1ML3A

Evidences for a flip-flop catalytic mechanism of trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase, from its crystal structure in complex with reacted irreversible inhibitor 2-(2-phosphono-ethyl)-acrylic acid 4-nitro-phenyl ester
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
359
structure length
359
Chain Sequence
MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for the Two Phosphate Binding Sites of an Analogue of the Thioacyl Intermediate for the Trypanosoma cruzi Glyceraldehyde-3-phosphate Dehydrogenase-Catalyzed Reaction, from Its Crystal Structure.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde 3-phosphate dehydrogenase, glycosomal
total genus 121
structure length 359
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1ml3A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ml3A01
1LDEA 3BMOA 3NEPX 4YT8A 1YONA 1JW9B 4N54A 2VWQA 3ZWVA 2PY6A 4B7UA 3ZNNA 3TZHA 2Z5LA 3VPSA 1O6ZA 3C85A 4I5GA 5IDWA 1XR3A 3BZUA 3R3SA 5DNAA 1E77A 5DULA 1NBOA 4BVAA 1OMOA 2EERA 4XQGA 4YRAA 1E7WA 2GNAA 1F12A 3FTNA 1W4ZA 1FF9A 4GX2A 2O4UX 2BGMA 4CR6A 3VVBA 1MC4A 4RJTA 1YE3A 4YJFB 3DAPA 1XQ6A 3QWAA 4FSHA 3DMTA 1DB3A 3S55A 1EE9A 4DMLA 4C7KA 1B7GO 4R5MA 2BMAA 2HMWA 2B37A 3H2ZA 3OQ6A 4KDFA 1PJCA 5HTOA 2BFMA 1HL3A 2VNSA 6ADHA 3U4DA 1PJQA 1B0AA 1UZLA 1YVEI 3EDMA 1ZO8A 3EHEA 2DVMA 3ETDA 4N5NA 3NX4A 1PZGA 4ZQHA 4CM1A 4DQVA 3LU1A 1PSDA 4NZ9A 3VH1A 4Y6RA 2D5CA 1E92A 1KVQA 3GGOA 4YA6A 5L3ZA 1ZXBA 2H5LA 3U9LA 4D43A 3UCXA 2P4HX 3FWNA 1T26A 2ZJ1A 1LXCA 1MFPA 2O3SA 3GDFA 3WLEA 1I30A 1QMGA 3L9WA 1WDMA 3OP4A 1YB4A 3H9EO 2JCXA 1EFLA 5JYAA 3PJFA 2P9GA 4BS9A 4KOAA 3DBHB 1N5DA 4BMNA 3JD0A 4JP3A 5DT9A 4BKOA 4EI2A 4MIOA 3AFNA 5F3RA 3P2YA 1T2DA 4ALJA 3DR3A 5AXCA 2I76A 4CLRB 1YS4A 3V1UA 4F6LA 3GFGA 3PHGA 3GRKA 4BNTA 3GNTA 3KSZO 3G1UA 3G0OA 3WS7A 1K3TA 1ZJZA 2B36A 3QVWA 3EY4A 3FSRA 3ZNQA 2FPIA 3JQCA 2QX7A 1P77A 2HDHA 4EUHA 2DU8A 4OMUA 1NPDA 1I3MA 2X86A 1P74A 2X23A 2TMGA 1PL6A 3GUYA 4XCVA 5KVCA 4IQ0A 4AJ1A 5JW6A 2D1YA 3HG7A 1U5CA 5TSDA 5DCYA 1TEHA 3H3FA 4YJHB 4E2XA 1Q1NA 5JDIC 3EZYA 2Q22A 4NH4A 3LC7O 4OOFA 5T6BA 2OMEA 4EGFA 4IDFA 3RD5A 3TFOA 1R4NA 4W6ZA 4PVDA 1D1TA 2BGLA 4U0KA 3DMYA 1P1KA 3N74A 5FI3A 3JV7A 3ZWOA 1YBVA 4EDFA 3E82A 2EV9A 4UVEA 2Q49A 1MA0A 1GZ4A 1MB4A 4BQPA 3RUFA 3F9IA 4TRNA 4Y8VA 1R0KA 1YOVA 1YL6A 1GCUA 1GY8A 2OGUA 1GEEA 3DOJA 1IB6A 1HKUA 2QQ5A 3WGQA 4L9RA 4HFNA 4II3A 3GEDA 5KVSA 1N92A 3GVIA 3ZHZA 4CLRA 4RLHA 4FQ8A 4NDNE 3INTA 5KJ6A 1Z82A 3VKUA 3QWHA 4ROSA 3JCZA 1JN0A 4JK3A 2HMTA 1T2FA 4R9RA 4XRGA 2X58A 2JFHA 4WKGA 3RCBA 4J1QA 4CV3A 2ET6A 3PLNA 2YZ7A 1GAEO 3LF2A 3PYXA 2AEJA 3JQ9A 3ZN2A 4NBTA 5HA5A 1BTOA 1Y6JA 4Z9FA 2A35A 4ALIA 4CMBA 2GF2A 1Z6ZA 1Z75A 2LDXA 1HTBA 3UHAA 4YPOA 3AFMA 2Y1CA 4J16A 1LSOA 3KRTA 3VZSA 3LT2A 1ADBA 3BTSA 2FR8A 3ITDA 2C82A 2Y1OA 5F1OA 4H7PA 3FNHA 3SC4A 3I6QA 3C1TA 4J91A 3DBVO 2YHIB 3FPLA 3PJEA 4BNIA 1WDLA 4IZIA 2CDAA 3RIHA 1D7OA 1LNQA 4OH1A 4J4BA 3Q9NA 4MINA 3GDOA 4HFRA 4WCFB 1WNTA 1I36A 2V6FA 2VYND 5JCJD 1YOVB 4BO4A 1YGYA 4D46A 1JAXA 3E9QA 1B16A 1QYXA 4PZCA 1ISIA 5GMOA 3LLVA 1SMKA 1YDWA 4IDGA 3O8QB 1AXEA 2OL4A 5JS6A 1J4AA 1DDOA 2ZB3A 3PQEA 3FBGA 2B4TO 3LLSA 3VZPA 3HE3A 4IMPA 1E3JA 3EYWA 3ONFA 2VHYA 1NHWA 2I65A 3R1IA 4NPCA 3DONA 2Z1NA 1BG6A 3JQDA 3LSYA 2QYSA 3LT4A 5DP1A 4U8GA 3KVOA 1P31A 4G65A 1TT5B 1IHYA 2X0NA 1UR5A 1Y8RB 4CLHA 1OZAA 4CV2A 5BT9A 1M75A 4W82A 4ND3A 3L4SO 5F5NA 1BSVA 3JSAA 2W90A 3ANLA 2NLOA 1B8UA 3IMFA 4J4HA 4QQRA 5JY1A 1LSSA 2C7GA 3TPCA 3ASUA 3PQFA 4U0JA 4E2YA 3E6AA 5CP8A 4GSKA 1ZK2A 1E1NA 2C54A 4TRJA 3GFBA 1GL3A 1P1IA 4XGKA 2NSDA 5KJCA 2JKVA 1U7HA 3ROQA 4CQLB 2FRDA 5CEJA 3WG9A 5MDHA 2Y1GA 4AJPA 5KIAA 4Y9DA 3NJ8A 3S8MA 2BELA 1DC6A 1BVUA 1MX3A 1JQBA 1ML3A 3D3EA 4GGPA 4KTTE 1FDVA 4DUPA 1DSSG 4M49A 3H65A 2VZ0A 4TQGA 1NXQA 4A73A 4CQMB 4RORA 1J6UA 2D4AA 1R66A 4R51A 1LBEA 1EDZA 3IKVA 3LT0A 5CFZA 4HKTA 3K92A 4MVJH 2GD1O 3WJ7A 1HDRA 1OOEA 5TIIA 1ZK3A 4D7AA 3NKLA 1DHTA 5CG2A 3I6IA 4ALMA 4MKXA 5A9RA 1TT5A 3NT4A 4BGVA 5T67A 5JNLA 2NNLD 2G0TA 4DIBA 3DBLA 3ROMA 5BQFA 3HN7A 3L6EA 2PV7A 1UP6A 4O6VA 1M66A 3GK3A 5TF4A 1K6XA 1Q7GA 1NFRA 1HRDA 3W8FA 3WTCA 5DOZA 4GKVA 2X0JA 5KCZA 3PXXA 4G81A 1HSZA 1ZW1A 3ZV4A 1G6KA 4GLLA 3RUAA 4E31A 4HADA 4PRLA 1VSUA 1P3DA 1BRMA 7MDHA 3I83A 2I99A 4ZVVA 2HRBA 3WGHA 2P9CA 2TMDA 3WYBA 3RUDA 4CM9A 1WAMA 2I6TA 4HY3A 4M1QA 1ULUA 2Z95A 3KUXA 1FDUA 2X4GA 4FC7A 5IN5A 1V3UA 3CZRA 4OHUA 4TVOA 2VHZA 4UVDA 4BO7A 3WIEA 4MKRA 4CLXA 2HMVA 3GEGA 4FJ2A 4Z3KA 5JFOA 3K73O 3TN7A 4IXWA 4JN6B 4GQAA 4KMSA 3JTMA 3HWRA 3TDKA 4D0SA 4UREA 3HB5X 4XZ3A 2X1HA 1XKQA 3ANMA 4D42A 1GR0A 2YV3A 5DF1A 3SX2A 1DPGA 4NBUA 1NAIA 1ORRA 2GN4A 3IC5A 2OP0A 4XQEA 1Q0HA 1F0YA 3WNVA 2WJPA 5CPBA 4BL5A 1ZEMA 4WLOA 1GV0A 4NU6A 1ARZA 3GH3A 4LISA 1NTOA 1JWAB 3JQFA 1C1DB 2FR0A 4Q9NA 2AQHA 4L0QA 1C1DA 5TQVA 5I7VA 3PEFA 1SC6A 3N58A 1LC0A 3WOHA 1WW8A 1AHHA 1PGNA 1YKFA 3IUPA 3WICA 3PP8A 1N7HA 4DLAA 5U9CA 3B1FA 2HO5A 3ZV6A 3GN1A 1AGNA 3IP3A 5T73A 1HE2A 1LLCA 1ZCJA 3OQBA 1NASA 3BYZA 2HU2A 4E5PA 4EITA 1MLDA 3FCOA 5JDCA 3F4BA 4CM6A 4B8WA 5C7IO 2VWPA 1PL8A 4F6CA 