1ML6A

Crystal structure of mgsta2-2 in complex with the glutathione conjugate of benzo[a]pyrene-7(r),8(s)-diol-9(s),10(r)-epoxide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
220
structure length
219
Chain Sequence
GKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPLDAKQIEEARKVFKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-Transferase GT41A
publication title Residues 207, 216, and 221 and the catalytic activity of mGSTA1-1 and mGSTA2-2 toward benzo[a]pyrene-(7R,8S)-diol-(9S,10R)-epoxide
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 82
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1ml6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ml6A01
2C0FA 1IYIA 4MF5A 4KGIA 2H1DA 2GQKA 1YJ6A 2PERA 3ERGA 4XCSA 1TJDA 4TXOA 1XCCA 1XWAA 2PPTA 1NW2A 1AQWA 1B8XA 5D9WA 3OR5A 2L6DA 3WGXA 2C80A 1U3IA 1GSDA 3P2AA 3BJ5A 3F3QA 4V2MA 1M9BA 4MJCA 5ABRA 2AJQB 3IDVA 4TR4A 3HVSA 3RDWA 5ECRB 2HNLA 2C3NA 1A2JA 4DVCA 5IMCA 5HFIA 1WWJA 1EGOA 1PRXA 3KP8A 4KCAA 1TU8A 16GSA 2YZUA 1GRXA 4GSNA 2IN3A 2H6XA 4K8MA 2DMLA 2IJYA 4WXTA 1XFLA 5IPGA 5ECMB 4BWSA 1K0BA 3F3RA 3S9FA 3ZYWA 1AW9A 1GSUA 4FYCA 1EOGA 4O5RA 4J2FA 3M9KA 3I43A 5D8IA 4MF6A 1O7UA 5DJMA 3V1WA 4N10A 2IPAA 4YAPA 4ECCA 2F8AA 3VWUA 5ELGA 1XWGA 2B3SA 2IIYA 4FYBA 2R2JA 4O32A 2GZYA 5C04A 3FY7A 5D9XA 1G7EA 1LJRA 1A0FA 2GSSA 1JZRA 2CT6A 4I2TA 2HZEA 3HXSA 4TW5A 5ID2B 5AIVA 5ECKB 3LXZA 3LYPA 2P31A 2FNOA 4EE0A 1VRSD 4TR0A 2IMFA 2FHEA 4HQZA 1PN9A 4N30A 4AJ8A 3GX0A 1M9AA 4K1FA 1DE2A 2LNTA 1G6YA 5DVBA 4KCEA 3PINA 4XS1A 2YV7A 4GQCA 4KDYA 1YQ1A 1VF1A 3FKFA 2HLSA 2E7PA 2JADA 2LQQA 1JZDA 4NV5A 3LFLA 4USSA 2IMKA 1NM3A 3TJBA 5HQPA 3DKSA 5IO0A 2MYGA 2YJHA 5ELAA 1GTUA 4PURA 1M2BA 3DEXA 3VPQA 1V9WA 4AF2A 1DUGA 3ZMLA 4ZIJA 4EL1A 4K2DA 2X64A 3CXGA 3IC8A 5ECHB 3VWXA 5E59A 5EVOA 1T00A 4G0LA 4PUAA 1GL8A 3FEUA 4KAEA 3BCKA 2BTOT 1V98A 2BMXA 2TRXA 2H6YA 2OE1A 4PTSA 3QPMA 5G1LA 4TR1A 2HZFA 2VLUA 1ON4A 22GSA 5G5FA 3F4RA 5F06A 1USBA 4EDYA 2HSNB 5G5EA 1GSQA 1K3LA 2PVOC 3E9JB 2ZUPA 2GLRA 1UN2A 5G31A 1VF4A 2FLSA 3KIJA 1GLQA 4YH2A 5IO2A 1W4VA 3EC3A 3NOFA 3QFBC 2A4VA 5EPFA 4ILFA 1F3AA 1A8LA 2L59A 1W89A 5A4VA 4ECIA 10GSA 2HSYA 3ZMKA 4V1Ap 3AY8A 4PNFA 4GCIA 4WR5A 3O76A 1S3AA 2HT9A 3A2VA 4IP6A 4OO4A 2LEGA 4HZ4A 3P7XA 4F82A 1PQNA 3GTUA 3CRTA 2JZTA 1N2AA 2M46A 2GQMA 1RW1A 3A5WA 4EF0A 5CAXA 4JR6A 3N9JA 3RBTA 1N8JA 4MCUA 2X8GA 3H4KA 3GSTA 3US3A 1SJ6A 3QR6A 3VLNA 4TN8A 3GURA 3FR9A 5HR2A 5GSTA 4V2NA 2HE3A 3ZTLA 1B4QA 3VWVA 2YCDA 5H5RA 4V1Ag 3UIWA 5IMDA 4ZBAA 1PD21 2OE0A 4HDEA 3EMPA 2DJJA 2R6KA 2K18A 1EWXA 4K0NA 4PNGA 3ZFBA 2L5LA 2TRCP 4OFNA 2H0IA 5ECSA 1B48A 4FH8A 2H1GA 5JCGA 3CTFA 4JU5A 3KGKA 2REMA 1QUWA 2GT6A 3KH7A 3IAS2 1EP7A 1Z6MA 2PN8A 1HQOA 3CSIA 2F3MA 1GTIA 14GSA 2EIRA 3MSZA 3DIEA 4HU7A 1JZWA 1WIKA 3CSHA 2LNSA 4TR3A 2VO4A 1BJXA 4MJEA 5DALA 2WRTA 2P0GA 3F63A 1XVWA 5IM9A 1EOHA 1JLVA 2DC5A 4POKA 1R5AA 2JACA 2B5YA 2OKAA 3DMLA 1UC7A 4GWRA 3D4TA 4YQMA 17GSA 1GWCA 2H75A 2YV9A 3DWVA 3GL5A 3QOUA 4CW9A 2XBIA 1O73A 2X99A 2XHFA 1ERVA 2PUKC 2M80A 1Z5YE 1YKAA 2X8HA 1KEBA 2GSTA 5H5QA 4ZB8A 2CZ2A 1M2AA 2GSQA 1X9SB 2CA8A 5DQYA 3HHVA 1OVNA 3G7JA 2L57A 4WBJA 2AYTA 4RUVA 3HVXA 5IMAA 1V2AA 3W8JA 2HSMB 4KSOA 3E0UA 5KEJA 4POLA 4MMMA 4HJ2A 1TW9A 3CTGA 2DLXA 1EEMA 1X5DA 1AXDA 1ZMAA 3DRNA 1FW1A 3O3TA 4RI7A 1SYXA 5D9TA 2B6MA 3ZRDA 1AC1A 2WZ9A 3E3EA 1GTAA 2HQTA 3TGZA 4DSSB 3D22A 3M0FA 3HYPA 2DMMA 2F51A 2J23A 2PVQA 3FHKA 1GUMA 1SD8A 5ECOB 3TRPA 3CMIA 3UOMA 1K3OA 2R3XA 7GSSA 4WEYA 4YQUA 1E6BA 1G6WA 3IK7A 5EY6A 1XOAA 3DGQA 3F8UA 5B8AA 4ZBBA 2GT5A 1G0TA 1M99A 1OC9B 3KZQA 4X0XA 1QXHA 1ABAA 4ZL9A 4HQSA 1SL1B 4N0ZA 2VD1A 2CX4A 2CAIA 2H0HA 1TRUA 4F2IA 3IV4A 4PUFC 4DEJA 2GSRA 2OE3A 3TKSC 3GIXA 2OACA 1ZYEA 3Q18A 3Q74A 2EC4A 6GSXA 5L71A 1T3BA 5DDLA 1V58A 2A2RA 2QKEA 1SK0A 3CBUA 2K9FA 3UBKA 5J4UA 4IHUA 4DSRA 4I8BA 1Y6EA 2K8VA 1AUCA 2FWEA 1THXA 4XIHA 5CREA 4POMA 2X8CA 3KJYA 3VFIA 1V57A 1M7TA 3ME8A 3IRAA 4IJ3A 4NAXA 4ACSA 1X0RA 3GV1A 2N5AA 1OAZA 2FWHA 1OC8A 2DIZA 1Z9HA 5FHIA 3F4SA 3I69A 2WGRA 4XHMA 1SKRB 1WMJA 5IMZA 2B7JA 4MPFA 1WP0A 1XPVA 3L9SA 1Q98A 2CZ3A 3DVWA 3DXBA 4NHWA 2C3TA 5J5NA 5D96A 2FWFA 4HJMA 3W8SA 3UMAA 3UBLA 5G1KA 3WGDA 3CSJA 2O8VB 1XVQA 3TRXA 2HRAA 4I6XA 2PMTA 1LU4A 1QFNA 4IVFA 2VCTA 1E2YA 3P90A 2YJ7A 2H72A 1THOA 3RPPA 4KDXA 1GSEA 1T4YA 1ZGNA 4DSQA 3EU3A 1PX6A 3J7Yb 2GZPA 4K0GA 5DCGA 3GA4A 2O7KA 4MF7A 1T4ZA 3TJFA 1T8EB 1LBKA 2VL3A 3FR6A 2I1UA 4JZQA 4ID0A 4KE3A 4E8EA 1MDIA 2BJXA 2VD0A 4MP4A 1F2EA 1FB0A 2H70A 3G9BA 1XWKA 9GSSA 4MZWA 3VPTA 2O85A 1MD4A 2ON5A 1TOFA 1B4PA 1MDJA 2HRNA 2GZZA 2YZHA 4RQXA 1B9YC 4N11A 4KDUA 3APSA 5IOXA 2CVBA 3PPUA 4RI6A 3R3EA 1PKZA 1URMA 3IE3A 2K8SA 2DBCA 2JL4A 4G0IA 