1MKEA

Structure of the n-wasp evh1 domain-wip complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
144
structure length
144
Chain Sequence
DLPPPEPYVQTTKSYPSKLARNESRGSGSGSLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion protein consisting of Wiskott-Aldrich syndrome protei
publication title Structure of the N-WASP EVH1 Domain-WIP Complex. Insight into the Molecular Basis of Wiskott-Aldrich Syndrome.
pubmed doi rcsb
source organism Rattus norvegicus, homo sapiens
molecule tags Protein binding
total genus 15
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mkeA00
4K17A 4CHJA 1P3RA 1DDWA 2COCA 2AL6A 4GPTB 3VIAA 2RVBB 4HB0B 2H7EA 3FSSA 5EFXA 1XD4A 3GYOA 3PVUA 1X1FA 2Z0PA 1Y5OA 2N23A 2X18A 2L2IA 2J0KA 4CYEA 1Z87A 4YL8A 1GG3A 5D3YA 2ADZA 1FGYA 4BBKA 2YRYA 2L1CA 2D4QA 2OQBA 2DLWA 5C79A 2GCLA 4MK0A 2D2QA 2E2XA 5CLLB 1V5UA 2DKPA 2YSZA 3CXBB 1MIZB 2D9ZA 1W1HA 2UVMA 3D8FA 2D11A 3MDBC 4EJNA 2I5CA 4IOYX 4GN1A 1FGZA 5DI9B 4F7UP 4ZRIA 3BJIA 1W1GA 4B6HA 3T06A 1GC6A 4P7IA 3TCAA 1J0WA 1K5DB 1M7RA 1MPHA 1RRPB 2LOXA 2RGNB 1NTVA 3ODOA 1LB1A 5DH9B 5JHGA 1QQGA 1WG7A 2NZ8B 5HE1A 4NY0A 2YVCA 4K81A 1WGUA 2ELAA 2V76A 4YONA 4A5KA 1TQZA 4HB2B 2DKQA 5FI0A 4HATB 3RCPA 2CY5A 2DTCA 3PP2A 1EVHA 2YT0A 2D10A 5KCVA 1SHCA 1V88A 1XR0B 1XKEA 3AU5A 3DXCA 1U27A 2G35A 1LW3A 3P6AA 3KRWA 3WA0A 1WVHA 1NTYA 4Z2NA 1FHOA 1FAOA 1V5MA 5C6RA 3N7CA 1ZM0A 3ULBA 1B55A 5JP4A 2Z0QA 3FM8C 3CIKA 4DX90 2YT1A 3QBVB 3U7DA 1U5DA 4IFSA 3D8EA 4KAXB 2R0DA 1GC7A 4A6FB 4HDQA 5LONB 2MFQA 2BCJA 4CHMA 2AEHA 3QWMA 2I1JA 4HHVA 1H10A 1XX0A 3A98B 4GXBA 4GZUA 4ZRJA 4GMVA 2W2XC 3IVFA 1U2BA 2HTHB 1ZC4B 3PEGA 2MWNB 1X11A 3ODWA 1N3HA 1RJ2A 2XQNM 5HE0A 2KGXB 3DXEA 3SV1A 5KQ1A 3SUZA 5DHFB 1UNPA 2P0FA 1NU2A 2CODA 5LOPB 3ZDTA 1WGQA 3D8DA 1X05A 2D9WA 1DDVA 2QKMA 3G9WA 2Y8GA 2YF0A 1I2HA 2UZSA 3SYXA 4EMOA 1EGXA 2DHIA 1OMWA 1NI2A 4A6FA 4TYZA 4A6KA 2N0YA 2MKRA 2ROVA 4EKUA 4TKNA 1BTKA 2DFKA 2LULA 4DX8A 4HAXB 4WJ7A 2RSGA 2Y7BA 1DDMA 4F7HA 1FB8A 2DA0A 1U5GA 1UNQA 1XODA 2I1KA 3TW1A 1FOEA 1BTNA 1TXDA 1WJ1A 2J0MA 2DHJA 4WSFA 4HB3B 2YS1A 1MK9B 2D9VA 2UZRA 4D0NB 3MPXA 2DX5A 3A8PA 3V5WA 4HAZB 1Q67A 1UPRA 2PZ1A 2LYDA 2J59M 2D9YA 2GJYA 1U5EA 5J3YA 2COFA 4XWXA 1FHWA 1UEFA 4KVGB 2DX1A 1WI1A 1MKEA 2EMSA 3PVLA 1MK7B 3SO6A 1V5PA 2K2UA 4GMXB 2M14A 5D3XA 1BAKA 3M1IB 3PZDA 2D9XA 3OANA 5J3TA 2KCJA 3ODXA 1DROA 1E5WA 2RUKB 4HAVB 4Z2MB 3TVVA 4Y94A 2EC1A 2FJLA 2YS3A 4K2PA 1P6SA 3LJUX 3BINA 1XCGA 4DXAB 1ISNA 5JLJB 1ZC3B 5C5BA 3GYPA 2VKIA 4HAWB 1ZVRA 1TJ6A 1KI1B 2Z0OA 2J0JA 4HAUB 1OQNA 3SNHA 2Y8FA 5HE3A 4NSWA 1K5GB 4MT7A 1EF1A 3KSYA 2W2XD 2GS0A 3QIJA 5D3WA 2KUPA 1AQCA 3O96A 1OY2A 2LKOA 2K00A 3KY9A 2RNRB 1SGHA 4DBBA 4A6HA 2Q13A 2DHKA 5D3VA 1EAZA 1H4RA 3HQCA 3FEHA 5D27A 2LOZA 1UPQA 2YS5A 1J19A 5FI1A 1IRSA 2GCJA 4HAYB 5CLQB 4PQ0A 1P5TA 2DYQA 3TFMA 1W1DA 2JP2A 1DYNA 3X23A 4K2OA 2OTXA 2R09A 3ML4A 1AWEA 4L6EA 4C0AA 4WVFB 1PMSA 2QKLA 1ZSQA 