1MKEA

Structure of the n-wasp evh1 domain-wip complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
144
structure length
144
Chain Sequence
b'DLPPPEPYVQTTKSYPSKLARNESRGSGSGSLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion protein consisting of Wiskott-Aldrich syndrome protei
publication title Structure of the N-WASP EVH1 Domain-WIP Complex. Insight into the Molecular Basis of Wiskott-Aldrich Syndrome.
pubmed doi rcsb
source organism Rattus norvegicus, homo sapiens
molecule tags Protein binding
total genus 15
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mkeA00
1MK9B 2LG1A 1FHXA 2YS3A 1TXDA 4CHJA 1Y5OA 3WA0A 1Q67A 5HE3A 3ULBA 1FOEA 2COAA 1I2HA 1FHOA 2H7DA 4A5KA 5C5BB 4KHOA 1EGXA 4NY0A 4WVFB 4MK0A 2J0KA 1PFJA 1GC6A 2DKPA 2YF0A 1UPRA 4H8SA 1NI2A 2KGXB 2CAYA 2MKRA 2GCLA 2P8VA 2W2WA 4BBKA 5D3VA 1WJ1A 2R09A 4ZRKA 1GC7A 3FSSA 1B55A 4KAXB 5DHFB 1V5UA 2QKLA 3ODWA 3ULCA 3A98B 4PNKA 2W2XC 2YRYA 5JHHA 5CLLB 2DHJA 2D9YA 4CHMA 3P7ZA 1UPQA 4EKUA 2RSGA 1MK7B 2YS5A 3SV1A 2L2IA 1QC6A 1U5FA 1KI1B 4GMXB 2RGNB 2Y8FA 2PZ1A 4CYEA 2X18A 4YONA 1P6SA 1V5PA 3A8PA 3N7CA 1K5GB 2CRFA 2EMTA 2GS0A 5FI1A 1X1GA 3TW1A 5EFXA 2AEHA 2CY5A 2VRWB 5LOPB 1U29A 1SHCA 1DBHA 4ZRIA 5LONB 2E2XA 2DLWA 3VIAA 2I1KA 3D8EA 1X86A 4HAUB 2YSZA 3WYFB 4HAXB 3CXBB 3PP2A 1GG3A 5D3XA 2MDXA 5CLQB 2I5CA 1XKEA 1MIZB 1M7EA 3P6AA 3QBVB 2RLOA 3O96A 2D10A 3U7DA 3FEHA 1LB1A 3GYOA 3PG7A 4DXAB 3KRWA 2J59M 2D9ZA 4GN1A 1J0WA 1AWEA 2UZSA 4HAZB 4HATB 3TFMA 2KUPA 1U27A 4A6FA 1TQZA 2GCJA 4HDQA 1MAIA 1UNQA 3PEGA 3UZTA 3ZVRA 3CIKA 3M1IB 2COFA 5HE2A 3PVLA 4EMOA 4IFSA 3KZ1A 2YVCA 2D4QA 5KQ4A 5C79A 1NTYA 2D9WA 2Z0PA 3TO1A 1BAKA 3F0WA 2VKIA 3HQCA 3VOQA 1M7RA 2VSZA 1UEFA 2G35A 1BWNA 4DX90 1K5DB 2Y7BA 4L6EA 4P7IA 2HTHB 4MT7A 1P3RA 1ZVRA 1X1FA 2M38A 2P0DA 1ISNA 2CODA 5D3WA 2ELAA 1U5EA 2QKMA 1X11A 4HHVA 1XODA 1XD4A 2ADZA 4A6FB 1E5WA 1U5DA 2ZPYA 2EMSA 3AJ4A 2YS1A 4C0AA 3PVWA 4PQ0A 1QQGA 1X05A 1MKEA 2DFKA 4XWXA 5KQ1A 1DROA 1N3HA 2JP2A 3AU5A 5HE1A 2NZ8B 1V89A 3F5RA 1PMSA 1SGHA 2UZRA 3ODOA 5C16A 2MFQA 2RUKB 2NMBA 4HDOA 2OTXA 1V61A 4D0NB 1NU2A 1W1GA 1ZM0A 2DX1A 3RCPA 3DXDA 4GXBA 1WI1A 4HB2B 4A6HA 1H10A 1FGZA 1U2BA 2Y8GA 4IOYX 1XCGA 3SO6A 3SNHA 2COCA 5FI0A 1WJMA 1U5GA 1UNPA 3T06A 2LOZA 4NSWA 3FM8C 1RRPB 3PSCA 1FGYA 4B6HA 1W1HA 4MY6A 1FHWA 2YT0A 5J3QA 3D8DA 1I7AA 2D9VA 1TJ6A 2IFSA 1H4RA 2ELBA 1XR0B 5JP4A 2DKQA 2I1JA 4DX8A 2XQNM 2FJLA 1OMWA 3TVVA 2Z0QA 2DYNA 4GZUA 1AQCA 3TCAA 1IRSA 2IYBA 3BINA 2N0YA 2R0DA 1EAZA 1WGUA 4GPTB 2HE7A 2OQBA 2DX5A 1LW3A 2LULA 1RJ2A 1NTVA 5GOWB 5D3YA 5DHAB 4HAVB 4K2OA 4HB4B 3PZDA 5J3YA 3QWMA 4F7GA 4ZRJA 3U8ZA 1MPHA 4EJNA 4K17A 4Y94A 2D11A 3KY9A 4Z2MB 1BTNA 3D8FA 2L1CA 1KZGA 3HW2B 1J19A 1WG7A 2CY4A 5C6RA 4HB3B 2DA0A 3MDBC 5DIFB 4IAPA 1V88A 3SYXA 4F7HA 2I5FA 4Z2NA 2LKOA 3AU4A 2LYDA 2RVBB 4K81A 2EC1A 1EF1A 3QIJA 2P0FA 2D2QA 5L81A 1V5MA 2J0JA 2M14A 2D9XA 3G9WA 2DHIA 1BTKA 3PVUA 3LJUX 2K2UA 