4BVXA 2H6ZA 3QAVA 3GKKA 4XTSA 5G2ZA 1XOBA 5ENUA 5KN1A 1MD3A 3Q19A 4L5LA 2L5OA 3VK9A 5KN0A 2H8LA 3GTUB 4KF9A 1O6JA 2YWNA 4IP1A 3GKNA 4F9ZA 1SKSB 4MA9A 1R5PA 1S3CA 3ZL5A 2WS2A 4OCEA 2XBQA 3LGCA 3RAZA 2C0GA 18GSA 2VUPA 3TKRA 3GRXA 2IMEA 3IK9A 3ZZXA 2VL2A 3FK8A 2WB9A 3VI7A 1K0OA 5A5KA 3EE2A 2H73A 2LRTA 1TKDB 5F05A 4IS0A 1RK4A 4BPYA 2DJ1A 1GUHA 5IMFA 3HJPA 2VCQA 5A4UA 2DIYA 1KNGA 4KA0A 1XXUA 1TRWA 3SBCA 4HEA2 1M0UA 4EC0A 2LKUA 5ECNB 4NMUA 2WFCA 5J3RA 5KN3A 2AAWA 3TJJA 4XS4A 2CVDA 5CYYA 5JWOB 5J41A 2MZCA 2B5EA 2OADA 2YANA 2ON7A 3NZNA 2GDRA 4RQRA 3L4NA 2VCZA 3GX8A 3RHCA 3EVIA 5HR0A 1FAAA 8GSSA 3N5OA 1SJZA 1YEXA 4EXJA 6GSYA 4LMWA 1ZYQB 2DSAA 1MDKA 1ERWA 1M2DA 1SD9A 4Q5RA 4L5OA 1VF2A 2FUG2 1BEDA 3DD3A 2HRFA 1A24A 1GSYA 2H19A 5LNKe 2VOCA 5ID2A 1SU9A 4XRDA 3F0IA 2IFQB 4J57E 2YN1A 1QMVA 3D4MA 3A2WA 4L8EA 4AJ7A 5F07A 4NHZA 1TRSA 5AGYA 1ST9A 3H8QA 4BVYA 1OKDA 3ZVJA 1XBSA 4NXIA 3LORA 4WF4A 3UVHA 1PMTA 2MMNA 1T1VA 2EIQA 1GH2A 2GS3A 3BCIA 4I2UA 5IMVA 3TB2A 4XRAA 2LS5A 3D6IA 2WDUA 4WKWA 5HFGA 1KTEA 2AV4A 1A2MA 1YKCA 5B6NA 1XWBA 1SK2A 1PX7A 1ZL9A 3LQ7A 1WOUA 2VL9A 2VIMA 5GAPD 3QFAC 2FY6A 4TXVA 3C73A 3HCZA 2LJAA 4ULXA 4O7HA 2VLTA 2J9HA 3FZ9A 1HNCA 12GSA 4TRXA 3APOA 2AB6A 5BMUA 2JZSA 3ZVJD 2G2QA 3KH9A 2HRKB 4ZILA 1DBYA 13GSA 2L4CA 1TRVA 4D73B 2R5GA 1X5CA 1Z3EA 4K7IA 5J9CA 1O85A 5J9BA 3UVTA 2IMDA 3M9JA 1YZXA 20GSA 3KMOA 3C1RA 2HXKA 1YDKA 1GLPA 1I5GA 2GQLA 2LUSA 1I9DA 1U6TA 2TIRA 4OD7A 4POBA 4PQ1A 2JSYA 1TTZA 3GMFA 3NIVA 2H76A 2YPMA 1PL1A 4MZBA 2E2GA 4OO5A 1PL2A 3HKRA 2H1AA 2P5RA 1GP1A 2YWMA 3HD5A 1V40A 5HFKA 2G0FA 3F6DA 2V1MA 2MMOA 3IXRA 1F37A 1TP9A 1XWCA 3BBYA 5CRHA 2KP2A 3HJMA 1ERUA 4G9HA 1EGRA 3LWAA 4FYUA 3L9VA 3ZREA 3MDKA 2KHPA 1XZOA 2LJRA 3KCMA 3DYRA 2C4JA 1H4OA 5AIXA 2H74A 4PQHA 2WCIA 1GSSA 4TXOB 1TK8B 2RUEA 4NPBA 3PR8A 3TKSE 3DVXA 3A2XA 4HI7A 4F03A 4HOJA 1TI3A 3J7Yk 3GYKA 4QL7A 1SJIA 2IMIA 3TKPA 1ILOA 3C8EA 4FO5A 5DAKA 4ISDA 1RQMA 1S3DA 3C71A 2NDOA 5H5SA 3UJ1A 4JBBA 5KN2A 3RPNA 3ED3A 3WGEA 3VWWA 2R4VA 4TVEA 4BL7A 4K7NA 3KTLA 2VCVA 4KX4A 1XIYA 3EWLA 3WT2A 1FHEA 2VM2A 5ECQB 4WF5A 3D0ZA 1A2LA 2OBKA 2VAFA 4K7OA 1O8WA 3ERWA 3FR3A 1GNWA 4ECJA 3LG6A 3GNJA 3A3TA 4IGJA 2MBTA 4OFTA 1BX9A 4Q5FA 2XC2A 4EKZA 2NPBA 1ERTA 2HI7A 4MDCA 3TCOA 1EV9A 3TUEA 4Z7XA 2YOIA 3FZ5A 5IIZA 2NVLA 2C1YA 4AJ6A 5HR3A 1JFUA 2RM5A 5AN1A 5GSSA 3G7IA 1FVKA 3ZFLA 4I5QA 3FZ4A 2VM1A 2HZEB 5DQSA 2CAQA 2HSMA 2LRCA 4BVXB 1SK1A 2HSHA 3IAM2 1K0MA 3VI5A 2FA4A 3SWLA 1SL0B 1MTCA 1GUKA 1AQXA 2KP1A 3HZ8A 2B1KA 3QD9A 3TOTA 4IQAA 1OE8A 4IBPA 2IWTA 4IW9A 4OCFA 4DSSA 1OE7A 2M72A 4HU9A 1YEPA 1PA3A 3IA1A 3GFKA 5G30A 1GULA 2F9SA 3U5RE 3H1NA 1CQHA 1JLWA 1JHBA 3ME7A 1QGVA 1IYHA 4ML1A 5E4WA 3TOUA 4LL1B 5JWRB 2GTUA 2YWOA 2LSTA 2I3YA 2AHEA 5JWQB 4K9ZA 2LJKA 1MEKA 1TK0B 5GAND 1OC9A 2LRNA 4KB3A 2R37A 3KEBA 3QDNA 3F9UA 1HYUA 1DSBA 1XW5A 5C00A 1SYRA 4K6XA 2C3QA 2V6KA 2I81A 4WR4A 5D9VA 1WPIA 5DCHA 3QAGA 3U6VA 2JSZA 2ES7A 4Q5NA 1GNEA 4GXZA 1R26A 1X5EA 2H71A 3VURA 2V41A 3KP9A 5CNWA 4MZCA 1QQ2A 2DJ3A 4ZXGA 2MMAA 4TR1B 3KD0A 4XS4B 4IN0A 2N5FA 5LCZA 1ML6A 1SKWB 1FG4A 5CRWA 4TKYA 1U88A 4JRRA 19GSA 3WYWA 4IELA 2YNXA 3EMXA 3H79A 2V6OA 4GLTA 3GSSA 3ISOA 2NBSA 1AIUA 1XW9A 1BYEA 1ZZYA 2H0GA 2KOKA 1WE0A 3C7MA 4FQUA 2PWJA 4WETA 11GSA 5CRGA 2L6CA 1OC3A 1A0RP 2QSIA 3EU4A 5FT3A 2MMZA 2UZ8A 5D73A 4EVMA 5IQYA 3HJOA 1Q4JA 3QCPA 1JZOA 3HA9A 5HR1A 2PGTA 3TKSA 5D93A 1BG5A 2WULA 1WJKA 3GH6A 2RUFA 1NHYA 4X1UA 1K0DA 5LD0A 2E0QA 4BVYB 4MJAA 4XS6A 2B1LA 1O8XA 1FO5A 2F8FA 4KUNA 2IL3A 4E8HA 4ZB9A 2JZRA 5IOWA 2QGVA 4BA7A 5B6MA 3TDGA 1YF1A 4AGSA 3MNGA 4ECBA 1BQ7A 3FW2A 4PX1A 1OKTA 4MH3A 4YQVA 1ZCPA 3I9V2 2OJLA 2PU9C 4GF0A 2GVPA 2H66A 1A23A 3M3MA 3CRUA 1TU7A 4LA1A 3EYTA 1K0CA 4IJIA 1K0AA 4MK3A 1R4WA 4KNDA 3ZITA 2FWGA 4LL4B 2NTOA 4BWQA 4HS1A 5B7CA 1A8YA 4JE1A 1TI1A 2K6VA 4MJBA 4KSMA 4WBRD 4G0KA 2CV4A 4GSTA 2CX3A 3EURA 3GL3A 1O81A 2CVKA 4HUAA 3D21A 3IHQA 3K8NA 5FWGA 2V2GA 3F6FA 6GSSA 2ALBA 1FB6A 2B5XA 4JEDA 5DALB 3FZAA 5A4WA 3LYKA 3LJRA 5B8BA 3GHAA 3KXOA 1X9MB 4P3YB 1X9WB 2AUVA 2VCWA 2DJKA 2V32A 1GTBA 1QK8A 5IPHA 4OFMA 2I4AA 3GKMA 4ZL8A 4JR4A 4GTUA 1EEJA 1TDIA 1FVJA 1NHOA 4O92A 1Z7RA 5ECIB 1WRYA 3PH9A 1VGLA 4F0CA 3I6AA 1TK5B 2C8UA 2KLXA 3PGTA 6GSUA 2O87A 4FIWA 1SENA 4GRFA 1Z6NA 4YAVA 1YY7A 3KTBA 3GKXA 2ZCTA 2OBIA 4V2LA 2L4QA 3EINA 1PSQA 1UA5A 4ML6A 1AAZA 3ERFA 5JCUA 3UL3A 3P8WA 1GSFA 5COHA 3C1SA 4NV2A 4G19A 4OWYA 2H01A 3F4TA 3WT1A 6GSWA 3BOAA 1J9BA 4KH7A 1HNAA 2EIOA 2LV3A 4LLRA 2WJUA 3JCML 5INYA 3HY2A 2I9HA 2P5QA 4GSSA 3GUSA 1BAYA 2RLIA 5DAKB 2MBSA 2FCHA 3TKQA 1SL2B 3FRCA 3TJGA 3MWHA 4ZB6A 2B7KA 2HYXA 4L0UA 3QAWA 3O6TA 5DBQA 4QL9A 4KW6A 5GZZB 5ECLB 4BL7B 1PGTA 2PBJA 4Q5QA 4IQ1A 2FA8A 3MAKA 3GN3A 