1M7EA 5DIFB 4H8SA 2H7DA 2ROZB 1V61A 4ZRKA 1QC6A 2M38A 3TO1A 3F5RA 3AU4A 5DHAB 2MDXA 1MIXA 2ELBA 3HW2B 5C5BB 2IYBA 1KZGA 2COAA 2VSZA 2EMTA 3F0WA 5C16A 1FHXA 5JHHA 4IAPA 5GOWB 2IFSA 1BWNA 2HE7A 1X1GA 4F7GA 3HK0A 2CY4A 5L81A 1WJMA 3U8ZA 5KQ4A 2P0DA 3AJ4A 2DN6A 3P7ZA 4KHAA 1KZ7A 1I7AA 4KHOA 3UZTA 2NMBA 2P0HA 2I5FA 3PVWA 4HB4B 2ZPYA 3VOQA 5J3QA 1PFJA 1X86A 3ZVRA 1PLSA 3NSUA 2CRFA 3DXDA 1MAIA 3ULCA 1DBHA 2K2JA 4KHBB 1U5FA 3PSCA 4PNKA 3KZ1A 2DYNA 2W2WA 2RLOA 1U29A 2P8VA 1Y19B 4HDOA 3KRXA 2EJ8A 1UNRA 4MY6A 2CAYA 5HE2A 3PG7A 2VRWB 3A8QA 3WYFB 1V89A 2LG1A
chains in the Genus database with same CATH superfamily
4K17A 4CHJA 1P3RA 1DDWA 2COCA 2AL6A 4GPTB 3VIAA 2RVBB 4HB0B 2H7EA 3FSSA 5EFXA 1XD4A 4QJ5B 3GYOA 3PVUA 1X1FA 2Z14A 2Z0PA 1Y5OA 2N23A 2X18A 2L2IA 2J0KA 4CYEA 1Z87A 4YL8A 1GG3A 5D3YA 2ADZA 1FGYA 5IRSA 4BBKA 2YRYA 2L1CA 2D4QA 2OQBA 4QJ4B 2DLWA 5C79A 2GCLA 4MK0A 2D2QA 2E2XA 5CLLB 1V5UA 2DKPA 2YSZA 3CXBB 1MIZB 4OSNA 2D9ZA 1W1HA 2UVMA 3D8FA 2D11A 4GOUA 3MDBC 4EJNA 2K49A 2I5CA 4IOYX 4GN1A 1FGZA 5DI9B 4F7UP 4ZRIA 3BJIA 1W1GA 4B6HA 3T06A 1GC6A 4L1RA 4P7IA 3TCAA 1J0WA 1K5DB 1M7RA 1MPHA 1RRPB 2LOXA 2RGNB 1NTVA 3ODOA 1LB1A 5DH9B 5JHGA 1QQGA 1WG7A 2NZ8B 5HE1A 4NY0A 2YVCA 4K81A 1WGUA 2YT2A 2ELAA 2V76A 4YONA 4A5KA 1TQZA 4HB2B 2DKQA 5FI0A 4HATB 3RCPA 2CY5A 2DTCA 3PP2A 1EVHA 2YT0A 2D10A 5KCVA 1SHCA 1V88A 1XR0B 1XKEA 3AU5A 3DXCA 1U27A 4GNKB 2G35A 1LW3A 3P6AA 3KRWA 3WA0A 1WVHA 1NTYA 4Z2NA 1FHOA 3A58A 1FAOA 1V5MA 5C6RA 3N7CA 1ZM0A 3ULBA 1B55A 5JP4A 2Z0QA 3FM8C 3CIKA 4DX90 2YT1A 3QBVB 3U7DA 1U5DA 4IFSA 3D8EA 4KAXB 2K8EA 2R0DA 3NW8A 1GC7A 4A6FB 4HDQA 5LONB 2MFQA 2BCJA 4CHMA 2AEHA 3QWMA 2KUQA 2I1JA 4HHVA 1H10A 1XX0A 3A98B 4GXBA 4GZUA 4ZRJA 4GMVA 2W2XC 3IVFA 1U2BA 2HTHB 4QJ3B 1ZC4B 3PEGA 5I2SA 2MWNB 1X11A 3ODWA 1N3HA 1RJ2A 2XQNM 5HE0A 2KGXB 5I2MA 3DXEA 2KIGA 3SV1A 5KQ1A 3SUZA 5DHFB 1UNPA 2P0FA 2FJUB 1NU2A 2CODA 5LOPB 3ZDTA 1WGQA 3D8DA 1X05A 2D9WA 1DDVA 2QKMA 3G9WA 2Y8GA 2YF0A 1I2HA 2Z13A 2UZSA 3SYXA 4EMOA 1EGXA 2DHIA 1OMWA 1NI2A 4A6FA 2NBVA 4TYZA 4A6KA 2N0YA 2MKRA 2ROVA 4EKUA 4TKNA 1BTKA 5LG4B 2DFKA 2LULA 4DX8A 4HAXB 4WJ7A 2RSGA 2Y7BA 1DDMA 4F7HA 1FB8A 2DA0A 3HIEA 1U5GA 1UNQA 1XODA 3HSAA 2I1KA 3TW1A 1FOEA 1BTNA 1TXDA 1WJ1A 2J0MA 2DHJA 4WSFA 4HB3B 2YS1A 1MK9B 2D9VA 2UZRA 4D0NB 2DX5A 3MPXA 3A8PA 1MI1A 3V5WA 4HAZB 2RRFA 1Q67A 1UPRA 2PZ1A 2LYDA 2J59M 2D9YA 1ZYIA 2GJYA 1U5EA 5J3YA 2KR0A 2COFA 2KIEA 4XWXA 1FHWA 1UEFA 4KVGB 2DX1A 1WI1A 1MKEA 2EMSA 3PVLA 1MK7B 3SO6A 1V5PA 2K2UA 4GMXB 2M14A 5D3XA 1BAKA 3M1IB 3PZDA 2D9XA 4OT1A 3OANA 5J3TA 2KCJA 3ODXA 1DROA 1E5WA 2RUKB 3B77A 4HAVB 4Z2MB 3TVVA 4Y94A 2EC1A 2FJLA 3FVCA 2YS3A 4K2PA 1P6SA 3LJUX 3BINA 1XCGA 4DXAB 1ISNA 5JLJB 1ZC3B 5C5BA 3GYPA 2VKIA 4HAWB 1ZVRA 2ZKMX 1TJ6A 3OHMB 1KI1B 2Z0OA 2J0JA 4HAUB 1OQNA 3SNHA 2Y8FA 5HE3A 4NSWA 1K5GB 4MT7A 1EF1A 3KSYA 2W2XD 2GS0A 3QIJA 5D3WA 2KUPA 1AQCA 3DCXA 3O96A 1OY2A 2LKOA 2K00A 4D6WA 3KY9A 2RNRB 