2YV2A 3WFIA 4G2NA 5DN9A 2WD7B 5I7SA 1HDXA 4A26A 2P91A 4R16A 3H5NA 1PJ4A 2NVBA 3ZWPA 4A10A 1EK6A 2F1KA 3V1TC 5JPIA 1HE4A 3PYMA 1I01A 1PQPA 1HEUA 4CM5A 3GT0A 1H2HA 2X9NA 1ZKMA 4C4OA 2BFPA 1O89A 3QY9A 2V65A 4XD2A 3GGPA 4M86A 2AE1A 1YXMA 4CM4A 4DGSA 4FFLA 1VL6A 1SEPA 2GN8A 4XYMA 5HBRA 4W9NA 3ENKA 5TX7A 4EW6A 5J9GA 2Q1WA 4UVGA 4E6PA 5ICSA 2QRKA 3O26A 2ZATA 3WSVA 3LT1A 2NQTA 1SZJG 2PGLA 2NADA 2P4QA 1XYGA 2DAPA 3HHPA 4TWRA 3OHSX 3UW3A 3G79A 1BMDA 3EGOA 3ZV3A 1VM6A 4Q3BA 1T4DA 3KXDA 1YJ8A 2G5CA 4PG8A 1GU7A 4YJFA 1HE5A 1ZK1A 3DZIA 3AOEC 4ALNA 4E12A 1SB9A 4D3SA 5T8KC 4GX0A 4EJMA 4PG6A 2CDBA 1CYDA 3UCFA 5ICMA 3LK7A 2OOSA 2FOIA 4UUOA 3ANNA 1T2CA 4E13A 4ILKA 3ZU3A 4CLDA 1G1AA 3NTQA 1ISHA 3IJRA 1O8CA 3ZHYA 2ZTMA 4F46A 2VUSA 1HDYA 4R3WA 3PZBA 4WLNA 5JMPA 1DRVA 1EVIA 4N7RA 4JGBA 1ZK4A 2VN8A 2WE7A 4LCJA 1SOVA 5KNLA 1NP3A 2QZZA 1UDBA 1HLDA 3S2EA 3BAZA 3O38A 1PZHA 2G82A 4WE3A 3PWZA 3RFTA 1RWBA 3INGA 4YJHA 1ENYA 1A9ZA 3E1KA 1M6WA 4DIFA 4J7UA 4WCFC 3DBHA 4OXKA 5JCXA 3HADA 1WZIA 5L4SA 3BIOA 2P9EA 3NGXA 4NK5A 3PHJA 1R16A 1H94A 4CM4B 1HZJA 3WBFA 3Q0EA 3MZ0A 1LDGA 3VHRA 1U4OA 4ZJUA 3PRJA 4RDHA 5DBGA 2ZTUA 4RPLA 2QG4A 1TB4A 2DUWA 4TSKA 1HSOA 1PR9A 1GQQA 2GZ1A 4I08A 3TRIA 3HB4X 1TA4A 2YYYA 2QYTA 4YACA 3LC1O 4EBFA 3CIFA 4JJGA 3H6KA 2VYNA 3JQ6A 3KYBA 2Q2VA 5I8WA 1MXHA 4I1IA 5GZ3A 1BDBA 1LI4A 3DEYX 1B3RA 3K9QO 1W8DA 3UICA 2EP7A 4B4OA 2NUAA 4IJKA 1C0IA 1QLJA 2EJVA 3RU9A 1PJLA 5B4TA 5IDXA 1ZMOA 2W2KB 1P45A 3BHMA 4MVJA 2W2KA 5FFFA 3W4JA 3BTOA 3D4PA 1MXFA 4QTZA 4RVGA 3LYLA 5EQFA 3ST7A 2HCTA 5IZCC 1GD1O 3DQPA 5ILOA 3GNQA 3GNSA 3H7AA 3RBZA 3I4FA 1NAHA 2DBQA 2PR2A 3C8MA 3DZKA 1YDEA 4PLVA 1GYPA 5KKAA 4XIYA 3ICPA 4IIVA 4KP7A 2RAFA 2PLAA 2EKLA 4YAIA 3M1AA 3PHHA 4W99A 2EJWA 4IXTA 4JXKA 2OO5A 4GPD1 3K31A 3VDRA 1KEVA 4PVCA 4BNYA 3D5TA 4GGOA 3OJOA 3P5SA 4ESOA 2Q4BA 1R0SA 2GZ3A 1F8GA 2AEFA 4M54A 3OETA 3JD2A 1N1EA 2ZB4A 3QWIA 2D3TA 4J9UE 3I1JA 2DBVO 4PLTA 2I9PA 5A9SA 3V2UA 4YCAA 5IDYA 4WJZA 4NJOA 1LA2A 1KYQA 2D59A 3JQAA 1SEVA 2YFHA 1BHSA 3JQAB 2AXQA 1A27A 1V35A 3IJPA 1VI2A 2HMSA 1VSVA 4B3HA 4J2OA 1CERA 4ND2A 2HRZA 4TKLA 1VKOA 3K5PA 3CE6A 2J3KA 1QKIA 4RPJA 5G0SA 3VH2A 5JAIA 2BFAA 4WOKA 3EZLA 4L76A 1LDMA 4NBWA 2IXAA 1EVYA 5A4DA 5JC1A 1BVRA 3GR6A 2EF1A 4F3YA 5IZ4A 3INRA 1DIHA 3EVTA 3D3WB 3I3OA 2B35A 4CMCA 2Z1MA 4GVXA 5JAZA 5A02A 5JO9A 2Y0EA 3DO5A 1V3TA 3IKTA 4J49A 3ZWAA 1PTJA 4U6QA 2NTJA 4OJNA 1QYVA 3LDHA 1UH5A 1H93A 3EC7A 4EEXA 5JMWA 1GTMA 2PA3A 1B26A 3S2GA 4TMFA 3TZCA 2DKNA 5CDUA 4U6SA 1X15A 1Y8RA 3DZJA 1T1RA 2AEMA 4B4WA 2I67A 3OM9A 5IAAA 1K6JA 1A71A 2HKIA 1HDZA 1R4MA 1T4BA 4JROA 4UVIA 4CMIB 2RCYA 2HLPA 4J9VA 1LC3A 4K26A 4DA9A 1H6CA 1S7CA 4BIIA 4C7JA 5C5IA 2YHUA 3WMXA 1DLJA 1ZSYA 4YXFA 2W8ZA 1V9LA 1D4FA 5ER6A 1B2LA 3GZNB 1DEHA 4J7CA 1G0NA 4WLFA 2B5VA 3U62A 4FDAA 2EKPA 4DWVA 3QE3A 3VVCA 3KYDB 4CMHA 4L73A 3ONDA 2I5PO 3O8QA 1N8KA 1WWKA 1DFHA 1EK5A 1UUFA 1JKIA 3O9ZA 4FFPA 4JIGA 4WASA 3T4XA 3TZQA 1PJTA 5IDQA 4ZU3A 2IXBA 1ULSA 1U4SA 1IL0A 2BHLA 4MP8A 4Y6PA 4B8ZA 4X54A 4AJOA 3C24A 4XR9A 2HUNA 2XOXA 1A4IA 1DHRA 1E5QA 2GR9A 3GRPA 4A5OA 3LQFA 1ZMTA 4DXHA 3PGJA 4BNNA 1EEHA 1BXKA 1N9GA 2AQ8A 4IS2A 5F1KA 3BMNA 5EQDA 3ROPA 2GZ2A 5GZ1A 1T2EA 1EZ4A 5KTKA 4J90A 3CKYA 1E7MA 2FHSA 2GERA 3DDNA 1PJBA 2VWGA 2CVZA 3EK2A 4Z0HO 2JCYA 1I3KA 1U9JA 1Z7BA 3W4KA 2JCVA 3W1VA 1SO8A 3VTFA 4PCVA 3JQ8A 5FYDA 1F17A 1M6HA 3JQAD 4J6FA 4YJGA 4W7HA 3RKUA 4AJJA 4JJFA 1R4MB 9LDBA 1RJWA 2ZYDA 5JCJA 4TZTA 3AK4A 2RH8A 4KZPA 4UUPA 5G0WA 4N5MA 2E4AA 4FW8A 2PKQO 1AXGA 5ES3A 1UXIA 2A94A 3L6DA 1SAYA 4KQWA 4RVDA 1A7AA 4QXMA 3ZU2A 4NNJA 3OA2A 1B14A 4IUYA 3H3JA 3PDUA 2R00A 1X1EA 3OIFA 1WMAA 3RU7A 2GO1A 3TL2A 3WB9A 1Y9EA 1W73A 3I9NA 2C2XA 1FK8A 4AG3A 3ORFA 2FY8A 1OC4A 5BSEA 4MJLA 1DLIA 5HS6A 1Q0QA 1U7TA 4OXYA 3FR7A 5BSFA 3KLPX 4WK6A 2UUPA 3E9MA 3JD1A 4J1NA 2ZB7A 4XQ9A 1UZNA 2DT5A 2ZTLA 2XAAA 3DZFA 1I2CA 2YJZA 4M8SA 4P8RA 4L74A 2NV6A 1CIVA 2DPHA 1P0CA 1I32A 4NMHA 1N9GB 4GH5A 3D4NA 3H8VA 4J3FA 3MTJA 3JYLA 4MVJP 1A4UA 2O7QA 2Y1FA 4WLUA 5B37A 1Q7BA 3LVFO 3Q1LA 4ZRNA 1X7HA 1T1SA 3BMCA 4R41A 1GPJA 4LW8A 3HFSA 3ZW8A 3RVDA 4CLOA 5BR7A 4MDHA 4MP6A 3RKRA 3OEYA 4D3FA 4Z0PA 3PYLA 1PJ3A 4B7XA 4R1SA 1XIVA 4BGUA 4OXNA 1VLLA 3R0IA 2EP5A 2XXBA 2ZYAA 5ITWA 4W7IA 2OP1A 5DBIA 4CM3A 5LDHA 4XIJA 1NNUA 3DXFA 4RGBA 4RZIA 1M2WA 1YJQA 2DTXA 3GG9A 4DC1A 1Y7TA 3H9QA 4YTEA 2Q2QA 2WD7A 2IEDA 2BGKA 2CZCA 1GDHA 1GFSA 4AVYA 2VWHA 3G17A 4S3MA 2Q4EA 2JFGA 3JYPA 5CDSA 3JD3A 1QORA 3Q6IA 1CDOA 4R1UA 5T64A 4I5EA 2AMFA 3ZI0A 1NVTA 2O50A 4YJDA 1DIRA 2J5QA 1KETA 5JXWA 3HDHA 4DBZA 3ZZNA 3UN1A 5HRUA 1YBAA 3GPIA 3BMOB 4E21A 4DBVO 2XXJA 1MUUA 4HP8A 1EUCA 3ON5A 5THKA 5BNIA 8LDHA 3C1OA 2AQIA 2GASA 3ETGA 1CJCA 3SVTA 1KVSA 1E6EA 2O7SA 4P4LA 2ZKLA 3FD8A 4CV1A 3RSHA 5JO0A 1IPEA 3IDSA 4K1LA 2EIHA 4IDBA 3WJAA 1LTHR 4M55A 1U3WA 4PLPA 3IIEA 4UEJA 3ZWXA 3ZDFA 4UAGA 1LRJA 1H9AA 1UP7A 3DTTA 2LDBA 4Z6KA 5JBIA 4UEKA 3KV3O 4BNKA 3GC6A 1KY4A 2IZZA 2NTVA 1KVRA 2Y05A 4P22A 1O0SA 2IZ0A 3HJAA 1XEAA 1CWUA 4INAA 3BMQA 4DIOA 4I8XA 1J49A 3DTYA 1Q0LA 1YRLA 4B79A 4RV9A 5G0TA 4CLEA 5F1PA 3AUAA 3CPSA 1YBMA 1YO6A 4S1VA 4ZQFA 2PGDA 