1DE1A 1R7HA 5AISA 3TRQA 3FYGA 3LEFA 1KBNA 2IFQA 4GQFA 2VLVA 2YWIA 3UEMA 1K3YA 3HZ4A 5ECPB 5CP1A 1HNBA 2A2SA 2DJ2A 4X43A 3IPZA 4ZL7A 4MH2A 1FOVA 2RM6A 2C0EA 3R2QA 1Z7PA 2H1BA 1NSWA 1Y25A 4PQIA 4G2EA 2FGXA 3RHBA 6GSVA 3WD6A 3KMNA 2D2ZA 4N0VA 1EZKA 4IKHA 5DJLA 2E2MA 3IOSA 3GH9A 1ZOFA 2CQ9A 4QQ7A 2O89A 4G10A 2LTKA 5F8BA 3APQA 2QC7A 1CQGA 4ZBDA 3IC4A 1UVZA 3HVVA 2VCXA 2RIIA 1F9MA 3M1GA 3ZIVA 3ZLPA 2GGTA 3IBHA 2H30A 2FD3A 2ZNMA 2XPDA 2Z9SA 1XW6A 1F6MC 1U3AA 2N5BA 1H75A 2YP6A 3CYNA 4HZ2A 4EUYA 3BD2A 5EL8A 3Q6OA 2HRKA 3KM6A 4F0BA 2HFDA 4CDOA 1U87A 4D73A 3H93A 3HDCA 3QMXA 2OA7A 4CHSA 3G7YA 1YF0A 1EP8A 2KUCA 3L0HA 3L9UA 1T7PB 1VF3A 2DJ0A 5CO3A 1G7OA 4L0WA 1J08A 1F3BA 2JU5A 3W6GA 4NWYA 4MPGA 2LQOA 1EV4A 1B9XC 3ZIJA 4LMVA 1ACVA 4MLYA 3TJKA 4J56E 1HD2A 2XPEA 1TXXA 2VL2C 1J0FA 4OMVA 1OYJA 4H86A 3M8NA 4EO3A 6GSTA 4I97A 4EDZA 3D5JA 3IR4A 1K0NA 4TOPA 1PKWA 3L78A 4PXOA 4PGTA 5F0GA 5CRDA 1C72A 1AQVA 3LXTA 3UAPA 3UARA 5JCWA 3LSZA 2C0DA 4MABA
chains in the Genus database with same CATH superfamily
2C0FA 1IYIA 4MF5A 4KGIA 2H1DA 2GQKA 1YJ6A 2PERA 3ERGA 4XCSA 1TJDA 4TXOA 1XCCA 1XWAA 2PPTA 1NW2A 1AQWA 1B8XA 5D9WA 3OR5A 2L6DA 3WGXA 2C80A 1U3IA 1GSDA 3P2AA 3BJ5A 3F3QA 4V2MA 1M9BA 4K2XA 4MJCA 5ABRA 2AJQB 3IDVA 4TR4A 3HVSA 3RDWA 5ECRB 2HNLA 2C3NA 1A2JA 4DVCA 5IMCA 5HFIA 1WWJA 1EGOA 1PRXA 3KP8A 4KCAA 1TU8A 16GSA 2YZUA 1GRXA 4GSNA 2IN3A 4A5PA 2H6XA 4K8MA 2WZSA 2DMLA 2IJYA 4WXTA 1XFLA 5IPGA 4EIPA 5ECMB 4BWSA 1K0BA 3F3RA 3HMJG 3S9FA 3ZYWA 1AW9A 1FOHA 1GSUA 4FYCA 1EOGA 4O5RA 4J2FA 3M9KA 3I43A 5D8IA 4MF6A 1O7UA 5DJMA 2UV8G 3V1WA 1S4BP 4N10A 1ZYPA 2IPAA 4YAPA 4ECCA 2F8AA 3VWUA 5ELGA 1XWGA 2B3SA 2IIYA 4FYBA 2R2JA 4O32A 2GZYA 5C04A 3FY7A 5D9XA 1G7EA 1LJRA 1A0FA 2GSSA 1JZRA 2CT6A 4I2TA 2HZEA 3HXSA 4TW5A 5ID2B 5AIVA 5ECKB 3LXZA 3LYPA 2P31A 2FNOA 4EE0A 1VRSD 4TR0A 2IMFA 2FHEA 4HQZA 1PN9A 4N30A 4AJ8A 3GX0A 1M9AA 4K1FA 1DE2A 2LNTA 1G6YA 5DVBA 4KCEA 4AKXB 3PINA 4XS1A 2YV7A 4GQCA 4KDYA 1YQ1A 1VF1A 3FKFA 2HLSA 2E7PA 2JADA 2LQQA 1JZDA 4NV5A 3LFLA 4USSA 2IMKA 1NM3A 3TJBA 5HQPA 3DKSA 5IO0A 4PHZC 2MYGA 2YJHA 5ELAA 1GTUA 4PURA 1M2BA 3DEXA 3VPQA 4K5SA 1V9WA 4AF2A 1DUGA 3ZMLA 4ZIJA 2R0GA 4EL1A 4K2DA 2X64A 3CXGA 3IC8A 5ECHB 3VWXA 5E59A 2R0CA 5EVOA 1T00A 4G0LA 4PUAA 1GL8A 5A5HA 3FEUA 4KAEA 3BCKA 5J4YA 1ZYNA 2BTOT 1V98A 2BMXA 2TRXA 2OE1A 2H6YA 4PTSA 3QPMA 5G1LA 4TR1A 2HZFA 2VLUA 1ON4A 22GSA 2O5VA 5G5FA 3CQFA 3F4RA 5F06A 1USBA 4EDYA 2HSNB 5G5EA 2O3EA 1GSQA 1K3LA 5BMUB 2PVOC 3E9JB 2ZUPA 2GLRA 1UN2A 5G31A 5J47A 1VF4A 2FLSA 3KIJA 1GLQA 4YH2A 5IO2A 1W4VA 3EC3A 3NOFA 1YEWC 1M3IA 3A5IA 2A4VA 3QFBC 5EPFA 4ILFA 2H1LA 1F3AA 1A8LA 2L59A 1W89A 5A4VA 4ECIA 10GSA 2HSYA 3ZMKA 4V1Ap 3AY8A 4PNFA 4GCIA 4WR5A 3O76A 1S3AA 2HT9A 3A2VA 4IP6A 4OO4A 2LEGA 4HZ4A 3P7XA 4F82A 1PQNA 3GTUA 3CRTA 2JZTA 4AKHA 1N2AA 2M46A 2GQMA 1RW1A 3A5WA 4EF0A 5CAXA 4JR6A 3N9JA 3RBTA 1N8JA 4MCUA 2X8GA 3H4KA 5A1NB 3GSTA 3US3A 1SJ6A 3QR6A 3VLNA 4TN8A 3GURA 3FR9A 5HR2A 5GSTA 4V2NA 2HE3A 3ZTLA 1B4QA 3VWVA 2YCDA 5H5RA 4V1Ag 3UIWA 5IMDA 4ZBAA 1PD21 2OE0A 4HDEA 3EMPA 2DJJA 2R6KA 4E68A 2K18A 1EWXA 4K0NA 4PNGA 3ZFBA 2L5LA 2TRCP 4AKGA 4OFNA 4W66A 2H0IA 5ECSA 1B48A 4FH8A 2H1GA 5JCGA 3CTFA 4JU5A 3KGKA 2REMA 1QUWA 2GT6A 3KH7A 3IAS2 1EP7A 1Z6MA 2PN8A 1HQOA 3CSIA 2F3MA 1SVMA 4AKIA 1GTIA 14GSA 2EIRA 3MSZA 3DIEA 4HU7A 1JZWA 1WIKA 3CSHA 2LNSA 4TR3A 2VO4A 1BJXA 4MJEA 5DALA 2WRTA 2P0GA 3F63A 1XVWA 5IM9A 1EOHA 1JLVA 2DC5A 4POKA 1R5AA 2JACA 4YKGA 2B5YA 2OKAA 3DMLA 1UC7A 4GWRA 3D4TA 4YQMA 17GSA 1GWCA 2H75A 2YV9A 3DWVA 3GL5A 3QOUA 4CW9A 2XBIA 1O73A 2X99A 2XHFA 1ERVA 2PUKC 2M80A 1Z5YE 1YKAA 2X8HA 1KEBA 2GSTA 5H5QA 4ZB8A 2CZ2A 2WVXA 1M2AA 2GSQA 1X9SB 2CA8A 5DQYA 3HHVA 1OVNA 3G7JA 2L57A 4WBJA 2AYTA 4RUVA 3HVXA 5IMAA 1V2AA 3W8JA 2HSMB 4KSOA 3E0UA 5KEJA 4POLA 4MMMA 4HJ2A 1TW9A 3CTGA 2DLXA 1EEMA 1X5DA 1AXDA 1ZMAA 3DRNA 2VKZG 1FW1A 3O3TA 4RI7A 2X4AA 1SYXA 5D9TA 2B6MA 3ZRDA 1AC1A 2WZ9A 3E3EA 1GTAA 4Z2UA 2HQTA 3TGZA 5J40A 4DSSB 3D22A 3M0FA 3HYPA 2WW1A 2DMMA 2F51A 2J23A 2PVQA 3FHKA 1GUMA 1SD8A 5ECOB 3TRPA 3CMIA 3UOMA 1K3OA 2R3XA 7GSSA 4WEYA 4YQUA 1E6BA 1G6WA 4MNNA 3IK7A 5EY6A 1XOAA 3DGQA 3F8UA 5B8AA 4ZBBA 2GT5A 1G0TA 1M99A 2X49A 3EPTA 1OC9B 3KZQA 4X0XA 1QXHA 1ABAA 4ZL9A 4HQSA 1SL1B 4N0ZA 2VD1A 2CX4A 2CAIA 2H0HA 1TRUA 4F2IA 4PI0C 3IV4A 4PUFC 4DEJA 2GSRA 2OE3A 3TKSC 3GIXA 2OACA 1ZYEA 3Q18A 3Q74A 2EC4A 6GSXA 5A34A 1PN0A 5L71A 1T3BA 5DDLA 1V58A 3CWGA 2A2RA 3CHXC 4CY6A 2QKEA 1SK0A 3CBUA 2K9FA 3UBKA 5J4UA 4IHUA 4DSRA 4I8BA 1Y6EA 2K8VA 1AUCA 2FWEA 1S3RA 1THXA 2WW0A 3MIXA 4XIHA 5CREA 4POMA 2X8CA 3KJYA 3VFIA 1V57A 1M7TA 3ME8A 3IRAA 4IJ3A 4NAXA 4GDFA 4ACSA 1X0RA 3GV1A 2N5AA 1OAZA 2WW2A 2FWHA 1OC8A 2DIZA 1Z9HA 5FHIA 3F4SA 3I69A 