2V76A 4YL8A 1OY2A 2K00A 1ZSQA 2YT1A 4KVGB 1MIXA 1KZ7A 3ODXA 5KCVA 3OANA 3ZDTA 2P0HA 3NSUA 4F7UP 1WVHA 5JLJB 5HE0A 1XX0A 2DYQA 4HAYB 4A6KA 1FB8A 2ROZB 3KSYA 2AL6A 3BJIA 2ROVA 2BCJA 2H7EA 2RNRB 3HK0A 1PLSA 2J0MA 1UNRA 1EVHA 1ZC3B 2KCJA 3MPXA 1W1DA 4K2PA 1ZC4B 4HB0B 2K2JA 4KHAA 3KRXA 2Q13A 5C5BA 1DDMA 2GJYA 2N23A 3DXCA 3SUZA 1FAOA 4GMVA 2UVMA 5J3TA 4WSFA 2DHKA 3ML4A 2MWNB 2EJ8A 5D27A 1OQNA 1WGQA 3DXEA 5DI9B 4TYZA 2DN6A 5DH9B 3A8QA 2W2XD 1DDVA 1Z87A 2Z0OA 3X23A 3IVFA 1DYNA 1P5TA 4WJ7A 1Y19B 3V5WA 4DBBA 4KHBB 4TKNA 4HAWB 1DDWA 3GYPA 5JHGA 2LOXA 2DTCA
chains in the Genus database with same CATH superfamily
1MK9B 2LG1A 1FHXA 2YS3A 1TXDA 4CHJA 1Y5OA 3WA0A 1Q67A 5HE3A 3ULBA 1FOEA 2COAA 1I2HA 1FHOA 2H7DA 1ZYIA 5C5BB 4A5KA 4KHOA 1EGXA 4NY0A 4WVFB 4MK0A 2J0KA 1PFJA 2ZKMX 1GC6A 2DKPA 2YF0A 1UPRA 4H8SA 1NI2A 2KGXB 2CAYA 2MKRA 2GCLA 2P8VA 2W2WA 4BBKA 5D3VA 1MI1A 1WJ1A 2R09A 4OT1A 4ZRKA 1GC7A 3FSSA 1B55A 4KAXB 5DHFB 1V5UA 2QKLA 3ODWA 3ULCA 3A98B 4PNKA 2W2XC 2YRYA 5JHHA 5CLLB 2DHJA 3HIEA 2D9YA 3HSAA 4CHMA 3P7ZA 1UPQA 4EKUA 3NWFA 2RSGA 1MK7B 2FJUB 2YT2A 2YS5A 3SV1A 2L2IA 4QJ3B 1QC6A 1U5FA 1KI1B 4GMXB 2RGNB 4KHBA 2Y8FA 2KIEA 2PZ1A 4CYEA 2X18A 4YONA 1P6SA 3A8PA 1V5PA 1K5GB 2CRFA 2EMTA 2GS0A 3N7CA 5FI1A 1X1GA 3TW1A 5EFXA 2AEHA 2CY5A 3NW8A 2VRWB 5LOPB 1U29A 1SHCA 1DBHA 4ZRIA 5LONB 2E2XA 2DLWA 3VIAA 2I1KA 2K8EA 3D8EA 3NWAA 1X86A 4HAUB 2YSZA 3WYFB 4HAXB 3CXBB 3PP2A 1GG3A 5D3XA 2MDXA 5CLQB 2I5CA 1XKEA 1MIZB 1M7EA 3P6AA 3QBVB 2RLOA 3O96A 2D10A 3U7DA 3FEHA 1LB1A 3GYOA 3PG7A 4DXAB 3KRWA 5M4YB 2J59M 2Z59A 2D9ZA 4GN1A 4OSNA 1J0WA 3FVCA 2UZSA 1AWEA 4HAZB 4HATB 3TFMA 2KUPA 1U27A 4A6FA 1TQZA 2GCJA 4HDQA 1MAIA 1UNQA 3PEGA 3UZTA 3ZVRA 3CIKA 3M1IB 2COFA 5HE2A 3PVLA 4EMOA 4IFSA 3KZ1A 2YVCA 2D4QA 5KQ4A 5C79A 1NTYA 2D9WA 2Z0PA 3TO1A 1BAKA 5I2SA 3F0WA 2VKIA 3HQCA 3VOQA 4QJ5B 1M7RA 2VSZA 3OHMB 3A58A 2R2YA 5I2MA 1UEFA 2G35A 1BWNA 4DX90 1K5DB 2Y7BA 4L6EA 2RRFA 4P7IA 2HTHB 4MT7A 1P3RA 1ZVRA 1X1FA 2M38A 2P0DA 2Z13A 1ISNA 2CODA 5D3WA 2ELAA 1U5EA 2QKMA 1X11A 4HHVA 1XODA 1XD4A 2ADZA 4A6FB 1E5WA 1U5DA 2ZPYA 2EMSA 3AJ4A 2YS1A 4C0AA 5IRSA 3PVWA 4GNKB 4PQ0A 1QQGA 1X05A 1MKEA 2DFKA 4XWXA 5KQ1A 1DROA 2NBVA 1N3HA 2JP2A 3AU5A 4QXAB 5HE1A 2NZ8B 1V89A 3F5RA 1PMSA 1SGHA 2UZRA 3ODOA 5C16A 2MFQA 2RUKB 2NMBA 4HSIA 4HDOA 2OTXA 1V61A 4D0NB 1NU2A 1W1GA 1ZM0A 2DX1A 3RCPA 3DXDA 4GXBA 1WI1A 4HB2B 4A6HA 1H10A 1FGZA 3B77A 1U2BA 2Y8GA 4IOYX 1XCGA 3SO6A 3SNHA 2COCA 5FI0A 1WJMA 1U5GA 1UNPA 3T06A 2LOZA 4NSWA 3FM8C 1RRPB 3PSCA 1FGYA 4B6HA 1W1HA 4DIXA 4MY6A 1FHWA 2YT0A 2KR0A 5J3QA 3D8DA 1I7AA 2D9VA 1TJ6A 2IFSA 1H4RA 2ELBA 1XR0B 5JP4A 2DKQA 3DCXA 2I1JA 4DX8A 2XQNM 2FJLA 1OMWA 3TVVA 2Z0QA 2DYNA 4GZUA 1AQCA 3TCAA 1IRSA 2IYBA 3BINA 2N0YA 2R0DA 1EAZA 1WGUA 4GPTB 2HE7A 2OQBA 2DX5A 1LW3A 2KIGA 2LULA 1RJ2A 1NTVA 5GOWB 5D3YA 5DHAB 4HAVB 4K2OA 4HB4B 4GOUA 3PZDA 5J3YA 3QWMA 4CSQA 4F7GA 2K49A 4ZRJA 3U8ZA 1MPHA 4EJNA 4K17A 2Z4DA 