1SGHA 4DBBA 4A6HA 2Q13A 2DHKA 5D3VA 4QXAB 1EAZA 1H4RA 3HQCA 3FEHA 5D27A 2LOZA 1UPQA 2YS5A 1J19A 5FI1A 1IRSA 4KHBA 2GCJA 4HAYB 5CLQB 4PQ0A 1P5TA 2DYQA 3NWAA 3TFMA 1W1DA 2JP2A 1DYNA 3X23A 4K2OA 3NWDA 2OTXA 2R09A 3ML4A 1AWEA 4L6EA 4C0AA 4WVFB 1PMSA 1T77A 2QKLA 1ZSQA 1M7EA 2R2YA 5DIFB 4H8SA 2H7DA 2ROZB 1V61A 4ZRKA 1QC6A 2M38A 3TO1A 3F5RA 3AU4A 5DHAB 2MDXA 1MIXA 2ELBA 3HW2B 5C5BB 2IYBA 1KZGA 2COAA 2VSZA 2EMTA 3F0WA 5C16A 1FHXA 5JHHA 4IAPA 5GOWB 2IFSA 1BWNA 2HE7A 1X1GA 4F7GA 3HK0A 2CY4A 5L81A 1WJMA 3U8ZA 5KQ4A 2P0DA 3AJ4A 2GUMA 2DN6A 2Z4DA 5M4YB 3P7ZA 4KHAA 1KZ7A 1I7AA 3NWFA 4KHOA 3UZTA 2NMBA 2P0HA 4HSIA 2I5FA 3PVWA 4HB4B 2ZPYA 3VOQA 5J3QA 1PFJA 1X86A 3ZVRA 1PLSA 3NSUA 2CRFA 3DXDA 1MAIA 4CSQA 3ULCA 1DBHA 2K2JA 4KHBB 1U5FA 3PSCA 4PNKA 3KZ1A 2DYNA 2W2WA 2RLOA 1U29A 2P8VA 1Y19B 4HDOA 2Z59A 3KRXA 2EJ8A 3U12A 1UNRA 4MY6A 2CAYA 5HE2A 3PG7A 2VRWB 4DIXA 3A8QA 3WYFB 1V89A 2LG1A
chains in the Genus database with same CATH topology
4K17A 4CHJA 1P3RA 1DDWA 2COCA 2AL6A 4GPTB 3VIAA 2RVBB 4HB0B 2H7EA 3FSSA 5EFXA 1XD4A 3GYOA 3PVUA 1X1FA 2Z0PA 1Y5OA 2N23A 2X18A 2L2IA 2J0KA 4CYEA 1Z87A 4YL8A 1GG3A 5D3YA 2ADZA 1FGYA 4BBKA 2YRYA 2L1CA 2D4QA 2OQBA 2DLWA 5C79A 2GCLA 4MK0A 2D2QA 2E2XA 5CLLB 1V5UA 2DKPA 2YSZA 3CXBB 1MIZB 2D9ZA 1W1HA 2UVMA 3D8FA 2D11A 3MDBC 4EJNA 2I5CA 4IOYX 4GN1A 1FGZA 5DI9B 4F7UP 4ZRIA 3BJIA 1W1GA 4B6HA 3T06A 1GC6A 4P7IA 3TCAA 1J0WA 1K5DB 1M7RA 1MPHA 1RRPB 2LOXA 2RGNB 1NTVA 3ODOA 1LB1A 5DH9B 5JHGA 1QQGA 1WG7A 2NZ8B 5HE1A 4NY0A 2YVCA 4K81A 1WGUA 2ELAA 2V76A 4YONA 4A5KA 1TQZA 4HB2B 2DKQA 5FI0A 4HATB 3RCPA 2CY5A 2DTCA 3PP2A 1EVHA 2YT0A 2D10A 5KCVA 1SHCA 1V88A 1XR0B 1XKEA 3AU5A 3DXCA 1U27A 2G35A 1LW3A 3P6AA 3KRWA 3WA0A 1WVHA 1NTYA 4Z2NA 1FHOA 1FAOA 1V5MA 5C6RA 3N7CA 1ZM0A 3ULBA 1B55A 5JP4A 2Z0QA 3FM8C 3CIKA 4DX90 2YT1A 3QBVB 3U7DA 1U5DA 4IFSA 3D8EA 4KAXB 2R0DA 1GC7A 4A6FB 4HDQA 5LONB 2MFQA 2BCJA 4CHMA 2AEHA 3QWMA 2I1JA 4HHVA 1H10A 1XX0A 3A98B 4GXBA 4GZUA 4ZRJA 4GMVA 2W2XC 3IVFA 1U2BA 2HTHB 1ZC4B 3PEGA 2MWNB 1X11A 3ODWA 1N3HA 1RJ2A 2XQNM 5HE0A 2KGXB 3DXEA 3SV1A 5KQ1A 3SUZA 5DHFB 1UNPA 2P0FA 1NU2A 2CODA 5LOPB 3ZDTA 1WGQA 3D8DA 1X05A 2D9WA 1DDVA 2QKMA 3G9WA 2Y8GA 2YF0A 1I2HA 2UZSA 3SYXA 4EMOA 1EGXA 2DHIA 1OMWA 1NI2A 4A6FA 4TYZA 4A6KA 2N0YA 2MKRA 2ROVA 4EKUA 4TKNA 1BTKA 2DFKA 2LULA 4DX8A 4HAXB 4WJ7A 2RSGA 2Y7BA 1DDMA 4F7HA 1FB8A 2DA0A 1U5GA 1UNQA 1XODA 2I1KA 3TW1A 1FOEA 1BTNA 1TXDA 1WJ1A 2J0MA 2DHJA 4WSFA 4HB3B 2YS1A 1MK9B 2D9VA 2UZRA 4D0NB 3MPXA 2DX5A 3A8PA 3V5WA 4HAZB 1Q67A 1UPRA 2PZ1A 2LYDA 2J59M 2D9YA 2GJYA 1U5EA 5J3YA 2COFA 4XWXA 1FHWA 1UEFA 4KVGB 2DX1A 1WI1A 1MKEA 2EMSA 3PVLA 1MK7B 3SO6A 1V5PA 2K2UA 4GMXB 2M14A 5D3XA 1BAKA 3M1IB 3PZDA 2D9XA 3OANA 5J3TA 2KCJA 3ODXA 1DROA 1E5WA 2RUKB 4HAVB 4Z2MB 3TVVA 4Y94A 2EC1A 2FJLA 2YS3A 4K2PA 1P6SA 3LJUX 3BINA 1XCGA 4DXAB 1ISNA 5JLJB 1ZC3B 5C5BA 3GYPA 2VKIA 4HAWB 1ZVRA 1TJ6A 1KI1B 2Z0OA 2J0JA 4HAUB 1OQNA 3SNHA 2Y8FA 