2WGRA 4XHMA 1SKRB 1WMJA 5IMZA 2B7JA 2OT3A 4MPFA 1WP0A 1XPVA 3L9SA 1Q98A 2CZ3A 3DVWA 3DXBA 4NHWA 2C3TA 5J5NA 5D96A 2FWFA 4HJMA 5BRTA 3W8SA 3UMAA 3UBLA 5G1KA 3WGDA 3CSJA 1XG8A 4FXYP 2O8VB 3RFRC 1XVQA 3TRXA 2HRAA 4I6XA 2PMTA 1LU4A 1QFNA 4IVFA 2VCTA 1E2YA 3P90A 2YJ7A 2H72A 1THOA 3RPPA 4KDXA 1GSEA 1T4YA 1ZGNA 1TXUA 4DSQA 3EU3A 1PX6A 3J7Yb 2GZPA 4K0GA 5DCGA 3GA4A 2O7KA 4MF7A 1T4ZA 3TJFA 1T8EB 1LBKA 2VL3A 3FR6A 2I1UA 4JZQA 4ID0A 4KE3A 4E8EA 1MDIA 2BJXA 2VD0A 4MP4A 1F2EA 1FB0A 2H70A 3G9BA 1XWKA 9GSSA 4MZWA 3VPTA 2O85A 1MD4A 2ON5A 1TOFA 1B4PA 1MDJA 2HRNA 2GZZA 2YZHA 4RQXA 1B9YC 4N11A 4KDUA 3APSA 5IOXA 2CVBA 3PPUA 4RI6A 2DKIA 3R3EA 1PKZA 1URMA 3IE3A 2K8SA 2DBCA 2JL4A 4G0IA 4BVXA 2H6ZA 3QAVA 2A2PA 2O36A 3GKKA 4XTSA 5G2ZA 1XOBA 5ENUA 5KN1A 1MD3A 3Q19A 4L5LA 2L5OA 3VK9A 5KN0A 2H8LA 3GTUB 4KF9A 1O6JA 2YWNA 4IP1A 3MYDA 3GKNA 4F9ZA 1SKSB 4MA9A 1R5PA 1S3CA 3ZL5A 2WS2A 4OCEA 2XBQA 3LGCA 3RAZA 2C0GA 18GSA 2VUPA 3TKRA 3GRXA 2IMEA 3IK9A 3ZZXA 2VL2A 3FK8A 2WB9A 3VI7A 1K0OA 5A5KA 3EE2A 2H73A 2LRTA 1TKDB 5F05A 4IS0A 1RK4A 4BPYA 2DJ1A 2EFDA 1GUHA 5IMFA 3HJPA 2VCQA 5A4UA 2DIYA 1KNGA 4KA0A 1XXUA 1TRWA 3SBCA 4HEA2 1M0UA 4EC0A 2LKUA 5ECNB 4NMUA 2WFCA 5J3RA 5KN3A 2AAWA 3TJJA 4XS4A 2CVDA 5CYYA 2A4HA 5JWOB 5J41A 2MZCA 2B5EA 2OADA 2YANA 2ON7A 3NZNA 2GDRA 4RQRA 2VCZA 3GX8A 3L4NA 3RHCA 3EVIA 5HR0A 1FAAA 8GSSA 3N5OA 1SJZA 1YEXA 4EXJA 6GSYA 4ZB7A 4LMWA 3HVNA 1ZYQB 2DSAA 1MDKA 1ERWA 1M2DA 1SD9A 4Q5RA 4L5OA 1VF2A 2FUG2 1BEDA 3DD3A 2HRFA 1A24A 4QMKA 1GSYA 2H19A 5LNKe 2VOCA 5ID2A 1SU9A 4XRDA 3F0IA 2IFQB 3LW9A 4J57E 2YN1A 1QMVA 3D4MA 3A2WA 4L8EA 4AJ7A 5F07A 4NHZA 1TRSA 5AGYA 1ST9A 3H8QA 4BVYA 1OKDA 3ZVJA 1XBSA 4NXIA 4K5RA 3LORA 4WF4A 2EFCA 3UVHA 1PMTA 2MMNA 1T1VA 2EIQA 1GH2A 2GS3A 3BCIA 4I2UA 5IMVA 3TB2A 4XRAA 2LS5A 3D6IA 2WDUA 4WKWA 5HFGA 1KTEA 2AV4A 1A2MA 1YKCA 4N3ZA 5B6NA 1XWBA 1SK2A 1PX7A 1ZL9A 3LQ7A 1WOUA 2VL9A 2VIMA 5GAPD 3QFAC 2FY6A 4TXVA 3C73A 3HCZA 2LJAA 2WVYA 4ULXA 4O7HA 2VLTA 2J9HA 3FZ9A 1HNCA 12GSA 2HSNA 4TRXA 5KOWA 3APOA 2AB6A 5BMUA 2JZSA 3FMWA 3ZVJD 2G2QA 3KH9A 1N25A 2HRKB 4ZILA 1DBYA 13GSA 2L4CA 1TRVA 4D73B 2R5GA 1X5CA 1Z3EA 4K7IA 5J9CA 1O85A 5J9BA 3UVTA 2IMDA 3M9JA 1YZXA 20GSA 3KMOA 3C1RA 2HXKA 1YDKA 1GLPA 1I5GA 2GQLA 2LUSA 1I9DA 1U6TA 2TIRA 4OD7A 4POBA 4PQ1A 2JSYA 1TTZA 3GMFA 3NIVA 2H76A 2YPMA 1PL1A 4MZBA 2E2GA 4OO5A 4PI2C 1PL2A 3HKRA 2H1AA 2P5RA 1GP1A 2YWMA 3HD5A 1V40A 5HFKA 2G0FA 4O5UA 3F6DA 2V1MA 2MMOA 3IXRA 1F37A 1TP9A 1XWCA 3BBYA 5CRHA 2KP2A 3HJMA 1ERUA 4G9HA 1EGRA 3LWAA 4FYUA 3L9VA 3ZREA 3MDKA 2KHPA 1XZOA 2LJRA 3KCMA 3DYRA 2C4JA 1H4OA 5AIXA 2H74A 1PFOA 4PQHA 2WCIA 1GSSA 4TXOB 1TK8B 2RUEA 4NPBA 3PR8A 3TKSE 3DVXA 3A2XA 4HI7A 4F03A 4HOJA 1TI3A 3J7Yk 3GYKA 4QL7A 1SJIA 2IMIA 3TKPA 1ILOA 3C8EA 4FO5A 5DAKA 4ISDA 1RQMA 1S3DA 3C71A 2NDOA 5H5SA 3UJ1A 4JBBA 5KN2A 3RPNA 3ED3A 3WGEA 3VWWA 2R4VA 4TVEA 4BL7A 3KTLA 4K7NA 2VCVA 4KX4A 1XIYA 2DKHA 3TU3B 3EWLA 3WT2A 1FHEA 2VM2A 5ECQB 4WF5A 3RGBC 3D0ZA 1A2LA 2OBKA 2VAFA 4K7OA 1O8WA 3ERWA 3FR3A 1GNWA 4ECJA 3LG6A 3GNJA 3A3TA 4IGJA 2MBTA 4OFTA 1BX9A 2QA1A 4Q5FA 4O5QA 2XC2A 4EKZA 2NPBA 1ERTA 2HI7A 4MDCA 3TCOA 1EV9A 3TUEA 4Z7XA 2YOIA 3FZ5A 5IIZA 2NVLA 2C1YA 4AJ6A 5HR3A 1JFUA 2RM5A 5AN1A 5GSSA 1BF5A 3G7IA 1FVKA 3ZFLA 4I5QA 3FZ4A 2VM1A 2HZEB 5DQSA 2CAQA 2HSMA 2LRCA 4BVXB 1SK1A 2HSHA 3IAM2 1K0MA 3VI5A 2FA4A 3SWLA 1SL0B 1MTCA 1GUKA 1AQXA 2KP1A 3HZ8A 2B1KA 3QD9A 3TOTA 4IQAA 1OE8A 4IBPA 2IWTA 5J4VA 4IW9A 4OCFA 4DSSA 1OE7A 2M72A 4HU9A 1YEPA 1PA3A 3IA1A 3GFKA 5G30A 1GULA 2F9SA 3U5RE 3H1NA 1CQHA 1JLWA 1JHBA 3ME7A 1QGVA 1IYHA 4ML1A 5E4WA 3TOUA 5KOXA 4LL1B 4ICYA 5JWRB 2GTUA 2YWOA 2LSTA 2I3YA 2AHEA 4G01A 5JWQB 4K9ZA 2LJKA 1MEKA 1TK0B 5GAND 1OC9A 2LRNA 4KB3A 2R37A 3KEBA 3QDNA 3F9UA 1HYUA 2EFHA 1DSBA 1XW5A 5C00A 1SYRA 2V6KA 2C3QA 4K6XA 2I81A 4WR4A 5D9VA 1WPIA 5DCHA 3QAGA 3U6VA 2JSZA 5A5HB 2ES7A 2WVZA 4Q5NA 1GNEA 4GXZA 1R26A 1X5EA 2H71A 3VURA 2V41A 3KP9A 5CNWA 4MZCA 1QQ2A 2DJ3A 4ZXGA 2MMAA 4TR1B 3KD0A 4XS4B 1I1IP 2WW3A 4IN0A 2N5FA 5LCZA 1ML6A 1SKWB 1FG4A 5CRWA 4TKYA 1U88A 4JRRA 19GSA 3WYWA 4IELA 2YNXA 3EMXA 3H79A 2V6OA 4GLTA 3GSSA 3ISOA 2NBSA 1AIUA 1XW9A 1BYEA 1ZZYA 2H0GA 2KOKA 1WE0A 3C7MA 4FQUA 2PWJA 4WETA 11GSA 5CRGA 2L6CA 1OC3A 1A0RP 2QSIA 3EU4A 5FT3A 2MMZA 2UZ8A 5D73A 4EVMA 5IQYA 3HJOA 1Q4JA 3QCPA 1JZOA 3HA9A 5HR1A 2PGTA 3TKSA 5D93A 1BG5A 2WULA 4CY8A 1WJKA 3GH6A 2RUFA 1NHYA 4Z2TA 4X1UA 1K0DA 5LD0A 2E0QA 4BVYB 4MJAA 4XS6A 2B1LA 1O8XA 1FO5A 2F8FA 4KUNA 2IL3A 4E8HA 4ZB9A 2JZRA 5IOWA 2QGVA 4BA7A 5B6MA 3TDGA 1YF1A 4AGSA 3MNGA 4ECBA 1BQ7A 3FW2A 4PX1A 1OKTA 4MH3A 4YQVA 1ZCPA 3I9V2 2OJLA 2PU9C 4GF0A 2GVPA 2H66A 1A23A 3M3MA 4HSCX 3CRUA 1TU7A 4LA1A 3EYTA 1K0CA 4IJIA 1K0AA 4MK3A 1R4WA 4KNDA 3ZITA 