQ0A 2MC3A 1PP8F 1LRZA 3RPQA 2Z5UA 4EGYA 2DFIA 3V8JA 5CYVA 4MTDA 4EVYA 1Y0UA 4XPDB 2Z10A 1UB9A 4RAZA 4ORFA 2QUFA 1FX7A 1IN8A 1U78A 4OMZA 3OV8A 1Y9WA 2OZUA 2XVCA 2VOOA 5JR3A 3UY5A 3HRTA 3ZN1A 5ICGA 3ERED 4EMSA 1FT9A 5FGMA 1R1TA 1WI9A 4LB5A 3LA2A 4ENJA 2RQPA 3FM5A 4Y49C 3TDUC 4M71A 2HDCA 2DPDA 1I1GA 1IXSB 5BPIA 5LRSA 3RKXA 1TW3A 2HYFA 4MQ9F 1PUEE 3KETA 2XGXA 3RKWA 1BC7C 2KIMA 3NE7A 4KOYA 3HUGA 4OAEA 2Z0ZA 1G6NA 1SFUA 1HW5A 3G8WA 1B9MA 2RDPA 5DUKA 1EV7A 4U0YA 2KKOA 1IB1E 4L5IA 3D8PA 2NMTA 5CJ9A 4KOUA 4IVNA 2FEZA 2JZYA 2R7FA 4JK1X 2RVCA 1R00A 2EFOA 4U88A 1Z4EA 3TCVA 1BM9A 1REPC 3I53A 1RO5A 3F22A 4FD5A 2OAZA 4O5VA 3SZTA 4MTEA 5AIQA 4PDKA 1Z9UA 5LBQA 4HV5A 1YGHA 3F3XA 3KP6A 4HNXB 4KIFA 2H94A 3NEUA 3GZ6A 2A4NA 3DR8A 2F5DA 2WWYA 1MDMB 3BJ7A 2VT3A 3QPTA 5E96A 1B9NA 4IF4A 4RB2C 1CJWA 4AIJA 2H6CA 3ZZIA 1Z05A 2XUBA 1IXRC 3CO7C 2EFNA 4NQWA 1J5YA 1XIXA 5IT9Z 4A12A 3FNCA 3GO5A 4L8AA 2Q0YA 5J8FA 2YX4A 2VBYA 2VEZA 4A6EA 4YFKF 1IN4A 5ED4A 2P5KA 3ULQB 4A2UA 1IIDA 1NMTA 3M9AA 2ZKZA 4MHDA 5HDGA 3IRRA 4HLXA 2Z11A 4A0XA 5E1WA 5F46A 4NXYA 2G9WA 5H6RA 3IHUA 3V8IA 4PSWA 2F5EA 1F1ZA 5DCFA 1S3ZA 3EYIA 2BSWA 2CO5A 4Q48A 2FE7A 4H0EA 1C0WA 2FSWA 2OZHA 2ZW6A 1K78B 3ZMZA 4KIBA 1YO5C 3IWZA 4GXOA 3F8NA 4KA4A 4G94A 1LNWA 3E5UA 3KP3A 3JAMK 1P4WA 2W85A 5E1ZB 1O3TA 1WK4A 2ZBKA 1FZPB 2Y75A 1Q2DA 2QBYB 4LFUA 1Z7UA 2HQYA 4JD6A 4FX0A 3GZ5A 1F4KA 4KUAA 4I0AA 1FSEA 4UVCA 1U3EM 4R8HA 2CW0F 1ZRDA 3U1DA 4BHCA 4RB3C 3FF5A 3QU6A 1CF7B 2VBXA 2J5OA 1J75A 1T6SA 2FS5A 3FRMA 4LK1F 5D5WB 3WTUC 1XF8A 3DPTA 1QO0D 3I54A 1S7KA 1P92A 3BROA 5E20A 4AWXB 5FLXZ 4PK3A 3WTXC 3K1PA 3TOBA 4XRFA 2K27A 1ZYRF 4WX9A 2Q8KA 1T38A 4PK2A 1LDKB 4GGGA 1YW8A 4A5MA 3IC7A 5ICFA 1KU9A 1W5SA 2WPXA 3E6MA 3S6HA 5E8GA 1FSHA 2QIRA 1OZPA 2QVOA 4GCVA 5H86A 1UCRA 2A6HF 1B6AA 2COMA 3KP7A 4GYGA 2XAGA 1L0OC 2V1DA 3BOQA 3RYOA 3BY6A 2BYVE 4M73A 4XPKA 2FMYA 1O7FA 1WRJA 2FNPA 1USSA 2EFWA 1YW7A 2M45A 2MA3A 1R23A 1M4DA 5DDGA 3GUDA 1HKQA 3J81K 1ZGAA 3ZMTA 5I0CA 3I9SA 1B6BA 1S7NA 3K2ZA 3JTHA 1R36A 4EJTA 1QSMA 4B09A 3NQOA 4U0WA 2ZCWA 1CM0A 1LEBA 1KA8A 2ISYA 4EJOA 3L9FA 1YK3A 2B5GB 2G7HA 3MGDA 3O2PE 4AG7A 5IX3A 1S6LA 1STZA 2O28A 2W24A 3F0AA 1JE8A 3CXQA 3QP5A 1FYLA 5L3GA 4CO8A 1R58A 1IICA 1QZYA 4YRHA 4QWQA 4A5NA 2FMLA 2FQ3A 3KZZA 4EV0A 5BOXA 4JBAA 4GYIA 4L9JA 4WXDA 2RN7A 1FBSA 3BPVA 5D5VB 3VFZA 2NAZA 2DPUA 1RXTA 5BMZA 2A69F 1W7PA 5EEHA 4R57A 1K7AA 2R7HA 4OMYA 4M6XA 1NSLA 3FX3A 4RAYA 1AOYA 2NS0A 3R61A 1FYMA 2KCWA 1V3FA 3P2FA 2P7VB 1KGSA 1QBJA 2E7XA 1SQHA 1GHEA 4XBFA 1WQ2A 4EM1A 4E2AA 5CVIA 4KORA 1Z9CA 5F47A 1L3LA 1QZZA 1UHMA 3WR7A 4CICA 1LB2A 3JSPA 2ADUA 4A0ZA 5L3CA 2PMHA 2O8XA 1XCVA 3E6CC 3T90A 2EV0A 3FMRA 4YFXF 3DDDA 1PUAA 4OADA 2XKPA 1G3YA 2DBBA 1U5TA 5A2QZ 5ILSA 2HOEA 1TQPA 1USTA 4HDVA 2RC4A 5HH1A 3TO9A 2K7LA 4FD6A 5EEGA 2EV5A 4EM0B 2WV0A 2H6BA 3JW4A 3MZHA 2CYYA 4KNYA 2P0WA 1ODDA 3KP4A 3O6BB 3ABUA 2WPWA 1LDDA 2BEOA 4G7HF 3L7WA 1PU9A 5AIPA 1TLHB 2V9VA 5ILUA 1GVJA 5K1YA 4KLWA 5IV0A 4IHSA 3GKRA 3TE4A 2FU4A 2LF8A 1YS7A 4L18B 3KZYA 2B4DA 4PV6A 5KTDA 1MKMA 1DP7P 3TFYA 3FB3A 2OB0A 1S60A 1O57A 4R87A 1P4AA 1BOBA 2PR1A 3S2WA 3ZMSA 1UFHA 2NNNA 5K5OA 3KLOA 2IP2A 3U2RA 4UV9A 1R22A 2XASA 2VC1A 4RGSA 4UWJA 3C26A 1Z6RA 1JHFA 4TV7A 4AVPA 3G3ZA 2Q0OA 3PGPA 2FXAA 4LD5A 4NHJA 5H6QA 2Q4VA 1JHHA 2WC2A 4HOBA 2WTEA 3I59A 2IW5A 2M87A 4KYWA 4MQVA 5CNPA 2ZMEB 3GEZA 2GWRA 3W6JB 4AIKA 1U5TC 4G6DA 3W91A 2A6EF 4M3SA 4R1HA 1TTYA 3LSTA 5JFRA 3VODA 1FC3A 3GWZA 3CXPA 4O6JA 4JWPA 3LFKA 3K9TA 4ENKA 3GY9A 1ZGJA 5EBVA 3EFAA 4GO1A 5D5XB 2O61A 5ERIA 1QSRA 1P4XA 2GA2A 4UVAA 4O3MA 2EV6A 4Z2YA 2RV8A 1BI0A 1XSXA 3WE2A 3B02A 2PC1A 4KFCA 1LQ1A 5DCMB 4OIOF 3LA3A 4FHTA 4FX4A 4WWCA 4HA8A 2QENA 4WXCA 1XD7A 2G0BA 3BJ8A 1LEAA 2PFBA 2MBFA 2ISZA 1XEBA 3G73A 1MZBA 4I09A 1I12A 1P2FA 3IWGA 4UV8A 2MLKA 5KTAA 2NNYA 1J4JA 2L54A 2XIGA 2W84A 1YVOA 3RJPA 2EJRA 4DNCA 2DTRA 4LX9A 1OYWA 5HVQC 3GFLA 1DPUA 5J6XA 1K79A 5AONA 1XB4A 2DK5A 2ATRA 3R9FA 1J7KA 2P7CB 1I27A 3V7SA 1YYVA 5D4RA 4IHTA 3HRMA 3I59B 4E8OA 3E5QA 3WTYC 2PBIA 1O7LA 1RZ4A 4U5YA 3O3KA 1VHSA 4HNYB 2Z33A 4ESFA 2IA2A 1KU7A 4LG0B 2BE5F 3KCCA 1R5HA 2VBZA 2Q2EA 3FXUA 2Q4YA 2L3DA 3LQQA 1ZG5A 3OOPA 2V1XA 1ZAOA 1BO4A 2UXXA 2FE3A 3H3UA 3F5BA 4M72A 3FZVA 5FFZA 4ZYDA 4RS8A 3QOPA 1H0MA 2DQLA 5LGUA 3HSRA 2FOKA 3HOTA 1XCBA 1ZH5A 2UXNA 1U2WA 4HQEA 3WGGA 2FBIA 3GX4X 3D2MA 2Q04A 4QB9A 4KVOE 1UFMA 1FNNA 3FXRA 4IPAA 4P96A 4CS0B 3Q9SA 1W7PD 5C82A 2PRBA 5HLGA 1BIBA 1BJAA 5L3EA 3EETA 3I5UA 1XGNA 4S05A 