4QJ4B 4Y94A 2D11A 3KY9A 4Z2MB 1BTNA 3D8FA 2L1CA 1KZGA 3HW2B 1J19A 1WG7A 2CY4A 5C6RA 4HB3B 2DA0A 3MDBC 5DIFB 4IAPA 1V88A 3SYXA 4F7HA 2I5FA 4Z2NA 2LKOA 3AU4A 2LYDA 2RVBB 4K81A 2EC1A 1EF1A 3QIJA 2GUMA 2P0FA 2D2QA 5L81A 1V5MA 2J0JA 2M14A 2D9XA 3G9WA 2DHIA 1BTKA 3PVUA 3LJUX 2K2UA 2V76A 4YL8A 1OY2A 2K00A 1ZSQA 2YT1A 4KVGB 1MIXA 1KZ7A 3ODXA 5KCVA 3OANA 3ZDTA 2P0HA 3NSUA 4F7UP 1WVHA 5JLJB 5HE0A 1XX0A 2DYQA 4HAYB 4A6KA 1FB8A 2ROZB 3NWDA 3KSYA 2AL6A 3BJIA 2ROVA 2BCJA 2H7EA 2RNRB 3HK0A 1PLSA 2J0MA 1UNRA 1EVHA 2Z14A 1ZC3B 2KCJA 3MPXA 1W1DA 4K2PA 1ZC4B 4HB0B 2K2JA 4KHAA 3KRXA 4L1RA 2Q13A 5C5BA 1DDMA 2GJYA 2N23A 3DXCA 3SUZA 1FAOA 4GMVA 2UVMA 5J3TA 4WSFA 2DHKA 1T77A 3ML4A 2MWNB 2EJ8A 5D27A 1OQNA 1WGQA 3DXEA 5DI9B 4TYZA 2DN6A 5DH9B 3A8QA 2W2XD 1DDVA 1Z87A 2Z0OA 3X23A 3U12A 3IVFA 1DYNA 1P5TA 2KUQA 4WJ7A 1Y19B 3V5WA 4DBBA 4KHBB 4TKNA 4HAWB 1DDWA 3GYPA 4D6WA 5LG4B 5JHGA 2LOXA 2DTCA
chains in the Genus database with same CATH topology
1MK9B 2LG1A 1FHXA 2YS3A 1TXDA 4CHJA 1Y5OA 3WA0A 1Q67A 5HE3A 3ULBA 1FOEA 2COAA 1I2HA 1FHOA 2H7DA 4A5KA 5C5BB 4KHOA 1EGXA 4NY0A 4WVFB 4MK0A 2J0KA 1PFJA 1GC6A 2DKPA 2YF0A 1UPRA 4H8SA 1NI2A 2KGXB 2CAYA 2MKRA 2GCLA 2P8VA 2W2WA 4BBKA 5D3VA 1WJ1A 2R09A 4ZRKA 1GC7A 3FSSA 1B55A 4KAXB 5DHFB 1V5UA 2QKLA 3ODWA 3ULCA 3A98B 4PNKA 2W2XC 2YRYA 5JHHA 5CLLB 2DHJA 2D9YA 4CHMA 3P7ZA 1UPQA 4EKUA 2RSGA 1MK7B 2YS5A 3SV1A 2L2IA 1QC6A 1U5FA 1KI1B 4GMXB 2RGNB 2Y8FA 2PZ1A 4CYEA 2X18A 4YONA 1P6SA 1V5PA 3A8PA 3N7CA 1K5GB 2CRFA 2EMTA 2GS0A 5FI1A 1X1GA 3TW1A 5EFXA 2AEHA 2CY5A 2VRWB 5LOPB 1U29A 1SHCA 1DBHA 4ZRIA 5LONB 2E2XA 2DLWA 3VIAA 2I1KA 3D8EA 1X86A 4HAUB 2YSZA 3WYFB 4HAXB 3CXBB 3PP2A 1GG3A 5D3XA 2MDXA 5CLQB 2I5CA 1XKEA 1MIZB 1M7EA 3P6AA 3QBVB 2RLOA 3O96A 2D10A 3U7DA 3FEHA 1LB1A 3GYOA 3PG7A 4DXAB 3KRWA 2J59M 2D9ZA 4GN1A 1J0WA 1AWEA 2UZSA 4HAZB 4HATB 3TFMA 2KUPA 1U27A 4A6FA 1TQZA 2GCJA 4HDQA 1MAIA 1UNQA 3PEGA 3UZTA 3ZVRA 3CIKA 3M1IB 2COFA 5HE2A 3PVLA 4EMOA 4IFSA 3KZ1A 2YVCA 2D4QA 5KQ4A 5C79A 1NTYA 2D9WA 2Z0PA 3TO1A 1BAKA 3F0WA 2VKIA 3HQCA 3VOQA 1M7RA 2VSZA 1UEFA 2G35A 1BWNA 4DX90 1K5DB 2Y7BA 4L6EA 4P7IA 2HTHB 4MT7A 1P3RA 1ZVRA 1X1FA 2M38A 2P0DA 1ISNA 2CODA 5D3WA 2ELAA 1U5EA 2QKMA 1X11A 4HHVA 1XODA 1XD4A 2ADZA 4A6FB 1E5WA 1U5DA 2ZPYA 2EMSA 3AJ4A 2YS1A 4C0AA 3PVWA 4PQ0A 1QQGA 1X05A 1MKEA 2DFKA 4XWXA 5KQ1A 1DROA 1N3HA 2JP2A 3AU5A 5HE1A 2NZ8B 1V89A 3F5RA 1PMSA 1SGHA 2UZRA 3ODOA 5C16A 2MFQA 2RUKB 2NMBA 4HDOA 2OTXA 1V61A 4D0NB 1NU2A 1W1GA 1ZM0A 2DX1A 3RCPA 3DXDA 4GXBA 1WI1A 4HB2B 4A6HA 1H10A 1FGZA 1U2BA 2Y8GA 4IOYX 1XCGA 3SO6A 3SNHA 2COCA 5FI0A 1WJMA 1U5GA 1UNPA 3T06A 2LOZA 4NSWA 3FM8C 1RRPB 3PSCA 1FGYA 4B6HA 1W1HA 4MY6A 1FHWA 2YT0A 5J3QA 3D8DA 1I7AA 2D9VA 1TJ6A 2IFSA 1H4RA 2ELBA 1XR0B 5JP4A 2DKQA 2I1JA 4DX8A 2XQNM 2FJLA 1OMWA 3TVVA 2Z0QA 2DYNA 4GZUA 1AQCA 3TCAA 1IRSA 2IYBA 3BINA 2N0YA 2R0DA 1EAZA 1WGUA 4GPTB 2HE7A 2OQBA 2DX5A 1LW3A 2LULA 1RJ2A 1NTVA 5GOWB 5D3YA 