5HE3A 4NSWA 1K5GB 4MT7A 1EF1A 3KSYA 2W2XD 2GS0A 3QIJA 5D3WA 2KUPA 1AQCA 3O96A 1OY2A 2LKOA 2K00A 3KY9A 2RNRB 1SGHA 4DBBA 4A6HA 2Q13A 2DHKA 5D3VA 1EAZA 1H4RA 3HQCA 3FEHA 5D27A 2LOZA 1UPQA 2YS5A 1J19A 5FI1A 1IRSA 2GCJA 4HAYB 5CLQB 4PQ0A 1P5TA 2DYQA 3TFMA 1W1DA 2JP2A 1DYNA 3X23A 4K2OA 2OTXA 2R09A 3ML4A 1AWEA 4L6EA 4C0AA 4WVFB 1PMSA 2QKLA 1ZSQA 1M7EA 5DIFB 4H8SA 2H7DA 2ROZB 1V61A 4ZRKA 1QC6A 2M38A 3TO1A 3F5RA 3AU4A 5DHAB 2MDXA 1MIXA 2ELBA 3HW2B 5C5BB 2IYBA 1KZGA 2COAA 2VSZA 2EMTA 3F0WA 5C16A 1FHXA 5JHHA 4IAPA 5GOWB 2IFSA 1BWNA 2HE7A 1X1GA 4F7GA 3HK0A 2CY4A 5L81A 1WJMA 3U8ZA 5KQ4A 2P0DA 3AJ4A 2DN6A 3P7ZA 4KHAA 1KZ7A 1I7AA 4KHOA 3UZTA 2NMBA 2P0HA 2I5FA 3PVWA 4HB4B 2ZPYA 3VOQA 5J3QA 1PFJA 1X86A 3ZVRA 1PLSA 3NSUA 2CRFA 3DXDA 1MAIA 3ULCA 1DBHA 2K2JA 4KHBB 1U5FA 3PSCA 4PNKA 3KZ1A 2DYNA 2W2WA 2RLOA 1U29A 2P8VA 1Y19B 4HDOA 3KRXA 2EJ8A 1UNRA 4MY6A 2CAYA 5HE2A 3PG7A 2VRWB 3A8QA 3WYFB 1V89A 2LG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K17 A;  4CHJ A;  1P3R A;  1DDW A;  2COC A;  2AL6 A;  4GPT B;  3VIA A;  2RVB B;  4HB0 B;  2H7E A;  3FSS A;  5EFX A;  1XD4 A;  3GYO A;  3PVU A;  1X1F A;  2Z0P A;  1Y5O A;  2N23 A;  2X18 A;  2L2I A;  2J0K A;  4CYE A;  1Z87 A;  4YL8 A;  1GG3 A;  5D3Y A;  2ADZ A;  1FGY A;  4BBK A;  2YRY A;  2L1C A;  2D4Q A;  2OQB A;  2DLW A;  5C79 A;  2GCL A;  4MK0 A;  2D2Q A;  2E2X A;  5CLL B;  1V5U A;  2DKP A;  2YSZ A;  3CXB B;  1MIZ B;  2D9Z A;  1W1H A;  2UVM A;  3D8F A;  2D11 A;  3MDB C;  4EJN A;  2I5C A;  4IOY X;  4GN1 A;  1FGZ A;  5DI9 B;  4F7U P;  4ZRI A;  3BJI A;  1W1G A;  4B6H A;  3T06 A;  1GC6 A;  4P7I A;  3TCA A;  1J0W A;  1K5D B;  1M7R A;  1MPH A;  1RRP B;  2LOX A;  2RGN B;  1NTV A;  3ODO A;  1LB1 A;  5DH9 B;  5JHG A;  1QQG A;  1WG7 A;  2NZ8 B;  5HE1 A;  4NY0 A;  2YVC A;  4K81 A;  1WGU A;  2ELA A;  2V76 A;  4YON A;  4A5K A;  1TQZ A;  4HB2 B;  2DKQ A;  5FI0 A;  4HAT B;  3RCP A;  2CY5 A;  2DTC A;  3PP2 A;  1EVH A;  2YT0 A;  2D10 A;  5KCV A;  1SHC A;  1V88 A;  1XR0 B;  1XKE A;  3AU5 A;  3DXC A;  1U27 A;  2G35 A;  1LW3 A;  3P6A A;  3KRW A;  3WA0 A;  1WVH A;  1NTY A;  4Z2N A;  1FHO A;  1FAO A;  1V5M A;  5C6R A;  3N7C A;  1ZM0 A;  3ULB A;  1B55 A;  5JP4 A;  2Z0Q A;  3FM8 C;  3CIK A;  4DX9 0;  2YT1 A;  3QBV B;  3U7D A;  1U5D A;  4IFS A;  3D8E A;  4KAX B;  2R0D A;  1GC7 A;  4A6F B;  4HDQ A;  5LON B;  2MFQ A;  2BCJ A;  4CHM A;  2AEH A;  3QWM A;  2I1J A;  4HHV A;  1H10 A;  1XX0 A;  3A98 B;  4GXB A;  4GZU A;  4ZRJ A;  4GMV A;  2W2X C;  3IVF A;  1U2B A;  2HTH B;  1ZC4 B;  3PEG A;  2MWN B;  1X11 A;  3ODW A;  1N3H A;  1RJ2 A;  2XQN M;  5HE0 A;  2KGX B;  3DXE A;  3SV1 A;  5KQ1 A;  3SUZ A;  5DHF B;  1UNP A;  2P0F A;  1NU2 A;  2COD A;  5LOP B;  3ZDT A;  1WGQ A;  3D8D A;  1X05 A;  2D9W A;  1DDV A;  2QKM A;  3G9W A;  2Y8G A;  2YF0 A;  1I2H A;  2UZS A;  3SYX A;  4EMO A;  1EGX A;  2DHI A;  1OMW A;  1NI2 A;  4A6F A;  4TYZ A;  4A6K A;  2N0Y A;  2MKR