1IRFA 5D4SA 5ICEA 3H4QA 4LLNA 1U8RA 3JUWA 5DV5A 3PFIA 2QQAA 3SFZA 2BV6A 2W25A 2EFQA 4CDGA 4L89A 1TQIA 4LJZF 1M4IA 4AD9A 5HDKA 4M6YA 1T2KA 2P6TA 4KN4X 4XNHC 2PG4A 2R8VA 3QPHA 1FWZA 1QGPA 2O0YA 5GCNA 2DQRA 3TT2A 3CLOA 5LLQA 3ABTA 4QLCU 3AAFA 5DCMA 2XHKA 3T5XA 1K4JA 1R7JA 5BS6A 1B59A 4AVAA 5BQTA 2A3SA 1IYLA 3GFIA 1D8JA 4U9YA 3QP6A 3HIFA 4L0YB 4RB0A 3V8KA 3KLNA 4L9NA 4RGXA 2H09A 2PMUA 4HZFA 3EQLF 2ZNYA 2H27A 1T98A 2MD5A 2OZ6A 1S7OA 1A04A 3W6SA 1WSUA 2Q44A 4NSQA 2DK8A 1IN5A 3F6VA 3WG9A 1J0RA 2PQ8A 4Q4ZF 5L3FA 5FFXA 1QPMA 3E6DA 4U9ZA 1I1SA 3KFWX 3JVNA 5D8KB 5LHGA 4EM2A 1ZG3A 3V8LA 4CGZA 2P4WA 4UBRA 3LA7A 4OOIA 1HSJA 3C1DA 5JHUA 3M1EA 2B3VA 1XN7A 3R0AA 1ZLKA 2IA0A 5HS7A 3DR6A 4GS4A 5K5RA 3MEXA 3HTSB 4U0VA 2XAFA 5D8LB 5CVUA 1B87A 1ZRFA 1XMTA 1SD4A 1ONVA 4B5PA 2PSWA 4UUVA 1KYZA 5HDNA 1SFEA 5H84A 5LRRA 2GIVA 2EVNA 4QBJA 3WGHA 1O3SA 4HNWB 5HLHA 3KP5A 4M85A 2GXGA 4KOXA 2JDDA 4IXAA 2DLLA 3GVAA 4KOVA 2V1UA 2ZMEA 4IF5A 2RGVA 3RIRA 3G3SA 3NRVA 3ZPLA 1IXCA 1D8KA 2XV4S 1IN7A 5JQ4A 2KRFA 4S04A 1SMTA 2IT0A 2CFXA 3ECOA 3ZMUA 4AB7A 4IUSA 3RYRA 3DPLC 3P9IA 4KIGA 3M8EA 2G7UA 5JPHA 2HKOA 2ZFWA 5E18F 3TTHA 2GA1A 2FXFA 2BBYA 1HQCA 2XRNA 4KOWA 5CVRA 4L5JA 3FYNA 1S8NA 5H20A 3WTWC 2FIAA 3I64A 3LAJA 2P8TA 3FXTA 2CNTA 4QC6A 2D4PA 2P5LC 4LGWA 3RYPA 3VB2A 2JTVA 1S7FA 3VEPA 1SD6A 3RTRA 4B5PB 3D0SA 3DXJF 2HQRA 5LEJA 5J8CA 1KU2A 2QLZA 4XSZF 1K78A 3W6KB 1P4NA 3L2CA 2Z99A 2DI3A 2RKHA 1F9NA 1IF1A 1FOKA 4HW0A 3BJ6A 2K02A 1BC8C 2IVMA 2M8EA 3T1BA 3J7AO 2QWWA 1ZLJA 4MHGA 3K69A 4HQMA 4KVXA 1ON2A 2VQYA 2XKOA 1V0CA 2P6EA 1HSTA 1SD7A 2E1NA 5DYMA 4I7HA 5ILVA 3TQNA 4P9FA 2O03A 3R60A 2ELHA 4L9VA 2VZZA 5ICCA 2L4MA 4OU0A 3V4GA 3K1NA 1KZFA 3QB8A 3K1MA 3WE3A 1MGTA 4WK8F 1S7AA 5EC4A 1RIOH 1U6GA 2MH9A 1Z91A 5KVRA 4LUAA 4UWIA 4KN7X 3HHGA 1H9TA 2QQBA 2K4BA 1OKRA 1YTYA 5LEKA 1IW7F 2QYOA 2LDUA 5TJJA 2VE8A 2D4OA 4BAYA 4KVME 4H6UA 1OMIA 2UZKA 1YR0A 1S3JA 4BQAA 1SFXA 3QAHA 4AIHA 4AVBA 3TDZC 1HW1A 2XAQA 1XMKA 3M8FA 5F49A 4M74A 4F7ZA 4R9MA 2YX7A 5K5QA 3I4PA 2AJ6A 4ETSA 1S5KA 4I0BA 2F5IA 4HV6A 3F8KA 3T8TA 3F72A 3J80Z 3P9CA 1BOAA 3N4MA 1WWXA 2FF4A 3ZMVA 3Q5FA 4XPLA 3SXNA 2B5GA 2LSOA 3W6XA 2FL4A 3H3ZA 4R3LA 2JT1A 1ZARA 2K86A 5DUIA 4NCZA 5F1RA 3V7CA 5E8IA 1U5TB 3R0JA 3ML6A 4HKFA 2CG4A 2HR3A 1W4MA 1FBQA 4ONUA 3WTVC 3IGRA 3BWGA 1KYWA 3P7NA 4KZTA 3F8BA 1MJAA 2STTA 2M5WA 2ZW7A 4N9HA 4KICA 1Y7RA 1M44A 2X4HA 3RKYA 3K0LA 3BJOA 1BI2A 4H6ZA 4I2OA 4Q5SF 4CZZA 4HX8A 4XLPF 2VONA 4ON0A 1S29A 1I1DA 4CYDA 5FD5A 3COAC 3ZP5A 5HOOA 3K9UA 1F5TA 5HS9A 3N97A 4HAMA 4I98B 4LG0A 4XNHB 2GZWA 3IL2A 2VXZA 4NB5A 5FD6A 4UXNA 3CUOA 3PQJA 4IRGA 4CAVA 4CXFA 2K5TA 2YSRA 2D2WA 2QQ9A 3WGIA 1X3UA 3CO6C 3GXOA 2CWEA 4HBLA 1NHAA 3MZYA 5E17F 4MGRA 4RGRA 1BIAA 2Z3YA 2PJPA 4HDUA 4F0YA 3MFKA 1HKTA 5ISVA 2VN2A 4KDPA 2QBYA 3T0YA 2MH2A 2HTSA 1PP7U 2ETHA 3SQNA 3S6FA 2DU9A 4G8XA 3KE2A 1IN6A 2BUEA 5L3DA 1MDMA 2HZTA 1OYYA 3QRFF 4PGGA 3WODF
chains in the Genus database with same CATH superfamily
3C2BA 2ACJA 1RPWA 2K85A 3A01A 2B0LA 2IBDA 3UR3C 2OUMA 2YUSA 4KUBA 4IRIA 5DS9A 3OIPA 5CVVA 2KLOA 4CGOA 1ON0A 3JRDA 3WC6A 2VC0A 4BQOA 2EWNA 3BDDA 5J1QA 2E1CA 1J59A 1SMYF 3K4KA 3LWFA 2FQ4A 1KUXA 4IAVA 2MABA 2AO9A 2J8MA 1HKSA 2FBHA 2STWA 2QQ8A 1ON1A 1OYVI 3TKYA 4PCQA 2C6YA 4OIQF 2IPQX 5KNLA 3UGLA 5AG7A 2WV1A 4DOZA 4XOPA 1QHHD 1D3YA 3LAPA 1RR8C 4LQ6A 2NU4I 4PJLA 2JRTA 1ZR2A 4B11A 4C2YA 4D1QA 4K2EA 4JLYA 5DTDA 1WI3A 1YQAA 3WTZA 3FJUA 3H8FA 4P55A 2GOMA 2Y48A 5A28A 1AN1I 2F7VA 4ASNA 1Y6IA 3A01B 4ONWA 5DWMA 5DD4A 1SFKA 1XDUA 4XIDA 1X3ZB 1Y0NA 2Z3LA 2ZSIB 1AWCA 3BJAA 2YNEA 1QSNA 3IKTA 4UIBA 3KZWA 1DPRA 3FXJA 2PJ8A 3BLNA 1T08B 2PJ5A 4KMUX 4DYCA 4G9YA 3SZPA 1HBXG 3VPRA 2HTJA 2UWMA 2L02A 1YW4A 2FSRA 3DV8A 4BNCA 4CGNA 2L7MP 3CTAA 2X0LA 2FIWA 4BY7J 4JXQA 3UEYA 2J5PA 2HEOA 2FOWA 1U9OA 1Y8RB 1SD5A 1ZK8A 2CNMA 1V55H 1JXSA 2ZW5A 1YG2A 3GFMA 3NARA 1HXDA 4J3GA 5J1UA 4XLNF 4CSWA 1X3WB 2QQEA 3R5AA 3UFFA 4U7DA 1EH6A 3M7GA 2ZC2A 2R92J 1M1DA 1GHCA 1FP2A 4AM3A 3EO4A 1XTAA 3KKWA 3ZN0A 3D68A 3HXLA 4YFJA 1AU7A 3B3VA 3BR3A 3R9EA 3EUHA 5FVJA 4YFNF 1OR7A 3P2HA 3FBUA 4FUUA 1I6XA 2R7WA 2FNAA 2R7DA 3FM3A 3BZ6A 5GTIC 3R9GA 4AC0A 1YLFA 3KQZA 1R1VA 2JDCA 1G3WA 2PR8A 2OQGA 1Y39A 2VRWB 3D67A 3N7ZA 2GXBA 1RKWA 4OC4A 3SHPA 3L00A 3HL2A 1CGII 3D00A 5IT9K 3MN2A 3A02A 4EJVA 5JLWA 2KJBA 1J2XA 1VQ8I 1TBNA 2BEIA 4E7SA 2C6CA 2ZENA 4OIDA 1BI3A 4DZJA 3I1UA 3TW6A 2F5CA 3ABKH 3L09A 1MIJA 2GFQA 2LKPA 3WTSC 4A3BJ 4HF0A 1P0HA 2SGDI 5IP6A 4UA3A 2P81A 1KU3A 2HGCA 