2FWGA 4LL4B 2NTOA 4BWQA 4HS1A 5B7CA 1A8YA 4JE1A 1Y1UA 1TI1A 2K6VA 4MJBA 4KSMA 4WBRD 4G0KA 2CV4A 4GSTA 2CX3A 3EURA 2QA2A 3GL3A 1O81A 2CVKA 4HUAA 3D21A 3IHQA 3K8NA 5FWGA 2V2GA 3F6FA 6GSSA 2ALBA 1FB6A 2B5XA 4JEDA 5DALB 3FZAA 5A4WA 3LYKA 3LJRA 5B8BA 3GHAA 3KXOA 1X9MB 4P3YB 1X9WB 2AUVA 2VCWA 2DJKA 2V32A 1GTBA 1QK8A 5IPHA 4OFMA 2I4AA 3GKMA 4ZL8A 4JR4A 4GTUA 1EEJA 1TDIA 1FVJA 1NHOA 4O92A 1Z7RA 5ECIB 1WRYA 3PH9A 1VGLA 4F0CA 3I6AA 1TK5B 2C8UA 2KLXA 2WVXB 3PGTA 6GSUA 2O87A 4FIWA 1SENA 4GRFA 1Z6NA 4YAVA 1YY7A 3KTBA 3GKXA 2ZCTA 2OBIA 4V2LA 2L4QA 3EINA 1SVOA 1PSQA 1UA5A 4ML6A 1AAZA 3ERFA 5JCUA 3UL3A 3P8WA 1GSFA 5COHA 3C1SA 4NV2A 4G19A 4OWYA 2H01A 3F4TA 3WT1A 6GSWA 4BIKA 3BOAA 4EIQA 1J9BA 4KH7A 1HNAA 2EIOA 2LV3A 4LLRA 2WJUA 3JCML 5INYA 3HY2A 4YKFA 2I9HA 2P5QA 4GSSA 3GUSA 1BAYA 2RLIA 5DAKB 2MBSA 2FCHA 3TKQA 1SL2B 3FRCA 3TJGA 3MWHA 4ZB6A 2B7KA 2HYXA 4L0UA 4X4JA 3QAWA 3O6TA 5DBQA 4QL9A 4KW6A 5GZZB 5ECLB 4BL7B 1PGTA 2PBJA 4Q5QA 4IQ1A 2FA8A 3MAKA 3GN3A 1DE1A 1R7HA 5AISA 3TRQA 3FYGA 3LEFA 1KBNA 2IFQA 5A34B 2VLVA 4GQFA 2YWIA 3UEMA 1K3YA 3HZ4A 5ECPB 5CP1A 5A1NA 1HNBA 2A2SA 2DJ2A 4X43A 2EFEA 3IPZA 4ZL7A 4MH2A 1FOVA 2RM6A 2C0EA 3R2QA 1Z7PA 2H1BA 1NSWA 1Y25A 4PQIA 4G2EA 2FGXA 1YVLA 3RHBA 6GSVA 3WD6A 3KMNA 2D2ZA 4N0VA 1EZKA 4IKHA 5DJLA 2E2MA 3IOSA 3GH9A 1BG1A 1ZOFA 2CQ9A 4QQ7A 2O89A 4G10A 2LTKA 5F8BA 3APQA 2QC7A 1CQGA 4ZBDA 3IHGA 3IC4A 1UVZA 3HVVA 2VCXA 2RIIA 1F9MA 3M1GA 3ZIVA 3ZLPA 1M3JA 2GGTA 3IBHA 2H30A 2FD3A 2ZNMA 2XPDA 2Z9SA 1XW6A 1F6MC 1U3AA 2N5BA 1H75A 2YP6A 3CYNA 4HZ2A 4EUYA 3BD2A 5EL8A 2HRKA 3Q6OA 3KM6A 4F0BA 2HFDA 4CDOA 1U87A 4D73A 4Z2RA 3H93A 3HDCA 3QMXA 2OA7A 4CHSA 3G7YA 1YF0A 1EP8A 2KUCA 3L0HA 3L9UA 1SVLA 1T7PB 1VF3A 2DJ0A 5CO3A 1G7OA 4L0WA 1J08A 2R0PA 1F3BA 2JU5A 3W6GA 4NWYA 4MPGA 2LQOA 1EV4A 1B9XC 4AI6A 3ZIJA 4LMVA 1ACVA 4MLYA 3TJKA 4J56E 1HD2A 2XPEA 1TXXA 2VL2C 1J0FA 4OMVA 1OYJA 4H86A 3M8NA 4EO3A 6GSTA 4I97A 4EDZA 3D5JA 3IR4A 1K0NA 4TOPA 1PKWA 3L78A 4PXOA 4PGTA 5F0GA 5CRDA 1C72A 1AQVA 3LXTA 3UAPA 3UARA 5JCWA 3LSZA 2C0DA 4MABA
chains in the Genus database with same CATH topology
2C0FA 1IYIA 4MF5A 4KGIA 2H1DA 2GQKA 1YJ6A 2PERA 3ERGA 4XCSA 1TJDA 4TXOA 1XCCA 1XWAA 2PPTA 1NW2A 1AQWA 1B8XA 5D9WA 3OR5A 2L6DA 3WGXA 2C80A 1U3IA 1GSDA 3P2AA 3BJ5A 3F3QA 4V2MA 1M9BA 4K2XA 4MJCA 5ABRA 2AJQB 3IDVA 4TR4A 3HVSA 3RDWA 5ECRB 2HNLA 2C3NA 1A2JA 4DVCA 5IMCA 5HFIA 1WWJA 1EGOA 1PRXA 3KP8A 4KCAA 1TU8A 16GSA 2YZUA 1GRXA 4GSNA 2IN3A 4A5PA 2H6XA 4K8MA 2DMLA 2IJYA 4WXTA 1XFLA 5IPGA 4EIPA 5ECMB 4BWSA 1K0BA 3F3RA 3HMJG 3S9FA 3ZYWA 1AW9A 1FOHA 1GSUA 4FYCA 1EOGA 4O5RA 4J2FA 3M9KA 3I43A 5D8IA 4MF6A 1O7UA 5DJMA 2UV8G 3V1WA 4N10A 1ZYPA 2IPAA 4YAPA 4ECCA 2F8AA 3VWUA 5ELGA 1XWGA 2B3SA 2IIYA 4FYBA 2R2JA 4O32A 2GZYA 5C04A 3FY7A 5D9XA 1G7EA 1LJRA 1A0FA 2GSSA 1JZRA 2CT6A 4I2TA 2HZEA 3HXSA 4TW5A 5ID2B 5AIVA 5ECKB 3LXZA 3LYPA 2P31A 2FNOA 4EE0A 1VRSD 4TR0A 2IMFA 2FHEA 4HQZA 1PN9A 4N30A 4AJ8A 3GX0A 1M9AA 4K1FA 1DE2A 2LNTA 1G6YA 5DVBA 4KCEA 4AKXB 3PINA 4XS1A 2YV7A 4GQCA 4KDYA 1YQ1A 1VF1A 3FKFA 2HLSA 2E7PA 2JADA 2LQQA 1JZDA 4NV5A 3LFLA 4USSA 2IMKA 1NM3A 3TJBA 5HQPA 3DKSA 5IO0A 2MYGA 2YJHA 5ELAA 1GTUA 4PURA 1M2BA 3DEXA 3VPQA 4K5SA 1V9WA 4AF2A 1DUGA 3ZMLA 4ZIJA 2R0GA 4EL1A 4K2DA 2X64A 3CXGA 3IC8A 5ECHB 3VWXA 5E59A 2R0CA 5EVOA 1T00A 4G0LA 4PUAA 1GL8A 5A5HA 3FEUA 4KAEA 3BCKA 5J4YA 1ZYNA 2BTOT 1V98A 2BMXA 2TRXA 2OE1A 2H6YA 4PTSA 3QPMA 5G1LA 4TR1A 2HZFA 2VLUA 1ON4A 22GSA 2O5VA 5G5FA 3F4RA 5F06A 1USBA 4EDYA 2HSNB 5G5EA 1GSQA 1K3LA 5BMUB 2PVOC 3E9JB 2ZUPA 2GLRA 1UN2A 5G31A 5J47A 1VF4A 2FLSA 3KIJA 1GLQA 4YH2A 5IO2A 1W4VA 3EC3A 3NOFA 3A5IA 2A4VA 3QFBC 5EPFA 4ILFA 2H1LA 1F3AA 1A8LA 2L59A 1W89A 5A4VA 4ECIA 10GSA 2HSYA 3ZMKA 4V1Ap 3AY8A 4PNFA 4GCIA 4WR5A 3O76A 1S3AA 2HT9A 3A2VA 4IP6A 4OO4A 2LEGA 4HZ4A 3P7XA 4F82A 1PQNA 3GTUA 3CRTA 2JZTA 4AKHA 1N2AA 2M46A 2GQMA 1RW1A 3A5WA 4EF0A 5CAXA 4JR6A 3N9JA 3RBTA 1N8JA 4MCUA 2X8GA 3H4KA 5A1NB 3GSTA 3US3A 1SJ6A 3QR6A 3VLNA 4TN8A 3GURA 3FR9A 5HR2A 5GSTA 4V2NA 2HE3A 3ZTLA 1B4QA 3VWVA 2YCDA 5H5RA 4V1Ag 3UIWA 5IMDA 4ZBAA 1PD21 2OE0A 4HDEA 3EMPA 2DJJA 2R6KA 4E68A 2K18A 1EWXA 4K0NA 4PNGA 3ZFBA 2L5LA 2TRCP 4AKGA 4OFNA 4W66A 2H0IA 5ECSA 1B48A 4FH8A 2H1GA 5JCGA 3CTFA 4JU5A 3KGKA 2REMA 1QUWA 2GT6A 3KH7A 3IAS2 1EP7A 1Z6MA 2PN8A 1HQOA 3CSIA 2F3MA 1SVMA 4AKIA 1GTIA 14GSA 2EIRA 3MSZA 3DIEA 4HU7A 1JZWA 1WIKA 3CSHA 2LNSA 4TR3A 2VO4A 1BJXA 4MJEA 5DALA 2WRTA 2P0GA 3F63A 1XVWA 5IM9A 1EOHA 1JLVA 2DC5A 4POKA 1R5AA 2JACA 4YKGA 2B5YA 2OKAA 3DMLA 1UC7A 4GWRA 3D4TA 4YQMA 17GSA 1GWCA 2H75A 2YV9A 3DWVA 3GL5A 3QOUA 4CW9A 2XBIA 1O73A 2X99A 2XHFA 1ERVA 2PUKC 2M80A 1Z5YE 1YKAA 2X8HA 1KEBA 2GSTA 5H5QA 4ZB8A 2CZ2A 1M2AA 2GSQA 1X9SB 2CA8A 5DQYA 3HHVA 