1MK2A

Smad3 sbd complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
197
Chain Sequence
DLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Smad3 allostery links TGF-beta receptor kinase activation to transcriptional control
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords SMAD 3
total genus 54
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2002-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03166 MH2 MH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.10 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1mk2A00
1U7FA 1U7FB 1G88A 4R9PA 1QWTA 1DD1A 5BVIA 1YGSA 3A77A 3GMJA 1MK2A 3DITA 1ZOQA 5JEOA 5JEJA 1MJSA 1U7VB 1U7VA 5C4VA 5JERA 3DSHA 5JEKA 1J2FA 5JEMA 1MR1A 1DEVA 1KHUA 1KHXA 5JELA
chains in the Genus database with same CATH superfamily
5DHRA 2CSWA 4G2SA 3T5PA 3V80A 3I6WA 3UV0A 3GMJA 5A8IA 1K3JA 4A4YA 1MJSA 1FHRA 3V8RA 3V7WA 5DHPA 2AN1A 4KU0D 1Y3IA 5JEKA 2XXSA 3VA1A 3V7YA 1J2FA 3KT9A 1U0RA 2I2BA 2KB4A 2PIEA 2JQJA 3S40A 1LGPA 1KHXA 3POAA 2JKDA 5JELA 5EJHA 2QV7A 1U7FB 1MZKA 1J4LA 1G88A 4R9PA 1K3QA 5EJGA 3FM8A 5BVIA 1YGSA 2BRFA 3ELSA 1U7VB 2I1WA 3V8MA 3HUFA 1K2MA 5JERA 2W3OA 1Y3HA 3ELVA 4HAOA 1Z0SA 5EJFA 2KFUA 4QCJA 2A0TA 1WLNA 1YJ5C 3VPYA 2Q5FA 2AFFA 4V24A 1SUWA 5DHSA 2JQIA 1Z0UA 4A0EA 4EGXA 3VZCA 4JIWD 1K2NA 1UHTA 2EH0A 2FF4A 3VZBA 5E50A 1QWTA 2I2CA 2JQLA 5DHTA 4EJQA 1FHQA 1DD1A 4JONA 4WRRA 3VZDA 4D9VA 3A77A 1J4PA 1R21A 1ZOQA 5JEJA 2I2DA 4DY6A 3I0NA 2BONA 3DSHA 1QU5A 4H87A 1J4KA 5DHUA 2I2FA 3AFOA 2G1LA 3UN0A 3OUNA 1K3NA 3GQSA 1KHUA 3I0MA 2LC1A 3I6UA 3V8PA 1U7FA 3PFNA 1DMZA 1GXCA 2XT9B 1YT5A 1Z0ZA 3VA4A 1MK2A 1G3GA 3DITA 5JEOA 2I29A 1U7VA 5DJOA 3V7UA 3PO8A 5C4VA 3UOTA 3UNNA 2KB3A 2I2AA 3V8NA 3HX1A 4WERA 1J4OA 3MDBA 2P1RA 2JPEA 1YJMA 2JGRA 1J4QA 5DHQA 1LGQA 1UJXA 4L02A 5JEMA 1MR1A 1U0TA 1WV3A 2QVLA 2FEZA 4JIVD 1DEVA 3V8QA 3UMZA 2KKLA 3UNMA 1G6GA 3HUEA 5EJIA
chains in the Genus database with same CATH topology
2CSWA 4G2SA 3T5PA 3I6WA 3UV0A 3GMJA 5A8IA 1K3JA 4A4YA 1MJSA 1FHRA 4KU0D 5JEKA 2XXSA 3VA1A 1J2FA 3KT9A 2KB4A 2PIEA 2JQJA 3S40A 1LGPA 3POAA 1KHXA 2JKDA 5JELA 2QV7A 1U7FB 1MZKA 1J4LA 1G88A 4R9PA 1K3QA 3FM8A 5BVIA 1YGSA 2BRFA 3ELSA 1U7VB 3HUFA 1K2MA 5JERA 2W3OA 3ELVA 2KFUA 4QCJA 2A0TA 1WLNA 1YJ5C 3VPYA 2AFFA 4V24A 2JQIA 4A0EA 4EGXA 3VZCA 4JIWD 1K2NA 1UHTA 2EH0A 2FF4A 3VZBA 5E50A 1QWTA 2JQLA 4EJQA 1FHQA 1DD1A 4JONA 4WRRA 3VZDA 4D9VA 3A77A 1J4PA 1R21A 1ZOQA 5JEJA 3I0NA 2BONA 3DSHA 1QU5A 4H87A 1J4KA 2G1LA 3UN0A 3OUNA 1K3NA 3GQSA 1KHUA 3I0MA 2LC1A 3I6UA 1U7FA 1DMZA 1GXCA 2XT9B 3VA4A 1MK2A 1G3GA 3DITA 5JEOA 1U7VA 5DJOA 5C4VA 3PO8A 3UOTA 3UNNA 2KB3A 3HX1A 4WERA 1J4OA 3MDBA 2P1RA 2JPEA 1YJMA 2JGRA 1J4QA 5JEMA 1LGQA 1UJXA 4L02A 1MR1A 1WV3A 2QVLA 2FEZA 4JIVD 1DEVA 3UMZA 2KKLA 3UNMA 1G6GA 3HUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7F A;  1U7F B;  1G88 A;  4R9P A;  1QWT A;  1DD1 A;  5BVI A;  1YGS A;  3A77 A;  3GMJ A;  1MK2 A;  3DIT A;  1ZOQ A;  5JEO A;  5JEJ A;  1MJS A;  1U7V B;  1U7V A;  5C4V A;  5JER A;  3DSH A;  5JEK A;  1J2F A;  5JEM A;  1MR1 A;  1DEV A;  1KHU A;  1KHX A;  5JEL A; 