1VHEA 2XAHA 4IOCF 4O23A 1TW2A 4CYPA 3CCJI 3RSNA 4P4JA 2DYRH 2MD0A 4NNJA 4XM3A 5FUWA 3FIXA 4BHBA 1AMPA 2HS5A 1TF8A 5C4XJ 1SGPI 2FCKA 2E2IJ 4MFEA 2PJ7A 3PZJA 1TNSA 3SDBA 3CUQA 2K5CA 3A03A 3EUAA 2UVOA 4OKOA 4ESJA 5EMIA 2TCTA 3EY5A 1Q2YA 4KUMA 3LNQA 3LMSA 4M9ZA 2LF7A 3KR4A 1LR7A 1K7UA 1SVOA 3VWBA 1OMTA 4JJXA 3REOA 1R5GA 5DEQA 5GPCA 3WTTC 4OVOA 5HXDA 2DOFA 1ZN2A 4H4KC 3E0KA 2QA4I 2JEVA 4XSXF 1ACIA 1DE4C 3D3SA 3P9KA 3OVOA 3LODA 1WJDA 4B8XA 1MH4A 4BHPA 1Y9KA 2RREA 1K83J 4J00A 4HYEA 4F9VA 4JQFA 1TIQA 3H5AA 1KZHA 3HJEA 1TC3C 2C6GA 2K9HA 3BT9A 2Q1ZB 2YU3A 4MEXF 5E3QA 3WU1B 5DD8A 1I3QJ 1I21A 2LD5A 2OH1A 2XPUA 2VODA 4ZZLA 3CPXA 2REEA 2XAJA 2V79A 4Q47A 4DIQA 1QSOA 2BOLA 1BBYA 4FD7A 2R3SA 3SYTA 4E70A 1BPMA 1LE8A 3DFGA 2VQHA 1HDUA 2NSMA 4IEJA 1T8IA 3LSHA 2G3AA 5LGTA 2DO7A 1TURA 4II9A 1R43A 4YEJA 3HH2C 4MY3A 4AU7A 2CNSA 3KHZA 3FBNB 4PSXA 3FMQA 4RS2A 3DCFA 1RTQA 1TQMA 3H5RA 5TGTA 4MEYF 1CQTA 4ZY1A 5EJCA 4Y49B 4KSIA 1TNTA 2OCCH 5F64A 1ZREA 5FUYA 4MFKA 5F48A 1M8CA 3S2HJ 2JBKA 4WWVA 5M5YJ 4MI4A 3HEFA 1OCPA 2E5NA 2QECA 3R6SA 5DS0A 3VWEA 1SGEI 4BE1A 2BHZA 3AKZA 5KTCA 4OIRF 1NK2P 1LAMA 2OC6A 1LVAA 2O3FA 4L0ZB 3S9MA 4TNUA 3RDIA 1Y0RA 2P6SA 2QM3A 2ZB9A 4D5FA 1IOFA 3ZOBA 4P5OA 4GXHA 2EA2A 5IP9J 1LDJA 2Y9YA 3B73A 2QYVA 2NRAC 1Y7EA 1Z6TA 2BXYA 3FWEA 3IRQA 4MRIA 4B5OA 2CW8A 4M9SA 4A38A 2KJCA 2EZHA 1TWCJ 5F6FA 1S9HA 2K4JA 3U9GA 5JM6A 2BY1A 2IJLA 1Q1VA 3ZQIA 3FK6A 3CD6I 3GOXA 4MHYA 2EZKA 3SJXA 2CJSC 2ODDA 3OYHA 5EX0A 3S9NA 4FKDA 3I71A 4PGHA 2REFA 5BPDA 5LYIA 4MHZA 1QRYA 1LVKA 3HOWJ 3G1MA 2PMZA 4KSFA 1Z3YA 1KQ0A 5DAEA 5CCMA 5G21A 1MBGA 1POGA 1H9GA 3GFJA 3CDHA 1RUOA 3OIOA 4FD4A 3SI1A 4CAWA 2D45A 1W7PB 3PSIA 3BI0A 1CSOI 2DW4A 4CCKA 3SDGA 4C3IJ 2ZW4A 3KPHA 1OCCH 2ELJA 3ZQLA 4MCPA 2R4GA 3VSKA 2Y0SN 4XRMA 1EJ9A 4E0AA 2DEAA 2QMLA 2OD5A 4R3KA 4Y17A 3C3WA 4CAXA 2DAOA 1FAQA 3JSOA 2C27A 2VIXA 4KOSA 2EK5A 3I58A 2CY2A 3DP7A 4B48A 3F23A 2O8KA 3HRSA 1Z67A 1VQMI 4ZYGA 3MAJA 3WABA 1QQIA 3KEQA 2ZNZA 1PJRA 2E7WA 3DEEA 4LB6B 2CUJA 4HF2A 2HXIA 3PB6X 3BPXA 3E59A 1MJBA 4MCRA 3GZNB 3LD2A 4K3NA 5CVJA 2MGQA 4ESBA 2F5FA 3B3SA 1ARLA 3H36A 1SFOJ 2H5MA 3GTLJ 3LQRA 5HLIA 1YIJI 1R0RI 3GLXA 2IS6A 1G3TA 4NFRA 3ZJ0A 3H92A 2FT0A 4DYOA 4A94A 3MWMA 3TO7A 1PUFB 4XLCA 1D1BA 2KIUA 4N4OB 3IC1A 3G1LA 4EFDA 3ELKA 5HS8A 2ZMEC 3FXQA 4UVBA 2HU9A 4PZJA 4J19A 3MN8A 1TBXA 3DEUA 2FBKA 1W36D 4IHWA 1IZ1A 2HWVA 2QKMB 5ELYA 1N77A 1PDNC 1MNMC 2O6GE 3HPHA 3C7JA 5FKOA 1X1PA 3DBHB 1WGXA 3HDDA 2DXQA 4R8FA 5EX3A 2A07F 4YIFA 4EQQA 3QU3A 2ME6A 8CPAA 2QZ8A 2BL1A 3EC4A 1Z1DA 1S20A 2E1OA 4RGUA 2BGCA 1HW2A 1D0ZA 2JPBA 1LFWA 1YSJA 2ZEEA 3FKIJ 1JUPA 3L2QA 4AG9A 3TGNA 3V7RA 1Z8WA 2M1BA 2X6XA 3E5XA 3HHHA 3R4KA 1Q2CA 3ZCOA 2VOPA 2L7KA 5HNHA 1SAXA 4BMHA 4RBOA 2PX9A 5FO5A 2Z3MA 1GV5A 2OVOA 1GT0C 1L0CA 1YS6A 1W5TA 4AVCA 2I79A 3VWDA 1TBQR 1NG7A 3SI2A 2HVSA 2FA5A 3CJNA 2VKVA 5HMNA 2FRHA 4IRHA 3FEDA 4NEXA 3DQVC 5LRGA 1UMQA 3HUVA 3OYIA 1DGWY 2M0MA 1FOWA 4C3HJ 2VBWA 4C9YA 3D7GA 2XROA 1GVDA 4OC1A 3BP8A 2DB6A 2WA0A 3PNYA 1BI1A 4MJ8A 1WJ5A 1WHUA 2I8DA 2CSOA 4BH9A 1FARA 1TGSI 1N25A 2JK3A 5E1XA 4BDZA 1ZRCA 1X74A 3F0CA 1EH7A 3DF8A 3EDPA 1CT4I 4E1RA 1LCPA 1ZTRA 3IU1A 2Q7BA 5CBMA 2VASA 1IY6A 1CGPA 2CRGA 3HOZJ 2ZJ2A 3CP2A 3J80K 3TJQA 2HUZA 2JLMA 4OLLA 2ESNA 2PMZN 1XA6A 3B3TA 3R5CA 4LK0F 3R1KA 1UHSA 2ORVA 5KK1A 4ZZDA 1H89C 4QVTA 2SGPI 2ZXWH 3I3GA 4ZH4F 4BXFA 2GQQA 3IWEA 3T9YA 4EGZA 3HZJA 4MLOA 4DQ2A 3D66A 3EYYA 3F8CA 4IJAA 1DDNA 1BW6A 2LNBA 3E3VA 2PN6A 1XMAA 3OL3A 3ROUA 4E7JA 4OC2A 5EF6A 4YIRX 3HG9A 5D5UB 1ITYA 5IY5H 1XSVA 3DKWA 1I6HJ 2Y0MA 2Z2SB 1YFHA 1UUCA 4P6YA 1CF7A 2XSJC 1K6OA 1RNLA 1X1CA 3HRUA 2PDOA 1FYKA 4XNFA 3GF2A 1MBHA 1U6MA 4L9TA 2D1HA 2OQRA 4A0YA 2K9NA 2LUYA 2BY0A 5LGNA 4II2A 5BWAB 5C88A 1LJ9A 2V6CA 4U7BA 1E17A 2AXLA 3WU0A 3PBEA 5D6EA 3WHBA 3GYHX 4HX7A 3MRUA 1GXQA 2JRMA 3DTKA 4MFDA 1CX8A 3IU2A 5CPRB 2OU2A 2VKDA 5JLXA 4BQNA 5HNFA 3R96A 3ERMA 1WJBA 1KQ9A 1WWZA 1TZLA 4YIIA 3NE8A 1J9IA 4EJUA 1YREA 4DGWB 4Y13A 4ZX8A 2EILH 2ID6A 4CRZB 2CGPA 2M7AA 3F8MA 4DW6A 4OIPF 5LRKA 3AG3H 3QODA 2ARHA 4YGOA 1B1BA 3JAMZ 4I49A 3A9LA 1ELMP 3KIOA 2XGDA 1XE4A 1GUUA 2L7XA 5JPHA 2EFPA 2O53A 2OD1A 4MHNA 3D5LA 1G4DA 1NSAA 1WJEA 1QSTA 4IQJA 3RKQA 3RI4A 2QQDA 3S6KA 3RPUD 4GDFA 4M6HA 2R7OA 1ULYA 2PEXA 4A3JJ 1KQ8A 4MPIA 3ZQQA 2TDXA 5G22A 1OFCX 3SHFA 2NU2I 2CQQA 3EUHC 3HKZN 5GPAA 2EK9A 4CAEA 2A61A 3S32A 1R4NB 4JYKA 4N9IA 2MYSA 4RB1A 3CT9A 1Z8XA 2NYXA 4TWEA 2YNCA 1U8BA 2JYYA 1AYEA 3BC8A 1T56A 2EA4A 2XRCA 2IMOA 3DLJA 