A;  2ROV A;  4EKU A;  4TKN A;  1BTK A;  2DFK A;  2LUL A;  4DX8 A;  4HAX B;  4WJ7 A;  2RSG A;  2Y7B A;  1DDM A;  4F7H A;  1FB8 A;  2DA0 A;  1U5G A;  1UNQ A;  1XOD A;  2I1K A;  3TW1 A;  1FOE A;  1BTN A;  1TXD A;  1WJ1 A;  2J0M A;  2DHJ A;  4WSF A;  4HB3 B;  2YS1 A;  1MK9 B;  2D9V A;  2UZR A;  4D0N B;  3MPX A;  2DX5 A;  3A8P A;  3V5W A;  4HAZ B;  1Q67 A;  1UPR A;  2PZ1 A;  2LYD A;  2J59 M;  2D9Y A;  2GJY A;  1U5E A;  5J3Y A;  2COF A;  4XWX A;  1FHW A;  1UEF A;  4KVG B;  2DX1 A;  1WI1 A;  1MKE A;  2EMS A;  3PVL A;  1MK7 B;  3SO6 A;  1V5P A;  2K2U A;  4GMX B;  2M14 A;  5D3X A;  1BAK A;  3M1I B;  3PZD A;  2D9X A;  3OAN A;  5J3T A;  2KCJ A;  3ODX A;  1DRO A;  1E5W A;  2RUK B;  4HAV B;  4Z2M B;  3TVV A;  4Y94 A;  2EC1 A;  2FJL A;  2YS3 A;  4K2P A;  1P6S A;  3LJU X;  3BIN A;  1XCG A;  4DXA B;  1ISN A;  5JLJ B;  1ZC3 B;  5C5B A;  3GYP A;  2VKI A;  4HAW B;  1ZVR A;  1TJ6 A;  1KI1 B;  2Z0O A;  2J0J A;  4HAU B;  1OQN A;  3SNH A;  2Y8F A;  5HE3 A;  4NSW A;  1K5G B;  4MT7 A;  1EF1 A;  3KSY A;  2W2X D;  2GS0 A;  3QIJ A;  5D3W A;  2KUP A;  1AQC A;  3O96 A;  1OY2 A;  2LKO A;  2K00 A;  3KY9 A;  2RNR B;  1SGH A;  4DBB A;  4A6H A;  2Q13 A;  2DHK A;  5D3V A;  1EAZ A;  1H4R A;  3HQC A;  3FEH A;  5D27 A;  2LOZ A;  1UPQ A;  2YS5 A;  1J19 A;  5FI1 A;  1IRS A;  2GCJ A;  4HAY B;  5CLQ B;  4PQ0 A;  1P5T A;  2DYQ A;  3TFM A;  1W1D A;  2JP2 A;  1DYN A;  3X23 A;  4K2O A;  2OTX A;  2R09 A;  3ML4 A;  1AWE A;  4L6E A;  4C0A A;  4WVF B;  1PMS A;  2QKL A;  1ZSQ A;  1M7E A;  5DIF B;  4H8S A;  2H7D A;  2ROZ B;  1V61 A;  4ZRK A;  1QC6 A;  2M38 A;  3TO1 A;  3F5R A;  3AU4 A;  5DHA B;  2MDX A;  1MIX A;  2ELB A;  3HW2 B;  5C5B B;  2IYB A;  1KZG A;  2COA A;  2VSZ A;  2EMT A;  3F0W A;  5C16 A;  1FHX A;  5JHH A;  4IAP A;  5GOW B;  2IFS A;  1BWN A;  2HE7 A;  1X1G A;  4F7G A;  3HK0 A;  2CY4 A;  5L81 A;  1WJM A;  3U8Z A;  5KQ4 A;  2P0D A;  3AJ4 A;  2DN6 A;  3P7Z A;  4KHA A;  1KZ7 A;  1I7A A;  4KHO A;  3UZT A;  2NMB A;  2P0H A;  2I5F A;  3PVW A;  4HB4 B;  2ZPY A;  3VOQ A;  5J3Q A;  1PFJ A;  1X86 A;  3ZVR A;  1PLS A;  3NSU A;  2CRF A;  3DXD A;  1MAI A;  3ULC A;  1DBH A;  2K2J A;  4KHB B;  1U5F A;  3PSC A;  4PNK A;  3KZ1 A;  2DYN A;  2W2W A;  2RLO A;  1U29 A;  2P8V A;  1Y19 B;  4HDO A;  3KRX A;  2EJ8 A;  1UNR A;  4MY6 A;  2CAY A;  5HE2 A;  3PG7 A;  2VRW B;  3A8Q A;  3WYF B;  1V89 A;  2LG1 A; 
#chains in the Genus database with same CATH topology
 4K17 A;  4CHJ A;  1P3R A;  1DDW A;  2COC A;  2AL6 A;  4GPT B;  3VIA A;  2RVB B;  4HB0 B;  2H7E A;  3FSS A;  5EFX A;  1XD4 A;  4QJ5 B;  3GYO A;  3PVU A;  1X1F A;  2Z14 A;  2Z0P A;  1Y5O A;  2N23 A;  2X18 A;  2L2I A;  2J0K A;  4CYE A;  1Z87 A;  4YL8 A;  1GG3 A;  5D3Y A;  2ADZ A;  1FGY A;  5IRS A;  4BBK A;  2YRY A;  2L1C A;  2D4Q A;  2OQB A;  4QJ4 B;  2DLW A;  5C79 A;  2GCL A;  4MK0 A;  2D2Q A;  2E2X A;  5CLL B;  1V5U A;  2DKP A;  2YSZ A;  3CXB B;  1MIZ B;  4OSN A;  2D9Z A;  1W1H A;  2UVM A;  3D8F A;  2D11 A;  4GOU A;  3MDB C;  4EJN A;  2K49 A;  2I5C A;  4IOY X;  4GN1 A;  1FGZ A;  5DI9 B;  4F7U P;  4ZRI A;  3BJI A;  1W1G A;  4B6H A;  3T06 A;  1GC6 A;  4L1R A;  4P7I A;  3TCA A;  1J0W A;  1K5D B;  1M7R A;  1MPH A;  1RRP B;  2LOX A;  2RGN B;  1NTV A;  3ODO A;  1LB1 A;  5DH9 B;  5JHG A;  1QQG A;  1WG7 A;  2NZ8 B;  5HE1 A;  4NY0 A;  2YVC A;  4K81 A;  1WGU A;  2YT2 A;  2ELA A;  2V76 A;  4YON A;  4A5K A;  1TQZ A;  4HB2 B;  2DKQ A;  5FI0 A;  4HAT B;  3RCP A;  2CY5 A;  2DTC A;  3PP2 A;  1EVH A;  2YT0 A;  2D10 A;  5KCV A;  1SHC A;  1V88 A;  1XR0 B;  1XKE A;  3AU5 A;  3DXC A;  1U27 A;  4GNK B;  2G35 A;  1LW3 A;  3P6A A;  3KRW A;  3WA0 A;  1WVH A;  1NTY A;  4Z2N A;  1FHO A;  3A58 A;  1FAO A;  1V5M A;  5C6R A;  3N7C A;  1ZM0 A;  3ULB A;  1B55 A;  5JP4 A;  2Z0Q A;  3FM8 C;  3CIK A;  4DX9 0;  2YT1 A;  3QBV B;  3U7D A;  1U5D A;  4IFS A;  3D8E A;  4KAX B;  2K8E A;  2R0D A;  3NW8 A;  1GC7 A;  4A6F B;  4HDQ A;  5LON B;  2MFQ A;  2BCJ A;  4CHM A;  2AEH A;  3QWM A;  2KUQ A;  2I1J A;  4HHV A;  1H10 A;  1XX0 A;  3A98 B;  4GXB A;  4GZU A;  4ZRJ A;  4GMV A;  2W2X C;  3IVF A;  1U2B A;  2HTH B;  4QJ3 B;  1ZC4 B;  3PEG A;  5I2S A;  2MWN B;  1X11 A;  3ODW A;  1N3H A;  1RJ2 A;  2XQN M;  5HE0 A;  2KGX B;  5I2M A;  3DXE A;  2KIG A;  3SV1 A;  5KQ1 A;  3SUZ A;  5DHF B;  1UNP A;  2P0F A;  2FJU B;  1NU2 A;  2COD A;  5LOP B;  3ZDT A;  1WGQ A;  3D8D A;  1X05 A;  2D9W A;  1DDV A;  2QKM A;  3G9W A;  2Y8G A;  2YF0 A;  1I2H A;  2Z13 A;  2UZS A;  3SYX A;  4EMO A;  1EGX A;  2DHI A;  1OMW A;  1NI2 A;  4A6F A;  2NBV A;  4TYZ A;  4A6K A;  2N0Y A;  2MKR A;  2ROV A;  4EKU A;  4TKN A;  1BTK A;  5LG4 B;  2DFK A;  2LUL A;  4DX8 A;  4HAX B;  4WJ7 A;  2RSG A;  2Y7B A;  1DDM A;  4F7H A;  1FB8 A;  2DA0 A;  3HIE A;  1U5G A;  1UNQ A;  1XOD A;  3HSA A;  2I1K A;  3TW1 A;  1FOE A;  1BTN A;  1TXD A;  1WJ1 A;  2J0M A;  2DHJ A;  4WSF A;  4HB3 B;  2YS1 A;  1MK9 B;  2D9V A;  2UZR A;  4D0N B;  2DX5 A;  3MPX A;  3A8P A;  1MI1 A;  3V5W A;  4HAZ B;  2RRF A;  1Q67 A;  1UPR A;  2PZ1 A;  2LYD A;  2J59 M;  2D9Y A;  1ZYI A;  2GJY A;  1U5E A;  5J3Y A;  2KR0 A;  2COF A;  2KIE A;  4XWX A;  1FHW A;  1UEF A;  4KVG B;  2DX1 A;  1WI1 A;  1MKE A;  2EMS A;  3PVL A;  1MK7 B;  3SO6 A;  1V5P A;  2K2U A;  4GMX B;  2M14 A;  5D3X A;  1BAK A;  3M1I B;  3PZD A;  2D9X A;  4OT1 A;  3OAN A;  5J3T A;  2KCJ A;  3ODX A;  1DRO A;  1E5W A;  2RUK B;  3B77 A;  4HAV B;  4Z2M B;  3TVV A;  4Y94 A;  2EC1 A;  2FJL A;  3FVC A;  2YS3 A;  4K2P A;  1P6S A;  3LJU X;  3BIN A;  1XCG A;  4DXA B;  1ISN A;  5JLJ B;  1ZC3 B;  5C5B A;  3GYP A;  2VKI A;  4HAW B;  1ZVR A;  2ZKM X;  1TJ6 A;  3OHM B;  1KI1 B;  2Z0O A;  2J0J A;  4HAU B;  1OQN A;  3SNH A;  2Y8F A;  5HE3 A;  4NSW A;  1K5G B;  4MT7 A;  1EF1 A;  3KSY A;  2W2X D;  2GS0 A;  3QIJ A;  5D3W A;  2KUP A;  1AQC A;  3DCX A;  3O96 A;  1OY2 A;  2LKO A;  2K00 