5DHAB 4HAVB 4K2OA 4HB4B 3PZDA 5J3YA 3QWMA 4F7GA 4ZRJA 3U8ZA 1MPHA 4EJNA 4K17A 4Y94A 2D11A 3KY9A 4Z2MB 1BTNA 3D8FA 2L1CA 1KZGA 3HW2B 1J19A 1WG7A 2CY4A 5C6RA 4HB3B 2DA0A 3MDBC 5DIFB 4IAPA 1V88A 3SYXA 4F7HA 2I5FA 4Z2NA 2LKOA 3AU4A 2LYDA 2RVBB 4K81A 2EC1A 1EF1A 3QIJA 2P0FA 2D2QA 5L81A 1V5MA 2J0JA 2M14A 2D9XA 3G9WA 2DHIA 1BTKA 3PVUA 3LJUX 2K2UA 2V76A 4YL8A 1OY2A 2K00A 1ZSQA 2YT1A 4KVGB 1MIXA 1KZ7A 3ODXA 5KCVA 3OANA 3ZDTA 2P0HA 3NSUA 4F7UP 1WVHA 5JLJB 5HE0A 1XX0A 2DYQA 4HAYB 4A6KA 1FB8A 2ROZB 3KSYA 2AL6A 3BJIA 2ROVA 2BCJA 2H7EA 2RNRB 3HK0A 1PLSA 2J0MA 1UNRA 1EVHA 1ZC3B 2KCJA 3MPXA 1W1DA 4K2PA 1ZC4B 4HB0B 2K2JA 4KHAA 3KRXA 2Q13A 5C5BA 1DDMA 2GJYA 2N23A 3DXCA 3SUZA 1FAOA 4GMVA 2UVMA 5J3TA 4WSFA 2DHKA 3ML4A 2MWNB 2EJ8A 5D27A 1OQNA 1WGQA 3DXEA 5DI9B 4TYZA 2DN6A 5DH9B 3A8QA 2W2XD 1DDVA 1Z87A 2Z0OA 3X23A 3IVFA 1DYNA 1P5TA 4WJ7A 1Y19B 3V5WA 4DBBA 4KHBB 4TKNA 4HAWB 1DDWA 3GYPA 5JHGA 2LOXA 2DTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK9 B;  2LG1 A;  1FHX A;  2YS3 A;  1TXD A;  4CHJ A;  1Y5O A;  3WA0 A;  1Q67 A;  5HE3 A;  3ULB A;  1FOE A;  2COA A;  1I2H A;  1FHO A;  2H7D A;  4A5K A;  5C5B B;  4KHO A;  1EGX A;  4NY0 A;  4WVF B;  4MK0 A;  2J0K A;  1PFJ A;  1GC6 A;  2DKP A;  2YF0 A;  1UPR A;  4H8S A;  1NI2 A;  2KGX B;  2CAY A;  2MKR A;  2GCL A;  2P8V A;  2W2W A;  4BBK A;  5D3V A;  1WJ1 A;  2R09 A;  4ZRK A;  1GC7 A;  3FSS A;  1B55 A;  4KAX B;  5DHF B;  1V5U A;  2QKL A;  3ODW A;  3ULC A;  3A98 B;  4PNK A;  2W2X C;  2YRY A;  5JHH A;  5CLL B;  2DHJ A;  2D9Y A;  4CHM A;  3P7Z A;  1UPQ A;  4EKU A;  2RSG A;  1MK7 B;  2YS5 A;  3SV1 A;  2L2I A;  1QC6 A;  1U5F A;  1KI1 B;  4GMX B;  2RGN B;  2Y8F A;  2PZ1 A;  4CYE A;  2X18 A;  4YON A;  1P6S A;  1V5P A;  3A8P A;  3N7C A;  1K5G B;  2CRF A;  2EMT A;  2GS0 A;  5FI1 A;  1X1G A;  3TW1 A;  5EFX A;  2AEH A;  2CY5 A;  2VRW B;  5LOP B;  1U29 A;  1SHC A;  1DBH A;  4ZRI A;  5LON B;  2E2X A;  2DLW A;  3VIA A;  2I1K A;  3D8E A;  1X86 A;  4HAU B;  2YSZ A;  3WYF B;  4HAX B;  3CXB B;  3PP2 A;  1GG3 A;  5D3X A;  2MDX A;  5CLQ B;  2I5C A;  1XKE A;  1MIZ B;  1M7E A;  3P6A A;  3QBV B;  2RLO A;  3O96 A;  2D10 A;  3U7D A;  3FEH A;  1LB1 A;  3GYO A;  3PG7 A;  4DXA B;  3KRW A;  2J59 M;  2D9Z A;  4GN1 A;  1J0W A;  1AWE A;  2UZS A;  4HAZ B;  4HAT B;  3TFM A;  2KUP A;  1U27 A;  4A6F A;  1TQZ A;  2GCJ A;  4HDQ A;  1MAI A;  1UNQ A;  3PEG A;  3UZT A;  3ZVR A;  3CIK A;  3M1I B;  2COF A;  5HE2 A;  3PVL A;  4EMO A;  4IFS A;  3KZ1 A;  2YVC A;  2D4Q A;  5KQ4 A;  5C79 A;  1NTY A;  2D9W A;  2Z0P A;  3TO1 A;  1BAK A;  3F0W A;  2VKI A;  3HQC A;  3VOQ A;  1M7R A;  2VSZ A;  1UEF A;  2G35 A;  1BWN A;  4DX9 0;  1K5D B;  2Y7B A;  4L6E A;  4P7I A;  2HTH B;  4MT7 A;  1P3R A;  1ZVR A;  1X1F A;  2M38 A;  2P0D A;  1ISN A;  2COD A;  5D3W A;  2ELA A;  1U5E A;  2QKM A;  1X11 A;  4HHV A;  1XOD A;  1XD4 A;  2ADZ A;  4A6F B;  1E5W A;  1U5D A;  2ZPY A;  2EMS A;  3AJ4 