2F2EA 3KY9A 1YLEA 1XX6A 1MW7A 5CKTA 2DA2A 4LIVA 4MY0A 3OR1C 1Y8FA 3IWFA 1BW5A 1W5CC 2ESHA 2GANA 2CV0A 2L4AA 2MSYA 1WTJA 1Y1BA 3DLLF 1Z8TA 4M3GA 3C18A 4A3IJ 2P6FA 3RZAA 3A2KA 5FKLA 4IHVA 1P6RA 2JSCA 4BYYA 2B58A 4RAFA 4BXUA 5FLXK 3PQKA 2V1CA 4MFPA 4X5KA 1I50J 1S5LC 2O5RA 4BU2A 4MNUA 1Q1HA 2ELKA 3K4JA 1YJWI 3CC4I 2L01A 1DP3A 2WB1N 2KIFA 3DSBA 3G1OA 2R7UA 1TBRR 1UHAA 1WKMA 4XKCA 4BACA 3H8EA 5JH9A 3F8FA 2VZYA 3GYAA 2G3TA 4DUKA 4RLFA 2B3UA 2YPRA 3IKVA 5HODA 1GXPA 3CUQB 3I4MJ 3MVPA 4LLGF 2B4DB 4CHUA 2MG4A 2ZELA 2PLYA 4PUSA 1FP1D 3TX8A 3HYIA 1HDPA 1V4RA 3IJ3A 3E6BA 2HQNA 2IS4A 4B14A 1MMSA 1UHWA 4N0BA 4MIMA 3OYJA 5IB0A 1E2XA 4AYBA 1CP6A 3PP9A 3IWWA 4E7HA 1FY7A 2OBPA 2Y2ZA 3JRHA 4JCVE 4PXBA 4DBQA 4V19K 3B8GA 1XGMA 5CLSA 1QNTA 2PJRB 1YX0A 4Y52J 4ZY0A 2J9RA 5C4JJ 3FMSA 3ISXA 2OF7A 4EVIA 2OTLI 3Q9VA 1V1IA 3RPUA 3D2PA 2DMTA 2M3AA 3QPSA 3GLJA 1APLC 4QUSA 2AS5F 2JPCA 3BZCA 5K8MA 4M9XA 3GW2A 4ZDPA 2B4BA 3Q0UA 1JTXA 5FRNA 2DA5A 1T0FA 2B0UC 2LKXA 1Z2LA 4LMYA 2Q7SA 4K30A 4HX4A 2EO8A 4HPQA 3F21A 3PUBA 2EUIA 3J81Z 2VT2A 1OCTC 4PXCA 1ELLP 4WXHA 5J4VA 3M1CA 5IT3A 4XPDC 3VYTB 1YVKA 1IYKA 5B1AH 1IC8A 4NC7A 3HC7A 3CPAA 1TL8A 2FVGA 2NVXJ 4UY8I 1D5VA 2IGMA 4KMFA 5D6FA 3SXYA 5AG6A 2JMWA 4I01A 5EDNA 3RZOJ 3CJQB 2LG4A 2IL4A 4BD9A 3HOSA 4B6ZA 1B72A 1I5ZA 2EPFA 2DKVA 2HYGD 2F6CA 3VOEA 4NBQA 3NA6A 3ZMDA 2P6GA 1NXUA 3KQXA 1Z4RA 3GUXA 4MCQA 2LTPA 4A3FJ 5JI6A 5FLMJ 2BO9A 5L3BA 1JGSA 3K10A 3EXNA 4H89A 2VE9A 2YNCC 1GYTA 4JXRA 4M6VA 1BR1A 3K4CA 2WZNA 2KRCA 2R5ZA 1B4AA 3BR0A 3KP2A 2CQKA 1X4PA 1Z77A 2W57A 3W2AA 3CXSA 3HSEA 2V53A 3LFUA 1ZG1A 5JVTA 2ZXJA 3SEKC 5LHHA 5B5EC 2R5YA 1IAWA 2ZXVA 4UXIA 1S7LA 1F57A 1KUVA 5FB2A 2I00A 3OOUA 4B3XA 4M6IA 2EZLA 1KUYA 2MLGA 1YW9A 3ISPA 1MNEA 2BOAA 4ZBGA 2LH9A 4HLYA 5TRDA 2DXIA 4Y7NJ 4ENMA 3BCBA 1NE9A 3ECHA 3DNSA 2EB7A 4P4FA 1RI7A 4L5EA 3GTJJ 2IRFG 1R57A 4CCMA 1R1UA 3H5NA 3MCZA 3CCMI 9ANTA 2WAFA 1MT1A 2VKEA 4OAYA 2XEJA 2CH0A 3FKJA 4Y15A 2J8RA 3S6GA 1T39A 3FVLA 2GAUA 4UXJA 3IEHA 4NGNA 1JKRC 4A33A 4ZYEA 5CQGA 4X3RA 2N1AB 4P9UA 1MK4A 1XGSA 1TBOA 1MNDA 1M4GA 4CRYB 3KEOA 3OMYA 6PAXA 7WGAA 2VXKA 4WF2A 5F0CA 5DM7F 5A27A 4KLVA 1OJLA 1VQ6I 2AQEA 2CF4A 2VI7A 1K7TA 1MMGA 1O3QA 4FETA 5LHIA 2HKXA 1IRGA 1SEUA 4UB8C 1CPXA 3ZQ7A 1FBUA 3FMCA 1EH8A 5DWNA 3MD2A 3AFHA 5JVGF 4EJWA 2DT5A 3AG2H 2H8RA 3F6OA 1HJAI 2RNJA 2HB6A 2R98A 5JGFA 2AE6A 2GE3A 3CJTB 2CWGA 4Z65A 2P5VA 4R79A 4BBSJ 1MJ9A 1OYIA 3K4BA 3D4UA 3GLLA 2JQ7A 2Z16A 1N71A 4GM5A 2D1VA 3SEZA 1E3OC 4JYWA 1VQLI 2VBQA 1D1CA 2BVMA 4KT5C 3IAM2 1VKCA 2Z1DA 2J8NA 2LFBA 5EG0B 4UHTA 2PI0A 3HTUA 1IUYA 1LR8A 4ZYHA 4MBUA 3VDPA 3TO6A 2ZO4A 4NUBA 5CQEA 3Q3SA 1XGOA 2M9HA 3SJEA 4RI1A 4P4IA 2YR2A 1NTCA 2R1IA 4LIUA 3TBIA 3CUQC 2UZ3A 2W7NA 1WJFA 1BPNA 3CCYA 3FXOA 1Y1VJ 2CQXA 3T8RA 2GREA 4P4BA 4UCNA 1TWFJ 1OPCA 5A2QK 2IQ6A 4F3QA 4G7OF 1FTZA 3E97A 4FT8A 3ESWB 4IOAF 3S9LA 1DUXC 2OA4A 1N78A 2GVIA 1IGNA 4G7ZF 2ZEDA 1BN5A 2X7BA 4XQFA 1NK3P 1FMWA 4A6DA 2HV2A 3R95A 1ZHFA 2A5YB 3JRIA 3G4SI 1JKOC 1B8IB 1CHOI 2ZPAA 1SVMA 1XSDA 3TOAA 2M30A 4HF1A 1MD0A 3MZ8A 4OINF 4M3BA 4I02A 2JEWA 3JTGA 3CMEI 3SXOA 1O3RA 4B12A 3CDLA 1FLIA 3IP4B 2M7BA 4B47A 4NF1A 3TP3A 1VTNC 2A68F 4WCGA 2ZOFA 1G3SA 4LLLA 4XL9A 2R7XA 1YIOA 2Z9OA 4ENNA 3UGDA 2IA1A 2RFHA 1XDSA 4D0PA 2JA6J 4UNOA 2KRHA 2Q4ZA 3I0TA 3OWCA 2OZGA 3LL7A 1SANA 2DA4A 3BR6A 1CBXA 3LMMA 4YG2F 1RUNA 2HFHA 4AUXA 3HSFA 3FHZA 5E3MA 4G6QA 4KOTA 1OQYA 1FPQA 2ROWA 4F6AA 1JUMA 5GAHJ 3MQ0A 4CZCA 3J7YJ 2MC3A 1ZGWA 1PP8F 1JKPC 3OYEA 1LRZA 3RPQA 2Z5UA 4EGYA 1G8XA 3DBLB 1CE3A 2DFIA 3V8JA 5CYVA 5KAFC 4MTDA 4EVYA 4PJNA 1Y0UA 5JHWC 1V54H 4XPDB 4GFBA 1PTRA 2XF5A 2Z10A 3NWTA 4UEFA 1UB9A 3FH4A 2VJ4A 4RAZA 1X1DA 4ORFA 2QUFA 2P6AC 1FX7A 1IN8A 4RMNA 3HGYA 4V2FA 1U78A 5E3RA 4OMZA 1A6QA 1YX3A 3OV8A 5E79C 1Y9WA 4XLFA 2OZUA 2XVCA 2VOOA 4R76A 5JR3A 3UY5A 3HRTA 3ZN1A 1VHOA 5ICGA 3ERED 4EMSA 3W6VA 4ZYQA 3A0HC 1FT9A 2ZEGA 2F5VA 4I6ZA 4A31A 4H2KA 5FGMA 2X85A 1R1TA 1WI9A 2DMNA 4LB5A 3FDYA 3LA2A 4ENJA 2RQPA 1B72B 3FM5A 1B8IA 1KWMA 3T8WA 2CTBA 2ELIA 4Y49C 3P5JA 3TDUC 4M71A 2HDCA 4JX5A 2DPDA 1BR4A 1I1GA 1IXSB 2V8VA 5BPIA 1LPQA 2H8WA 5LRSA 5M5XJ 3RKXA 1TW3A 1FOXA 2AFMA 2HYFA 2WBMA 1UG0A 3NAUA 3OXLA 4MQ9F 1PUEE 3OSGA 2CS3A 4MFQA 3DU5A 4ZJZA 3KETA 2XGXA 3A4CA 3RKWA 3IIBA 1BC7C 2KIMA 3JRUA 3NE7A 1SGYI 3OWTA 4KOYA 3ZRGA 3ABMH 3VH9A 2EQRA 4DJLA 3HUGA 4DYQA 4OAEA 4BBRJ 3LSPA 2ORWA 2R0QC 1JKQC 4XN0A 2Z0ZA 1G6NA 2K9QA 1HW5A 2F4OB 1SFUA 2L8EA 3G8WA 1B9MA 2RDPA 5DUKA 1EV7A 4U0YA 4X8IA 1V5GA 