1MKEA

Structure of the n-wasp evh1 domain-wip complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
144
structure length
144
Chain Sequence
DLPPPEPYVQTTKSYPSKLARNESRGSGSGSLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-WASP EVH1 Domain-WIP Complex. Insight into the Molecular Basis of Wiskott-Aldrich Syndrome.
pubmed doi rcsb
source organism Rattus norvegicus, homo sapiens
molecule tags Protein binding
molecule keywords Fusion protein consisting of Wiskott-Aldrich syndrome protei
total genus 15
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mkeA00
4CYEA 3PVWA 2D9YA 5KCVA 2UZRA 2GCLA 5EFXA 2D9VA 1SHCA 2COFA 3ML4A 5JHHA 1M7EA 3HQCA 1QC6A 5DHFB 5C16A 4K81A 2YT0A 2RLOA 4CHJA 3HW2B 2DTCA 1ISNA 1MK7B 2LKOA 2Y8FA 2N23A 3A8QA 1K5GB 3ODWA 2PZ1A 4HB0B 1DBHA 3PVLA 4KVGB 1MIZB 5C5BB 3V5WA 2Z0QA 2BCJA 3MPXA 3ULBA 4HAWB 3PSCA 2LULA 1Y5OA 5JHGA 1WG7A 2OTXA 2CODA 2YVCA 1WJ1A 2DYQA 2GJYA 5GOWB 1X86A 3ULCA 1RRPB 2DKPA 3PP2A 4HDQA 4EJNA 5LONB 2V76A 3P6AA 2XQNM 1ZM0A 1EGXA 1AWEA 4HAZB 3KSYA 5L81A 2LYDA 1W1DA 1V61A 2D10A 2Y8GA 4K2PA 4ZRJA 1TJ6A 3X23A 1U2BA 1Z87A 3SNHA 4BBKA 3U7DA 4B6HA 4HAVB 1X1FA 2Z0PA 4F7UP 1H10A 1KZGA 4HB2B 2OQBA 2KUPA 4HAXB 3TFMA 2EMSA 2RNRB 2DHJA 2YRYA 1NTVA 1ZSQA 1J0WA 3BINA 5CLQB 2D9WA 4KAXB 5DHAB 3PZDA 1UNQA 1WI1A 1UEFA 1DDWA 3WA0A 2AL6A 1UNRA 1BWNA 2COCA 2ZPYA 4A6HA 2LOXA 3NSUA 3CXBB 5J3QA 2I5FA 5FI1A 4MY6A 1X05A 4A6FA 1E5WA 3D8DA 5C5BA 1N3HA 4GN1A 3SUZA 2RSGA 1MIXA 2YS3A 2VKIA 1EVHA 4HDOA 3IVFA 3KZ1A 1XCGA 3SV1A 1DYNA 3PG7A 1OQNA 3OANA 2EMTA 2HE7A 2I1JA 3DXEA 3FM8C 2DLWA 1XR0B 2YT1A 1FOEA 3D8FA 2CRFA 2ELAA 1MK9B 2DA0A 4MK0A 1PFJA 2Y7BA 2DHKA 3ODXA 4YL8A 1UPQA 4DBBA 4ZRIA 3AU5A 2UVMA 3CIKA 1OMWA 1EAZA 3PEGA 3KRXA 5J3YA 2W2XD 1M7RA 5C79A 2AEHA 1WJMA 1BTKA 1TQZA 2NZ8B 2Z0OA 4GPTB 3DXDA 2KGXB 2EJ8A 2QKLA 2H7EA 4P7IA 2P0DA 4XWXA 1V5PA 1WGUA 2VRWB 3QIJA 3TVVA 1ZVRA 5KQ4A 4HB3B 1AQCA 4YONA 2J0JA 5LOPB 4A5KA 3LJUX 4EMOA 4DX90 3DXCA 1U29A 1PLSA 3ZDTA 4C0AA 2YS1A 2DX5A 5JLJB 5J3TA 5DIFB 1B55A 2ROZB 2M14A 2DHIA 1W1HA 2DN6A 2D4QA 3SO6A 1MKEA 2MFQA 1X11A 2YS5A 2D2QA 4GMXB 1IRSA 4TYZA 2IYBA 3UZTA 1OY2A 5HE1A 4DX8A 4NSWA 1XX0A 5D3YA 1KZ7A 1FB8A 2RGNB 2YSZA 4ZRKA 1LW3A 1V5MA 1V5UA 3D8EA 5HE3A 2G35A 3QWMA 4HHVA 4NY0A 1U5GA 2GS0A 1GG3A 4WVFB 4KHAA 5FI0A 2M38A 1QQGA 3VOQA 3QBVB 1X1GA 1NU2A 2MWNB 3ODOA 5HE0A 4PNKA 1U5DA 1K5DB 2HTHB 2P0HA 4A6FB 4HB4B 2VSZA 2I5CA 2H7DA 3O96A 3TO1A 1KI1B 4KHBB 5JP4A 2ROVA 3A8PA 1MPHA 1UNPA 2J0MA 1UPRA 3FSSA 1P3RA 2I1KA 3AJ4A 2K00A 4IOYX 3P7ZA 1XODA 1Q67A 1BTNA 1ZC3B 5D3VA 4D0NB 2DKQA 4K2OA 2P0FA 3FEHA 1FGYA 2ADZA 4MT7A 1WGQA 2MDXA 2P8VA 3KY9A 2DFKA 2FJLA 4H8SA 1GC7A 1U27A 1DDMA 2LG1A 3F5RA 3PVUA 4WSFA 2RVBB 2MKRA 2R09A 1WVHA 3G9WA 4WJ7A 3WYFB 1XKEA 4Z2MB 1W1GA 5HE2A 2NMBA 2CAYA 3MDBC 2CY5A 2LOZA 5DI9B 3ZVRA 4DXAB 1ZC4B 2K2UA 1XD4A 1FHWA 1RJ2A 3RCPA 2L1CA 2RUKB 4Z2NA 1P6SA 5KQ1A 1U5FA 2J59M 1H4RA 2W2WA 2R0DA 2UZSA 1MAIA 3VIAA 3TW1A 3HK0A 3U8ZA 4Y94A 2KCJA 2ELBA 4PQ0A 4KHOA 5D3WA 4IFSA 1LB1A 4L6EA 4GXBA 3F0WA 2QKMA 3TCAA 1FGZA 1FHOA 2E2XA 2W2XC 1BAKA 1Y19B 2D11A 4F7GA 5CLLB 2YF0A 4A6KA 3SYXA 2D9ZA 5D27A 5D3XA 1U5EA 1V88A 3A98B 4HATB 4F7HA 1TXDA 1SGHA 3GYOA 2X18A 4GMVA 5C6RA 2DX1A 2L2IA 4TKNA 2J0KA 4GZUA 2IFSA 2Q13A 1PMSA 3N7CA 4K17A 2COAA 3GYPA 4CHMA 2DYNA 4IAPA 3T06A 1I2HA 3KRWA 1J19A 1NI2A 1P5TA 1DDVA 5DH9B 1FAOA 2CY4A 1DROA 2K2JA 2N0YA 3BJIA 1V89A 2GCJA 3M1IB 4HAUB 1I7AA 1FHXA 2EC1A 4HAYB 3AU4A 1NTYA 2D9XA 1GC6A 4EKUA 2JP2A 1EF1A
chains in the Genus database with same CATH superfamily
4CYEA 3NWDA 3PVWA 2D9YA 5KCVA 2UZRA 2GCLA 5EFXA 2D9VA 1SHCA 5LG4B 2COFA 3ML4A 5JHHA 1M7EA 3HQCA 1QC6A 5DHFB 5C16A 4K81A 2YT0A 1T77A 2RLOA 4CHJA 3HW2B 1ZYIA 2DTCA 3DCXA 1ISNA 1MK7B 2LKOA 2KUQA 2Y8FA 2N23A 3A8QA 1K5GB 3ODWA 2PZ1A 4HB0B 1DBHA 3PVLA 4KVGB 1MIZB 5C5BB 3V5WA 2Z0QA 2BCJA 3MPXA 5I2SA 3ULBA 4HAWB 4QJ3B 3PSCA 2LULA 1Y5OA 5JHGA 1WG7A 2OTXA 2CODA 2YVCA 1WJ1A 2DYQA 2GJYA 5GOWB 1X86A 3ULCA 1RRPB 2DKPA 3PP2A 2K49A 4HDQA 4EJNA 5LONB 2V76A 3P6AA 2XQNM 2NBVA 1ZM0A 1EGXA 1AWEA 4HAZB 3KSYA 4QJ4B 5L81A 2LYDA 1W1DA 1V61A 2D10A 2Y8GA 4K2PA 4ZRJA 1TJ6A 3X23A 1U2BA 1Z87A 3SNHA 4BBKA 3U7DA 4B6HA 5IRSA 4HAVB 1X1FA 2Z0PA 2YT2A 4F7UP 1H10A 1KZGA 4HB2B 2OQBA 2KUPA 4HAXB 3TFMA 2EMSA 2RNRB 2DHJA 2YRYA 1NTVA 1ZSQA 1J0WA 3BINA 4GNKB 4OSNA 5I2MA 5CLQB 2Z14A 2D9WA 4HSIA 4KAXB 5DHAB 3PZDA 1UNQA 1WI1A 1UEFA 1DDWA 3OHMB 3WA0A 2AL6A 1UNRA 1BWNA 2COCA 2ZPYA 4A6HA 2LOXA 3NSUA 3CXBB 5J3QA 2I5FA 5FI1A 4MY6A 1X05A 4A6FA 1E5WA 3D8DA 5C5BA 1N3HA 4GN1A 3SUZA 2RSGA 1MIXA 2YS3A 2VKIA 1EVHA 4HDOA 3IVFA 4QXAB 3KZ1A 1XCGA 3SV1A 1DYNA 3PG7A 2KIEA 1OQNA 3OANA 2EMTA 2HE7A 2I1JA 3DXEA 3FM8C 2DLWA 1XR0B 2YT1A 1FOEA 3D8FA 2CRFA 2ELAA 1MK9B 2DA0A 4MK0A 1PFJA 2Y7BA 2DHKA 3ODXA 4YL8A 1UPQA 4DBBA 4ZRIA 3AU5A 2UVMA 2Z13A 4L1RA 3CIKA 1OMWA 1EAZA 3PEGA 3KRXA 5J3YA 2W2XD 1M7RA 2Z59A 5C79A 2AEHA 1WJMA 1BTKA 1TQZA 2NZ8B 2Z0OA 4GPTB 3DXDA 2KGXB 2EJ8A 2QKLA 2H7EA 4P7IA 2P0DA 4XWXA 1V5PA 1WGUA 2VRWB 3QIJA 3TVVA 1ZVRA 5KQ4A 4HB3B 1AQCA 4YONA 2J0JA 5LOPB 4A5KA 3LJUX 4EMOA 4DX90 3DXCA 1U29A 1PLSA 3FVCA 3ZDTA 2KIGA 2YS1A 4C0AA 2DX5A 5JLJB 5J3TA 5DIFB 1B55A 2ROZB 3HIEA 2M14A 2DHIA 1W1HA 2DN6A 2D4QA 3SO6A 1MKEA 2MFQA 1X11A 2YS5A 2D2QA 4GMXB 1IRSA 4OT1A 4TYZA 2IYBA 3UZTA 1OY2A 5HE1A 4DX8A 4NSWA 1XX0A 5D3YA 1KZ7A 3U12A 1FB8A 2RGNB 2YSZA 4ZRKA 1LW3A 1V5MA 2GUMA 1V5UA 3D8EA 5HE3A 2G35A 3QWMA 4HHVA 4NY0A 1U5GA 2GS0A 1GG3A 4WVFB 4KHAA 5FI0A 2M38A 1QQGA 3VOQA 3QBVB 1X1GA 2K8EA 1NU2A 2MWNB 3ODOA 5HE0A 4PNKA 1U5DA 1K5DB 2HTHB 2P0HA 4A6FB 4HB4B 4KHBA 2VSZA 2I5CA 2H7DA 3O96A 3NWFA 3TO1A 2R2YA 1KI1B 4KHBB 5JP4A 2ROVA 3A8PA 1MPHA 1UNPA 2J0MA 1UPRA 3FSSA 1P3RA 2I1KA 3AJ4A 2K00A 4IOYX 3P7ZA 1XODA 2KR0A 1Q67A 1BTNA 1ZC3B 5D3VA 3HSAA 4D0NB 2RRFA 2DKQA 4K2OA 2P0FA 3FEHA 1FGYA 2ADZA 4MT7A 4CSQA 1WGQA 2MDXA 2FJUB 2P8VA 3KY9A 2DFKA 2FJLA 