1CETA 3Q2KA 1D1SA 1RPNA 3KEQA 2IYOA 5L40A 2BLLA 1EBUA 2Y99A 1Y9AA 1R4NB 3OF2A 1Z73A 5B12A 2Q46A 4Z9YA 4XKJA 2D8AA 3L07A 3QHAA 4BO2A 2B69A 1LQTA 1NHGA 1ISGA 1QV7A 2YDXA 1XCBA 4YB8A 2PD3A 2O2YA 4Y6SA 3H2SA 3UOGA 3FBTA 3GA0A 3HNPA 1IE3A 4NBRA 1P1RA 2XPCA 3BA1A 1VJ0A 1HLPA 1M76A 3C3XA 5ADHA 3OIDA 1EVJA 4A0SA 4YQYA 1UXKA 5M6DA 4ND1A 4RPGA 5THQA 4OOEA 2G76A 4IY1A 4EUFA 2ZK7A 4KDEA 3PQDA 1YB1A 2ZB8A 4QECA 4U7WA 4DC0A 2AE2A 3VAZA 1LQUA 1ZNQO 1N2SA 1FDTA 3QLJA 4TRMA 3JYQA 5L95A 3I9MA 2PKQP 2R2GA 5C7LO 5A3VA 1PIWA 4P4NA 1DIGA 2ZQZA 5CDGA 1C1XB 4R9SA 1UDCA 2PZMA 4ZA2A 3K6JA 1SBYA 2Q1UA 3I52A 1QG6A 5CEFA 1P1JA 2H1SA 4PGFA 4LVCA 5COAA 4OQYA 2OFPA 4BNMA 2NU7A 3TL3A 2PNFA 2FSSA 5COQA 4YAGA 3ZWBA 1W6UA 2NACA 1ID1A 1LSJA 5B4UA 4O0LA 1EQ2A 3C7DB 1P44A 3ABIA 2B4QA 1HWYA 4Q3CA 1Y5MA 2W2LD 1E5LA 3WDSA 5HS4A 2YFQA 3TQHA 1DFGA 4NFSA 3GAFA 4GVLA 2D0IA 1P1FA 1HF3A 3AI3A 3COSA 5I8ZA 5KKCA 1SB8A 4BNJA 2GRAA 3EMKA 4WOJA 1NWCA 2QRLA 4R1NA 3SJ7A 3ROKA 4XQCA 1MC5A 3NT2A 1H6BA 2I3GA 4DREA 1ZK0A 3RUCA 5EESA 4BO8A 1JKJA 5K0ZA 4IDCA 5G0UA 4MVJE 4YWJA 2W2LA 2C5AA 5DCWA 2NU9A 1RKXA 3JYNA 5HWSA 3AM4A 4J2HA 5F21A 3CZMA 1E1LA 1GPDG 4RPKA 1W0CA 1PGQA 1WMBA 1GUZA 3QVTA 1NR7A 3WMWA 3F4LA 1YB5A 2J5KA 3DHYA 3EAGA 2DC1A 4XDYA 3O03A 3L6OO 4II2A 3JD4A 4JNKA 2X9GA 4DYDA 1U3VA 1R15A 2VHVA 1UP4A 2Q99A 2FZWA 4A7PA 3QV1A 3D4OA 3DZHA 5TNXA 5EMHA 4DRYA 3B20A 2X5JO 3AY6A 3TF5A 1HETA 4Z9XA 5I9LA 1MFZA 4FD3A 1ENZA 3AUTA 4PZEA 4LRTB 1LDNA 4B4UA 3WFJA 4XB1A 2C2YA 2ZQYA 3ICCA 1H9BA 4KTVE 5KVQA 3ZW9A 1PGOA 1ADCA 1X13A 5FI5A 2J8ZA 1NVMB 3H9GA 4HXYA 1ISFA 4DYVA 1NFFA 3KHUA 1I5RA 3X2EA 1JU9A 1N7GA 2GN9A 4AJLA 1DAOA 1WZEA 3NDIA 4D45A 3WYCA 4DTIA 2PWZA 3GZNA 4RVHA 3WWYA 4RQUA 3AOGA 1UXGA 2A92A 3KSDO 4R4JA 1H2BA 4CQMA 4GL4A 3WYEA 3CUKA 3L4BC 1X0XA 4NFYA 1MV8A 1CF2O 3M6IA 4R69A 4FJ0A 2NU8A 1MGOA 2VUUA 4CMEA 2X6TA 3OJLA 1E0DA 5T8KA 1IY8A 1NQTA 3KYCB 1I24A 3BMNB 3NJ4A 4LK3A 4Q3AA 4F45A 1IZ9A 1BW9A 4BNXA 1P33A 2GSDA 4YRDA 1VL0A 2EXXA 4YAEA 5G4KA 1XQ1A 2HJSA 1KEUA 1ONPA 3OQ1A 1QYWA 4BGEA 2CFCA 1FJHA 2PGJA 1LLUA 2AG8A 2Q45A 3R3JA 2QHXA 3WWZA 1NQ5A 2FZEA 4HX5A 2O3QA 2DLDA 1ZH8A 2PTGA 2PZJA 4J43A 4NI5A 3SBOA 1GYRA 3EUWA 4MO2A 3JQ8B 4UEOA 1I10A 3PWSA 2O23A 3GMDA 3QVSA 2GDZA 2VQ3A 2JAPA 2AW5A 3MJCA 4J7XA 4MOWA 4CMJA 3BHJA 2H9IA 4FCCA 4UVHA 1JVBA 1KC1A 4CJXA 5CHEA 1EBFA 1X1TA 4OO3A 3PJDA 3IL2A 2VRBA 2J5RA 3H9UA 2WEKA 4CR7A 4G5HA 3D7LA 1IULA 4BO3A 4RPHA 1RM4A 1EFKA 2UDPA 1DAPA 3CXRA 3GY0A 3PGXA 2DFVA 4BO9A 4NJMB 3M2PA 3S2FA 3BHIA 2OORA 4QUKA 1GUYA 1DIBA 2EEZA 1A5ZA 3FNGA 5DZSA 4FOOA 3MJSA 2EHDA 4PN3A 1JDJA 4O63O 4PG4A 2Y66A 3QA9A 4NU5A 1WXDA 3D5QA 1PEDA 1C0PA 3EVNA 4FIZA 4PLWA 4BGIA 2DFDA 1AHIA 2UYYA 5I9MA 4WPGA 2A4KA 1BW9B 1KEWA 2AQKA 1VJ1A 4N5LA 1SPXA 4FBGA 4BV8A 1HDCA 1Z74A 3OICA 4RL6A 4D41A 1ADGA 2CUKA 4JJIA 5LC1A 4IQ8A 2X0IA 3PHIA 3RUHA 4CQMD 3VH3A 2VRCD 5JY6A 2VTDA 4Q3NA 3WGIA 3CH6A 3KB6A 4ONEA 4YT5A 4ZQBA 3D0OA 3NGLA 3JQFC 1HT0A 2VHWA 5AVOA 1G0OA 4EJ0A 1LRLA 1TXGA 2C29D 1EMDA 4ZICA 2EWMA 5J23A 2BI8A 3U4IA 6LDHA 3OA0A 1E6WA 2CY0A 4EJ6A 2VT2A 2CNBA 1LLDA 5DDIP 4PRKA 1I2ZA 1I3NA 4BKQA 4CLOB 4PG7A 3DOOA 3DHEA 1PS9A 1XU7A 5U4QA 3SC6A 3HFGA 4GX5A 4I5FA 1GYQA 5JC8A 1V0JA 2IEBA 4EZBA 5TC4A 3VTZA 1UDAA 1U8FO 3BTVA 3HDQA 1PS8A 5AOVA 5TS3A 3KEOA 4FOSA 4JQCA 3GAZA 3CEAA 3VKVA 4CUJA 4MVJD 3SEFA 5KVVA 3I4CA 2FWMX 5EINA 4A27A 3AOEA 1JVSA 3ZCXA 1A9YA 2X5KO 3L4BA 4ZQEA 1TT7A 2E6UX 4GBJA 3W8EA 1DC5A 3DBRA 4OGWA 1I0ZA 3MWDB 2DTEA 4BNGA 4B3IA 1DRWA 3DBRB 4CMAA 3EW7A 4WUVA 3RJ9A 4RF4A 1E1MA 5JYFA 1E3IA 1K5HA 4ZQGA 8ADHA 3NYWA 4GKBA 4TRRA 4E33A 2PKRA 2H6EA 5TJ9A 5TT1A 3ZWWA 4AJKA 3IOYA 3QQPA 1X0VA 4GWKA 4WNIA 3U4CA 3NTOA 4AJNA 4LMPA 1XA0A 3KTDA 3PHLA 5L4LA 5C37A 2W98A 4PFJA 4E2WA 4XRRA 1TLTA 4ZD6A 1QLHA 3QWBA 4ID9A 4HUJA 4BO5A 5CEEA 1R37A 2CVOA 4FC6A 4K6CA 2ILTA 1B3BA 3D64A 4WCDA 3BTUA 1XDWA 2ZCUA 3PJGA 4GX1A 3BMQB 4NIMA 3FR8A 4HNGA 4GWGA 1BWSA 3JQ9C 3VZRA 5BSHA 1JLLA 1DJNA 2WWRA 3V2GA 4GSLA 4J0EA 3PPIA 4CM7A 2CDCA 2JD0A 4OYRA 4CODB 3A28A 4RF2A 3TWOA 1V3VA 2JD2A 4E5KA 4ZN6A 4R54A 2CVQA 1RYDA 1MG0A 3DFUA 5DCUA 3WIDA 4E2ZA 3FPCA 4Q39A 2HK9A 3JQBA 2NVUB 1PQWA 3FI9A 2WMDA 1K6IA 3S2IA 3GPDG 7ADHA 4NK4A 5A05A 3RC7A 3GEMA 3QSGA 1J5PA 4DVJA 1SCUA 3RBXA 3DOCA 4H15A 5DBFA 4ALKA 2O2SA 3F1KA 2HK7A 1I8TA 3K30A 1BXZA 5G4LA 3ZNOA 5IG2A 3KLMX 4W4TA 4DLLA 2RIRA 1LLQA 5BNFA 4R01A 3RC2A 1FMCA 3B1KA 3RC9A 1I2BA 2PH3A 3JQBC 1Z45A 4CUZA 3VPFA 3WX0A 5K6AC 3PWKA 4BNVA 1IZ0A 4AJEA 3CTMA 3L0DA 4I9HA 3TZKA 3AY3A 4MVJG 1E7QA 1EDOA 2DTDA 3DAGA 5ENVA 5AXBA 3M1LA 1LRKA 1LSUA 3HDJA 3OEWA 2GN6A 1E7YA 4K6FA 5EIOA 3ZNPA 1I3LA 4HV4A 4E5NA 2CD9A 2JHGA 5HM8A 1QYDA 2D5AA 4IGEA 4ALLA 1LUAA 4NBVA 5A9TA 3WNQA 4FS3A 4XX0A 4BUCA 3FNEA 2AG5A 3CMCO 3OJ0A 5AQ1A 4R1TA 3TOXA 4E5YA 5FEUA 2FSVA 1V8BA 3Q3CA 1F06A 5A5EA 3VOSA 1K2WA 4P38A 3V2HA 2OZPA 3WLFA 2J3JA 4IJWA 5AXAA 2X0RA 3FRJA 5A06A 4TROA 4FR5A 2NVUA 3I23A 3V1YA 1LX6A 1DC4A 2YUTA 4YT2A 2GYYA 5JYEA 1ZBQA 1CQJA 3PVZA 4JBIA 1U28A 3GHHA 3E18A 2EW2A 3MOGA 2ZJ0A 1FDWA 3VH4A 3SLGA 1QSGA 1PS0A 5T5QA 2R6JA 1WDKA 3DC2A 3UKOA 3ZV5A 4MIYA 2OBYA 4O1MA 3DMTC 