A;  2YS1 A;  4C0A A;  3PVW A;  4PQ0 A;  1QQG A;  1X05 A;  1MKE A;  2DFK A;  4XWX A;  5KQ1 A;  1DRO A;  1N3H A;  2JP2 A;  3AU5 A;  5HE1 A;  2NZ8 B;  1V89 A;  3F5R A;  1PMS A;  1SGH A;  2UZR A;  3ODO A;  5C16 A;  2MFQ A;  2RUK B;  2NMB A;  4HDO A;  2OTX A;  1V61 A;  4D0N B;  1NU2 A;  1W1G A;  1ZM0 A;  2DX1 A;  3RCP A;  3DXD A;  4GXB A;  1WI1 A;  4HB2 B;  4A6H A;  1H10 A;  1FGZ A;  1U2B A;  2Y8G A;  4IOY X;  1XCG A;  3SO6 A;  3SNH A;  2COC A;  5FI0 A;  1WJM A;  1U5G A;  1UNP A;  3T06 A;  2LOZ A;  4NSW A;  3FM8 C;  1RRP B;  3PSC A;  1FGY A;  4B6H A;  1W1H A;  4MY6 A;  1FHW A;  2YT0 A;  5J3Q A;  3D8D A;  1I7A A;  2D9V A;  1TJ6 A;  2IFS A;  1H4R A;  2ELB A;  1XR0 B;  5JP4 A;  2DKQ A;  2I1J A;  4DX8 A;  2XQN M;  2FJL A;  1OMW A;  3TVV A;  2Z0Q A;  2DYN A;  4GZU A;  1AQC A;  3TCA A;  1IRS A;  2IYB A;  3BIN A;  2N0Y A;  2R0D A;  1EAZ A;  1WGU A;  4GPT B;  2HE7 A;  2OQB A;  2DX5 A;  1LW3 A;  2LUL A;  1RJ2 A;  1NTV A;  5GOW B;  5D3Y A;  5DHA B;  4HAV B;  4K2O A;  4HB4 B;  3PZD A;  5J3Y A;  3QWM A;  4F7G A;  4ZRJ A;  3U8Z A;  1MPH A;  4EJN A;  4K17 A;  4Y94 A;  2D11 A;  3KY9 A;  4Z2M B;  1BTN A;  3D8F A;  2L1C A;  1KZG A;  3HW2 B;  1J19 A;  1WG7 A;  2CY4 A;  5C6R A;  4HB3 B;  2DA0 A;  3MDB C;  5DIF B;  4IAP A;  1V88 A;  3SYX A;  4F7H A;  2I5F A;  4Z2N A;  2LKO A;  3AU4 A;  2LYD A;  2RVB B;  4K81 A;  2EC1 A;  1EF1 A;  3QIJ A;  2P0F A;  2D2Q A;  5L81 A;  1V5M A;  2J0J A;  2M14 A;  2D9X A;  3G9W A;  2DHI A;  1BTK A;  3PVU A;  3LJU X;  2K2U A;  2V76 A;  4YL8 A;  1OY2 A;  2K00 A;  1ZSQ A;  2YT1 A;  4KVG B;  1MIX A;  1KZ7 A;  3ODX A;  5KCV A;  3OAN A;  3ZDT A;  2P0H A;  3NSU A;  4F7U P;  1WVH A;  5JLJ B;  5HE0 A;  1XX0 A;  2DYQ A;  4HAY B;  4A6K A;  1FB8 A;  2ROZ B;  3KSY A;  2AL6 A;  3BJI A;  2ROV A;  2BCJ A;  2H7E A;  2RNR B;  3HK0 A;  1PLS A;  2J0M A;  1UNR A;  1EVH A;  1ZC3 B;  2KCJ A;  3MPX A;  1W1D A;  4K2P A;  1ZC4 B;  4HB0 B;  2K2J A;  4KHA A;  3KRX A;  2Q13 A;  5C5B A;  1DDM A;  2GJY A;  2N23 A;  3DXC A;  3SUZ A;  1FAO A;  4GMV A;  2UVM A;  5J3T A;  4WSF A;  2DHK A;  3ML4 A;  2MWN B;  2EJ8 A;  5D27 A;  1OQN A;  1WGQ A;  3DXE A;  5DI9 B;  4TYZ A;  2DN6 A;  5DH9 B;  3A8Q A;  2W2X D;  1DDV A;  1Z87 A;  2Z0O A;  3X23 A;  3IVF A;  1DYN A;  1P5T A;  4WJ7 A;  1Y19 B;  3V5W A;  4DBB A;  4KHB B;  4TKN A;  4HAW B;  1DDW A;  3GYP A;  5JHG A;  2LOX A;  2DTC A; 
#chains in the Genus database with same CATH topology
 1MK9 B;  2LG1 A;  1FHX A;  2YS3 A;  1TXD A;  4CHJ A;  1Y5O A;  3WA0 A;  1Q67 A;  5HE3 A;  3ULB A;  1FOE A;  2COA A;  1I2H A;  1FHO A;  2H7D A;  1ZYI A;  5C5B B;  4A5K A;  4KHO A;  1EGX A;  4NY0 A;  4WVF B;  4MK0 A;  2J0K A;  1PFJ A;  2ZKM X;  1GC6 A;  2DKP A;  2YF0 A;  1UPR A;  4H8S A;  1NI2 A;  2KGX B;  2CAY A;  2MKR A;  2GCL A;  2P8V A;  2W2W A;  4BBK A;  5D3V A;  1MI1 A;  1WJ1 A;  2R09 A;  4OT1 A;  4ZRK A;  1GC7 A;  3FSS A;  1B55 A;  4KAX B;  5DHF