4H8SA 4QJ5B 1GC7A 1U27A 1DDMA 3A58A 2LG1A 3F5RA 3PVUA 4WSFA 2RVBB 2MKRA 2R09A 1WVHA 3G9WA 4WJ7A 3WYFB 1XKEA 4Z2MB 1W1GA 5HE2A 2NMBA 2CAYA 3MDBC 2CY5A 2LOZA 5DI9B 3ZVRA 4DXAB 1ZC4B 2K2UA 1XD4A 1FHWA 1RJ2A 3RCPA 2L1CA 2RUKB 4Z2NA 1P6SA 5KQ1A 1U5FA 2J59M 4GOUA 1H4RA 2W2WA 2R0DA 2UZSA 1MAIA 3VIAA 3TW1A 3HK0A 3U8ZA 4Y94A 2KCJA 2ELBA 4PQ0A 4KHOA 5D3WA 4IFSA 3B77A 1LB1A 3NWAA 4L6EA 4DIXA 4GXBA 3F0WA 2QKMA 3TCAA 1FGZA 1FHOA 2E2XA 2W2XC 1BAKA 1Y19B 2D11A 4F7GA 5CLLB 2YF0A 4A6KA 3SYXA 2D9ZA 5D27A 5D3XA 4D6WA 1U5EA 1V88A 3A98B 4HATB 4F7HA 1TXDA 1MI1A 1SGHA 3GYOA 2X18A 4GMVA 5C6RA 2DX1A 2L2IA 4TKNA 2J0KA 4GZUA 2IFSA 2Q13A 1PMSA 3N7CA 4K17A 2COAA 3GYPA 4CHMA 2ZKMX 2DYNA 4IAPA 2Z4DA 3T06A 1I2HA 3KRWA 1J19A 1NI2A 1P5TA 1DDVA 5DH9B 1FAOA 2CY4A 1DROA 2K2JA 3NW8A 3BJIA 2N0YA 1V89A 2GCJA 3M1IB 4HAUB 1I7AA 5M4YB 1FHXA 2EC1A 4HAYB 3AU4A 1NTYA 2D9XA 1GC6A 4EKUA 2JP2A 1EF1A
chains in the Genus database with same CATH topology
4CYEA 3PVWA 2D9YA 5KCVA 2UZRA 2GCLA 5EFXA 2D9VA 1SHCA 2COFA 3ML4A 5JHHA 1M7EA 3HQCA 1QC6A 5DHFB 5C16A 4K81A 2YT0A 2RLOA 4CHJA 3HW2B 2DTCA 1ISNA 1MK7B 2LKOA 2Y8FA 2N23A 3A8QA 1K5GB 3ODWA 2PZ1A 4HB0B 1DBHA 3PVLA 4KVGB 1MIZB 5C5BB 3V5WA 2Z0QA 2BCJA 3MPXA 3ULBA 4HAWB 3PSCA 2LULA 1Y5OA 5JHGA 1WG7A 2OTXA 2CODA 2YVCA 1WJ1A 2DYQA 2GJYA 5GOWB 1X86A 3ULCA 1RRPB 2DKPA 3PP2A 4HDQA 4EJNA 5LONB 2V76A 3P6AA 2XQNM 1ZM0A 1EGXA 1AWEA 4HAZB 3KSYA 5L81A 2LYDA 1W1DA 1V61A 2D10A 2Y8GA 4K2PA 4ZRJA 1TJ6A 3X23A 1U2BA 1Z87A 3SNHA 4BBKA 3U7DA 4B6HA 4HAVB 1X1FA 2Z0PA 4F7UP 1H10A 1KZGA 4HB2B 2OQBA 2KUPA 4HAXB 3TFMA 2EMSA 2RNRB 2DHJA 2YRYA 1NTVA 1ZSQA 1J0WA 3BINA 5CLQB 2D9WA 4KAXB 5DHAB 3PZDA 1UNQA 1WI1A 1UEFA 1DDWA 3WA0A 2AL6A 1UNRA 1BWNA 2COCA 2ZPYA 4A6HA 2LOXA 3NSUA 3CXBB 5J3QA 2I5FA 5FI1A 4MY6A 1X05A 4A6FA 1E5WA 3D8DA 5C5BA 1N3HA 4GN1A 3SUZA 2RSGA 1MIXA 2YS3A 2VKIA 1EVHA 4HDOA 3IVFA 3KZ1A 1XCGA 3SV1A 1DYNA 3PG7A 1OQNA 3OANA 2EMTA 2HE7A 2I1JA 3DXEA 3FM8C 2DLWA 1XR0B 2YT1A 1FOEA 3D8FA 2CRFA 2ELAA 1MK9B 2DA0A 4MK0A 1PFJA 2Y7BA 2DHKA 3ODXA 4YL8A 1UPQA 4DBBA 4ZRIA 3AU5A 2UVMA 3CIKA 1OMWA 1EAZA 3PEGA 3KRXA 5J3YA 2W2XD 1M7RA 5C79A 2AEHA 1WJMA 1BTKA 1TQZA 2NZ8B 2Z0OA 4GPTB 3DXDA 2KGXB 2EJ8A 2QKLA 2H7EA 4P7IA 2P0DA 4XWXA 1V5PA 1WGUA 2VRWB 3QIJA 3TVVA 1ZVRA 5KQ4A 4HB3B 1AQCA 4YONA 2J0JA 5LOPB 4A5KA 3LJUX 4EMOA 4DX90 3DXCA 1U29A 1PLSA 3ZDTA 4C0AA 2YS1A 2DX5A 5JLJB 5J3TA 5DIFB 1B55A 2ROZB 2M14A 2DHIA 1W1HA 2DN6A 2D4QA 3SO6A 1MKEA 2MFQA 1X11A 2YS5A 2D2QA 4GMXB 1IRSA 4TYZA 2IYBA 3UZTA 1OY2A 5HE1A 4DX8A 4NSWA 1XX0A 5D3YA 1KZ7A 1FB8A 2RGNB 2YSZA 4ZRKA 1LW3A 1V5MA 1V5UA 3D8EA 5HE3A 2G35A 3QWMA 4HHVA 4NY0A 1U5GA 2GS0A 1GG3A 4WVFB 4KHAA 5FI0A 2M38A 1QQGA 3VOQA 3QBVB 1X1GA 1NU2A 2MWNB 3ODOA 5HE0A 4PNKA 1U5DA 1K5DB 2HTHB 2P0HA 4A6FB 4HB4B 2VSZA 2I5CA 2H7DA 3O96A 3TO1A 1KI1B 4KHBB 5JP4A 2ROVA 3A8PA 1MPHA 1UNPA 2J0MA 1UPRA 3FSSA 1P3RA 2I1KA 3AJ4A 2K00A 4IOYX 3P7ZA 1XODA 1Q67A 1BTNA 1ZC3B 