1PWXA 4FFNA 4TVBA 4RQTA 4N18A 1IUKA 1O95A 2FN7A 3FWZA 2WE8A 1HYHA 5IF3A 1UZMA 2R00C 2GPTA 4Q3EA 4YAKA 3JQEA 4BQRA 3VC7A 4DLBA 4GMFA 1GQYA 2I66A 4RZHA 4YT4A 3ADPA 4I9UA 1KY5A 4E32A 3QVXA 3ZWCA 1JA9A 4O5OA 2G1UA 2E37A 2RHCA 2Q1TA 1C3VA 3UXYA 1NQAO 1EE2A 2Q1SA 4KWHA 4NR0A 4YAJA 2UAGA 5TT0A 3X2FA 1ISJA 4OSOA 3LZ6A 3U4HA 4OQZA 4MVJM 5H83A 2W4QA 3RI3A 5EERA 4ND5A 1YL7A 1DC3A 4PLFA 4CM8A 3WBBA 2PK3A 1A72A 1EUZA 4QFDA 2VCYA 1ONOA 1RM0A 3E48A 1J0XO 3OJEA 1JAYA 1U2GA 4FFMA 1NPYA 2Q3EA 2FMUA 2DPGA 1WVGA 4JBHA 4XGNA 2WYWA 4L75A 4CPDA 1A7KA 1Q7CA 5CG1A 2J3HA 3N7UA 3LC2O 4IDEA 4A2CA 1ZXLA 3NDRA 3QRWA 3NDJA 4CL8A 1L7EA 4UULA 2I3AA 3RBVA 4URFA 3JYOA 4CR8A 1VJTA 4PLGA 1I33A 3G3EA 2O3UA 2O3RA 5CPFA 3PIDA 3C7CB 2EW8A 3G1TA 3ZU5A 4YRBA 5JLAA 3RUEA 3K96A 4NQZA 5AYVA 3Q9UA 3WR5A 1AN9A 2IODA 4RO0A 4BNHA 1Y8QB 3E9NA 1NPTO 3VPHA 1Y8QA 3OBBA 5K6AA 2FR1A 3OJFA 5IXSA 1PZEA 1DBVO 1GCOA 1ZFNA 4IZHA 4DL9A 1PZFA 2YV1A 1IHXA 4IJUA 4KUHA 4IM7A 4EYEA 5KJFA 2NVWA 4QO7A 1LDYA 3QW2A 1E3WB 1JWBB 3G49A 3GVPA 3OH8A 1DOHA 2B83A 3UH1A 4IDDA 2DUUA 4PLYA 1VRWA 4DPKA 1PQUA 3A06A 3BXXA 3WQQA 2UVDA 2V6MA 1E3SA 2NTNA 4XR4A 3UGKA 4OAQA 2O48X 5EL0A 3DBLB 1EQUA 5IFLA 4Y67A 3MJ4A 2GGSA 4DPMA 1LJ8A 1VPDA 5KJEA 5EN4A 4XDZA 4BO0A 2EGGA 4YVFA 3L9XA 3WGOA 4TKMA 3HZZA 3MWEB 4R68A 2VOJA 1XU9A 1MG5A 2VYVD 1DIAA 5FWNA 1KVTA 4WECA 2C7VA 4QO8A 4CMIA 3STHA 3VPXA 2OBNA 4Z3DA 3DFZA 4NJMA 3A1NA 4J0FA 1PU2A 1WPQA 1UAYA 1ZVMA 1DO8A 4PLHA 4FFRA 3I9JA 3ITKA 1BGVA 2JD1A 1YQGA 3DL2A 1S6YA 1U5AA 4Z0TA 4BB6A 4B3JA 4WGGA 1H5QA 4E0BA 3GUCA 4XWYA 1FXSA 1PGJA 3DHNA 1PGPA 5EJ2A 2P2SA 1Y5RA 1VC2A 4BNZA 3NRCA 4E4YA 3KYCA 3PI7A 4NHEA 5KWEA 1C14A 4OSPA 1HYGA 1PWZA 1R6DA 1DXYA 2XF8A 3ADOA 4BKPA 1OC2A 1HDGO 4XYLA 2PD4A 5IXYA 1K89A 1IOLA 5EPOA 3PDJA 2OXIA 2Y0CA 1ZEJA 5JSFA 4M89A 1OBFO 3KETA 3GQVA 1ENOA 3E5RA 3OIGA 1EVZA 4XJSA 4D79A 3W4IA 5COBA 1OFGA 2X8LA 2B5WA 3K8ZA 1E3EA 2CF5A 2POQX 3UVEA 2WYUA 3C7AA 4L4XA 5JAQA 1C0KA 5IN4A 3PFFA 2CMDA 2VHXA 2Q50A 4XGIA 4PZDA 3P7MA 2YY7A 1KS9A 3PTZA 3H9JA 2VZ9A 1YH3A 3QVOA 5L53A 5FF9A 5H81A 1XHLA 2PH5A 3MCVA 1GZ3A 3QIVA 1EUDA 2GUGA 3K2EA 2DQ4A 2WTBA 1GV1A 3PZRA 1O94A 3JQGB 2B0JA 2C59A 3GDGA 3JQ7B 4RVSA 3JQ7A 3JQGA 3T4EA 1SOWA 3DZGA 5C3MA 3GF4A 4RVFA 4CL3A 3NUGA 3QJ5A 2BD0A 3FNFA 2VRCA 5GZ6A 1M67A 3VZQA 4MVJF 4WLEA 3ZH2A 3IUSA 1BDMA 4KUGA 4FGSA 5B1YA 3RQSA 3MOIA 1E7RA 4CM9D 2PZLA 1UJMA 1Z7EA 5TRTA 1QP8A 3ONEA 2WDZA 3TJRA 1IPFA 4YR9A 5TLSA 2IDZA 2G17A 1DFIA 3TFQA 2Y93A 4TZKA 3HSKA 2B4RO 3F5SA 4E3ZA 4J1SA 4BOYA 4YEDA 5L7YA 2AA3A 3ZWYA 3PIIA 5L7WA 4H3VA 4CV0A 4I5DA 2D2IA 3FTPA 4K9DA 4IBOA 4KWIA 2GLXA 4ND4A 2HSDA 3AM3A 1X7GA 3RFVA 1RYEA 3B1JA 4FFOA 4WEQA 4BKUA 1NWHA 3GGGA 2SCUA 2NU6A 3AU8A 1PJSA 2FP4A 5G2OA 4AJ4A 3WXBA 4YYZA 5A1TA 4OM8A 2V7PA 4AJ2A 3U5TA 3P2OA 1X14A 3OFSA 4I9NA 2BI7A 1R0LA 3C1AA 2PD6A 5JDIA 3LF1A 5A04A 4PLCA 4JCOA 2VYVA 1QRRA 1AUPA 4OKNA 3DAFA 2AHRA 3WTBA 4IJVA 1MP0A 2JL1A 3AW9A 4NFHA 5IZCA 1FDSA 1NYTA 4D44A 1VE9A 1RM3A 2HQ1A 4BNWA 2DM6A 3UUWA 3MEQA 4H16A 4QEDA 1F8FA 1GQ2A 1H0KA 4RF3A 4MPDA 3M2TA 4LSWA 2BRUA 3GMSA 1UAGA 3ASVA 4IIUA 1UXHA 3AJRA 3IP1A 4MVJI 4FJ1A 1PX0A 1B15A 4GAEA 3ZWNA 4LMRA 3R6DA 3ZHXA 1PL7A 2A9FA 3GVCA 4YDRA 2Y1EA 1K0UA 4XJTA 3ZU4A 5L51A 1PR3A 4HFMA 2NQ8A 3Q11A 4QFCA 3S1LA 3AU9A 4CMEC 2P5YA 3UFXA 3PLRA 2GCGA 3MJTA 3WSWA 5C7OO 5KJ1A 3U09A 4ZGWA 1ZUD1 4BNUA 4MKZA 1ONNA 4WEOA 3FHLA 3ZWMA 1CQIA 1Q2XA 1NVGA 3DZBA 4B7CA 2JHFA 2EG9A 3OMLA 4CMKA 1QYCA 1T24A 1QR6A 3FF4A 5CDTA 5L9AA 1T25A 2NM0A 1WLYA 1GEGA 1HXHA 2J6IA 4OIMA 5F5LA 1Y81A 3V5NA 1C1XA 1R12A 1X7DA 4OL9A 4U5QA 4MIEA 3NV9A 4AL4A 5TJHA 3IQDB 2RH4A 4LSMA 1GADO 1D3AA 2BFOA 3AY7A 3U49A 3ENNA 3AI2A 5T57A 1ZJYA 1OAAA 4LRSB 4XYEA 3F46A 4L8VA 4XYBA 2VNAA 1L1FA 2PFGA 3SJUA 2YW9A 3AUSA 4LCEA 1LDBA 3L77A 3B70A 3SLKA 4XB2A 1D8AA 3F1LA 4D0RA 1KC3A 5JDCC 1JKFA 1ZSNA 1DJQA 2C20A 4FB5A 4AFNA 2Q2WA 3KO8A 3NAQA 2QRJA 4BNLA 3OSUA 4IGFA 5I7EA 1E3LA 2OUIA 2JAHA 3MJEA 4M87A 4RF5A 4WNCA 4BHTA 4BNFA 3T7CA 4FGWA 4WCFA 3I9KA 1KOLA 3CSDA 1LU9A 1O9BA 5CAEA 4EEZA 3FN4A 3TZ6A 1XLTA 3GOHA 5JE8A 4JLWA 5BSGA 2P5UA 5G0VA 3ULKA 2X22A 2Y1DA 3A4VA 4UUNA 5MGBA 1H6AA 2P68A 3HUDA 1KERA 3D3WA 4IS3A 3RWBA 5DP2A 3SXPA 3WGZA 2DBZA 4P4GA 4XA8A 4AJHA 1B8PA 1U3UA 2ZCVA 1TVEA 1H6DA 4RDIA 5DOVA 4DQUA 1P0FA 3UCEA 5JYDA 3PFWO 1XG5A 2VZ8A 2ZIZA 4R5HA 4LGVA 4CM8B 2EGHA 1KVUA 4R3NA 2VT3A 3F3SA 4XEHA 1B8VA 4IINA 3E5MA 1P9LA 4O59O 3WGYA 4CUKA 4CMGA 1KBZA 2YQ5A 4NG5A 5CDYA 3H5AA 4MP3A 3ZHBA 3HQ4O 3W6ZA 4QSMA 3RFXA 4BMVA 1OI7A 3NTRA 1JTVA 1ZSVA 2OHXA 5ILGA 4RCVA 3T7EA 4BV9A 4AJIA 4EUEA 2EKQA 1XSEA 1NR1A 1KEPA 3TNLA 4Y98A 3KSUA 4E30A 2HAEA 1QXSA 2WSBA 2YHIA 4IMRA 5LDGA 1YQDA 5A9SB 3A14A 1PJ2A 1LEHA 2YDYA 3GZ4A 2WYVA 1YWGO 1YQXA 4BKRA 4UUMA 2YQ4A 3IAHA 5U1PA 5L4NA 4AICA 3Q2IA 4PIVA 4GI2A 1HYEA 3E03A 2Y67A 4GLOA 2O4CA 4D3DA 1IYZA 4DPLA 2E48A 2DBRA 4RVUA 2F00A 4Q3DA 4KUEA 3IS3A 4L4RA 2IYPA 2HJRA 3DWFA 2O3JA 2NWQA 2IZ1A 3U3XA 4IQGA 4QT0A 1TI7A 3U0BA 1RM5A 1HZZA 4FPXA 1VL8A 1QV6A 4B4VA 2ZYGA 9LDTA 4BB5A 4JBGA 3GN2A 1KIFA 3H4VA 1E3WA 3WGTA 1NM5A 1HDOA 2C5EA 2PZKA 3AUUA 2E82A 3B6ZA 1E1KA 