2KKOA 1IB1E 2UUZA 4L5IA 1WVRA 2NMTA 3D8PA 4P44A 1IUFA 1AKHA 4FAIA 4WP4A 2DFHA 5CJ9A 4KOUA 2V26A 4IVNA 2DF5A 2FEZA 1HPTA 2JZYA 1P9GA 4PPZA 5E3NA 1RC9A 4BDYA 2AFXA 2R7FA 4JK1X 3I56I 1IJWC 2RVCA 1R00A 4IK2A 2EFOA 4U88A 2W0TA 1XMBA 4BINA 5FLVA 2WCYA 2E2JJ 1Z4EA 2NS8A 2ZXIA 3MKLA 3TCVA 1BM9A 4IHXA 4MFLA 1REPC 3UOEA 2FJ1A 1BUSA 2VQLA 3I53A 5B3SH 4PK4A 2NU3I 1RO5A 3BZKA 3F22A 4FD5A 1BR2A 1R79A 2OAZA 4O5VA 3CF2A 3SZTA 4F52A 4MTEA 5AIQA 2FD5A 2CTCA 4PDKA 3GTQJ 1IGBA 2F4IA 1ETWA 1Z9UA 2KQRA 5LBQA 1QPIA 4HV5A 2ZJRF 1YGHA 3F3XA 3KP6A 1A36A 4ZC3A 4HNXB 1H88C 4KIFA 2VLAA 2H94A 3NEUA 3MEKA 1LUJB 2XSDC 3GZ6A 2A4NA 3DR8A 4JZ0A 2F5DA 2WWYA 5GADJ 2HVRA 3PSFA 1LKXA 1MDMB 3BJ7A 3KR5A 2VT3A 4XK4A 3QPTA 5E96A 1XBUA 1B9NA 4FISA 1FNOA 2V6EA 3O8GA 4IF4A 4RB2C 1CJWA 1M8BA 2H6CA 4AIJA 3ZZIA 1Z05A 2XUBA 1IXRC 2XEIA 1X58A 3QWLA 2E35A 2EFNA 3CO7C 4NQWA 1JI8A 1J5YA 5FJ8J 5AGEA 3S1MJ 1XIXA 5IT9Z 5J3LA 4A12A 3FNCA 3GO5A 4L8AA 2Q0YA 5J8FA 2YX4A 4Q7AA 2VBYA 3N05A 2VEZA 3JRAA 2AFSA 4A6EA 4YFKF 4NC6A 1IN4A 3JCUC 2P5KA 5ED4A 1EA3A 3ULQB 3SFIA 3K2KA 4CYNA 1MMAA 4A2UA 1IIDA 1NMTA 3BG7A 3H5ZA 3KASA 5EGOB 4UEZA 4UIAA 4E4HA 3M9AA 2LOOA 2ZKZA 4MHDA 1W0TA 5HDGA 1VQOI 3EPZA 3IH3A 3IRRA 4HLXA 2Z11A 4A0XA 5E1WA 2V4JC 4BEHB 1AHDP 5F46A 4B43A 3TEDA 4NXYA 2G9WA 3LWUA 5H6RA 3IHUA 2L2OA 3V8IA 3CXLA 4PSWA 3ZXSA 2NVUB 3FC3A 4YELA 2F5EA 1F1ZA 5DCFA 1S3ZA 2LMDA 3EYIA 2BSWA 2OJED 3JRGA 4A69C 1Z2IA 2CXAA 1MBEA 5M3MJ 2CO5A 4Q48A 3B6CA 2FE7A 4BY1J 4H0EA 1CT2I 3ASNH 1C0WA 2FSWA 2FNFX 2OZHA 1AUGA 1IG7A 3SEQA 2ARPF 3FSXA 2ZW6A 1FTTA 4MMOA 2PJRA 1XS9A 1K78B 3ZMZA 1VQ9I 2JA8J 2BY2A 4KIBA 4KT6A 1YO5C 2L7FP 3IWZA 4GXOA 4ZTJA 2GIZA 4IZZA 3F8NA 1WCMJ 4D7MA 1O4XA 4KA4A 1XX5A 1BL0A 1MH3A 2X51A 4G94A 1LNWA 3E5UA 3CMMA 1P9QC 1P4WA 2W85A 3KP3A 3JAMK 5E1ZB 4C2TA 4L9MA 4AVZA 1O3TA 4UUSA 1WK4A 3OYFA 2ZBKA 3HOUJ 4JX6A 1FZPB 2XB0X 2Y75A 1NUBA 2ODFA 3DKYA 1MMNA 1Q2DA 2QBYB 4LFUA 1Z7UA 2HQYA 4JD6A 4QPQA 3QAYA 4FX0A 3GZ5A 1LAPA 2KMPA 1XMXA 3LOCA 1F4KA 4KUAA 1RETA 4I0AA 1FSEA 4UVCA 3H9GA 3TP0A 2RB7A 4AXVA 3DEWA 2DJNA 2KDOA 3RZDJ 3GTOJ 1BAVA 3KEYA 1U3EM 4R8HA 2CW0F 3QPLA 1ZRDA 3WC7A 3U1DA 2OV7A 1IDZA 1FIAA 4BHCA 2CWHA 4RB3C 4LG3A 3SGBI 3FF5A 3BQYA 3QU6A 1CF7B 2OOTA 2VBXA 2J5OA 4A3MJ 1J75A 3WC5A 1JTYA 3KHXA 1T6SA 2FS5A 3FRMA 4LK1F 3VARA 5D5WB 1TWAJ 3R5DA 3WTUC 1XF8A 2ANPA 3DPTA 1QO0D 3I54A 3K70C 2KMRA 1S7KA 1P92A 1QQ9A 3BROA 1K7VA 2ZEFA 5E20A 4AWXB 1FJLA 2MW8A 5FLXZ 2O9LA 4PK3A 3WTXC 1G2HA 3W3CA 3NH4A 2VKHA 3K1PA 5THWA 2QSHX 2ERWA 3TOBA 1OMUA 4XRFA 2K27A 1ZYRF 2Q8KA 4WX9A 1T38A 4PK2A 1LDKB 1IW4A 1WPKA 1A31A 4GGGA 3JRCA 4FCYA 1SGNI 1YW8A 4A5MA 3IC7A 3K4NA 4B3AA 4ZYAA 5ICFA 1F2OA 1KU9A 1W5SA 2WPXA 3S1NJ 1ETOA 3E6MA 1K4TA 1KBFA 2VJJA 3ISZA 2Y9ZA 2DA6A 2JN6A 3AL0C 3DU6A 3S6HA 4UUTA 5E8GA 3H3VK 3O8HA 1FSHA 2ENNA 2QIRA 2PJ2A 4Y4RA 2X6YA 1OZPA 2QVOA 4GCVA 5H86A 1UCRA 2A6HF 1B6AA 2COMA 2Y69H 3KP7A 4GYGA 3PM1A 2J9AA 4LQGA 3N5FA 3HPGA 1L0OC 1MBFA 2XAGA 2V1DA 2WYRA 4XLAA 2DDAA 4PXEA 3BOQA 4PJJA 3RYOA 3BY6A 2BYVE 2E5ZA 4M73A 4XPKA 2FMYA 3OL4A 1O7FA 1VIXA 1JT6A 3NWSA 1X1AA 4Y3OA 1WRJA 2FNPA 4W1UA 1U9NA 1USSA 4G12A 2EFWA 5HI7A 4I99C 1YW7A 4F55A 2M45A 2MA3A 2CV2A 1R23A 3ZR8X 1E0EA 1M4DA 2AFWA 4C7IA 5DDGA 3GUDA 5LYLA 1HKQA 3J81K 1ZGAA 1A2ZA 3ZMTA 6CPAA 2DT7B 4F8ZA 1HEVA 4XRSA 1HA8A 1SGDI 4JOMA 4M6GA 5I0CA 3I9SA 5K7ZA 1NG6A 5M3FJ 1B6BA 1SGRI 1S7NA 1TT0A 2JZMA 1YLOA 3K2ZA 1LFBA 2DOAA 1N13A 3JTHA 1R36A 4E6KG 3OYNA 4EJTA 3S2DJ 2RAEA 1X10A 2I3CA 1QSMA 3KYDB 4RAGA 1TKHA 1X4OA 4U87A 4B09A 4XKVA 3NQOA 3M4OJ 4U0WA 2ZCWA 2DMQA 1CM0A 1LEBA 4FBEA 1KA8A 2ISYA 4EJOA 3L9FA 1YK3A 2B5GB 1YU6C 2G7HA 2Y30A 3OS2A 5B66C 1BMOA 1BA5A 3MGDA 2HQAA 3O2PE 2VJ5A 4A24A 2V1CC 4AG7A 5IX3A 3OY9A 1S6LA 1STZA 1U5KA 1Z0XA 2OPTA 2L9RA 2WADA 2ZOGA 2O28A 1WGTA 1WH7A 2W24A 3F0AA 1JE8A 1M4LA 3H1CA 3CXQA 3QP5A 1FYLA 3QYBA 1NH3A 1HDDC 1T95A 5L3GA 4CO8A 4E7KA 1R58A 4UFXA 3K4LA 2X6OA 1IICA 5K8OA 3D5SC 1QZYA 3FSYA 4YRHA 4NGSA 4QWQA 4A5NA 3TW7A 2FMLA 3NH5A 2FQ3A 3KZZA 3LSGA 4EV0A 5BOXA 4JBAA 4GYIA 4L9JA 4WXDA 2RN7A 3EUKL 1I39A 5J1YA 1SAUA 1FBSA 2I5UA 3BPVA 5EYRA 2R7SA 2GKTI 3V38A 5D5VB 3VFZA 4C2UA 2NAZA 2DPUA 2B63J 2R7VA 2KMQA 1RXTA 5HVFA 4DBRA 5BMZA 2A69F 3PNVA 3L2VA 1W7PA 5EEHA 4R57A 1XG1A 4QIWN 2ME0A 2YS9A 1K7AA 3LACA 1GDTA 4RN7A 2R7HA 4OMYA 4LITA 4M6XA 1NSLA 4UXHA 1D5YA 3VDUA 1SGQI 2IGOA 3FX3A 4RAYA 3U1KA 1AOYA 2J87A 2OCEA 2CQ7A 2NS0A 3R61A 1FYMA 2KCWA 1V3FA 3BR5A 4NGQA 4RM2A 5JHFA 1VGYA 3P2FA 2P7VB 1KGSA 1QBJA 2RNGA 