A;  4D6W A;  3KY9 A;  2RNR B;  1SGH A;  4DBB A;  4A6H A;  2Q13 A;  2DHK A;  5D3V A;  4QXA B;  1EAZ A;  1H4R A;  3HQC A;  3FEH A;  5D27 A;  2LOZ A;  1UPQ A;  2YS5 A;  1J19 A;  5FI1 A;  1IRS A;  4KHB A;  2GCJ A;  4HAY B;  5CLQ B;  4PQ0 A;  1P5T A;  2DYQ A;  3NWA A;  3TFM A;  1W1D A;  2JP2 A;  1DYN A;  3X23 A;  4K2O A;  3NWD A;  2OTX A;  2R09 A;  3ML4 A;  1AWE A;  4L6E A;  4C0A A;  4WVF B;  1PMS A;  1T77 A;  2QKL A;  1ZSQ A;  1M7E A;  2R2Y A;  5DIF B;  4H8S A;  2H7D A;  2ROZ B;  1V61 A;  4ZRK A;  1QC6 A;  2M38 A;  3TO1 A;  3F5R A;  3AU4 A;  5DHA B;  2MDX A;  1MIX A;  2ELB A;  3HW2 B;  5C5B B;  2IYB A;  1KZG A;  2COA A;  2VSZ A;  2EMT A;  3F0W A;  5C16 A;  1FHX A;  5JHH A;  4IAP A;  5GOW B;  2IFS A;  1BWN A;  2HE7 A;  1X1G A;  4F7G A;  3HK0 A;  2CY4 A;  5L81 A;  1WJM A;  3U8Z A;  5KQ4 A;  2P0D A;  3AJ4 A;  2GUM A;  2DN6 A;  2Z4D A;  5M4Y B;  3P7Z A;  4KHA A;  1KZ7 A;  1I7A A;  3NWF A;  4KHO A;  3UZT A;  2NMB A;  2P0H A;  4HSI A;  2I5F A;  3PVW A;  4HB4 B;  2ZPY A;  3VOQ A;  5J3Q A;  1PFJ A;  1X86 A;  3ZVR A;  1PLS A;  3NSU A;  2CRF A;  3DXD A;  1MAI A;  4CSQ A;  3ULC A;  1DBH A;  2K2J A;  4KHB B;  1U5F A;  3PSC A;  4PNK A;  3KZ1 A;  2DYN A;  2W2W A;  2RLO A;  1U29 A;  2P8V A;  1Y19 B;  4HDO A;  2Z59 A;  3KRX A;  2EJ8 A;  3U12 A;  1UNR A;  4MY6 A;  2CAY A;  5HE2 A;  3PG7 A;  2VRW B;  4DIX A;  3A8Q A;  3WYF B;  1V89 A;  2LG1 A; 
#chains in the Genus database with same CATH homology
 4K17 A;  4CHJ A;  1P3R A;  1DDW A;  2COC A;  2AL6 A;  4GPT B;  3VIA A;  2RVB B;  4HB0 B;  2H7E A;  3FSS A;  5EFX A;  1XD4 A;  3GYO A;  3PVU A;  1X1F A;  2Z0P A;  1Y5O A;  2N23 A;  2X18 A;  2L2I A;  2J0K A;  4CYE A;  1Z87 A;  4YL8 A;  1GG3 A;  5D3Y A;  2ADZ A;  1FGY A;  4BBK A;  2YRY A;  2L1C A;  2D4Q A;  2OQB A;  2DLW A;  5C79 A;  2GCL A;  4MK0 A;  2D2Q A;  2E2X A;  5CLL B;  1V5U A;  2DKP A;  2YSZ A;  3CXB B;  1MIZ B;  2D9Z A;  1W1H A;  2UVM A;  3D8F A;  2D11 A;  3MDB C;  4EJN A;  2I5C A;  4IOY X;  4GN1 A;  1FGZ A;  5DI9 B;  4F7U P;  4ZRI A;  3BJI A;  1W1G A;  4B6H A;  3T06 A;  1GC6 A;  4P7I A;  3TCA A;  1J0W A;  1K5D B;  1M7R A;  1MPH A;  1RRP B;  2LOX A;  2RGN B;  1NTV A;  3ODO A;  1LB1 A;  5DH9 B;  5JHG A;  1QQG A;  1WG7 A;  2NZ8 B;  5HE1 A;  4NY0 A;  2YVC A;  4K81 A;  1WGU A;  2ELA A;  2V76 A;  4YON A;  4A5K A;  1TQZ A;  4HB2 B;  2DKQ A;  5FI0 A;  4HAT B;  3RCP A;  2CY5 A;  2DTC A;  3PP2 A;  1EVH A;  2YT0 A;  2D10 A;  5KCV A;  1SHC A;  1V88 A;  1XR0 B;  1XKE A;  3AU5 A;  3DXC A;  1U27 A;  2G35 A;  1LW3 A;  3P6A A;  3KRW A;  3WA0 A;  1WVH A;  1NTY A;  4Z2N A;  1FHO A;  1FAO A;  1V5M A;  5C6R A;  3N7C A;  1ZM0 A;  3ULB A;  1B55 A;  5JP4 A;  2Z0Q A;  3FM8 C;  3CIK A;  4DX9 0;  2YT1 A;  3QBV B;  3U7D A;  1U5D A;  4IFS A;  3D8E A;  4KAX B;  2R0D A;  1GC7 A;  4A6F B;  4HDQ A;  5LON B;  2MFQ A;  2BCJ A;  4CHM A;  2AEH A;  3QWM A;  2I1J A;  4HHV A;  1H10 A;  1XX0 A;  3A98 