3RUIA 3NT5A 5IJZA 4HWKA 2FPPA 5B4VA 3CINA 4YQZA 5ITVA 5KOIA 1CRWG 2BF7A 3I5MA 2QZ9A 5AXDA 5JAMA 3W6UA 3RASA 3WQRA 4CQLA 2BKAA 4RLSA 5L45A 1U2DA 5TGDA 3RROA 1VKNA 3WGGA 1L7DA 1U8XX 5I9NA 1P1HA 1ADFA 2VOEA 2HK8A 3P19A 4IPTA 1UXJA 3HN2A 4K28A 4DQXA 1XGKA 1NX6A 3GVHA 3V8BA 4BMSA 1C0LA 4JP2A 3DB2A 1GUFA 2CSUA 3I9OA 4A03A 3F5QA 5K9ZA 3CMMA 1SNYA 1N1GA 3O4RA 3QP9A 2WM3A 4PLZA 3KYDA 1E6UA 4YBZA 2C0CA 2V6BA 1ZZEA 3D1LA 3AWDA 4XYGA 1DRUA 3TOZA 2QW8A 2H63A 5A3JA 2X9VA 5GY7A 5H82A 3KZVA 2Y68A 5I7FA 1U3TA 4BO1A 3RC1A 1GZ6A 3K2BA 1XELA 1XWFA 4WLVA 2IRWA 3A9WA 3WQSB 3AM5A 4ZRMA 1ZIDA 3H5RA 2J3IA 4KQXA 3VPGA 4L4SA 3MJVA 3ZGYA 2RBEA 5G4KB 3GHYA 4IDAA 4ITUA 4PG5A 1U1IA 4OKIA 2C07A 2UV8A 3ETEA 3BMCB 2IE0A 1T2AA 4DMMA 3I9LA 1CEQA 2WD8A 4J1TA 1NFQA 4ZHSA 3E8XA 3AI1A 3KOUA 2JFFA 3F47A 3RAJA 3W8DA 4YJGB 1O5IA 3F6YA 4BO6A 4E5MA 2E49A 3UF0A 3MTGA 5A5FA 2X5OA 2FPGA 1E7SA 1V6AA 2V6GA 3UAGA 3GG2A 5L7TA 2O3TA 5ER9A 1YL5A 3VDQA 1ISMA 2JJYA 3PK0A 4LVUA 2UUOA 1HE3A 3HDYA 2Y0DA 2BH9A 2RHRA 4QX6A 4HBGA 4GMGA 5A03A 3OECA 1BXGA 1ENPA 5LCXA 1Y1PA 4J4TA 2HMUA 1BXGB 4JX8A 5ENDA 2VUTA 2X7HA 3GLQA 3KM0A 4W9NC 2CF6A 3TSCA 5BNTA 1AE1A 2VTEA 4FN4A 3RJ5A 1NQOA 2QIOA 1F14A 3GVXA 2ZTVA 4LN1A 1WP4A 4HFJA 4HNHA 3QWFA 3KBOA
chains in the Genus database with same CATH superfamily
1ZUNA 2XW6A 3HVIA 3KYIB 4FX2A 4WY2A 1LDEA 2ZJ3A 3CYFA 3MGKA 1OYYA 4E70A 4G1CA 5FTMA 1JAIA 1XD2A 2JI6A 3AKEA 3R5KA 3EJ6A 2Z5LA 3VPSA 3R75A 4Z53A 3NM5A 3TO5A 3M82A 3USES 2G83A 5FRDA 3R3SA 3QKIA 5DNAA 3SIXA 2X5XA 4LJLA 4A0GA 3OPYA 5DULA 3C3BA 3TLCA 4BVAA 4B4DA 1E9SA 3GT4A 1E2EA 2GNAA 3QBVA 1YZHA 4ZYUA 4IX1A 1W4ZA 1F3LA 2W6OA 1XROA 3OIYA 4GX2A 3R6WA 4HGYA 4ER6A 2HLNA 1JR6A 4OBXA 2GYUA 2RJOA 2VPPA 1YQWA 2WUGA 1A9XB 1FL9A 1QFMA 4UW9A 4BVGA 4FFWA 3AQ4A 3OOEA 3HR8A 2Y2VA 1X8LA 3SSAA 1VQ1A 3H99A 3ZGLA 2BMDA 1EE9A 4LDPA 4IUDS 4DMLA 3H2ZA 4IHJB 1PP4A 2HMWA 4I2NA 2QMOA 1RWWA 5HTOA 1PJCA 1BRTA 2BFMA 5C8VA 2A5LA 3HEBA 4D9MA 2VNSA 1W5FA 3CR3C 4MWOA 3MRXA 1PN3A 1QLWA 4LHZA 5JMTA 2JFXA 2NZYA 4K9MA 1IVSA 3ETDA 1FU8A 3UMGA 1OXMA 4QYWA 1E0AA 3PC6A 3NX4A 1PZGA 4N5NA 1XTRA 2WPDD 3LU1A 4RTNA 4K8RB 1R6TA 4Y6RA 1YDGA 2D5CA 4B6FA 2Q6OA 4NCKA 1E4YA 5AHXA 3PL1A 1VE1A 2I3ZA 4QU0A 3UAZA 3B7GA 3PUVA 1YBHA 5AUQA 3OD1A 2R4UA 4M4SA 5IPFA 1I13A 2I4RA 2H5LA 2B3TA 4XEUA 3OY7A 3UCXA 4GKKB 1GDDA 3MQFA 1MFPA 1RFGE 2GM3A 3WLEA 1JBQA 2ZVJA 4QOIA 3T4PA 3HJUA 2REQA 4LOLA 2PSFA 2HT1A 1JLSA 1V5FA 1U7PA 4GOKA 1EFLA 1EVKA 4Q03A 4EYKA 5HKBA 2LKDA 4KOAA 1VIMA 1N5DA 2GRJA 3WLLA 1RLIA 1KH3A 1C9MA 1L7NA 4JP3A 3G5MA 5ALNA 3KU1A 1BEEA 1C9JA 1YA4A 1SULA 3CCFA 2AMJA 3HO8A 3LIIA 4RHCA 4RM3A 2GZMA 3P2YA 1T2DA 1EVQA 4MZXA 2P2YA 1K6EA 4XWWA 2WWTA 4DBLC 1OA0A 2CFRA 3CRNA 4CT5A 4PCUA 2WTNA 1KU6A 1OTYA 1JQAA 4MB0A 4PGHA 1R50A 4BNTA 3ANTA 3IDOA 2G08A 2XCRB 3RS4A 1KO1A 4M46A 1R5NA 4M0UA 2ZRPA 4XWTA 1KQNA 2LIPA 1PR0A 1KE2A 1K3TA 4DR5B 4KPYA 2WMNB 3IBFA 3SY8A 4NYMR 2VK8A 1M2EA 1TOAA 1Q6YA 3IJEB 1HUQA 3KQOA 4L07A 2FPIA 3JQCA 3QM1A 5BXYA 5CA1B 3GBPA 4RHFA 1ZXXA 4QL3A 4K9NA 4ZC1A 2QX9A 1Y7PA 2JLRA 3QA3E 1NOKA 4FU0A 4XM0A 2QA5A 1F5NA 4XJXA 2R65A 3C43A 2H0AA 4XCVA 3RTCA 2X1MA 1A9PA 2OGWA 1A9QA 3VO2A 3ESYA 4WXYB 3QVVA 4QARA 1VCMA 1L5YA 3QTBA 1SQ0A 1TEHA 5FOWA 3SSMA 3H3FA 4YJHB 1Z4OA 5KYNA 5BV2P 4E2XA 1GQOA 1R9NA 1TU4A 1WBDA 3EZYA 2W8BA 5J2TB 2J0EA 4L85A 5FR1A 3LC7O 4QT4A 2MSDB 1RHMA 3OF5A 3RVQA 2YV5A 3BILA 4UTZA 3RD5A 3TFOA 1PVOA 1MC8A 4BYGA 1GDTA 1LI5A 1RYZA 3WLRA 2FFHA 2OR3A 1C30B 1L1RA 3VJLA 2HA0A 3DSRA 3NKVA 2WIGA 4BMZA 2YKGA 3W9UA 1DAMA 4Z54A 3IEXA 3E82A 5A4AA 4JENA 5CYOA 1SBIA 1WR8A 3ED5A 1SG9A 4DLTA 1C9KA 2CL7X 3GLHE 2HRCA 5K09A 4TRNA 1OZGA 5EWMB 3GCDA 3TKAA 2IT1A 3BE5A 1BH2A 3BRCA 1GCUA 3AZPA 1B2RA 2EFEB 3BSFA 2OGUA 4GXQA 3QYPA 2ZRCA 3KELA 3DOJA 4X7RA 2WK1A 4I55A 1QHSA 4II3A 3DE6X 1C3JA 4HLCA 4HC4A 4HZIA 3B1ZA 2QL5A 3GELA 1N92A 5HZKA 3KKMA 5KHOC 2J0SA 1Z0SA 1WXHA 3PXCX 3O31A 1QGUB 1DBPA 2GETA 2QUKA 3O0DA 4HLQB 4KQGA 1T36A 5B53A 4X93A 2DH5A 1U31A 4A5SA 4TKVA 4WXPA 5CB0A 4EAQA 1ZM9A 2C97A 3GLHA 1XE3A 3JCZA 3KKOA 3TAUA 4F4DA 5JJCA 1T2FA 4B3XA 2B0CA 5SY4A 3L6CA 4JBNA 3PDIB 2GXQA 4HH0A 2TRSB 4RKEA 4MVWA 2VF2A 4JVMA 3ZY5A 3H6HA 2LE0A 5A2GA 1W85A 5IT4A 2YZ7A 4Y9UA 4UTVA 2K7FA 2YZMA 4MUMA 1RJEA 3C5CA 4LKRA 5DLPA 2FUG1 4S0XA 1N5OX 3F6SA 2QP3A 2QN2A 4MS4A 4J7AA 3RRYA 3TAXA 3QHQA 2LDXA 3OJXA 3UHAA 3IODA 2VJCA 2Y1CA 1NI3A 2FRXA 3B1YA 1FTYA 4J16A 3BL8A 3KRTA 1B42A 1KK3A 3BDIA 4M37A 1ADBA 1QIIA 3GNLA 2ZUTA 5EHXA 3DR5A 3GJQA 4OI2A 2C82A 1Z4KA 4JSRA 1O57A 4AZ3B 1XTKA 3FNHA 1TQ4A 3ELWA 3L5KA 4O4LA 4J91A 1VCIA 2PO5A 2JNWA 3FPLA 3PJEA 4K03A 4MW0A 4QQFA 2CDAA 2V3WA 2YXDA 1D7OA 4OH1A 2VDWA 3DFFA 1EGVB 1Q44A 3Q9NA 4MINA 3GDOA 2ABWA 4HFRA 5AI8A 5DT2A 3CHYA 1I36A 4UU7A 2WYHA 3NHJA 1SC4A 4PZZA 1YOVB 3DA8A 2HWYA 3AMVA 4BO4A 3B3FA 1VPTA 1Q83A 1XFDA 2PPVA 3HN6A 4MRAA 3B7WA 4D0LB 3E9QA 2JGMA 1E9BA 4PNHA 5EP2A 3DFIA 3UJBA 4F91B 3DMPA 3N2IA 1QYXA 5IBPA 4PZCA 3WHIA 3IUEA 3F7OA 5GMOA 2VXOA 2BEKA 2A9PA 2O8CA 5D5HA 3S7ZA 1E2LA 3L4KA 3A4TA 1DDOA 2ZB3A 2ZSKA 3L41A 3QVKA 1MVLA 3ZYZA 2X3UA 3LM8A 3L7BA 4WNYA 3EYWA 2X9LA 5LOVF 2MSKA 1RC1A 