1OVNA 3G7JA 2L57A 4WBJA 2AYTA 4RUVA 3HVXA 5IMAA 1V2AA 3W8JA 2HSMB 4KSOA 3E0UA 5KEJA 4POLA 4MMMA 4HJ2A 1TW9A 3CTGA 2DLXA 1EEMA 1X5DA 1AXDA 1ZMAA 3DRNA 2VKZG 1FW1A 3O3TA 4RI7A 2X4AA 1SYXA 5D9TA 2B6MA 3ZRDA 1AC1A 2WZ9A 3E3EA 1GTAA 4Z2UA 2HQTA 3TGZA 5J40A 4DSSB 3D22A 3M0FA 3HYPA 2DMMA 2F51A 2J23A 2PVQA 3FHKA 1GUMA 1SD8A 5ECOB 3TRPA 3CMIA 3UOMA 1K3OA 2R3XA 7GSSA 4WEYA 4YQUA 1E6BA 1G6WA 4MNNA 3IK7A 5EY6A 1XOAA 3DGQA 3F8UA 5B8AA 4ZBBA 2GT5A 1G0TA 1M99A 2X49A 3EPTA 1OC9B 3KZQA 4X0XA 1QXHA 1ABAA 4ZL9A 4HQSA 1SL1B 4N0ZA 2VD1A 2CX4A 2CAIA 2H0HA 1TRUA 4F2IA 3IV4A 4PUFC 4DEJA 2GSRA 2OE3A 3TKSC 3GIXA 2OACA 1ZYEA 3Q18A 3Q74A 2EC4A 6GSXA 5A34A 1PN0A 5L71A 1T3BA 5DDLA 1V58A 3CWGA 2A2RA 4CY6A 2QKEA 1SK0A 3CBUA 2K9FA 3UBKA 5J4UA 4IHUA 4DSRA 4I8BA 1Y6EA 2K8VA 1AUCA 2FWEA 1THXA 3MIXA 4XIHA 5CREA 4POMA 2X8CA 3KJYA 3VFIA 1V57A 1M7TA 3ME8A 3IRAA 4IJ3A 4NAXA 4GDFA 4ACSA 1X0RA 3GV1A 2N5AA 1OAZA 2FWHA 1OC8A 2DIZA 1Z9HA 5FHIA 3F4SA 3I69A 2WGRA 4XHMA 1SKRB 1WMJA 5IMZA 2B7JA 2OT3A 4MPFA 1WP0A 1XPVA 3L9SA 1Q98A 2CZ3A 3DVWA 3DXBA 4NHWA 2C3TA 5J5NA 5D96A 2FWFA 4HJMA 5BRTA 3W8SA 3UMAA 3UBLA 5G1KA 3WGDA 3CSJA 2O8VB 1XVQA 3TRXA 2HRAA 4I6XA 2PMTA 1LU4A 1QFNA 4IVFA 2VCTA 1E2YA 3P90A 2YJ7A 2H72A 1THOA 3RPPA 4KDXA 1GSEA 1T4YA 1ZGNA 1TXUA 4DSQA 3EU3A 1PX6A 3J7Yb 2GZPA 4K0GA 5DCGA 3GA4A 2O7KA 4MF7A 1T4ZA 3TJFA 1T8EB 1LBKA 2VL3A 3FR6A 2I1UA 4JZQA 4ID0A 4KE3A 4E8EA 1MDIA 2BJXA 2VD0A 4MP4A 1F2EA 1FB0A 2H70A 3G9BA 1XWKA 9GSSA 4MZWA 3VPTA 2O85A 1MD4A 2ON5A 1TOFA 1B4PA 1MDJA 2HRNA 2GZZA 2YZHA 4RQXA 1B9YC 4N11A 4KDUA 3APSA 5IOXA 2CVBA 3PPUA 4RI6A 2DKIA 3R3EA 1PKZA 1URMA 3IE3A 2K8SA 2DBCA 2JL4A 4G0IA 4BVXA 2H6ZA 3QAVA 2A2PA 3GKKA 4XTSA 5G2ZA 1XOBA 5ENUA 5KN1A 1MD3A 3Q19A 4L5LA 2L5OA 3VK9A 5KN0A 2H8LA 3GTUB 4KF9A 1O6JA 2YWNA 4IP1A 3MYDA 3GKNA 4F9ZA 1SKSB 4MA9A 1R5PA 1S3CA 3ZL5A 2WS2A 4OCEA 2XBQA 3LGCA 3RAZA 2C0GA 18GSA 2VUPA 3TKRA 3GRXA 2IMEA 3IK9A 3ZZXA 2VL2A 3FK8A 2WB9A 3VI7A 1K0OA 5A5KA 3EE2A 2H73A 2LRTA 1TKDB 5F05A 4IS0A 1RK4A 4BPYA 2DJ1A 2EFDA 1GUHA 5IMFA 3HJPA 2VCQA 5A4UA 2DIYA 1KNGA 4KA0A 1XXUA 1TRWA 3SBCA 4HEA2 1M0UA 4EC0A 2LKUA 5ECNB 4NMUA 2WFCA 5J3RA 5KN3A 2AAWA 3TJJA 4XS4A 2CVDA 5CYYA 2A4HA 5JWOB 5J41A 2MZCA 2B5EA 2OADA 2YANA 2ON7A 3NZNA 2GDRA 4RQRA 3L4NA 2VCZA 3GX8A 3RHCA 3EVIA 5HR0A 1FAAA 8GSSA 3N5OA 1SJZA 1YEXA 4EXJA 6GSYA 4ZB7A 4LMWA 1ZYQB 2DSAA 1MDKA 1ERWA 1M2DA 1SD9A 4Q5RA 4L5OA 1VF2A 2FUG2 1BEDA 3DD3A 2HRFA 1A24A 4QMKA 1GSYA 2H19A 5LNKe 2VOCA 5ID2A 1SU9A 4XRDA 3F0IA 2IFQB 3LW9A 4J57E 2YN1A 1QMVA 3D4MA 3A2WA 4L8EA 4AJ7A 5F07A 4NHZA 1TRSA 5AGYA 1ST9A 3H8QA 4BVYA 1OKDA 3ZVJA 1XBSA 4NXIA 4K5RA 3LORA 4WF4A 2EFCA 3UVHA 1PMTA 2MMNA 1T1VA 2EIQA 1GH2A 2GS3A 3BCIA 4I2UA 5IMVA 3TB2A 4XRAA 2LS5A 3D6IA 2WDUA 4WKWA 5HFGA 1KTEA 2AV4A 1A2MA 1YKCA 4N3ZA 5B6NA 1XWBA 1SK2A 1PX7A 1ZL9A 3LQ7A 1WOUA 2VL9A 2VIMA 5GAPD 3QFAC 2FY6A 4TXVA 3C73A 3HCZA 2LJAA 4ULXA 4O7HA 2VLTA 2J9HA 3FZ9A 1HNCA 12GSA 2HSNA 4TRXA 5KOWA 3APOA 2AB6A 5BMUA 2JZSA 3FMWA 3ZVJD 2G2QA 3KH9A 1N25A 2HRKB 4ZILA 1DBYA 13GSA 2L4CA 1TRVA 4D73B 2R5GA 1X5CA 1Z3EA 4K7IA 5J9CA 1O85A 5J9BA 3UVTA 2IMDA 3M9JA 1YZXA 20GSA 3KMOA 3C1RA 2HXKA 1YDKA 1GLPA 1I5GA 2GQLA 2LUSA 1I9DA 1U6TA 2TIRA 4OD7A 4POBA 4PQ1A 2JSYA 1TTZA 3GMFA 3NIVA 2H76A 2YPMA 1PL1A 4MZBA 2E2GA 4OO5A 1PL2A 3HKRA 2H1AA 2P5RA 1GP1A 2YWMA 3HD5A 1V40A 5HFKA 2G0FA 4O5UA 3F6DA 2V1MA 2MMOA 3IXRA 1F37A 1TP9A 1XWCA 3BBYA 5CRHA 2KP2A 3HJMA 1ERUA 4G9HA 1EGRA 3LWAA 4FYUA 3L9VA 3ZREA 3MDKA 2KHPA 1XZOA 2LJRA 3KCMA 3DYRA 2C4JA 1H4OA 5AIXA 2H74A 4PQHA 2WCIA 1GSSA 4TXOB 1TK8B 2RUEA 4NPBA 3PR8A 3TKSE 3DVXA 3A2XA 4HI7A 4F03A 4HOJA 1TI3A 3J7Yk 3GYKA 4QL7A 1SJIA 2IMIA 3TKPA 1ILOA 3C8EA 4FO5A 5DAKA 4ISDA 1RQMA 1S3DA 3C71A 2NDOA 5H5SA 3UJ1A 4JBBA 5KN2A 3RPNA 3ED3A 3WGEA 3VWWA 2R4VA 4TVEA 4BL7A 3KTLA 4K7NA 2VCVA 4KX4A 1XIYA 2DKHA 3TU3B 3EWLA 3WT2A 1FHEA 2VM2A 5ECQB 4WF5A 3D0ZA 1A2LA 2OBKA 2VAFA 4K7OA 1O8WA 3ERWA 3FR3A 1GNWA 4ECJA 3LG6A 3GNJA 3A3TA 4IGJA 2MBTA 4OFTA 1BX9A 2QA1A 4Q5FA 4O5QA 2XC2A 4EKZA 2NPBA 1ERTA 2HI7A 4MDCA 3TCOA 1EV9A 3TUEA 4Z7XA 2YOIA 3FZ5A 5IIZA 2NVLA 2C1YA 4AJ6A 5HR3A 1JFUA 2RM5A 5AN1A 5GSSA 1BF5A 3G7IA 1FVKA 3ZFLA 4I5QA 3FZ4A 2VM1A 2HZEB 5DQSA 2CAQA 2HSMA 2LRCA 4BVXB 1SK1A 2HSHA 3IAM2 1K0MA 3VI5A 2FA4A 3SWLA 1SL0B 1MTCA 1GUKA 1AQXA 2KP1A 3HZ8A 2B1KA 3QD9A 3TOTA 4IQAA 1OE8A 4IBPA 2IWTA 5J4VA 4IW9A 4OCFA 4DSSA 1OE7A 2M72A 4HU9A 1YEPA 1PA3A 3IA1A 3GFKA 5G30A 1GULA 2F9SA 3U5RE 3H1NA 1CQHA 1JLWA 1JHBA 3ME7A 1QGVA 1IYHA 4ML1A 5E4WA 3TOUA 5KOXA 4LL1B 4ICYA 5JWRB 2GTUA 2YWOA 2LSTA 2I3YA 2AHEA 4G01A 5JWQB 4K9ZA 2LJKA 1MEKA 1TK0B 5GAND 1OC9A 2LRNA 4KB3A 2R37A 3KEBA 3QDNA 3F9UA 1HYUA 2EFHA 1DSBA 1XW5A 5C00A 1SYRA 2V6KA 2C3QA 4K6XA 