B;  1V5U A;  2QKL A;  3ODW A;  3ULC A;  3A98 B;  4PNK A;  2W2X C;  2YRY A;  5JHH A;  5CLL B;  2DHJ A;  3HIE A;  2D9Y A;  3HSA A;  4CHM A;  3P7Z A;  1UPQ A;  4EKU A;  3NWF A;  2RSG A;  1MK7 B;  2FJU B;  2YT2 A;  2YS5 A;  3SV1 A;  2L2I A;  4QJ3 B;  1QC6 A;  1U5F A;  1KI1 B;  4GMX B;  2RGN B;  4KHB A;  2Y8F A;  2KIE A;  2PZ1 A;  4CYE A;  2X18 A;  4YON A;  1P6S A;  3A8P A;  1V5P A;  1K5G B;  2CRF A;  2EMT A;  2GS0 A;  3N7C A;  5FI1 A;  1X1G A;  3TW1 A;  5EFX A;  2AEH A;  2CY5 A;  3NW8 A;  2VRW B;  5LOP B;  1U29 A;  1SHC A;  1DBH A;  4ZRI A;  5LON B;  2E2X A;  2DLW A;  3VIA A;  2I1K A;  2K8E A;  3D8E A;  3NWA A;  1X86 A;  4HAU B;  2YSZ A;  3WYF B;  4HAX B;  3CXB B;  3PP2 A;  1GG3 A;  5D3X A;  2MDX A;  5CLQ B;  2I5C A;  1XKE A;  1MIZ B;  1M7E A;  3P6A A;  3QBV B;  2RLO A;  3O96 A;  2D10 A;  3U7D A;  3FEH A;  1LB1 A;  3GYO A;  3PG7 A;  4DXA B;  3KRW A;  5M4Y B;  2J59 M;  2Z59 A;  2D9Z A;  4GN1 A;  4OSN A;  1J0W A;  3FVC A;  2UZS A;  1AWE A;  4HAZ B;  4HAT B;  3TFM A;  2KUP A;  1U27 A;  4A6F A;  1TQZ A;  2GCJ A;  4HDQ A;  1MAI A;  1UNQ A;  3PEG A;  3UZT A;  3ZVR A;  3CIK A;  3M1I B;  2COF A;  5HE2 A;  3PVL A;  4EMO A;  4IFS A;  3KZ1 A;  2YVC A;  2D4Q A;  5KQ4 A;  5C79 A;  1NTY A;  2D9W A;  2Z0P A;  3TO1 A;  1BAK A;  5I2S A;  3F0W A;  2VKI A;  3HQC A;  3VOQ A;  4QJ5 B;  1M7R A;  2VSZ A;  3OHM B;  3A58 A;  2R2Y A;  5I2M A;  1UEF A;  2G35 A;  1BWN A;  4DX9 0;  1K5D B;  2Y7B A;  4L6E A;  2RRF A;  4P7I A;  2HTH B;  4MT7 A;  1P3R A;  1ZVR A;  1X1F A;  2M38 A;  2P0D A;  2Z13 A;  1ISN A;  2COD A;  5D3W A;  2ELA A;  1U5E A;  2QKM A;  1X11 A;  4HHV A;  1XOD A;  1XD4 A;  2ADZ A;  4A6F B;  1E5W A;  1U5D A;  2ZPY A;  2EMS A;  3AJ4 A;  2YS1 A;  4C0A A;  5IRS A;  3PVW A;  4GNK B;  4PQ0 A;  1QQG A;  1X05 A;  1MKE A;  2DFK A;  4XWX A;  5KQ1 A;  1DRO A;  2NBV A;  1N3H A;  2JP2 A;  3AU5 A;  4QXA B;  5HE1 A;  2NZ8 B;  1V89 A;  3F5R A;  1PMS A;  1SGH A;  2UZR A;  3ODO A;  5C16 A;  2MFQ A;  2RUK B;  2NMB A;  4HSI A;  4HDO A;  2OTX A;  1V61 A;  4D0N B;  1NU2 A;  1W1G A;  1ZM0 A;  2DX1 A;  3RCP A;  3DXD A;  4GXB A;  1WI1 A;  4HB2 B;  4A6H A;  1H10 A;  1FGZ A;  3B77 A;  1U2B A;  2Y8G A;  4IOY X;  1XCG A;  3SO6 A;  3SNH A;  2COC A;  5FI0 A;  1WJM A;  1U5G A;  1UNP A;  3T06 A;  2LOZ A;  4NSW A;  3FM8 C;  1RRP B;  3PSC A;  1FGY A;  4B6H A;  1W1H A;  4DIX A;  4MY6 A;  1FHW A;  2YT0 A;  2KR0 A;  5J3Q A;  3D8D A;  1I7A A;  2D9V A;  1TJ6 A;  2IFS A;  1H4R A;  2ELB A;  1XR0 B;  5JP4 A;  2DKQ A;  3DCX A;  2I1J A;  4DX8 A;  2XQN M;  2FJL A;  1OMW A;  3TVV A;  2Z0Q A;  2DYN A;  4GZU A;  1AQC A;  3TCA A;  1IRS A;  2IYB A;  3BIN A;  2N0Y A;  2R0D A;  1EAZ A;  1WGU A;  4GPT B;  2HE7 A;  2OQB A;  2DX5 A;  1LW3 A;  2KIG A;  2LUL A;  1RJ2 A;  1NTV A;  5GOW B;  5D3Y A;  5DHA B;  4HAV B;  4K2O A;  4HB4 B;  4GOU A;  3PZD A;  5J3Y A;  3QWM A;  4CSQ A;  4F7G A;  2K49 A;  4ZRJ A;  3U8Z A;  1MPH