5D3VA 4D0NB 2DKQA 4K2OA 2P0FA 3FEHA 1FGYA 2ADZA 4MT7A 1WGQA 2MDXA 2P8VA 3KY9A 2DFKA 2FJLA 4H8SA 1GC7A 1U27A 1DDMA 2LG1A 3F5RA 3PVUA 4WSFA 2RVBB 2MKRA 2R09A 1WVHA 3G9WA 4WJ7A 3WYFB 1XKEA 4Z2MB 1W1GA 5HE2A 2NMBA 2CAYA 3MDBC 2CY5A 2LOZA 5DI9B 3ZVRA 4DXAB 1ZC4B 2K2UA 1XD4A 1FHWA 1RJ2A 3RCPA 2L1CA 2RUKB 4Z2NA 1P6SA 5KQ1A 1U5FA 2J59M 1H4RA 2W2WA 2R0DA 2UZSA 1MAIA 3VIAA 3TW1A 3HK0A 3U8ZA 4Y94A 2KCJA 2ELBA 4PQ0A 4KHOA 5D3WA 4IFSA 1LB1A 4L6EA 4GXBA 3F0WA 2QKMA 3TCAA 1FGZA 1FHOA 2E2XA 2W2XC 1BAKA 1Y19B 2D11A 4F7GA 5CLLB 2YF0A 4A6KA 3SYXA 2D9ZA 5D27A 5D3XA 1U5EA 1V88A 3A98B 4HATB 4F7HA 1TXDA 1SGHA 3GYOA 2X18A 4GMVA 5C6RA 2DX1A 2L2IA 4TKNA 2J0KA 4GZUA 2IFSA 2Q13A 1PMSA 3N7CA 4K17A 2COAA 3GYPA 4CHMA 2DYNA 4IAPA 3T06A 1I2HA 3KRWA 1J19A 1NI2A 1P5TA 1DDVA 5DH9B 1FAOA 2CY4A 1DROA 2K2JA 2N0YA 3BJIA 1V89A 2GCJA 3M1IB 4HAUB 1I7AA 1FHXA 2EC1A 4HAYB 3AU4A 1NTYA 2D9XA 1GC6A 4EKUA 2JP2A 1EF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYE A;  3PVW A;  2D9Y A;  5KCV A;  2UZR A;  2GCL A;  5EFX A;  2D9V A;  1SHC A;  2COF A;  3ML4 A;  5JHH A;  1M7E A;  3HQC A;  1QC6 A;  5DHF B;  5C16 A;  4K81 A;  2YT0 A;  2RLO A;  4CHJ A;  3HW2 B;  2DTC A;  1ISN A;  1MK7 B;  2LKO A;  2Y8F A;  2N23 A;  3A8Q A;  1K5G B;  3ODW A;  2PZ1 A;  4HB0 B;  1DBH A;  3PVL A;  4KVG B;  1MIZ B;  5C5B B;  3V5W A;  2Z0Q A;  2BCJ A;  3MPX A;  3ULB A;  4HAW B;  3PSC A;  2LUL A;  1Y5O A;  5JHG A;  1WG7 A;  2OTX A;  2COD A;  2YVC A;  1WJ1 A;  2DYQ A;  2GJY A;  5GOW B;  1X86 A;  3ULC A;  1RRP B;  2DKP A;  3PP2 A;  4HDQ A;  4EJN A;  5LON B;  2V76 A;  3P6A A;  2XQN M;  1ZM0 A;  1EGX A;  1AWE A;  4HAZ B;  3KSY A;  5L81 A;  2LYD A;  1W1D A;  1V61 A;  2D10 A;  2Y8G A;  4K2P A;  4ZRJ A;  1TJ6 A;  3X23 A;  1U2B A;  1Z87 A;  3SNH A;  4BBK A;  3U7D A;  4B6H A;  4HAV B;  1X1F A;  2Z0P A;  4F7U P;  1H10 A;  1KZG A;  4HB2 B;  2OQB A;  2KUP A;  4HAX B;  3TFM A;  2EMS A;  2RNR B;  2DHJ A;  2YRY A;  1NTV A;  1ZSQ A;  1J0W A;  3BIN A;  5CLQ B;  2D9W A;  4KAX B;  5DHA B;  3PZD A;  1UNQ A;  1WI1 A;  1UEF A;  1DDW A;  3WA0 A;  2AL6 A;  1UNR A;  1BWN A;  2COC A;  2ZPY A;  4A6H A;  2LOX A;  3NSU A;  3CXB B;  5J3Q A;  2I5F A;  5FI1 A;  4MY6 A;  1X05 A;  4A6F A;  1E5W A;  3D8D A;  5C5B A;  1N3H A;  4GN1 A;  3SUZ A;  2RSG A;  1MIX A;  2YS3 A;  2VKI A;  1EVH A;  4HDO A;  3IVF A;  3KZ1 A;  1XCG A;  3SV1 A;  1DYN A;  3PG7 A;  1OQN A;  3OAN A;  2EMT A;  2HE7 A;  2I1J A;  3DXE A;  3FM8 C;  2DLW A;  1XR0 B;  2YT1 A;  1FOE A;  3D8F A;  2CRF A;  2ELA A;  1MK9 B;  2DA0 A;  4MK0 A;  1PFJ A;  2Y7B A;  2DHK A;  3ODX A;  4YL8 A;  1UPQ A;  4DBB A;  4ZRI A;  3AU5 A;  2UVM A;  3CIK A;  1OMW A;  1EAZ A;  3PEG A;  3KRX A;  5J3Y A;  2W2X D;  1M7R A;  5C79 A;  2AEH A;  1WJM A;  1BTK A;  1TQZ A;  2NZ8 B;  2Z0O A;  4GPT B;  3DXD A;  2KGX B;  2EJ8 A;  2QKL A;  2H7E A;  4P7I A;  2P0D A;  4XWX A;  1V5P A;  1WGU A;  2VRW B;  3QIJ A;  3TVV A;  1ZVR