2I81A 4WR4A 5D9VA 1WPIA 5DCHA 3QAGA 3U6VA 2JSZA 5A5HB 2ES7A 4Q5NA 1GNEA 4GXZA 1R26A 1X5EA 2H71A 3VURA 2V41A 3KP9A 5CNWA 4MZCA 1QQ2A 2DJ3A 4ZXGA 2MMAA 4TR1B 3KD0A 4XS4B 4IN0A 2N5FA 5LCZA 1ML6A 1SKWB 1FG4A 5CRWA 4TKYA 1U88A 4JRRA 19GSA 3WYWA 4IELA 2YNXA 3EMXA 3H79A 2V6OA 4GLTA 3GSSA 3ISOA 2NBSA 1AIUA 1XW9A 1BYEA 1ZZYA 2H0GA 2KOKA 1WE0A 3C7MA 4FQUA 2PWJA 4WETA 11GSA 5CRGA 2L6CA 1OC3A 1A0RP 2QSIA 3EU4A 5FT3A 2MMZA 2UZ8A 5D73A 4EVMA 5IQYA 3HJOA 1Q4JA 3QCPA 1JZOA 3HA9A 5HR1A 2PGTA 3TKSA 5D93A 1BG5A 2WULA 4CY8A 1WJKA 3GH6A 2RUFA 1NHYA 4Z2TA 4X1UA 1K0DA 5LD0A 2E0QA 4BVYB 4MJAA 4XS6A 2B1LA 1O8XA 1FO5A 2F8FA 4KUNA 2IL3A 4E8HA 4ZB9A 2JZRA 5IOWA 2QGVA 4BA7A 5B6MA 3TDGA 1YF1A 4AGSA 3MNGA 4ECBA 1BQ7A 3FW2A 4PX1A 1OKTA 4MH3A 4YQVA 1ZCPA 3I9V2 2OJLA 2PU9C 4GF0A 2GVPA 2H66A 1A23A 3M3MA 3CRUA 1TU7A 4LA1A 3EYTA 1K0CA 4IJIA 1K0AA 4MK3A 1R4WA 4KNDA 3ZITA 2FWGA 4LL4B 2NTOA 4BWQA 4HS1A 5B7CA 1A8YA 4JE1A 1Y1UA 1TI1A 2K6VA 4MJBA 4KSMA 4WBRD 4G0KA 2CV4A 4GSTA 2CX3A 3EURA 2QA2A 3GL3A 1O81A 2CVKA 4HUAA 3D21A 3IHQA 3K8NA 5FWGA 2V2GA 3F6FA 6GSSA 2ALBA 1FB6A 2B5XA 4JEDA 5DALB 3FZAA 5A4WA 3LYKA 3LJRA 5B8BA 3GHAA 3KXOA 1X9MB 4P3YB 1X9WB 2AUVA 2VCWA 2DJKA 2V32A 1GTBA 1QK8A 5IPHA 4OFMA 2I4AA 3GKMA 4ZL8A 4JR4A 4GTUA 1EEJA 1TDIA 1FVJA 1NHOA 4O92A 1Z7RA 5ECIB 1WRYA 3PH9A 1VGLA 4F0CA 3I6AA 1TK5B 2C8UA 2KLXA 3PGTA 6GSUA 2O87A 4FIWA 1SENA 4GRFA 1Z6NA 4YAVA 1YY7A 3KTBA 3GKXA 2ZCTA 2OBIA 4V2LA 2L4QA 3EINA 1SVOA 1PSQA 1UA5A 4ML6A 1AAZA 3ERFA 5JCUA 3UL3A 3P8WA 1GSFA 5COHA 3C1SA 4NV2A 4G19A 4OWYA 2H01A 3F4TA 3WT1A 6GSWA 3BOAA 4EIQA 1J9BA 4KH7A 1HNAA 2EIOA 2LV3A 4LLRA 2WJUA 3JCML 5INYA 3HY2A 4YKFA 2I9HA 2P5QA 4GSSA 3GUSA 1BAYA 2RLIA 5DAKB 2MBSA 2FCHA 3TKQA 1SL2B 3FRCA 3TJGA 3MWHA 4ZB6A 2B7KA 2HYXA 4L0UA 4X4JA 3QAWA 3O6TA 5DBQA 4QL9A 4KW6A 5GZZB 5ECLB 4BL7B 1PGTA 2PBJA 4Q5QA 4IQ1A 2FA8A 3MAKA 3GN3A 1DE1A 1R7HA 5AISA 3TRQA 3FYGA 3LEFA 1KBNA 2IFQA 5A34B 2VLVA 4GQFA 2YWIA 3UEMA 1K3YA 3HZ4A 5ECPB 5CP1A 5A1NA 1HNBA 2A2SA 2DJ2A 4X43A 2EFEA 3IPZA 4ZL7A 4MH2A 1FOVA 2RM6A 2C0EA 3R2QA 1Z7PA 2H1BA 1NSWA 1Y25A 4PQIA 4G2EA 2FGXA 1YVLA 3RHBA 6GSVA 3WD6A 3KMNA 2D2ZA 4N0VA 1EZKA 4IKHA 5DJLA 2E2MA 3IOSA 3GH9A 1BG1A 1ZOFA 2CQ9A 4QQ7A 2O89A 4G10A 2LTKA 5F8BA 3APQA 2QC7A 1CQGA 4ZBDA 3IHGA 3IC4A 1UVZA 3HVVA 2VCXA 2RIIA 1F9MA 3M1GA 3ZIVA 3ZLPA 2GGTA 3IBHA 2H30A 2FD3A 2ZNMA 2XPDA 2Z9SA 1XW6A 1F6MC 1U3AA 2N5BA 1H75A 2YP6A 3CYNA 4HZ2A 4EUYA 3BD2A 5EL8A 2HRKA 3Q6OA 3KM6A 4F0BA 2HFDA 4CDOA 1U87A 4D73A 4Z2RA 3H93A 3HDCA 3QMXA 2OA7A 4CHSA 3G7YA 1YF0A 1EP8A 2KUCA 3L0HA 3L9UA 1SVLA 1T7PB 1VF3A 2DJ0A 5CO3A 1G7OA 4L0WA 1J08A 2R0PA 1F3BA 2JU5A 3W6GA 4NWYA 4MPGA 2LQOA 1EV4A 1B9XC 4AI6A 3ZIJA 4LMVA 1ACVA 4MLYA 3TJKA 4J56E 1HD2A 2XPEA 1TXXA 2VL2C 1J0FA 4OMVA 1OYJA 4H86A 3M8NA 4EO3A 6GSTA 4I97A 4EDZA 3D5JA 3IR4A 1K0NA 4TOPA 1PKWA 3L78A 4PXOA 4PGTA 5F0GA 5CRDA 1C72A 1AQVA 3LXTA 3UAPA 3UARA 5JCWA 3LSZA 2C0DA 4MABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0F A;  1IYI A;  4MF5 A;  4KGI A;  2H1D A;  2GQK A;  1YJ6 A;  2PER A;  3ERG A;  4XCS A;  1TJD A;  4TXO A;  1XCC A;  1XWA A;  2PPT A;  1NW2 A;  1AQW A;  1B8X A;  5D9W A;  3OR5 A;  2L6D A;  3WGX A;  2C80 A;  1U3I A;  1GSD A;  3P2A A;  3BJ5 A;  3F3Q A;  4V2M A;  1M9B A;  4MJC A;  5ABR A;  2AJQ B;  3IDV A;  4TR4 A;  3HVS A;  3RDW A;  5ECR B;  2HNL A;  2C3N A;  1A2J A;  4DVC A;  5IMC A;  5HFI A;  1WWJ A;  1EGO A;  1PRX A;  3KP8 A;  4KCA A;  1TU8 A;  16GS A;  2YZU A;  1GRX A;  4GSN A;  2IN3 A;  2H6X A;  4K8M A;  2DML A;  2IJY A;  4WXT A;  1XFL A;  5IPG A;  5ECM B;  4BWS A;  1K0B A;  3F3R A;  3S9F A;  3ZYW A;  1AW9 A;  1GSU A;  4FYC A;  1EOG A;  4O5R A;  4J2F A;  3M9K A;  3I43 A;  5D8I A;  4MF6 A;  1O7U A;  5DJM A;  3V1W A;  4N10 A;  2IPA A;  4YAP A;  4ECC A;  2F8A A;  3VWU A;  5ELG A;  1XWG A;  2B3S A;  2IIY A;  4FYB A;  2R2J A;  4O32 A;  2GZY A;  5C04 A;  3FY7 A;  5D9X A;  1G7E A;  1LJR A;  1A0F A;  2GSS A;  1JZR A;  2CT6 A;  4I2T A;  2HZE A;  3HXS A;  4TW5 A;  5ID2 B;  5AIV A;  5ECK B;  3LXZ A;  3LYP A;  2P31 A;  2FNO A;  4EE0 A;  1VRS D;  4TR0 A;  2IMF A;  2FHE A;  4HQZ A;  1PN9 A;  4N30 A;  4AJ8 A;  3GX0 A;  1M9A A;  4K1F A;  1DE2 A;  2LNT A;  1G6Y A;  5DVB A;  4KCE A;  3PIN A;  4XS1 A;  2YV7 A;  4GQC A;  4KDY A;  1YQ1 A;  1VF1 A;  3FKF A;  2HLS A;  2E7P A;  2JAD A;  2LQQ A;  1JZD A;  4NV5 A;  3LFL A;  4USS A;  2IMK A;  1NM3 A;  3TJB A;  5HQP A;  3DKS A;  5IO0 A;  2MYG A;  2YJH A;  5ELA A;  1GTU A;  4PUR A;  1M2B A;  3DEX A;  3VPQ A;  1V9W A;  4AF2 A;  1DUG A;  3ZML A;  4ZIJ A;  4EL1 A;  4K2D A;  2X64 A;  3CXG A;  3IC8 A;  5ECH B;  3VWX A;  5E59 A;  5EVO A;  1T00 A;  4G0L A;  4PUA A;  1GL8 A;  3FEU A;  4KAE A;  3BCK