B;  4GXB A;  4GZU A;  4ZRJ A;  4GMV A;  2W2X C;  3IVF A;  1U2B A;  2HTH B;  1ZC4 B;  3PEG A;  2MWN B;  1X11 A;  3ODW A;  1N3H A;  1RJ2 A;  2XQN M;  5HE0 A;  2KGX B;  3DXE A;  3SV1 A;  5KQ1 A;  3SUZ A;  5DHF B;  1UNP A;  2P0F A;  1NU2 A;  2COD A;  5LOP B;  3ZDT A;  1WGQ A;  3D8D A;  1X05 A;  2D9W A;  1DDV A;  2QKM A;  3G9W A;  2Y8G A;  2YF0 A;  1I2H A;  2UZS A;  3SYX A;  4EMO A;  1EGX A;  2DHI A;  1OMW A;  1NI2 A;  4A6F A;  4TYZ A;  4A6K A;  2N0Y A;  2MKR A;  2ROV A;  4EKU A;  4TKN A;  1BTK A;  2DFK A;  2LUL A;  4DX8 A;  4HAX B;  4WJ7 A;  2RSG A;  2Y7B A;  1DDM A;  4F7H A;  1FB8 A;  2DA0 A;  1U5G A;  1UNQ A;  1XOD A;  2I1K A;  3TW1 A;  1FOE A;  1BTN A;  1TXD A;  1WJ1 A;  2J0M A;  2DHJ A;  4WSF A;  4HB3 B;  2YS1 A;  1MK9 B;  2D9V A;  2UZR A;  4D0N B;  3MPX A;  2DX5 A;  3A8P A;  3V5W A;  4HAZ B;  1Q67 A;  1UPR A;  2PZ1 A;  2LYD A;  2J59 M;  2D9Y A;  2GJY A;  1U5E A;  5J3Y A;  2COF A;  4XWX A;  1FHW A;  1UEF A;  4KVG B;  2DX1 A;  1WI1 A;  1MKE A;  2EMS A;  3PVL A;  1MK7 B;  3SO6 A;  1V5P A;  2K2U A;  4GMX B;  2M14 A;  5D3X A;  1BAK A;  3M1I B;  3PZD A;  2D9X A;  3OAN A;  5J3T A;  2KCJ A;  3ODX A;  1DRO A;  1E5W A;  2RUK B;  4HAV B;  4Z2M B;  3TVV A;  4Y94 A;  2EC1 A;  2FJL A;  2YS3 A;  4K2P A;  1P6S A;  3LJU X;  3BIN A;  1XCG A;  4DXA B;  1ISN A;  5JLJ B;  1ZC3 B;  5C5B A;  3GYP A;  2VKI A;  4HAW B;  1ZVR A;  1TJ6 A;  1KI1 B;  2Z0O A;  2J0J A;  4HAU B;  1OQN A;  3SNH A;  2Y8F A;  5HE3 A;  4NSW A;  1K5G B;  4MT7 A;  1EF1 A;  3KSY A;  2W2X D;  2GS0 A;  3QIJ A;  5D3W A;  2KUP A;  1AQC A;  3O96 A;  1OY2 A;  2LKO A;  2K00 A;  3KY9 A;  2RNR B;  1SGH A;  4DBB A;  4A6H A;  2Q13 A;  2DHK A;  5D3V A;  1EAZ A;  1H4R A;  3HQC A;  3FEH A;  5D27 A;  2LOZ A;  1UPQ A;  2YS5 A;  1J19 A;  5FI1 A;  1IRS A;  2GCJ A;  4HAY B;  5CLQ B;  4PQ0 A;  1P5T A;  2DYQ A;  3TFM A;  1W1D A;  2JP2 A;  1DYN A;  3X23 A;  4K2O A;  2OTX A;  2R09 A;  3ML4 A;  1AWE A;  4L6E A;  4C0A A;  4WVF B;  1PMS A;  2QKL A;  1ZSQ A;  1M7E A;  5DIF B;  4H8S A;  2H7D A;  2ROZ B;  1V61 A;  4ZRK A;  1QC6 A;  2M38 A;  3TO1 A;  3F5R A;  3AU4 A;  5DHA B;  2MDX A;  1MIX A;  2ELB A;  3HW2 B;  5C5B B;  2IYB A;  1KZG A;  2COA A;  2VSZ A;  2EMT A;  3F0W A;  5C16 A;  1FHX A;  5JHH A;  4IAP A;  5GOW B;  2IFS A;  1BWN A;  2HE7 A;  1X1G A;  4F7G A;  3HK0 A;  2CY4 A;  5L81 A;  1WJM A;  3U8Z A;  5KQ4 A;  2P0D A;  3AJ4 A;  2DN6 A;  3P7Z A;  4KHA A;  1KZ7 A;  1I7A A;  4KHO A;  3UZT A;  2NMB A;  2P0H A;  2I5F A;  3PVW A;  4HB4 B;  2ZPY A;  3VOQ A;  5J3Q A;  1PFJ A;  1X86 A;  3ZVR A;  1PLS A;  3NSU A;  2CRF A;  3DXD A;  1MAI A;  3ULC A;  1DBH A;  2K2J A;  4KHB B;  1U5F A;  3PSC A;  4PNK A;  3KZ1 A;  2DYN A;  2W2W A;  2RLO A;  1U29 A;  2P8V A;  1Y19 B;  4HDO A;  3KRX A;  2EJ8 A;  1UNR A;  4MY6 A;  2CAY A;  5HE2 A;  3PG7 A;  2VRW B;  3A8Q A;  3WYF B;  1V89 A;  2LG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...