A;  4EJN A;  4K17 A;  2Z4D A;  4QJ4 B;  4Y94 A;  2D11 A;  3KY9 A;  4Z2M B;  1BTN A;  3D8F A;  2L1C A;  1KZG A;  3HW2 B;  1J19 A;  1WG7 A;  2CY4 A;  5C6R A;  4HB3 B;  2DA0 A;  3MDB C;  5DIF B;  4IAP A;  1V88 A;  3SYX A;  4F7H A;  2I5F A;  4Z2N A;  2LKO A;  3AU4 A;  2LYD A;  2RVB B;  4K81 A;  2EC1 A;  1EF1 A;  3QIJ A;  2GUM A;  2P0F A;  2D2Q A;  5L81 A;  1V5M A;  2J0J A;  2M14 A;  2D9X A;  3G9W A;  2DHI A;  1BTK A;  3PVU A;  3LJU X;  2K2U A;  2V76 A;  4YL8 A;  1OY2 A;  2K00 A;  1ZSQ A;  2YT1 A;  4KVG B;  1MIX A;  1KZ7 A;  3ODX A;  5KCV A;  3OAN A;  3ZDT A;  2P0H A;  3NSU A;  4F7U P;  1WVH A;  5JLJ B;  5HE0 A;  1XX0 A;  2DYQ A;  4HAY B;  4A6K A;  1FB8 A;  2ROZ B;  3NWD A;  3KSY A;  2AL6 A;  3BJI A;  2ROV A;  2BCJ A;  2H7E A;  2RNR B;  3HK0 A;  1PLS A;  2J0M A;  1UNR A;  1EVH A;  2Z14 A;  1ZC3 B;  2KCJ A;  3MPX A;  1W1D A;  4K2P A;  1ZC4 B;  4HB0 B;  2K2J A;  4KHA A;  3KRX A;  4L1R A;  2Q13 A;  5C5B A;  1DDM A;  2GJY A;  2N23 A;  3DXC A;  3SUZ A;  1FAO A;  4GMV A;  2UVM A;  5J3T A;  4WSF A;  2DHK A;  1T77 A;  3ML4 A;  2MWN B;  2EJ8 A;  5D27 A;  1OQN A;  1WGQ A;  3DXE A;  5DI9 B;  4TYZ A;  2DN6 A;  5DH9 B;  3A8Q A;  2W2X D;  1DDV A;  1Z87 A;  2Z0O A;  3X23 A;  3U12 A;  3IVF A;  1DYN A;  1P5T A;  2KUQ A;  4WJ7 A;  1Y19 B;  3V5W A;  4DBB A;  4KHB B;  4TKN A;  4HAW B;  1DDW A;  3GYP A;  4D6W A;  5LG4 B;  5JHG A;  2LOX A;  2DTC A; 
#chains in the Genus database with same CATH homology
 1MK9 B;  2LG1 A;  1FHX A;  2YS3 A;  1TXD A;  4CHJ A;  1Y5O A;  3WA0 A;  1Q67 A;  5HE3 A;  3ULB A;  1FOE A;  2COA A;  1I2H A;  1FHO A;  2H7D A;  4A5K A;  5C5B B;  4KHO A;  1EGX A;  4NY0 A;  4WVF B;  4MK0 A;  2J0K A;  1PFJ A;  1GC6 A;  2DKP A;  2YF0 A;  1UPR A;  4H8S A;  1NI2 A;  2KGX B;  2CAY A;  2MKR A;  2GCL A;  2P8V A;  2W2W A;  4BBK A;  5D3V A;  1WJ1 A;  2R09 A;  4ZRK A;  1GC7 A;  3FSS A;  1B55 A;  4KAX B;  5DHF B;  1V5U A;  2QKL A;  3ODW A;  3ULC A;  3A98 B;  4PNK A;  2W2X C;  2YRY A;  5JHH A;  5CLL B;  2DHJ A;  2D9Y A;  4CHM A;  3P7Z A;  1UPQ A;  4EKU A;  2RSG A;  1MK7 B;  2YS5 A;  3SV1 A;  2L2I A;  1QC6 A;  1U5F A;  1KI1 B;  4GMX B;  2RGN B;  2Y8F A;  2PZ1 A;  4CYE A;  2X18 A;  4YON A;  1P6S A;  1V5P A;  3A8P A;  3N7C A;  1K5G B;  2CRF A;  2EMT A;  2GS0 A;  5FI1 A;  1X1G A;  3TW1 A;  5EFX A;  2AEH A;  2CY5 A;  2VRW B;  5LOP B;  1U29 A;  1SHC A;  1DBH A;  4ZRI A;  5LON B;  2E2X A;  2DLW A;  3VIA A;  2I1K A;  3D8E A;  1X86 A;  4HAU B;  2YSZ A;  3WYF B;  4HAX B;  3CXB B;  3PP2 A;  1GG3 A;  5D3X A;  2MDX A;  5CLQ B;  2I5C A;  1XKE A;  1MIZ B;  1M7E A;  3P6A A;  3QBV B;  2RLO A;  3O96 A;  2D10 A;  3U7D A;  3FEH A;  1LB1 A;  3GYO A;  3PG7 A;  4DXA B;  3KRW A;  2J59 M;  2D9Z A;  4GN1 A;  1J0W A;  1AWE A;  2UZS A;  4HAZ B;  4HAT B;  3TFM A;  2KUP A;  1U27 A;  4A6F A;  1TQZ A;  2GCJ A;  4HDQ A;  1MAI A;  1UNQ A;  3PEG A;  3UZT A;  3ZVR A;  3CIK A;  3M1I B;  2COF A;  5HE2 