1NHWA 1Z0JA 2I65A 1UL1X 1AIPA 2IU0A 3F6BX 1I4OA 3LSYA 5IDVA 2QYSA 3FNBA 5DP1A 1C4KA 1PUIA 4L15A 4YNBA 5LBTA 2VF8A 4Q37A 3KVOA 2ZUUA 3BC1A 1FQKA 2IH5A 4YRSA 1I0IA 2CGEA 2X0NA 1Z4MA 2NYVA 4LQDA 4Y6QA 4PHHA 4CLHA 4URVR 4KRYA 1TYZA 4Q0MA 4KQCA 4FONA 3RRXA 3JSAA 1ZITA 3KUKA 4ZHQA 4LYAA 4QQRA 3WK9A 4IXNA 1EM6A 4NYIR 3OOHA 3C0KA 3I8XA 2IHJA 5AMXA 4X92A 4EENA 1YS1X 3A04A 1Q0UA 1D6SA 4AS1A 3G8DA 1GZ5A 2HEIA 1KJ8A 4ERXA 3CISA 5KYUB 1ZR2A 5HE9A 1M5RA 1LPPA 2FRDA 1QF7A 1XZFA 4M1TA 2R87A 4K2HA 1VL5A 4DCSA 1GILA 3IYLW 4AJPA 4Z1MD 3SHOA 3N2EA 1MA3A 5LP1A 2LCIA 3S8MA 2WLTA 3LCUA 1Y80A 1SVMA 1BVUA 3WGUA 1JQBA 4EKGA 4KTTE 3N8IA 2FZCA 1XP5A 2V7QA 4H1TA 3AVUA 3ECAA 4HTFA 4PO9A 1D5CA 4B83A 3ENZA 3HU5A 2XQVA 2WPDA 3LPCA 3H65A 5CT8A 3H87A 4LI3X 1AZLA 3THXA 1JQLB 4TQGA 1NXQA 4A73A 4KFCA 5HCNA 3AF3A 3GLTA 2DPYA 1ZA2A 4RORA 2YJ5A 5HR5A 4X20A 1I5OA 1JT9A 5HSGA 3CLTD 1T2UA 4RD1A 5LZ2A 2JANA 4X91A 5HUHA 3ZBTA 4POOA 1SQ5A 4MLPA 2VAWA 1Z83A 4R51A 2VP3A 1QQ5A 2HI0A 1L5NA 3FAKA 4Q93A 3ENQA 4OHCA 2ATIA 4BLUA 4BNDA 1VJRA 8GPBA 1Z2AA 2PUHA 1SKAA 3SG0A 3EWNA 3AUYA 4R71A 1QIMA 5DYTA 2I78A 4RIHA 3TSAA 2WM9B 1TT5A 4CLRB 5JNLA 2NNLD 2IZ5A 1ODKA 5BQFA 3HN7A 3L6EA 4O6VA 1E60A 3O4FA 2ODTX 4FMCB 4RS4A 2GTPA 4C30A 4CF3A 4ER7A 1Q7GA 1YDFA 3WTCA 2A9RA 3L7LA 2X0JA 1SWVA 5KCZA 5KSYA 4ESVA 3G8YA 1NJ5A 4E31A 1OWNA 2HDOA 2O8FB 4HADA 5AVQA 4G0PA 3NETA 4RK6A 1BFKA 4B6QA 3CLTC 2G8LA 3WK8A 3BREA 1V8ZA 4GR5A 4F2WA 7MDHA 4PC1A 5KTSA 2WHQA 1OYVA 5C8YB 3IQEA 1RJ9A 5JI2E 4M1KA 1TQ2A 3B3GA 1RR6A 3T0IA 4PPQA 3P32A 4HY3A 4M1QA 4X95A 5TEVA 4FHEA 3KUXA 2Q5LA 3IULA 1P8AA 2HX1A 4DDVA 4FC7A 4GDMA 1NJ1A 1V3UA 1TKRA 5IN5A 1NY6A 5A7FA 4MKRA 5FOQA 5FD8A 1CG6A 2VSNA 2HMVA 3R5FA 4FJ2A 1WUTA 3LBAA 4RH1A 3IQGX 4W9RA 3Q3JB 4GKAA 4JN6B 3MILA 4K9KA 4P0TA 4MUFA 3PTAA 3WMRA 4IO0A 4HDOB 3ZUPA 3OUUA 4ANFA 1FUKA 3RIGA 1P0PA 4D42A 4UTOA 1GR0A 4OGKA 4JYZA 4DB2A 4KHPB 3SX2A 1UK9A 3OPNA 1NAIA 4NBUA 2CXHA 2QVBA 5IKEA 5BURA 3N87A 2EFHB 2OP0A 4HT3B 3TG8A 1JAHA 1JYFA 3B5JA 4XFJA 1ZEMA 2P77A 4LTMA 1GV0A 2UXBB 1JR3A 4NU6A 4ZJYA 4ZV7A 1YAJA 3WDLA 5AOBA 4C7OA 4MH0R 3G2LA 1NULA 4G36A 4OKSA 2X76A 1C1DA 3BSSA 4G0OA 5TQVA 2GK3A 1W0KD 2XYVA 1TQ8A 3WOHA 1WW8A 1UPXA 2V5VA 4JEUA 3WICA 1E9FA 3PP8A 2H4HA 1N7HA 4HUQA 2XWBF 3THYB 5ERXA 3QF7A 5U9CA 3TOVA 3EA0A 3IP3A 5T73A 1LLCA 3LTEA 4FKBA 4K7JA 3WOVA 4EITA 1RYFA 2HU2A 4PZYA 5AIAA 3V4FA 3FCOA 4DWOA 5JNTA 2Y0PA 4WADA 5IBRA 4B8WA 1J39A 1UADA 1PL8A 4DJEC 2W70A 1AG9A 2O1XA 2QRHA 2HCJB 3RKSA 1JMYA 3P26A 1HDXA 4NE2A 4A26A 4MWCA 5BVHB 4W5HA 2NVBA 2FQQA 1CQWA 4HZUB 4OB8A 2ZYSA 1EK6A 1BE6A 4N8EA 2IHKA 3TOCA 1LJLA 1UT6A 2VJMB 3K35A 1XLTC 2YY6A 1UC5B 4ZZIA 2JC3A 3B78A 3B8HA 4OL0A 2PRJA 2X9NA 1OREA 3RRZA 1PFWA 4N0MA 1L8QA 3VAAA 5FI1B 2C4NA 1Z7YA 1FP1D 1DJMA 3LKVA 1P6UA 4NL4H 4RJKA 1C8LA 1RPJA 1XOIA 4GOOD 2QLFA 4DGSA 2J9GA 2O57A 1EQAA 2IYTA 4ZVSA 5HBRA 3ENKA 3ILYA 5EPEA 4J0DA 4EW6A 5J9GA 2Q1WA 1PUJA 4UVGA 5EVJA 1ZD4A 2CEAA 2ZYWX 1Z5OA 3IB3A 2LV8A 4PR0A 3MGAA 4QUIA 1J70A 2ZATA 5AVTA 5AM2A 3LT1A 3E58A 2G5GX 3W3AH 3P97A 4BFLA 2NADA 3PQ4A 2DAPA 2AK3A 5BYKA 2V1UA 3EGOA 4NCNA 4Q3BA 2JHPA 1T4DA 2GJSA 2V1XA 4HNRA 1WXXA 1YJ8A 5J2TF 4KYVA 4PG8A 4YJFA 1I4DD 1RSZA 1VG9B 3EP6B 2BIFA 2RGUA 2X2FA 2C77A 1FFHA 1AM4D 4HYYA 3RYFB 1S01A 4LY9A 3OLZA 3LP6A 3AW8A 2HCRA 1A8IA 2FW6A 3W78A 3DEJA 5EMJA 3VNSA 3MMNA 2NYAA 3C3MA 2V8BA 3LK7A 2FOIA 5GJVC 5ICMA 1EFUA 3PNMA 5DKFA 4QTXA 3T06B 2WOOA 1SK9A 4DCGA 4E13A 2DLNA 5JS1A 2NU6B 3ZU3A 1IM5A 5IAJA 3DF7A 4DDHA 4HNSA 4F46A 5FOUA 1RXYA 521PA 1X3LA 5DGIA 1RBMA 2IC5A 2JJ1A 2P3OA 4AX4A 1DRVA 3R6LA 1E2PA 4IYJA 4JB3A 1JDBB 2A3NA 2JIQA 4MCAA 3WE7A 4JGBA 1ZK4A 1GKKA 1BQEA 3HRHA 4LDZA 3E7DA 3I64A 5ILQA 3PU6A 4OQLA 4QZVA 5KNLA 3NXKA 1UDBA 3CONA 2OAP1 2YNMD 4UASA 4JKOA 1Q0RA 2O5CA 2YHAA 2FMTA 4ZOLF 2G72A 1PZHA 1S5PA 1E6CA 2XKBA 4NOLA 4BN0A 3INGA 1W2HA 3FUVA 2COKA 3I3SR 3IAAA 5CA0A 3UAVA 1ENYA 2NTEA 2Q0QA 4J0IA 1A9ZA 4C2UA 1YZGA 3G9TA 1M6WA 3STUA 4WFJA 1M6NA 4WCFC 3Q8XB 3L5OA 2C2MA 4RD4A 4TTTS 3HADA 3PXGA 1GL9B 5E3IA 3LPDA 2BGIA 4NK5A 1NF8A 1QZZA 2AJLI 2QLJA 1HZJA 4ZI7B 4O4JA 3MZ0A 1KY2A 4ZJUA 1IEXA 1SIUA 1M74A 1RJDA 1U6IA 4RPLA 2H54A 3QPBA 2QG4A 3O47A 3U3ZA 3DZ2B 1D9XA 2O9JA 2QW0X 1Q2UA 3P2IA 4B9EA 5F23A 1HR0B 2QYTA 3V34A 1OSNA 2P1ZA 2HMAA 4YP6A 4P3XA 4I99A 3LC1O 4LZNA 2RGXA 4PYIA 2FSUA 3H6KA 3JQ6A 1XPRA 2Q2VA 5DNVA 5I8WA 2FPIB 5E9WA 1Y37A 1BOOA 3R5JA 5EMLA 3ER8A 2I6QA 1ULBA 1D2MA 2ATVA 4UXHA 1QS0A 3DWIA 3ZUGA 3KHSA 3LRPA 1XZJA 2EP7A 1MOQA 2FN4A 2EJVA 2GCPA 1FPQA 2QUIA 3H4IA 3RU9A 5BY2A 3ZBQA 1ZMOA 5IDXA 3CVJA 5IYZF 1P45A 1Y8ZA 4MVJA 2VFAA 2W2KA 5FFFA 2NV2B 3VYSB 4DGQA 3THWA 5ILOA 5EWJB 2R8ZA 1PK9A 1IXRC 2FX3A 2YMMA 3WWDA 3GLSA 1RXCA 1OIXA 2Z30A 4MGZR 4QA9A 4DWJA 5IYZB 4P2GA 2DBQA 1YDEA 2GCNA 1YACA 4G85A 4HWPA 4N3BA 4XIYA 3UHFA 4ER5A 5K05A 1BCSA 1AUVA 1GG2A 1XQYA 2ACWA 4IIVA 1M2VB 1KO8A 4GIBA 4Q6BA 2PLAA 5EKDA 3UMCA 2EKLA 5JARA 4OQMA 4EQ6A 4MWGA 3LC0A 4KU4A 4RX1A 1VA5A 3O73A 1KEVA 3B6MA 4I36A 4PVCA 2UZ4A 3CUWA 4YP7A 3OJOA 3P5SA 4HTAA 1DJPA 2Q4BA 1RMQA 2H07A 2R5NA 1V6SA 3OETA 5HMLA 2D13A 4C88A 3I1JA 5DTEA 2DBVO 4MQLA 