3KL9A 1IRZA 2E7XA 1SQHA 5HLTA 3L1PA 1GHEA 4XBFA 4BL0B 1WQ2A 1ORKA 4EM1A 4YU9A 4E2AA 3H8GA 2F48A 5CVIA 2HC9A 4KORA 2JXDA 1Z9CA 2QVPA 2PVVA 3CCLI 2DCEA 5F47A 1L3LA 2K9SA 1QZZA 1UHMA 2W82A 3WR7A 2N71A 4CICA 1LB2A 3JSPA 1E3PA 2KZVA 2ADUA 4A0ZA 9WGAA 5L3CA 2PMHA 2O8XA 1XCVA 3GCMA 3E6CC 3T90A 2EV0A 3FMRA 4YFXF 3DDDA 3GIUA 1PUAA 4OADA 1LR9A 2XKPA 1G3YA 2YGWA 1VI0A 2A20A 3A0BC 2DBBA 1H0ZA 1U5TA 1OCRH 2L7ZA 2N8GA 2VL1A 5A2QZ 4UEEA 5ILSA 2HOEA 1R3NA 1Z8LA 4WJBA 1OR7C 1ERDA 4MHPA 1TQPA 1USTA 4HDVA 2RC4A 1TKJA 2VQGA 5HH1A 4ZY2A 3TO9A 2K7LA 4FD6A 5EEGA 2EV5A 1K61A 4NJRA 2WY8Q 4EM0B 4EMEA 2WV0A 2EWBA 1UZCA 4BJ6C 2H6BA 3CF5F 2LRDA 3UKGA 3RU0A 5K7HA 2K3FA 3JW4A 2CYYA 3MZHA 2CFOA 2CUEA 2P0WA 2K9MA 4KNYA 3CC2I 1S72I 1ODDA 3KP4A 1WGCA 2M2EA 3O6BB 4YWYA 3ABUA 4CCOA 2WPWA 4XMYA 1LDDA 2DTZA 4KS9A 3BG5A 2BEOA 4G7HF 2PJ6A 4FE7A 3L7WA 2WSAA 2VL8A 1F43A 5AIPA 1PU9A 1TLHB 2GBYA 4F92B 1YI2I 2V9VA 5LFAA 5ILUA 1GVJA 5K1YA 1E3HA 4KLWA 5IV0A 1YE9A 1DGRM 2E36A 2XPWA 4IHSA 1P9ZA 3GKRA 4R7MA 3WG7H 4CCJA 3TE4A 2FU4A 5IB9A 4A32A 3HOVJ 2G9DA 2LF8A 1LFPA 1S7EA 1YS7A 4BEHA 4CA0A 1ARMA 4HGUA 5FKKA 3KZYA 4FTHA 4L18B 4X6AJ 2B4DA 1HLVA 2YNDA 4PV6A 4XRSG 4EWTA 1MKMA 5KTDA 1DP7P 4JX4A 3B3CA 5IOZA 1W36C 3ZQFA 3BI1A 2WUUA 1YTPA 1W0UA 1X2NA 3TFYA 3PIPF 3FB3A 4HPSA 2R93J 2OB0A 1X2MA 2BHYA 1A35A 5F04A 2PJ0A 1S60A 3MMYB 1O57A 1TOTA 4R87A 2HOTA 1P4AA 3DKXA 4BQQA 3KGQA 1BOBA 2PR1A 3QYEA 2PE3A 3S2WA 2EBJA 4W9YA 2VJIA 3ZMSA 1UFHA 2ZEPA 2QQCA 2NNNA 2Z3OA 1SC7A 5BNGA 1P7JA 5K5OA 1QA6A 4C30A 2QJ8A 1MMDA 3KLOA 1YOVB 3PL8A 3PB8X 2IP2A 3RCOA 3U2RA 4UV9A 1R22A 2XASA 2VC1A 4RGSA 1LANA 4UWJA 3C26A 5KHDA 5F0HA 3FX6A 1Z6RA 1JHFA 4TV7A 2E5RA 4ABZA 1EF4A 2UV1A 4D9JA 4AVPA 3G3ZA 1Z3XA 3VDXA 2Q0OA 3PGPA 3S3OA 5GAGJ 2FXAA 1WFXA 2LKSA 4LD5A 4NHJA 3OIQA 3DTEA 2CW7A 3CCQI 2DMUA 3GTPJ 2K9LA 5H6QA 1CGJI 2Q4VA 1JHHA 2WC2A 4HOBA 2WTEA 4OC5A 2X9DA 5B1BH 3S3MA 2EH3A 2E73A 1DU0A 5GTHC 1X1BA 4FQGA 3CDIA 1QVUA 3BTIA 4CPAA 2PRQA 3I59A 2IW5A 2M87A 2HNHA 4MQVA 1JGGA 4KYWA 2QPOA 2CUZA 1Y1WJ 2X52A 5CNPA 1RKTA 2ZMEB 3GEZA 4UFVA 2GWRA 4F93B 3W6JB 4AIKA 2XPVA 2IAIA 3S16J 1U5TC 2TRTA 3QWPA 4G6DA 4PJMA 4UUSB 3W91A 2HDWA 1HC8A 1IDYA 3ZQGA 3IV5A 3FK7A 1PTQA 2V1NA 5E3OA 2A6EF 4M3SA 3KYCB 2F8HA 4Z6YA 2XGCA 4R1HA 1AKHB 3OYBA 1TTYA 3LSTA 5JFRA 3VODA 1FC3A 3GWZA 1GLNA 3CXPA 4O6JA 2YU9J 4JWPA 2XF6A 3LFKA 3K9TA 4ENKA 4OAZA 2EK8A 3PFYA 3GY9A 1ZGJA 5EBVA 2WVJA 3L2WA 3EFAA 4GO1A 5D5XB 1ZELA 2O61A 2DPSA 4CCNA 3PFOA 4NJQA 5ERIA 2GKRI 1QSRA 4C2ZA 1A6IA 4ZDOA 1P4XA 2GLFA 3HB9A 1WJAA 2GA2A 2VPRA 4UVAA 4O3MA 4BKXA 2EV6A 3S15J 1PYTB 4Z2YA 1PYVA 1BI0A 2RV8A 5FUXA 3B3WA 1XSXA 2QCOA 3LSJA 3WE2A 4UCMA 1IRXA 1A5JA 1CT0I 3B02A 2H1LA 3OYAA 4KFCA 2MFZA 3E7LA 5LD2C 1LQ1A 2PC1A 4RUHA 5DCMB 4OIOF 3LA3A 3B4VC 4FHTA 4FX4A 4WWCA 1ETVA 3SI0A 5FKNA 4HA8A 2QENA 3GTGJ 4SGBI 4F91B 4WXCA 1XD7A 1YX5A 1N75A 4PJ0C 2G0BA 3BJ8A 1LEAA 1D0XA 1I3AA 2JVGA 5EZGA 2PFBA 2V8DA 4IO9F 2MBFA 2ISZA 3VSLA 1EE3P 2LEOA 1XEBA 3G73A 1MZBA 4I09A 1I12A 1P2FA 3I4NJ 1X12A 3IWGA 2CU7A 1GV2A 4UV8A 2MLKA 1VQNI 3PBBA 3HOXJ 5KTAA 2CMPA 2NNYA 3RO0A 1J4JA 2L54A 2XIGA 2PJAA 2Y0SA 2W84A 3BG3A 2LVSA 3K4MA 1YVOA 4XR6A 1Y56A 3RJPA 3H9JA 1Z5RA 4OC0A 2LLKA 2EJRA 4DNCA 1W3SA 4QPOA 2GKVA 4FASD 2ID3A 2DTRA 3J7ZI 4LX9A 1OYWA 2VI6A 5HVQC 2AQFA 3GFLA 3S93A 1DPUA 3FF3A 5J6XA 1K79A 3KI9A 5AONA 3H35A 1XB4A 4BE0A 3HOYJ 2DK5A 2L9NA 2X1EA 1J7KA 2DFFA 3L2RA 2P7CB 2ATRA 3R9FA 3QTLD 2DYSH 3WHCA 2ZFUA 4HG2A 4A3EJ 1WH5A 3B35A 1I27A 2WAQA 3V7SA 3JRFA 2B8TA 1YYVA 1YJNI 1OCZH 5D4RA 2A05A 1PJUA 4IHTA 4BUPA 3HRMA 3VYSB 1TT5B 2VUMJ 2CQNA 3I59B 2E34A 2XAUA 2GM4A 4E8OA 2JJ7A 3E5QA 1ETQA 3WTYC 2PJ1A 2PBIA 1O7LA 1RZ4A 4U5YA 2KISA 3O3KA 5F0FA 3OYDA 3PNTA 1VHSA 4FWUA 4IHMA 4HNYB 1XC5A 1UAAA 2Z33A 2JSPA 4ESFA 2IA2A 5FROA 3BR1A 1YRNB 1KU7A 1Y8QB 4LG0B 3VE5A 3WT4A 2BE5F 3KCCA 3S14J 1R5HA 4KISA 3TC8A 2VBZA 2Q2EA 3FXUA 2BW3A 2Q4YA 4MCSA 4A95A 2L9SA 5LYFA 3PO3J 2KHMA 2L3DA 3BQZA 1KONA 1XFOA 2KFDA 1SVLA 4UFWA 3LQQA 1ZG5A 3OOPA 1ZG8A 2V1XA 1ZAOA 3RQ4A 3HUGB 2UXXA 3B6AA 1BO4A 2FE3A 3OYCA 1IV8A 3H3UA 2BUSA 2SGEI 3F5BA 4G1PA 4M72A 4OIWA 2Q43A 5KAIC 3B2YA 3FZVA 5FFZA 3UGIA 1YMEA 4CH7A 2LY1A 1IY5A 2N52A 4UF4A 1TIHA 4ZYDA 4RS8A 4UB6C 2KL4A 3RNZA 3QOPA 1H0MA 2Q51A 4OC3A 3W2WA 2DQLA 3SJGA 3FXLA 5LGUA 3G6EI 2LY2A 1MSEC 3DWLE 3HSRA 4F0XA 2FOKA 1YQEA 3HOTA 2DA7A 1XRYA 3VATA 1XCBA 1JWQA 1ZH5A 2POKA 2BCOA 4P1WA 3CC7I 2M34A 4CAFA 2UXNA 1U2WA 2COBA 2V8HA 1YRNA 3Q0WA 2IS1A 5EEAA 4HQEA 3WGGA 2FBIA 