A;  3PVL A;  4EMO A;  4IFS A;  3KZ1 A;  2YVC A;  2D4Q A;  5KQ4 A;  5C79 A;  1NTY A;  2D9W A;  2Z0P A;  3TO1 A;  1BAK A;  3F0W A;  2VKI A;  3HQC A;  3VOQ A;  1M7R A;  2VSZ A;  1UEF A;  2G35 A;  1BWN A;  4DX9 0;  1K5D B;  2Y7B A;  4L6E A;  4P7I A;  2HTH B;  4MT7 A;  1P3R A;  1ZVR A;  1X1F A;  2M38 A;  2P0D A;  1ISN A;  2COD A;  5D3W A;  2ELA A;  1U5E A;  2QKM A;  1X11 A;  4HHV A;  1XOD A;  1XD4 A;  2ADZ A;  4A6F B;  1E5W A;  1U5D A;  2ZPY A;  2EMS A;  3AJ4 A;  2YS1 A;  4C0A A;  3PVW A;  4PQ0 A;  1QQG A;  1X05 A;  1MKE A;  2DFK A;  4XWX A;  5KQ1 A;  1DRO A;  1N3H A;  2JP2 A;  3AU5 A;  5HE1 A;  2NZ8 B;  1V89 A;  3F5R A;  1PMS A;  1SGH A;  2UZR A;  3ODO A;  5C16 A;  2MFQ A;  2RUK B;  2NMB A;  4HDO A;  2OTX A;  1V61 A;  4D0N B;  1NU2 A;  1W1G A;  1ZM0 A;  2DX1 A;  3RCP A;  3DXD A;  4GXB A;  1WI1 A;  4HB2 B;  4A6H A;  1H10 A;  1FGZ A;  1U2B A;  2Y8G A;  4IOY X;  1XCG A;  3SO6 A;  3SNH A;  2COC A;  5FI0 A;  1WJM A;  1U5G A;  1UNP A;  3T06 A;  2LOZ A;  4NSW A;  3FM8 C;  1RRP B;  3PSC A;  1FGY A;  4B6H A;  1W1H A;  4MY6 A;  1FHW A;  2YT0 A;  5J3Q A;  3D8D A;  1I7A A;  2D9V A;  1TJ6 A;  2IFS A;  1H4R A;  2ELB A;  1XR0 B;  5JP4 A;  2DKQ A;  2I1J A;  4DX8 A;  2XQN M;  2FJL A;  1OMW A;  3TVV A;  2Z0Q A;  2DYN A;  4GZU A;  1AQC A;  3TCA A;  1IRS A;  2IYB A;  3BIN A;  2N0Y A;  2R0D A;  1EAZ A;  1WGU A;  4GPT B;  2HE7 A;  2OQB A;  2DX5 A;  1LW3 A;  2LUL A;  1RJ2 A;  1NTV A;  5GOW B;  5D3Y A;  5DHA B;  4HAV B;  4K2O A;  4HB4 B;  3PZD A;  5J3Y A;  3QWM A;  4F7G A;  4ZRJ A;  3U8Z A;  1MPH A;  4EJN A;  4K17 A;  4Y94 A;  2D11 A;  3KY9 A;  4Z2M B;  1BTN A;  3D8F A;  2L1C A;  1KZG A;  3HW2 B;  1J19 A;  1WG7 A;  2CY4 A;  5C6R A;  4HB3 B;  2DA0 A;  3MDB C;  5DIF B;  4IAP A;  1V88 A;  3SYX A;  4F7H A;  2I5F A;  4Z2N A;  2LKO A;  3AU4 A;  2LYD A;  2RVB B;  4K81 A;  2EC1 A;  1EF1 A;  3QIJ A;  2P0F A;  2D2Q A;  5L81 A;  1V5M A;  2J0J A;  2M14 A;  2D9X A;  3G9W A;  2DHI A;  1BTK A;  3PVU A;  3LJU X;  2K2U A;  2V76 A;  4YL8 A;  1OY2 A;  2K00 A;  1ZSQ A;  2YT1 A;  4KVG B;  1MIX A;  1KZ7 A;  3ODX A;  5KCV A;  3OAN A;  3ZDT A;  2P0H A;  3NSU A;  4F7U P;  1WVH A;  5JLJ B;  5HE0 A;  1XX0 A;  2DYQ A;  4HAY B;  4A6K A;  1FB8 A;  2ROZ B;  3KSY A;  2AL6 A;  3BJI A;  2ROV A;  2BCJ A;  2H7E A;  2RNR B;  3HK0 A;  1PLS A;  2J0M A;  1UNR A;  1EVH A;  1ZC3 B;  2KCJ A;  3MPX A;  1W1D A;  4K2P A;  1ZC4 B;  4HB0 B;  2K2J A;  4KHA A;  3KRX A;  2Q13 A;  5C5B A;  1DDM A;  2GJY A;  2N23 A;  3DXC A;  3SUZ A;  1FAO A;  4GMV A;  2UVM A;  5J3T A;  4WSF A;  2DHK A;  3ML4 A;  2MWN B;  2EJ8 A;  5D27 A;  1OQN A;  1WGQ A;  3DXE A;  5DI9 B;  4TYZ A;  2DN6 A;  5DH9 B;  3A8Q A;  2W2X D;  1DDV A;  1Z87 A;  2Z0O A;  3X23 A;  3IVF A;  1DYN A;  1P5T A;  4WJ7 A;  1Y19 B;  3V5W A;  4DBB A;  4KHB B;  4TKN A;  4HAW B;  1DDW A;  3GYP A;  5JHG A;  2LOX A;  2DTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...