4YCAA 5KNBA 2NTYC 1D2NA 1VMDA 1ZGJA 4R84A 5CJJA 1AQJA 4UZSA 1LA2A 1IHUA 1LF5A 3NVAA 2XCQA 1KYQA 2YCLA 4AY6A 1ZUIA 3T3HA 2YFHA 1QK3A 4JNCA 5DM2A 4F2PA 4DYHA 1V35A 1A27A 2YJ4A 1Z0KA 4JOQA 5C46F 4RMGA 4J2OA 1CERA 2O6HA 4MXDA 1JEJA 1VKOA 1P1CA 4TXNA 1EWQA 2C95A 1E8DA 1QKIA 2J31A 2VK2A 2IF0A 3D1VA 1LDMA 4NBWA 3VYRB 5FTNA 3G5TA 5ARCA 1EVYA 5CH3A 5A4DA 1BVRA 2WAYA 1Z3IX 5I7WA 5JC1A 2P75A 3G9QA 3R7WB 1O4WA 3INRA 8OHMA 1DIHA 4N3CA 5FI0B 4YJ2A 1D2AA 4GVXA 1JL3A 3KAKA 3ZVNA 1POXA 5REQB 3ETJA 2Q6LA 3RM3A 1Q0ZA 4D8UA 3SF8A 1H0SA 3ZWAA 2X2PA 3O4IA 2LUOA 4C7BA 3R0JA 4X8MA 5K0SA 3U2QA 2PPLA 1D09A 2ZIXA 3NIBA 3EVEA 3C3JA 1QYVA 3AVQA 3KK0A 1KKLA 1KORA 1UH5A 2PG3A 2VSYA 1H93A 1QO0A 4IHKA 1D03A 5TR9A 3RS2A 1WY7A 1U2GC 1DT3A 2XKAA 5JMWA 5AKEA 1T5IA 2WWYA 3BSWA 4Q24A 4HDNB 3PUHA 5EOVA 3TZCA 2OCXA 4U6SA 2XT9A 4FKMA 2JIRA 1T1RA 2I67A 1ZP6A 3OM9A 1WXWA 2W6ZA 1A71A 1HDZA 3NASA 2ZWIA 4CMIB 1XZEA 4J9VA 2CCJA 1LC3A 5T4FA 5F2EA 4DA9A 5K0GA 4O4IA 1QH1A 3R6GA 1V16B 1HTTA 1LB1B 4CKZA 4ZU1X 3L4JA 5AKJA 3UWKA 1Z5VA 2W8ZA 2HPAA 4RGYA 2V5AA 4O2BA 3ZJXA 4FEEA 4YRKA 4OXRA 5FB3A 1GZUA 2TMKA 5BW8A 3SKXA 1G0NA 2W6PA 4HTFB 3N5CA 4YAOA 4E5UA 5B2FA 2VDVE 1IRXA 5CRIA 1TECE 1JLHA 3DP9A 1DL5A 1RKUA 5K3SA 4AS2A 3EIHA 3QE3A 3K71B 1XK7A 3LL7A 3LZDA 4L73A 4B31A 4HYTA 1N8KA 1WWKA 5BYAA 3OO0A 3HDVA 1IAQA 1P5HA 5IJWA 1NF3A 2FMIA 1TA9A 2WMYA 1G8FA 1N36B 3WYAA 1EB8A 1YKGA 3T3GA 4BV2A 2HWUA 3CRZA 1G4HA 4QUHA 4BRUA 2WJAA 3SZLA 1LZKA 3HA7A 4MP8A 4Y6PA 4C0QC 5ITZB 1L4HA 5LOVA 4YUWA 2I7CA 1Q5PA 5EKUA 4XWAA 2HUNA 2PIDA 4B35A 2R4TA 1RYBA 1X1CA 4FWBA 4RHXA 5LZ7A 1DHRA 1E5QA 2GR9A 4EG8A 4A5OA 2QU7A 3EVGA 3ANXA 1KYTA 4YCCA 3GEPA 4WWHA 1MIOB 1Q17A 3A4IA 2V7TA 2GX6A 2QN6A 2XTMA 4FD2A 4BNXA 5K45A 1GTL1 1VJCA 5CB4B 3VU1A 5GZ1A 5AVZA 4HQLA 4J90A 3CKYA 4KWEA 2FHSA 3M6WA 4LECA 4NMMA 3WAKA 4DZTA 4K0KB 3LX5A 4H0NA 3M6VA 4JJ6A 4Q1VA 3EK2A 5DHAA 3IIKA 3GFOA 5IARA 2UYOA 1BHJA 5ULLA 4AWXA 4BBAA 3MWEA 4P1ZA 5T3UA 2GBFA 2XTZA 1E1YA 4EY3A 3AHFA 2FV8A 1G9XA 3VTFA 1NW7A 3OU2A 3OZFA 1EJ2A 5B58C 3H19A 1M6HA 3JQAD 3R23A 1FUEA 1FVXA 4J6FA 1OGJA 1QVAA 3DMGA 1R4MB 3L6BA 2IHUA 2FPGB 3HB1A 3W6NA 3MLAA 2LVBA 4YRJA 2BEVA 2QP4A 2C9ZA 4N5MA 1LNSA 3HTXA 5DHFA 2JFZA 1U9CA 5KOHB 3N3AC 3HCOA 1UXIA 4ZXPA 3KPWA 1TM5E 3CF4G 2QE6A 4RVDA 3OA2A 4IUYA 1ORHA 4N3NA 4DV4B 4I6JA 3FTEA 3RU7A 2QPTA 4G5OA 4W5WA 2BGNA 2PGNA 4JL8A 1PX2A 1G55A 1J9ZA 1Y9EA 2F1RA 2Q9UA 3COPA 2ZRIA 3QW4B 2DHDA 1HQKA 3P5BA 5DEIA 1FK8A 4AG3A 2FY8A 3ENVA 2IS4A 2IHZA 3BN3A 2C2BA 4MJLA 1DLIA 4DQKA 1U7TA 4X8LA 4ZDKA 1YJCA 3MGCA 5D85A 5CYGA 4V02A 4GMKA 3NBXX 1L9KA 2EBUA 1VPEA 2UUPA 4J1NA 5TQ2A 4XQ9A 2XBLA 1UZNA 4GECA 4ZOEA 5C35A 1DKRA 1SCJA 3DZFA 3UUGA 4MUBA 5D01A 5AVUA 3EPHA 1S1MA 4P8RA 4RV5A 3T9DA 3U7QA 2ZOSA 2B5OA 3PLAE 1CIVA 3P4YA 1GAXA 3B85A 3LV8A 4RBNA 3WDKA 4YO8A 5FUBA 2WJIA 3CSSA 4D8XA 1I6LA 2MHCA 4ZVOA 4KEAA 1KDPA 4FDUA 4GH5A 1DOAA 3H8VA 4TTQA 5SZKB 4J3FA 4FUTA 3R3YA 2CLIB 3VDMA 3JYLA 3TLGA 3H2IA 1GG5A 4LX0A 2ORWA 1A4UA 2Y1FA 5E0OA 1I7QB 2B30A 1QONA 2HWXA 4L4YA 4XUEA 5ITSA 4YQFA 3LCVB 2WT4A 3M8KA 1DBIA 3BMCA 3AFOA 3HFSA 1GVNB 1R0BA 1R9GA 4CLOA 3QX7A 4QGBA 2G4CA 4QRIA 3G9ZA 1VJDA 4MDHA 2RKBA 4U2BA 3OZAA 1INLA 3C4JA 3RKRA 2KSQA 4Z0PA 4U7GA 4JUAA 4KITB 4Q00A 4AJ9A 4EPTA 2HPZA 2XOKA 4NRDA 3TX2A 2VJMA 5H3LA 4CHGA 1N2ZA 1RC8A 5AI9A 4RGBA 3A3KA 3PEVA 4RZIA 1X80A 5AM3A 1P4RA 1YJQA 4Q7KA 1JDVA 2IWRA 1Y7TA 3WLOA 2Z58A 1QGYA 2Q2QA 2R6R1 1PDWA 1LWNA 1E5TA 1NLFA 3H8JA 1CU1A 4IIEA 4BWFB 4URWR 3CPHA 1GFSA 2W4MA 3JYPA 3RS7A 1JSCA 1R6AA 1JTEA 1JIJA 3VI4B 1VDMA 1QORA 1CDOA 1WMDA 2GN0A 3HJTA 3M49A 1RHUA 4FK8A 4MROA 4S1NA 4ZO6A 4OUDB 4X00A 4DCVA 4ETNA 2PKWA 3FHOA 3ZGXA 1W34A 1YVUA 2O50A 2QSYA 4O4HF 1P3JA 1R0RE 4BCDA 2O8BB 3ZE8A 3O4VA 5KU7A 1FSSA 3ZZNA 4ZVTA 3AONB 3GPIA 5EIFA 3N0TA 4QFMA 4C0LA 4HVAA 4HP8A 4UZFA 5EHGA 1XVVA 2I6UA 3ON5A 4V1CB 3OIVA 4R9NA 5THKA 4EX6A 3N6RA 1CZKA 3V6LA 2FE4A 1T9BA 2GPAA 3PUIA 2CYBA 2IYNA 1O1YA 3HU1A 1DXQA 4CV1A 1U63A 3IXMA 3DOIA 1Z5WA 3GRCA 3WLNA 5JO0A 5K3FB 4LC1A 4IGKA 1KHTA 3EGEA 1MAVA 3B3QA 3U4MA 2VATA 3EEQA 4DCJA 1RJGA 5KTRA 4QSHA 3VR2D 1U0SY 4EB8A 2VPQA 1BD3A 2P9ZA 2G0AA 1EWTA 3CC8A 4UAGA 3VO9A 5DASA 4PGAA 4E7OA 5DV9A 1X9HA 2HWWA 1WG8A 4WK4B 4O2AA 4Z6KA 1T9KA 2GZRA 4KVFA 2CHEA 3JXEA 4NJEA 1S2LA 2NTVA 1KVRA 3VHQA 3HMQA 3I62A 4TMXA 3A4LA 1H3EA 4LZLA 1LV7A 2QG9A 3G5AA 1CB0A 3CNNA 5GV7A 1J49A 1URPA 1Q0LA 2QE7A 3SD7A 1JPVA 3UV6A 1HDIA 3V3TA 4F8JA 2WV7A 3I5YA 2BTOA 2QUAA 2Q3BA 2DULA 2JHCA 4HWGA 3K0CA 5F1PA 1NW6A 3CPSA 3AEKB 1YO6A 1JLLB 5KTOA 2WP8J 1PK8A 5HNKA 3Q2KA 5JISA 5GOTA 5MFPA 3KEQA 4XX1A 3EDQA 5L40A 2I29A 2BLLA 3U7IA 4F2GA 3OIUA 1Y33E 2Y99A 1Y9AA 3EIUA 4MQMA 3R76A 1YE8A 4N48A 1M6VA 1R4NB 1M2KA 1I3CA 3K70D 5D3MA 2GM4A 1ST3A 2Q46A 1R6XA 3AFGA 5D7BA 4RZ2A 2WWVD 3UAXA 4F72A 2I6SA 2IBTA 4FR0A 1E4OA 4TT3A 4TYQA 4WIAA 2D8AA 1WY5A 4GI5A 3QHAA 4IJ6A 1QJ4A 4MR7A 5TPWA 1KSGA 2EFCB 1OF1A 1NHGA 3OCYA 2BY4A 3E3AA 1IATA 5JALA 1K7EB 1LW7A 3SU8A 2YVQA 4BVKA 1SD5A 2DZDA 4URZR 1PEKE 4G67A 3H2SA 4Y6SA 3TTSA 3SC2A 4NBRA 4WFKA 5CH5A 2XPCA 1I7SB 2R6FA 1VJ0A 3WRXA 2ZJ6A 4A0SA 2ZT5A 4GBMA 5FCDA 1LY1A 