A;  5KQ4 A;  4HB3 B;  1AQC A;  4YON A;  2J0J A;  5LOP B;  4A5K A;  3LJU X;  4EMO A;  4DX9 0;  3DXC A;  1U29 A;  1PLS A;  3ZDT A;  4C0A A;  2YS1 A;  2DX5 A;  5JLJ B;  5J3T A;  5DIF B;  1B55 A;  2ROZ B;  2M14 A;  2DHI A;  1W1H A;  2DN6 A;  2D4Q A;  3SO6 A;  1MKE A;  2MFQ A;  1X11 A;  2YS5 A;  2D2Q A;  4GMX B;  1IRS A;  4TYZ A;  2IYB A;  3UZT A;  1OY2 A;  5HE1 A;  4DX8 A;  4NSW A;  1XX0 A;  5D3Y A;  1KZ7 A;  1FB8 A;  2RGN B;  2YSZ A;  4ZRK A;  1LW3 A;  1V5M A;  1V5U A;  3D8E A;  5HE3 A;  2G35 A;  3QWM A;  4HHV A;  4NY0 A;  1U5G A;  2GS0 A;  1GG3 A;  4WVF B;  4KHA A;  5FI0 A;  2M38 A;  1QQG A;  3VOQ A;  3QBV B;  1X1G A;  1NU2 A;  2MWN B;  3ODO A;  5HE0 A;  4PNK A;  1U5D A;  1K5D B;  2HTH B;  2P0H A;  4A6F B;  4HB4 B;  2VSZ A;  2I5C A;  2H7D A;  3O96 A;  3TO1 A;  1KI1 B;  4KHB B;  5JP4 A;  2ROV A;  3A8P A;  1MPH A;  1UNP A;  2J0M A;  1UPR A;  3FSS A;  1P3R A;  2I1K A;  3AJ4 A;  2K00 A;  4IOY X;  3P7Z A;  1XOD A;  1Q67 A;  1BTN A;  1ZC3 B;  5D3V A;  4D0N B;  2DKQ A;  4K2O A;  2P0F A;  3FEH A;  1FGY A;  2ADZ A;  4MT7 A;  1WGQ A;  2MDX A;  2P8V A;  3KY9 A;  2DFK A;  2FJL A;  4H8S A;  1GC7 A;  1U27 A;  1DDM A;  2LG1 A;  3F5R A;  3PVU A;  4WSF A;  2RVB B;  2MKR A;  2R09 A;  1WVH A;  3G9W A;  4WJ7 A;  3WYF B;  1XKE A;  4Z2M B;  1W1G A;  5HE2 A;  2NMB A;  2CAY A;  3MDB C;  2CY5 A;  2LOZ A;  5DI9 B;  3ZVR A;  4DXA B;  1ZC4 B;  2K2U A;  1XD4 A;  1FHW A;  1RJ2 A;  3RCP A;  2L1C A;  2RUK B;  4Z2N A;  1P6S A;  5KQ1 A;  1U5F A;  2J59 M;  1H4R A;  2W2W A;  2R0D A;  2UZS A;  1MAI A;  3VIA A;  3TW1 A;  3HK0 A;  3U8Z A;  4Y94 A;  2KCJ A;  2ELB A;  4PQ0 A;  4KHO A;  5D3W A;  4IFS A;  1LB1 A;  4L6E A;  4GXB A;  3F0W A;  2QKM A;  3TCA A;  1FGZ A;  1FHO A;  2E2X A;  2W2X C;  1BAK A;  1Y19 B;  2D11 A;  4F7G A;  5CLL B;  2YF0 A;  4A6K A;  3SYX A;  2D9Z A;  5D27 A;  5D3X A;  1U5E A;  1V88 A;  3A98 B;  4HAT B;  4F7H A;  1TXD A;  1SGH A;  3GYO A;  2X18 A;  4GMV A;  5C6R A;  2DX1 A;  2L2I A;  4TKN A;  2J0K A;  4GZU A;  2IFS A;  2Q13 A;  1PMS A;  3N7C A;  4K17 A;  2COA A;  3GYP A;  4CHM A;  2DYN A;  4IAP A;  3T06 A;  1I2H A;  3KRW A;  1J19 A;  1NI2 A;  1P5T A;  1DDV A;  5DH9 B;  1FAO A;  2CY4 A;  1DRO A;  2K2J A;  2N0Y A;  3BJI A;  1V89 A;  2GCJ A;  3M1I B;  4HAU B;  1I7A A;  1FHX A;  2EC1 A;  4HAY B;  3AU4 A;  1NTY A;  2D9X A;  1GC6 A;  4EKU A;  2JP2 A;  1EF1 A; 
#chains in the Genus database with same CATH topology
 4CYE A;  3NWD A;  3PVW A;  2D9Y A;  5KCV A;  2UZR A;  2GCL A;  5EFX A;  2D9V A;  1SHC A;  5LG4 B;  2COF A;  3ML4 A;  5JHH A;  1M7E A;  3HQC A;  1QC6 A;  5DHF B;  5C16 A;  4K81 A;  2YT0 A;  1T77 A;  2RLO A;  4CHJ A;  3HW2 B;  1ZYI A;  2DTC A;  3DCX A;  1ISN A;  1MK7 B;  2LKO A;  2KUQ A;  2Y8F A;  2N23 A;  3A8Q A;  1K5G B;  3ODW A;  2PZ1 A;  4HB0 B;  1DBH A;  3PVL A;  4KVG B;  1MIZ B;  5C5B B;  3V5W A;  2Z0Q A;  2BCJ A;  3MPX A;  5I2S A;  3ULB A;  4HAW B;  