3X2QH 2HQ5A 3GX4X 1YHQI 2Q04A 3D2MA 4QB9A 4KVOE 2QQ0A 1UFMA 1DTDA 1FNNA 5HVGA 2IEKA 3FXRA 4IPAA 4M3EA 4C3JJ 4P96A 4A3GJ 1JT0A 4CS0B 3Q9SA 1W7PD 5C82A 3PJRA 3JREA 2PRBA 3FHNA 5HLGA 1BIBA 1HOMA 3BXMA 1BJAA 5L3EA 2JA1A 1PCEA 1WKXA 1VQ4I 3EETA 1T33A 2KMOA 3C2HA 5K8NA 3I5UA 3RAMA 1XGNA 4HNTA 4S05A 1K4SA 1IRFA 5D4SA 3CJRB 2KZGA 1WZ2A 2XC7A 2AFOA 5ICEA 2PJCA 2ECCA 3HGGA 3H4QA 4LLNA 3FEEA 4HSTA 1U8RA 3PRTA 3JUWA 4OMEA 2N17A 3DPUA 5DV5A 3PFIA 2QQAA 3RQIA 1ENHA 3SFZA 4C7HA 2BV6A 2W25A 4HSRA 2EFQA 2HOSA 2FUG2 3IO1A 4CDGA 4XICA 2ZEHA 4L89A 1TQIA 1IU8A 4ITVA 3SZGA 1J09A 1W1WE 2VQCA 4LJZF 2E19A 2M4GA 1M4IA 3BG9A 4AD9A 3NFZA 7CPAA 5F1JA 5HDKA 4M6YA 1T2KA 2JA2A 5EG0A 2DA3A 3H9QA 3F9KA 2P6TA 4KN4X 1DS3I 2C6PA 3M3YJ 2CJJA 3PB4X 4XNHC 3IH4A 2IGNA 1PCAA 3Q0VA 4KITB 2PG4A 1ZG7A 2R8VA 2BW3B 4PFPA 1QGPA 1FWZA 3QPHA 4W97A 2RIJA 1X4SA 2Z3KA 2O0YA 3CQZJ 4C2MJ 5GCNA 2I10A 4Y33A 2DQRA 2M5XA 3TT2A 3CLOA 4F9UA 5LLQA 2NS7A 2ABZA 2EIJH 3ABTA 4GRIA 4QLCU 3KYLA 2EBIA 5DCMA 2XHKA 3AAFA 2WGCA 3T5XA 1H8AC 2V9PA 1K4JA 2ZEOA 1R7JA 2HVQA 2WY7Q 4IHYA 4MXUA 5BS6A 2G0EA 1B59A 3BCAA 4AVAA 2EINH 4QSHA 5BQTA 2GLJA 2AHQA 2A3SA 3D7HA 1IY7A 2W1OA 3PDNA 1IYLA 3GFIA 3S8PA 4DJAA 1D8JA 1VQKI 4U9YA 3QP6A 2GOXB 3OYGA 3CMYA 2ICWG 3HBLA 2ENZA 3HIFA 2MC4A 4NGRA 1F36A 3BTLA 3CESA 4RB0A 3V8KA 4L0YB 2CWFA 3K70D 2WB1A 2SGFI 3KLNA 4L9NA 4BS9A 4RGXA 5IYBJ 4KJZA 3OSFA 2H09A 4OP4A 2PMUA 4HZFA 5D29A 3EQLF 3V42A 1G59A 2ZNYA 2H27A 1T98A 2JA5J 2K40A 3R5BA 2MD5A 3I55I 2LR8A 2V7FA 2OZ6A 4CYOA 5C3EJ 2KMUA 5IYDJ 5G20A 3IH2A 5C44J 1S7OA 1MBJA 1A04A 1QZEA 3W6SA 1WSUA 2PIYA 3IUOA 2Q44A 1IOIA 4NSQA 5AG5A 2Z3NA 2W4SA 2DK8A 1IN5A 4NGPA 3F6VA 1PUFA 2LP0A 3WG9A 1HDLA 1J0RA 1D0YA 2PQ8A 4RLQA 3D7DA 4Q4ZF 5L3FA 2AXTC 4MFJA 5FFXA 1QPMA 3E6DA 4U9ZA 1I1SA 1QU3A 3KFWX 1FEXA 3JVNA 5D8KB 3BR2A 1F2PA 2DT6A 4HNUA 5LHGA 4EM2A 1KBEA 3IFEA 1ZG3A 2B9SA 1FOYA 2M4KA 4XKBA 3V8LA 4B13A 3CDXA 2NVYJ 4CGZA 2P4WA 4RA2A 2JBJA 1H8LA 2JVHA 2WAQN 4LOCA 3LA7A 4OOIA 1BLLE 4MFZA 4UBRA 4V2GA 2O4HA 4A3LJ 1HSJA 4E1PA 3PFEA 3C1DA 5JHUA 3M1EA 1W4RA 1XN7A 2B3VA 3R0AA 1TWHJ 1ZLKA 2IA0A 5HS7A 3DR6A 3C2GA 3MKZA 4GS4A 1OCOH 5K5RA 1Z7KB 1UVGA 3HKZA 3MEXA 3PB9X 1TWGJ 3HTSB 4IKFA 4P4DA 3CCVI 4U0VA 5F27A 2XAFA 3E2IA 5D8LB 5CVUA 3CCUI 2R7TA 4D7NA 2SGQI 3I9V2 2DJIA 1ZRFA 1B87A 3ABLH 1XMTA 3B7IA 2ZJQF 5CPAA 4CGMA 1SD4A 3HLPA 1ONVA 4B5PA 2PSWA 4UUVA 1KYZA 2YQPA 3OYKA 3WU2C 5HDNA 4A30A 1SFEA 1VFCA 5H84A 5LRRA 4P4EA 2GIVA 1Q9BA 3MKWB 2EVNA 4XLHA 4QBJA 2PJ4A 1JUSA 3WGHA 3BLYA 5F09A 3OS0A 3D5RC 2AFZA 2HXOA 1O3SA 3JTKA 1EKEA 5LRJA 4MO7A 2LBFB 1OISA 4A37A 3OYLA 4HNWB 2F4MB 5HLHA 3KP5A 2X3TA 1ZQ3P 3D7FA 4M85A 3RBUA 2LREA 1R4MB 2GXGA 4KOXA 2PIZA 2JDDA 2CV1A 4IXAA 2DLLA 4CUGA 1R9TJ 5EGOA 3GVAA 4NDLA 3LSRA 2LK2A 3FXMA 4DYRA 4EATA 4AIDA 2V1UA 2ZMEA 4KOVA 4BBHA 4XORA 4IF5A 2RGVA 3FISA 2F3CI 4BJTA 3PUFA 3RIRA 3G3SA 1VQPI 2ZSHB 3NRVA 3OYMA 2HPMA 2IS2A 2JW6A 3ZPLA 1IXCA 1D8KA 1VF9A 2XV4S 1IN7A 5JQ4A 2KRFA 2KT0A 2JUCA 4GI3C 2BZTA 3PO2J 4S04A 3SJFA 1SMTA 4I76A 5FUVA 3GB0A 3UNGC 2IT0A 2CFXA 3ECOA 4CYQA 4P10A 3ZMUA 4AB7A 4IUSA 1KMAA 3DGVA 3RYRA 3DPLC 2L5QA 3P9IA 4KIGA 4ANJA 3H0DA 2NOGA 3CCEI 3M8EA 3QNVA 2G7UA 3J7AY 2EIKH 2HKOA 4M3FA 2ZFWA 2IXSA 5IP7J 5E18F 3SJMA 3TTHA 2DOEA 4XOTA 2DIPA 3E0JB 2GA1A 5HVHA 2FXFA 2BBYA 1TUSA 1HQCA 4CGPA 1ZLHA 2XRNA 4KOWA 5CVRA 2B7EA 1UELB 1RESA 1XPXA 1DQUA 2X1CA 4L5JA 3FYNA 1S8NA 2XEFA 1Z21A 2IJZA 4RM3A 5H20A 3WTWC 2FIAA 2FX0A 4NC8A 3I64A 3GTMJ 1OVOA 4NGMA 3OXFA 3LAJA 4II3A 3H0GJ 2XB5A 2P8TA 5J40A 3FXTA 2Z3PA 2CNTA 4QC6A 2D4PA 3K6GA 3PIOF 2LC2A 2P5LC 4LGWA 3RYPA 4NGTA 3VB2A 2JTVA 2HPIA 1S7FA 2XGEA 3VEPA 1CG2A 3CCRI 1SD6A 2NYQA 2PVWA 1X19A 3RTRA 1XJOA 1ZKGA 4B5PB 3D0SA 3VYUB 3DXJF 2HQRA 2HDDA 5LEJA 2KPMA 4B6DA 4XKWA 5J8CA 1HEEA 5AG4A 2WAEA 3E1SA 3K7AJ 2HOAA 5G1ZA 1RRJA 2HZDA 1KU2A 2QLZA 4EEFG 3OS1A 4XSZF 1UJ8A 1K78A 1U0JA 3W6KB 1FMVA 3JRBA 4A3KJ 2NU1I 5M5WJ 3L2CA 1P4NA 5K8PA 3DTIA 2Z99A 2DI3A 2RKHA 4YRVA 2ECBA 3GMEA 1F9NA 2H1KA 2XEGA 1IF1A 1FOKA 4HW0A 2E71A 2EZIA 2K02A 3BJ6A 3K2AA 1BC8C 1QHGA 2GXAA 2IVMA 2E1MB 2M8EA 3T1BA 2A5WA 3U21A 3J7AO 3CCSI 4UCPA 1P7IA 1HF0A 2QWWA 1ZLJA 3ZGKA 5F08A 1D1AA 2HI3A 2DFEA 3GBGA 4MHGA 4RDUA 2VXDA 3K69A 3QQAA 2D5VA 2NVQJ 2NU0I 4HQMA 2NVTJ 2ZEMA 4KVXA 1PVEA 1ON2A 3L2NA 1K6YA 4PQAA 1V5FA 2VQYA 1ETXA 4N4NB 4KSAA 2DODA 3A1YA 3OR2C 4OWRB 2ZJPF 2XKOA 5IYCJ 2LBFA 1V0CA 2XDVA 5CCLA 2P6EA 2R7ZJ 5TISC 3LSKA 5EZHA 2KCXA 1HSTA 1SD7A 2E1NA 5D8NA 1MSFC 5DYMA 4I7HA 5ILVA 3TQNA 