4ND1A 2ST1A 1MQAA 1COZA 4OOEA 2G76A 2ZULA 4MGEA 3SMQA 1NG1A 5E6UB 2QT1A 3CG4A 1UDXA 5EFOA 3RU2A 2ZB8A 2B1QA 1RHJA 1LQUA 3LJKA 3OZCA 3QLJA 4I19A 1F2UB 2ESRA 5K4HA 4JS0A 3JYQA 3ZOKA 4TWIA 1SXJA 5L95A 1G3MA 1EYZA 3E3NA 1K9SA 1PIWA 3NIWA 3HKBA 1DBWA 1D6MA 1DIGA 1THGA 2EATA 3D3NA 3OWXA 3VGJA 4ZYTA 1C1XB 4R9SA 1UDCA 3OX4A 5DHTA 1BA2A 1SBYA 1Z5UA 4MV1A 4YMIA 3VHLB 2HB6A 2QAGA 1QG6A 1DS6A 3I52A 4HNVA 1WDTA 4PGFA 5KDLA 3OOJA 5TGZA 4AG5A 2ZIGA 2IW3A 3TKLA 3L8DA 3TL3A 1TM3E 1RYHA 2JB9A 3K6KA 5COQA 3U44B 1C7ZA 1E4VA 1AQUA 1KZ6A 1G20B 1L4NA 4C29A 1ULZA 1XRSB 1ID1A 4Y9RA 1DOZA 1LSJA 3MD0A 1G8SA 1Z22A 2XHEA 3NBAA 3ZD9A 2OXEA 3TQCA 4Q3CA 5HS4A 3GT7A 5GGXA 2W2MA 4IMJB 2ZZNA 2LP4Y 2YFQA 4O33A 4XWKA 3WIVA 2HV8A 1L7OA 4OP2A 2ANBA 4C6HA 4EF5A 2NPOA 4MA4A 1SB8A 5KKCA 2VBIA 1ZBDA 5HZMA 2HBYA 1NWCA 2QRLA 3RTEA 1X2EA 4XQCA 1ZN2A 3OQPA 3ZGZA 4PANA 2AJBA 4G4SP 1B4DA 3M3DA 1ZK0A 3WRYC 3U7GA 1XZLA 1Z4IA 5ESDA 4TLMB 2W2LA 1LJUA 1Z2NX 3C3YA 3GZJA 3CRW1 4QLBA 1I7MB 2VJDA 3EYAA 3I6YA 2C8LA 1TKBA 3JYNA 4G1MB 5F21A 1MJ5A 4YREA 2H5JA 5WRFA 1N4AA 1E1LA 1W0CA 4U9HS 1ABEA 4JP8A 2P8JA 1GTVA 4I8IA 3QVTA 5EXEA 4YO7A 3WMWA 3ZCQA 4ZKDA 3QEKA 1BS9A 1YR7A 3NBFA 4XDYA 4F12A 3AHHA 5BVGA 4JNKA 5DXFA 2X9GA 1NNEA 2FGJA 4GKJB 3GDWA 2Q5HA 3IBCA 4YMGA 1BFDA 1R15A 2BW0A 1F1BA 2JJ2D 2C96A 3HBFA 3D6TB 4LTNA 5TVOB 3B13B 3GA5A 4FI3F 1P81A 1M73E 3AJ9A 4KI0A 5IVDA 1N5IA 3V4ZA 4EB6A 1W35A 1ZVJA 3R9XA 3LFTA 5B6IA 4P53A 3T7TA 1WUYA 3ZHQA 1PT6A 5BPFA 3QV1A 1BE1A 1E9DA 1D2CA 2QX8A 2V6JA 2WG0A 2WJZB 3K9LA 3B9PA 4I4NA 2YN4A 3TF5A 1H3NA 4AJ4A 1HETA 4Z9XA 4RFLA 1QC5B 1KI2A 1ENZA 4HAWA 3IUMA 2RDMA 2ZIWB 3PNOA 3UW1A 1LDNA 3H5OA 3N6VA 4J3NA 3RQIA 4Q4DA 1ILWA 3P0IA 3WFJA 1CEYA 1QHEA 2C2YA 2HF2A 3K1YA 1Q57A 2XUAA 3OOSA 4JU8A 1BYUA 1OKKA 3GROA 1N5JA 3OEHD 4NXMB 1ADCA 1RTTA 1UPFA 5DLEA 1NVMB 4HXYA 4I2VA 1JJFA 1NFFA 5H0IA 1I5RA 4O4LB 2MT9A 3FCEA 4NMXB 1TJ5A 1L5HA 3P9YA 3LT5A 4DQLA 5EIBD 4O4IB 3FSGD 3ZCRA 1Z4NA 2QY9A 1CD5A 4ZOBA 4JUBA 3VOBA 2QAGC 4IOMA 1XWIA 1V8DA 4M7OA 5I7HA 1RBYA 1ZGAA 1QUFA 4W6QA 1EESA 1Y8CA 1HI9A 5K8TA 1H2ZA 2QM0A 3FF1A 3DYBA 3MWFA 1AUQA 3AOGA 4NPAA 1M7GA 1H2BA 1CFZA 2FW8A 1MC1A 2FH5B 3E3MA 1QPZA 1RACA 2C57A 2FWPA 3SHWA 3VKWA 3FROA 2XGGA 3JVDA 4E4TA 5IVPA 2A33A 4F3RA 5DNWA 1BJKA 3B60A 1U04A 2WVGA 3QSYA 3IT1A 4M7WA 3C3DA 1CRPA 3DKKA 2R7MA 3M6IA 3D31A 5HW0A 4Q7MB 2VUUA 4BUZA 1MEOA 5T8KA 1E0DA 3I39X 2PT9A 1ZOIA 3PXDA 4JQSA 3OT1A 2CMGA 1I24A 3NG1A 3HJHA 2X42A 3RRJA 2IHTA 1A2OA 1BW9A 1NDUA 4IVRA 5FKJA 2GNOA 4QBFA 1VL0A 2EXXA 2YXLA 4Q1BA 4RQAA 4ZI2A 2Z9CA 3Q3VA 2HJSA 3LGAA 1E1RA 2BHRA 2EBHX 2JAUA 1QYWA 2D5IA 4IDHA 2CFCA 3EP9B 2H7XA 3EG9B 2AG8A 3HBMA 4JJ4A 5AO9A 1M2OA 4R0MA 4OY3A 1BXRB 1CUDA 1ZRMA 1NVUQ 4HX5A 1UQRA 2DP4E 1VPVA 2PZJA 5ANRB 4MA0A 1AZWA 1GYRA 2EZ4A 2ZT8A 2PV0A 5JSKA 3FVQA 1FDOA 3JQPA 3M6LA 3PWSA 2FMKA 2O23A 4UEOA 4C01A 4FZ5A 3DL0A 2O8NA 2JF0A 3W1WA 2VQ3A 1MO2A 2O5VA 2AW5A 1QH1B 4MOWA 1O0CA 1RAAA 1UJ5A 1Z7GA 5FOSA 1P4GA 4EA6A 1W7AA 5HJ7A 3JRXA 1R8SA 1X1TA 3PJDA 3IL2A 2BTEA 5CLJA 2WM2A 4M9ZA 4AO7A 1ADYA 1ORDA 1SD1A 2YJNA 3H9UA 2XQJA 3AVVA 1WIWA 4G5HA 3D7LA 3RVMA 1IULA 5F9FA 1CLEA 2HIAA 1OFVA 3CRMA 2W6QA 2COUA 2H48A 3UB4A 1EFKA 5HCUA 3GY0A 4R2MA 1Q6ZA 3PGXA 2DFVA 3FVRA 3W34A 4NJMB 5CDHA 3S2FA 1WSWA 4CE6A 3HVRA 4QUKA 5GINE 4F7DA 4LDJA 1N3YA 2BONA 2IPAB 3FNGA 1K92A 4HB3A 3RIXA 2FPKA 4C08A 4PN3A 1JDJA 2OWEA 1KGDA 1DINA 2ZIUB 2FW7A 4X64B 2AN1A 2CJFA 5K6RA 4PU0A 4NU5A 4BFSA 1PEDA 2QBYB 2BGJA 2J5BA 4S0ZA 4NYJR 1C0EA 1JFFB 3DT8A 2QXTA 4JFRA 3PEUA 1GOTA 4PLWA 1NKVA 2P4UA 1J0BA 4Q9JA 5D3QA 4HN2A 1FFXB 1W48A 5J1SB 2A4KA 1FOEB 2Q41A 3GZTB 4V0QA 3UA4A 1KAMA 1CUIA 3SFVA 1SPXA 4D8TA 4ZAVA 1SCBA 1Z74A 1M83A 4RL6A 1PJRA 3KAJA 2CUKA 3FPHA 1MDFA 4D41A 2X0IA 4ENWA 5JPDA 4QFBA 1YR9A 1UJNA 2O20A 1SVSA 4YFYA 2IOQA 3CH6A 1J8DA 3L0YA 4MKFA 1PTKA 4OLBA 4B2LA 1HT0A 2BPOA 2IDMA 3EP3B 5AVOA 5KYXA 3H84A 2NN3C 1LRLA 1TXGA 2C29D 4RLFA 3ZTYA 4D3YA 3CT4A 3E22A 1Q1BA 2ID8A 3KSBC 3B51X 3R7AA 3A9TA 2CKDA 3TXXA 5C18A 1SY7A 2CK3D 3DUWA 3ET4A 2O05A 4JODA 3MMPA 3AJEA 2VT2A 3LSTA 5K3AA 1NZDA 4FR2A 1LLDA 1OX4B 1I3NA 3BCHA 3IELA 3QG5A 4Q02A 3RVKA 4CLOB 5LJIA 8MHTA 1M72A 3OPXA 2LKCA 5EYPB 4H59A 3DHEA 1FA9A 3I2KA 4M99A 4M98A 5AKIA 3BWEA 3CVUA 1PV4A 4WKOA 4CYMA 2OHFA 3I0ZA 4HZUA 3Q0IA 4I5FA 1Y9JA 5JC8A 3HCFA 3AR7A 4ZOLA 1ESEA 2F55A 4KAFA 2ADOA 1EFVB 2PMFA 2I55A 3PQ5A 2BLNA 1T6BY 1Z2OX 3AF1A 3HDQA 3HJGA 5AOVA 1IK4A 3O2SB 4FOSA 3GBSA 3GAZA 2DQYA 1GWNA 1NT4A 2ZITA 1KYWA 2JIMA 3R41A 4CL2A 1DRKA 2ORED 1GTJ1 1SCNE 5E9JA 1RHKA 2IUUA 1EK2A 1RWNA 4LG1A 3S99A 4EATA 4F92B 1ATZA 2ECOA 1A9YA 2DJ5A 3L4BA 2AFRA 4ZQEA 3ZIAA 2LW7A 4B84A 1DC5A 4OGWA 2HXSA 1I0ZA 3ZPXA 5GOZA 1YUNA 2XA9A 3F78A 1E1MA 5JU6A 4ZQGA 4DSTA 5JJKA 3X1DA 1MZVA 4GM0A 1D2EA 1LNZA 3AETA 3ZWWA 1OI4A 3FX2A 3VISA 3DEIA 4IH4A 3ADDA 4O4HB 1KYVA 5HJEA 1A5BB 2YXEA 421PA 3HWX1 1DKLA 1P7VA 3V8VA 1XA0A 3BE8A 3ILSA 3KTDA 2IYEA 2LTAA 4BV3A 2XE6A 3LRXA 4JT8A 1SKYE 1ZQ9A 4PFJA 2V0GA 4XRRA 3ZLVA 2IX9A 4B3TB 4D80A 3GRYA 3DXXA 1Y8AA 1IXZA 1QLHA 2GN1A 3OWHA 4LI0A 4HUJA 3ZI7A 1NUSA 1QVWA 3N0VA 10MHA 4FC6A 1F8XA 2ILTA 5EJEA