4QJ3 B;  3PSC A;  2LUL A;  1Y5O A;  5JHG A;  1WG7 A;  2OTX A;  2COD A;  2YVC A;  1WJ1 A;  2DYQ A;  2GJY A;  5GOW B;  1X86 A;  3ULC A;  1RRP B;  2DKP A;  3PP2 A;  2K49 A;  4HDQ A;  4EJN A;  5LON B;  2V76 A;  3P6A A;  2XQN M;  2NBV A;  1ZM0 A;  1EGX A;  1AWE A;  4HAZ B;  3KSY A;  4QJ4 B;  5L81 A;  2LYD A;  1W1D A;  1V61 A;  2D10 A;  2Y8G A;  4K2P A;  4ZRJ A;  1TJ6 A;  3X23 A;  1U2B A;  1Z87 A;  3SNH A;  4BBK A;  3U7D A;  4B6H A;  5IRS A;  4HAV B;  1X1F A;  2Z0P A;  2YT2 A;  4F7U P;  1H10 A;  1KZG A;  4HB2 B;  2OQB A;  2KUP A;  4HAX B;  3TFM A;  2EMS A;  2RNR B;  2DHJ A;  2YRY A;  1NTV A;  1ZSQ A;  1J0W A;  3BIN A;  4GNK B;  4OSN A;  5I2M A;  5CLQ B;  2Z14 A;  2D9W A;  4HSI A;  4KAX B;  5DHA B;  3PZD A;  1UNQ A;  1WI1 A;  1UEF A;  1DDW A;  3OHM B;  3WA0 A;  2AL6 A;  1UNR A;  1BWN A;  2COC A;  2ZPY A;  4A6H A;  2LOX A;  3NSU A;  3CXB B;  5J3Q A;  2I5F A;  5FI1 A;  4MY6 A;  1X05 A;  4A6F A;  1E5W A;  3D8D A;  5C5B A;  1N3H A;  4GN1 A;  3SUZ A;  2RSG A;  1MIX A;  2YS3 A;  2VKI A;  1EVH A;  4HDO A;  3IVF A;  4QXA B;  3KZ1 A;  1XCG A;  3SV1 A;  1DYN A;  3PG7 A;  2KIE A;  1OQN A;  3OAN A;  2EMT A;  2HE7 A;  2I1J A;  3DXE A;  3FM8 C;  2DLW A;  1XR0 B;  2YT1 A;  1FOE A;  3D8F A;  2CRF A;  2ELA A;  1MK9 B;  2DA0 A;  4MK0 A;  1PFJ A;  2Y7B A;  2DHK A;  3ODX A;  4YL8 A;  1UPQ A;  4DBB A;  4ZRI A;  3AU5 A;  2UVM A;  2Z13 A;  4L1R A;  3CIK A;  1OMW A;  1EAZ A;  3PEG A;  3KRX A;  5J3Y A;  2W2X D;  1M7R A;  2Z59 A;  5C79 A;  2AEH A;  1WJM A;  1BTK A;  1TQZ A;  2NZ8 B;  2Z0O A;  4GPT B;  3DXD A;  2KGX B;  2EJ8 A;  2QKL A;  2H7E A;  4P7I A;  2P0D A;  4XWX A;  1V5P A;  1WGU A;  2VRW B;  3QIJ A;  3TVV A;  1ZVR A;  5KQ4 A;  4HB3 B;  1AQC A;  4YON A;  2J0J A;  5LOP B;  4A5K A;  3LJU X;  4EMO A;  4DX9 0;  3DXC A;  1U29 A;  1PLS A;  3FVC A;  3ZDT A;  2KIG A;  2YS1 A;  4C0A A;  2DX5 A;  5JLJ B;  5J3T A;  5DIF B;  1B55 A;  2ROZ B;  3HIE A;  2M14 A;  2DHI A;  1W1H A;  2DN6 A;  2D4Q A;  3SO6 A;  1MKE A;  2MFQ A;  1X11 A;  2YS5 A;  2D2Q A;  4GMX B;  1IRS A;  4OT1 A;  4TYZ A;  2IYB A;  3UZT A;  1OY2 A;  5HE1 A;  4DX8 A;  4NSW A;  1XX0 A;  5D3Y A;  1KZ7 A;  3U12 A;  1FB8 A;  2RGN B;  2YSZ A;  4ZRK A;  1LW3 A;  1V5M A;  2GUM A;  1V5U A;  3D8E A;  5HE3 A;  2G35 A;  3QWM A;  4HHV A;  4NY0 A;  1U5G A;  2GS0 A;  1GG3 A;  4WVF B;  4KHA A;  5FI0 A;  2M38 A;  1QQG A;  3VOQ A;  3QBV B;  1X1G A;  2K8E A;  1NU2 A;  2MWN B;  3ODO A;  5HE0 A;  4PNK A;  1U5D A;  1K5D B;  2HTH B;  2P0H A;  4A6F B;  4HB4 B;  4KHB A;  2VSZ A;  2I5C A;  2H7D A;  3O96 A;  3NWF A;  3TO1 A;  2R2Y A;  1KI1 B;  4KHB B;  5JP4 A;  2ROV A;  3A8P A;  1MPH A;  1UNP A;  2J0M A;  1UPR A;  3FSS A;  1P3R A;  2I1K A;  3AJ4 A;  2K00 A;  4IOY X;  3P7Z A;  1XOD A;  2KR0 A;  1Q67 A;  1BTN A;  1ZC3 B;  5D3V A;  3HSA A;  4D0N B;  2RRF A;  2DKQ A;  4K2O A;  2P0F A;  3FEH A;  1FGY A;  2ADZ A;  4MT7 A;  4CSQ A;  1WGQ A;  2MDX A;  