2QF7A 4S0HB 1XOVA 4P9FA 1MBKA 1VQ7I 2OTJI 2HYJA 2O03A 3R60A 4NQWB 2ELHA 1R6RA 3TL4X 3UEJA 4C68A 4L9VA 3QYFA 2VZZA 5ICCA 2L4MA 4OU0A 3V4GA 2AFUA 3K1NA 3GTKJ 3BG6A 4B1RA 3QOEA 3CMAI 1V5EA 2GU2A 1KZFA 3QB8A 3K1MA 3WE3A 1MGTA 4WK8F 1UG2A 1S7AA 2XRLA 3FBIB 5EC4A 2KIQA 3CLQA 2LB7A 1RIOH 5DM6F 1Z7LA 1U6GA 2MH9A 2LY9A 1Z91A 3I3LA 1UWYA 5KVRA 1R5ID 4LUAA 4UWIA 3PB7X 4KN7X 3HHGA 4G6TB 1H9TA 2E1MC 4ZTFA 2L0KA 1HDQA 1QMUA 1M1EB 2QQBA 5FRMA 5HQ8A 2K4BA 4E7ZA 4AYBN 1OKRA 1YTYA 4PFOA 2K3PA 1HCRA 1IV6A 3D1NI 1IW7F 5LEKA 1ZG9A 2QYOA 2LDUA 5TJJA 2VE8A 2X6WA 1Y1CA 2D4OA 1BJZA 4HRIA 4BAYA 4KVME 4H6UA 1VZ0A 3FECA 1OMIA 4BJ5C 2UZKA 5E3LA 4D5CA 1V1HA 2BY3A 2QGUA 1YR0A 3DBRB 1S3JA 4BQAA 1SFXA 3QAHA 4E7LA 4ZDLA 4AIHA 4AMLA 4IX7A 4AVBA 4FE4A 3M07A 3TDZC 1HW1A 3KZIC 2XAQA 1XMKA 3M8FA 4IQ4A 4CYCA 4Q36A 5F49A 4ZX9A 2IGKA 4M74A 4F7ZA 4R9MA 4BGDA 2YX7A 3KX2A 5K5QA 3I4PA 1FIPA 3ASOH 4ETSA 1S5KA 2AJ6A 3M8JA 4I0BA 4DZPA 3AG1H 2JUGA 4HV6A 3JR9A 3T8TA 2F5IA 3F8KA 3F72A 2DA1A 4IL6C 3J80Z 3P9CA 5I4MA 2CUFA 3TMOA 1TXRA 1BOAA 3N4MA 1RR7A 4P45A 1WWXA 2FF4A 3ZMVA 3Q5FA 1VQ5I 1ETYA 4XPLA 1ULKA 2BXZA 2EIMH 3SXNA 3LSMA 3G2BA 1ULMA 1FYBA 3S17J 2B5GA 2V8GA 3NH8A 2LSOA 2C1CA 1OLTA 3W6XA 2FL4A 3H3ZA 1VNDA 1DS2I 4R3LA 2JT1A 1YW6A 1LFUP 1ZARA 1JJ6C 4XLEA 2K86A 5DUIA 4CCLA 4NCZA 5FKMA 5F1RA 1LE8B 4A93J 3V7CA 5E8IA 1U5TB 1FT7A 1T0FC 3R0JA 4M3DA 1VDDA 4A3CJ 3ML6A 3DLAA 4HKFA 4BE2A 2CG4A 2HR3A 2M8GX 1R71A 2M0CA 2X1DA 3BTJA 1W4MA 2PJBA 3ZQHA 1Y0YA 1FBQA 4ONUA 3WTVC 5IOYA 2V9KA 1PPFI 2W48A 3IGRA 2OR4A 3MKYB 1R49A 2YUUA 2A6TA 3BWGA 1KYWA 3P7NA 2ZXHA 1CPSA 4HNVA 4KZTA 5IPAA 1XBTA 3F8BA 1MJAA 2VPLA 3BHXA 5J47A 2CIJA 2STTA 2M5WA 4B10A 2ZW7A 3OL0A 4N9HA 3ZQCA 1UVFA 4KICA 4PXDA 1Y7RA 2KDZA 1M44A 1JJ8C 1LOKA 2V77A 5J1RA 2X4HA 3RKYA 3AG4H 5GAEJ 3K0LA 3BJOA 1BI2A 1TKFA 1WJCA 4H6ZA 4I2OA 3OXGA 4Q5SF 4Q38A 2R7RA 2RQQA 4CZZA 2JA7J 4HX8A 4R6TA 5H2FC 4XLPF 2VONA 3BTCA 4ON0A 4XN3A 2PJ3A 1S29A 1I1DA 3L2UA 4CYDA 1ZR4A 5GP9A 3CP8A 4E7IA 5FD5A 3COAC 3ZP5A 3CZ6A 1YJ9I 5HOOA 4ZI6A 2QEXI 1DU6A 3K9UA 1F5TA 3S3NA 5HS9A 3S1QJ 4CGLA 3G71I 3N97A 4B44A 4HAMA 4I98B 4LG0A 2DN0A 1TF9A 4XNHB 5J4YA 2W00A 4JP0A 1ZO0A 2GZWA 3S1RJ 2XF7A 3IL2A 2VXZA 4NB5A 5FD6A 4UXNA 2LYCA 3CUOA 3BJIA 4BXXJ 4CYCB 5E3PA 3PEIA 3PQJA 4IRGA 4CAVA 4CXFA 2QSGX 2K5TA 2JWTA 2YSRA 2NXNB 2D2WA 2QQ9A 3WGIA 3AL0B 1X3UA 3HM5A 2DMPA 1ZLIA 3CO6C 2Q2EB 2QSFX 2KP6A 2DDBA 3GXOA 3CZXA 1QVTA 2CWEA 3FIWA 4HBLA 1NHAA 1OBRA 2Y31A 4C2XA 3MZYA 2NOJB 3LSIA 5E17F 2X48A 4MGRA 1AA7A 4J01A 3FXKA 4RGRA 1BIAA 2Z3YA 2GLOA 3VYRB 4A2ZA 2PJPA 3IAS2 4HDUA 4A3DJ 1IO2A 3V7ZA 4F0YA 2E60A 3MFKA 2L9VA 2R5YB 1YITI 1HKTA 2VN2A 4KDPA 5ISVA 4HEA2 3T0YA 2QBYA 2MH2A 1Q7LA 2HTSA 3W2VA 1PP7U 5LYDA 4A39A 2ETHA 5KCMA 3SQNA 3S6FA 2DU9A 2DPTA 2QKLB 4X2TA 3SGQI 2VB6A 4G8XA 4ZGYB 2R5ZB 3KE2A 1IN6A 4X1EA 1TP4A 4QTRA 1CP7A 2BUEA 2BVLA 4B4CA 2O7OA 2E2HJ 1ETKA 4X0GA 5L3DA 1MDMA 2HZTA 4XONA 1OYYA 3ONQA 5K7FA 1RFHA 1ULNA 1JQGA 2PCUA 2PJ9A 3QRFF 4PGGA 3WODF 2R7QA
chains in the Genus database with same CATH topology
2ACJA 4KUBA 2B0LA 4IRIA 5CVVA 4CGOA 1ON0A 2VC0A 2EWNA 3BDDA 2E1CA 1J59A 1SMYF 3LWFA 1KUXA 2J8MA 1HKSA 2FBHA 2STWA 1ON1A 3TKYA 4PCQA 2C6YA 4OIQF 2IPQX 5AG7A 1D3YA 3LAPA 2JRTA 4B11A 4C2YA 4K2EA 4JLYA 1YQAA 3WTZA 4P55A 2Y48A 5A28A 4ASNA 5DWMA 5DD4A 1XDUA 2Z3LA 1AWCA 3BJAA 2YNEA 1QSNA 3IKTA 1DPRA 3BLNA 4KMUX 4G9YA 3SZPA 1HBXG 2HTJA 2UWMA 2L02A 2FSRA 3DV8A 4BNCA 4CGNA 3CTAA 2X0LA 2FIWA 4JXQA 2J5PA 2HEOA 1SD5A 2CNMA 1JXSA 2ZW5A 1YG2A 3GFMA 4J3GA 1HXDA 4XLNF 4U7DA 1EH6A 3M7GA 1M1DA 1GHCA 1FP2A 3EO4A 3KKWA 3ZN0A 4YFJA 3R9EA 3EUHA 5FVJA 4YFNF 1OR7A 3P2HA 3FBUA 1I6XA 2FNAA 2R7DA 3FM3A 3BZ6A 3R9GA 1YLFA 1R1VA 2JDCA 1G3WA 2PR8A 2OQGA 3SHPA 3N7ZA 2GXBA 3L00A 5IT9K 4EJVA 2KJBA 1J2XA 2BEIA 1BI3A 2F5CA 3L09A 2LKPA 3WTSC 1P0HA 4HF0A 4UA3A 1KU3A 2HGCA 2XAHA 1TW2A 4CYPA 3FIXA 4BHBA 2HS5A 2FCKA 3PZJA 1TNSA 3CUQA 4ESJA 3EY5A 1Q2YA 4KUMA 4M9ZA 2LF7A 4JJXA 3REOA 1R5GA 5DEQA 3WTTC 1ZN2A 3E0KA 2JEVA 4XSXF 3D3SA 3P9KA 3LODA 4B8XA 4BHPA 1Y9KA 4HYEA 4JQFA 1TIQA 2YU3A 4MEXF 3WU1B 5DD8A 1I21A 2OH1A 2VODA 4ZZLA 2REEA 2XAJA 2V79A 4Q47A 1QSOA 4FD7A 1BBYA 2R3SA 4E70A 3DFGA 2G3AA 5LGTA 2DO7A 4II9A 4MY3A 2CNSA 4PSXA 3FMQA 4RS2A 1TQMA 4MEYF 4Y49B 1TNTA 5F48A 5F64A 1ZREA 4MFKA 4MI4A 2QECA 3R6SA 3VWEA 5KTCA 4OIRF 1LVAA 2O3FA 4L0ZB 3RDIA 2P6SA 2QM3A 4P5OA 2EA2A 1LDJA 3B73A 2NRAC 4B5OA 1Z6TA 3IRQA 3FWEA 4M9SA 2KJCA 5F6FA 2K4JA 3U9GA 2IJLA 3I71A 4PGHA 2REFA 5BPDA 4KSFA 1KQ0A <