#chains in the Genus database with same CATH topology
 5DHR A;  2CSW A;  4G2S A;  3T5P A;  3V80 A;  3I6W A;  3UV0 A;  3GMJ A;  5A8I A;  1K3J A;  4A4Y A;  1MJS A;  1FHR A;  3V8R A;  3V7W A;  5DHP A;  2AN1 A;  4KU0 D;  1Y3I A;  5JEK A;  2XXS A;  3VA1 A;  3V7Y A;  1J2F A;  3KT9 A;  1U0R A;  2I2B A;  2KB4 A;  2PIE A;  2JQJ A;  3S40 A;  1LGP A;  1KHX A;  3POA A;  2JKD A;  5JEL A;  5EJH A;  2QV7 A;  1U7F B;  1MZK A;  1J4L A;  1G88 A;  4R9P A;  1K3Q A;  5EJG A;  3FM8 A;  5BVI A;  1YGS A;  2BRF A;  3ELS A;  1U7V B;  2I1W A;  3V8M A;  3HUF A;  1K2M A;  5JER A;  2W3O A;  1Y3H A;  3ELV A;  4HAO A;  1Z0S A;  5EJF A;  2KFU A;  4QCJ A;  2A0T A;  1WLN A;  1YJ5 C;  3VPY A;  2Q5F A;  2AFF A;  4V24 A;  1SUW A;  5DHS A;  2JQI A;  1Z0U A;  4A0E A;  4EGX A;  3VZC A;  4JIW D;  1K2N A;  1UHT A;  2EH0 A;  2FF4 A;  3VZB A;  5E50 A;  1QWT A;  2I2C A;  2JQL A;  5DHT A;  4EJQ A;  1FHQ A;  1DD1 A;  4JON A;  4WRR A;  3VZD A;  4D9V A;  3A77 A;  1J4P A;  1R21 A;  1ZOQ A;  5JEJ A;  2I2D A;  4DY6 A;  3I0N A;  2BON A;  3DSH A;  1QU5 A;  4H87 A;  1J4K A;  5DHU A;  2I2F A;  3AFO A;  2G1L A;  3UN0 A;  3OUN A;  1K3N A;  3GQS A;  1KHU A;  3I0M A;  2LC1 A;  3I6U A;  3V8P A;  1U7F A;  3PFN A;  1DMZ A;  1GXC A;  2XT9 B;  1YT5 A;  1Z0Z A;  3VA4 A;  1MK2 A;  1G3G A;  3DIT A;  5JEO A;  2I29 A;  1U7V A;  5DJO A;  3V7U A;  3PO8 A;  5C4V A;  3UOT A;  3UNN A;  2KB3 A;  2I2A A;  3V8N A;  3HX1 A;  4WER A;  1J4O A;  3MDB A;  2P1R A;  2JPE A;  1YJM A;  2JGR A;  1J4Q A;  5DHQ A;  1LGQ A;  1UJX A;  4L02 A;  5JEM A;  1MR1 A;  1U0T A;  1WV3 A;  2QVL A;  2FEZ A;  4JIV D;  1DEV A;  3V8Q A;  3UMZ A;  2KKL A;  3UNM A;  1G6G A;  3HUE A;  5EJI A; 
#chains in the Genus database with same CATH homology
 2CSW A;  4G2S A;  3T5P A;  3I6W A;  3UV0 A;  3GMJ A;  5A8I A;  1K3J A;  4A4Y A;  1MJS A;  1FHR A;  4KU0 D;  5JEK A;  2XXS A;  3VA1 A;  1J2F A;  3KT9 A;  2KB4 A;  2PIE A;  2JQJ A;  3S40 A;  1LGP A;  3POA A;  1KHX A;  2JKD A;  5JEL A;  2QV7 A;  1U7F B;  1MZK A;  1J4L A;  1G88 A;  4R9P A;  1K3Q A;  3FM8 A;  5BVI A;  1YGS A;  2BRF A;  3ELS A;  1U7V B;  3HUF A;  1K2M A;  5JER A;  2W3O A;  3ELV A;  2KFU A;  4QCJ A;  2A0T A;  1WLN A;  1YJ5 C;  3VPY A;  2AFF A;  4V24 A;  2JQI A;  4A0E A;  4EGX A;  3VZC A;  4JIW D;  1K2N A;  1UHT A;  2EH0 A;  2FF4 A;  3VZB A;  5E50 A;  1QWT A;  2JQL A;  4EJQ A;  1FHQ A;  1DD1 A;  4JON A;  4WRR A;  3VZD A;  4D9V A;  3A77 A;  1J4P A;  1R21 A;  1ZOQ A;  5JEJ A;  3I0N A;  2BON A;  3DSH A;  1QU5 A;  4H87 A;  1J4K A;  2G1L A;  3UN0 A;  3OUN A;  1K3N A;  3GQS A;  1KHU A;  3I0M A;  2LC1 A;  3I6U A;  1U7F A;  1DMZ A;  1GXC A;  2XT9 B;  3VA4 A;  1MK2 A;  1G3G A;  3DIT A;  5JEO A;  1U7V A;  5DJO A;  5C4V A;  3PO8 A;  3UOT A;  3UNN A;  2KB3 A;  3HX1 A;  4WER A;  1J4O A;  3MDB A;  2P1R A;  2JPE A;  1YJM A;  2JGR A;  1J4Q A;  5JEM A;  1LGQ A;  1UJX A;  4L02 A;  1MR1 A;  1WV3 A;  2QVL A;  2FEZ A;  4JIV D;  1DEV A;  3UMZ A;  2KKL A;  3UNM A;  1G6G A;  3HUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...