2FJU B;  2P8V A;  3KY9 A;  2DFK A;  2FJL A;  4H8S A;  4QJ5 B;  1GC7 A;  1U27 A;  1DDM A;  3A58 A;  2LG1 A;  3F5R A;  3PVU A;  4WSF A;  2RVB B;  2MKR A;  2R09 A;  1WVH A;  3G9W A;  4WJ7 A;  3WYF B;  1XKE A;  4Z2M B;  1W1G A;  5HE2 A;  2NMB A;  2CAY A;  3MDB C;  2CY5 A;  2LOZ A;  5DI9 B;  3ZVR A;  4DXA B;  1ZC4 B;  2K2U A;  1XD4 A;  1FHW A;  1RJ2 A;  3RCP A;  2L1C A;  2RUK B;  4Z2N A;  1P6S A;  5KQ1 A;  1U5F A;  2J59 M;  4GOU A;  1H4R A;  2W2W A;  2R0D A;  2UZS A;  1MAI A;  3VIA A;  3TW1 A;  3HK0 A;  3U8Z A;  4Y94 A;  2KCJ A;  2ELB A;  4PQ0 A;  4KHO A;  5D3W A;  4IFS A;  3B77 A;  1LB1 A;  3NWA A;  4L6E A;  4DIX A;  4GXB A;  3F0W A;  2QKM A;  3TCA A;  1FGZ A;  1FHO A;  2E2X A;  2W2X C;  1BAK A;  1Y19 B;  2D11 A;  4F7G A;  5CLL B;  2YF0 A;  4A6K A;  3SYX A;  2D9Z A;  5D27 A;  5D3X A;  4D6W A;  1U5E A;  1V88 A;  3A98 B;  4HAT B;  4F7H A;  1TXD A;  1MI1 A;  1SGH A;  3GYO A;  2X18 A;  4GMV A;  5C6R A;  2DX1 A;  2L2I A;  4TKN A;  2J0K A;  4GZU A;  2IFS A;  2Q13 A;  1PMS A;  3N7C A;  4K17 A;  2COA A;  3GYP A;  4CHM A;  2ZKM X;  2DYN A;  4IAP A;  2Z4D A;  3T06 A;  1I2H A;  3KRW A;  1J19 A;  1NI2 A;  1P5T A;  1DDV A;  5DH9 B;  1FAO A;  2CY4 A;  1DRO A;  2K2J A;  3NW8 A;  3BJI A;  2N0Y A;  1V89 A;  2GCJ A;  3M1I B;  4HAU B;  1I7A A;  5M4Y B;  1FHX A;  2EC1 A;  4HAY B;  3AU4 A;  1NTY A;  2D9X A;  1GC6 A;  4EKU A;  2JP2 A;  1EF1 A; 
#chains in the Genus database with same CATH homology
 4CYE A;  3PVW A;  2D9Y A;  5KCV A;  2UZR A;  2GCL A;  5EFX A;  2D9V A;  1SHC A;  2COF A;  3ML4 A;  5JHH A;  1M7E A;  3HQC A;  1QC6 A;  5DHF B;  5C16 A;  4K81 A;  2YT0 A;  2RLO A;  4CHJ A;  3HW2 B;  2DTC A;  1ISN A;  1MK7 B;  2LKO A;  2Y8F A;  2N23 A;  3A8Q A;  1K5G B;  3ODW A;  2PZ1 A;  4HB0 B;  1DBH A;  3PVL A;  4KVG B;  1MIZ B;  5C5B B;  3V5W A;  2Z0Q A;  2BCJ A;  3MPX A;  3ULB A;  4HAW B;  3PSC A;  2LUL A;  1Y5O A;  5JHG A;  1WG7 A;  2OTX A;  2COD A;  2YVC A;  1WJ1 A;  2DYQ A;  2GJY A;  5GOW B;  1X86 A;  3ULC A;  1RRP B;  2DKP A;  3PP2 A;  4HDQ A;  4EJN A;  5LON B;  2V76 A;  3P6A A;  2XQN M;  1ZM0 A;  1EGX A;  1AWE A;  4HAZ B;  3KSY A;  5L81 A;  2LYD A;  1W1D A;  1V61 A;  2D10 A;  2Y8G A;  4K2P A;  4ZRJ A;  1TJ6 A;  3X23 A;  1U2B A;  1Z87 A;  3SNH A;  4BBK A;  3U7D A;  4B6H A;  4HAV B;  1X1F A;  2Z0P A;  4F7U P;  1H10 A;  1KZG A;  4HB2 B;  2OQB A;  2KUP A;  4HAX B;  3TFM A;  2EMS A;  2RNR B;  2DHJ A;  2YRY A;  1NTV A;  1ZSQ A;  1J0W A;  3BIN A;  5CLQ B;  2D9W A;  4KAX B;  5DHA B;  3PZD A;  1UNQ A;  1WI1 A;  1UEF A;  1DDW A;  3WA0 A;  2AL6 A;  1UNR A;  1BWN A;  2COC A;  2ZPY A;  4A6H A;  2LOX A;  3NSU A;  3CXB B;  5J3Q A;  2I5F A;  5FI1 A;  4MY6 A;  1X05 A;  4A6F A;  1E5W A;  3D8D A;  5C5B A;  1N3H A;  4GN1 A;  3SUZ A;  2RSG A;  1MIX A;  2YS3 A;  2VKI A;  1EVH A;  4HDO A;  3IVF A;  3KZ1 A;  1XCG A;  3SV1 A;  1DYN A;  3PG7 A;  1OQN A;  3OAN A;  2EMT A;  2HE7 A;  2I1J A;  3DXE A;  3FM8 C;  2DLW A;  1XR0 B;  2YT1 A;  1FOE A;  3D8F A;  2CRF A;  2ELA A;  1MK9 B;  2DA0 A;  4MK0 A;  1PFJ A;  2Y7B A;  2DHK A;  3ODX A;  4YL8 A;  1UPQ A;  4DBB A;  4ZRI A;  3AU5 A;  2UVM A;  3CIK A;  1OMW A;  1EAZ A;  3PEG A;  3KRX A;  5J3Y A;  2W2X D;  1M7R A;  5C79 A;  2AEH A;  1WJM A;  1BTK A;  1TQZ A;  2NZ8 B;  2Z0O A;  4GPT B;  3DXD A;  2KGX B;  2EJ8 A;  2QKL A;  2H7E A;  4P7I A;  2P0D A;  4XWX A;  1V5P A;  1WGU A;  2VRW B;  3QIJ A;  3TVV A;  1ZVR A;  5KQ4 A;  4HB3 B;  1AQC A;  4YON A;  2J0J A;  5LOP B;  4A5K A;  3LJU X;  4EMO A;  4DX9 0;  3DXC A;  1U29 A;  1PLS A;  3ZDT A;  4C0A A;  2YS1 A;  2DX5 A;  5JLJ B;  5J3T A;  5DIF B;  1B55 A;  2ROZ B;  2M14 A;  2DHI A;  1W1H A;  2DN6 A;  2D4Q A;  3SO6 A;  1MKE A;  2MFQ A;  1X11 A;  2YS5 A;  2D2Q A;  4GMX B;  1IRS A;  4TYZ A;  2IYB A;  3UZT A;  1OY2 A;  5HE1 A;  4DX8 A;  4NSW A;  1XX0 A;  5D3Y A;  1KZ7 A;  1FB8 A;  2RGN B;  2YSZ A;  4ZRK A;  1LW3 A;  1V5M A;  1V5U A;  3D8E A;  5HE3 A;  2G35 A;  3QWM A;  4HHV A;  4NY0 A;  1U5G A;  2GS0 A;  1GG3 A;  4WVF B;  4KHA A;  5FI0 A;  2M38 A;  1QQG A;  3VOQ A;  3QBV B;  1X1G A;  1NU2 A;  2MWN B;  3ODO A;  5HE0 A;  4PNK A;  1U5D A;  1K5D B;  2HTH B;  2P0H A;  4A6F B;  4HB4 B;  2VSZ A;  2I5C A;  2H7D A;  3O96 A;  3TO1 A;  1KI1 B;  4KHB B;  5JP4 A;  2ROV A;  3A8P A;  1MPH A;  1UNP A;  2J0M A;  1UPR A;  3FSS A;  1P3R A;  2I1K A;  3AJ4 A;  2K00 A;  4IOY X;  3P7Z A;  1XOD A;  1Q67 A;  1BTN A;  1ZC3 B;  5D3V A;  4D0N B;  2DKQ A;  4K2O A;  2P0F A;  3FEH A;  1FGY A;  2ADZ A;  4MT7 A;  1WGQ A;  2MDX A;  2P8V A;  3KY9 A;  2DFK A;  2FJL A;  4H8S A;  1GC7 A;  1U27 A;  1DDM A;  2LG1 A;  3F5R A;  3PVU A;  4WSF A;  2RVB B;  2MKR A;  2R09 A;  1WVH A;  3G9W A;  4WJ7 A;  3WYF B;  1XKE A;  4Z2M B;  1W1G A;  5HE2 A;  2NMB A;  2CAY A;  3MDB C;  2CY5 A;  2LOZ A;  5DI9 B;  3ZVR A;  4DXA B;  1ZC4 B;  2K2U A;  1XD4 A;  1FHW A;  1RJ2 A;  3RCP A;  2L1C A;  2RUK B;  4Z2N A;  1P6S A;  5KQ1 A;  1U5F A;  2J59 M;  1H4R A;  2W2W A;  2R0D A;  2UZS A;  1MAI A;  3VIA A;  3TW1 A;  3HK0 A;  3U8Z A;  4Y94 A;  2KCJ A;  2ELB A;  4PQ0 A;  4KHO A;  5D3W A;  4IFS A;  1LB1 A;  4L6E A;  4GXB A;  3F0W A;  2QKM A;  3TCA A;  1FGZ A;  1FHO A;  2E2X A;  2W2X C;  1BAK A;  1Y19 B;  2D11 A;  4F7G A;  5CLL B;  2YF0 A;  4A6K A;  3SYX A;  2D9Z A;  5D27 A;  5D3X A;  1U5E A;  1V88 A;  3A98 B;  4HAT B;  4F7H A;  1TXD A;  1SGH A;  3GYO A;  2X18 A;  4GMV A;  5C6R A;  2DX1 A;  2L2I A;  4TKN A;  2J0K A;  4GZU A;  2IFS A;  2Q13 A;  1PMS A;  3N7C A;  4K17 A;  2COA A;  3GYP A;  4CHM A;  2DYN A;  4IAP A;  3T06 A;  1I2H A;  3KRW A;  1J19 A;  1NI2 A;  1P5T A;  1DDV A;  5DH9 B;  1FAO A;  2CY4 A;  1DRO A;  2K2J A;  2N0Y A;  3BJI A;  1V89 A;  2GCJ A;  3M1I B;  4HAU B;  1I7A A;  1FHX A;  2EC1 A;  4HAY B;  3AU4 A;  1NTY A;  2D9X A;  1GC6 A;  4EKU A;  2JP2 A;  1EF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...