A;  2BTO T;  1V98 A;  2BMX A;  2TRX A;  2H6Y A;  2OE1 A;  4PTS A;  3QPM A;  5G1L A;  4TR1 A;  2HZF A;  2VLU A;  1ON4 A;  22GS A;  5G5F A;  3F4R A;  5F06 A;  1USB A;  4EDY A;  2HSN B;  5G5E A;  1GSQ A;  1K3L A;  2PVO C;  3E9J B;  2ZUP A;  2GLR A;  1UN2 A;  5G31 A;  1VF4 A;  2FLS A;  3KIJ A;  1GLQ A;  4YH2 A;  5IO2 A;  1W4V A;  3EC3 A;  3NOF A;  3QFB C;  2A4V A;  5EPF A;  4ILF A;  1F3A A;  1A8L A;  2L59 A;  1W89 A;  5A4V A;  4ECI A;  10GS A;  2HSY A;  3ZMK A;  4V1A p;  3AY8 A;  4PNF A;  4GCI A;  4WR5 A;  3O76 A;  1S3A A;  2HT9 A;  3A2V A;  4IP6 A;  4OO4 A;  2LEG A;  4HZ4 A;  3P7X A;  4F82 A;  1PQN A;  3GTU A;  3CRT A;  2JZT A;  1N2A A;  2M46 A;  2GQM A;  1RW1 A;  3A5W A;  4EF0 A;  5CAX A;  4JR6 A;  3N9J A;  3RBT A;  1N8J A;  4MCU A;  2X8G A;  3H4K A;  3GST A;  3US3 A;  1SJ6 A;  3QR6 A;  3VLN A;  4TN8 A;  3GUR A;  3FR9 A;  5HR2 A;  5GST A;  4V2N A;  2HE3 A;  3ZTL A;  1B4Q A;  3VWV A;  2YCD A;  5H5R A;  4V1A g;  3UIW A;  5IMD A;  4ZBA A;  1PD2 1;  2OE0 A;  4HDE A;  3EMP A;  2DJJ A;  2R6K A;  2K18 A;  1EWX A;  4K0N A;  4PNG A;  3ZFB A;  2L5L A;  2TRC P;  4OFN A;  2H0I A;  5ECS A;  1B48 A;  4FH8 A;  2H1G A;  5JCG A;  3CTF A;  4JU5 A;  3KGK A;  2REM A;  1QUW A;  2GT6 A;  3KH7 A;  3IAS 2;  1EP7 A;  1Z6M A;  2PN8 A;  1HQO A;  3CSI A;  2F3M A;  1GTI A;  14GS A;  2EIR A;  3MSZ A;  3DIE A;  4HU7 A;  1JZW A;  1WIK A;  3CSH A;  2LNS A;  4TR3 A;  2VO4 A;  1BJX A;  4MJE A;  5DAL A;  2WRT A;  2P0G A;  3F63 A;  1XVW A;  5IM9 A;  1EOH A;  1JLV A;  2DC5 A;  4POK A;  1R5A A;  2JAC A;  2B5Y A;  2OKA A;  3DML A;  1UC7 A;  4GWR A;  3D4T A;  4YQM A;  17GS A;  1GWC A;  2H75 A;  2YV9 A;  3DWV A;  3GL5 A;  3QOU A;  4CW9 A;  2XBI A;  1O73 A;  2X99 A;  2XHF A;  1ERV A;  2PUK C;  2M80 A;  1Z5Y E;  1YKA A;  2X8H A;  1KEB A;  2GST A;  5H5Q A;  4ZB8 A;  2CZ2 A;  1M2A A;  2GSQ A;  1X9S B;  2CA8 A;  5DQY A;  3HHV A;  1OVN A;  3G7J A;  2L57 A;  4WBJ A;  2AYT A;  4RUV A;  3HVX A;  5IMA A;  1V2A A;  3W8J A;  2HSM B;  4KSO A;  3E0U A;  5KEJ A;  4POL A;  4MMM A;  4HJ2 A;  1TW9 A;  3CTG A;  2DLX A;  1EEM A;  1X5D A;  1AXD A;  1ZMA A;  3DRN A;  1FW1 A;  3O3T A;  4RI7 A;  1SYX A;  5D9T A;  2B6M A;  3ZRD A;  1AC1 A;  2WZ9 A;  3E3E A;  1GTA A;  2HQT A;  3TGZ A;  4DSS B;  3D22 A;  3M0F A;  3HYP A;  2DMM A;  2F51 A;  2J23 A;  2PVQ A;  3FHK A;  1GUM A;  1SD8 A;  5ECO B;  3TRP A;  3CMI A;  3UOM A;  1K3O A;  2R3X A;  7GSS A;  4WEY A;  4YQU A;  1E6B A;  1G6W A;  3IK7 A;  5EY6 A;  1XOA A;  3DGQ A;  3F8U A;  5B8A A;  4ZBB A;  2GT5 A;  1G0T A;  1M99 A;  1OC9 B;  3KZQ A;  4X0X A;  1QXH A;  1ABA A;  4ZL9 A;  4HQS A;  1SL1 B;  4N0Z A;  2VD1 A;  2CX4 A;  2CAI A;  2H0H A;  1TRU A;  4F2I A;  3IV4 A;  4PUF C;  4DEJ A;  2GSR A;  2OE3 A;  3TKS C;  3GIX A;  2OAC A;  1ZYE A;  3Q18 A;  3Q74 A;  2EC4 A;  6GSX A;  5L71 A;  1T3B A;  5DDL A;  1V58 A;  2A2R A;  2QKE A;  1SK0 A;  3CBU A;  2K9F A;  3UBK A;  5J4U A;  4IHU A;  4DSR A;  4I8B A;  1Y6E A;  2K8V A;  1AUC A;  2FWE A;  1THX A;  4XIH A;  5CRE A;  4POM A;  2X8C A;  3KJY A;  3VFI A;  1V57 A;  1M7T A;  3ME8 A;  3IRA A;  4IJ3 A;  4NAX A;  4ACS A;  1X0R A;  3GV1 A;  2N5A A;  1OAZ A;  2FWH A;  1OC8 A;  2DIZ A;  1Z9H A;  5FHI A;  3F4S A;  3I69 A;  2WGR A;  4XHM A;  1SKR B;  1WMJ A;  5IMZ A;  2B7J A;  4MPF A;  1WP0 A;  1XPV A;  3L9S A;  1Q98 A;  2CZ3 A;  3DVW A;  3DXB A;  4NHW A;  2C3T A;  5J5N A;  5D96 A;  2FWF A;  4HJM A;  3W8S A;  3UMA A;  3UBL A;  5G1K A;  3WGD A;  3CSJ A;  2O8V B;  1XVQ A;  3TRX A;  2HRA A;  4I6X A;  2PMT A;  1LU4 A;  1QFN A;  4IVF A;  2VCT A;  1E2Y A;  3P90 A;  2YJ7 A;  2H72 A;  1THO A;  3RPP A;  4KDX A;  1GSE A;  1T4Y A;  1ZGN A;  4DSQ A;  3EU3 A;  1PX6 A;  3J7Y b;  2GZP A;  4K0G A;  5DCG A;  3GA4 A;  2O7K A;  4MF7 A;  1T4Z A;  3TJF A;  1T8E B;  1LBK A;  2VL3 A;  3FR6 A;  2I1U A;  4JZQ A;  4ID0 A;  4KE3 A;  4E8E A;  1MDI A;  2BJX A;  2VD0 A;  4MP4 A;  1F2E A;  1FB0 A;  2H70 A;  3G9B A;  1XWK A;  9GSS A;  4MZW A;  3VPT A;  2O85 A;  1MD4 A;  2ON5 A;  1TOF A;  1B4P A;  1MDJ A;  2HRN A;  2GZZ A;  2YZH A;  4RQX A;  1B9Y C;  4N11 A;  4KDU A;  3APS A;  5IOX A;  2CVB A;  3PPU A;  4RI6 A;  3R3E A;  1PKZ A;  1URM A;  3IE3 A;  2K8S A;  2DBC A;  2JL4 A;  4G0I A;  4BVX A;  2H6Z A;  3QAV A;  3GKK A;  4XTS A;  5G2Z A;  1XOB A;  5ENU A;  5KN1 A;  1MD3 A;  3Q19 A;  4L5L A;  2L5O A;  3VK9 A;  5KN0 A;  2H8L A;  3GTU B;  4KF9 A;  1O6J A;  2YWN A;  4IP1 A;  3GKN A;  4F9Z A;  1SKS B;  4MA9 A;  1R5P A;  1S3C A;  3ZL5 A;  2WS2 A;  4OCE A;  2XBQ A;  3LGC A;  3RAZ A;  2C0G A;  18GS A;  2VUP A;  3TKR A;  3GRX A;  2IME A;  3IK9 A;  3ZZX A;  2VL2 A;  3FK8 A;  2WB9 A;  3VI7 A;  1K0O A;  5A5K A;  3EE2 A;  2H73 A;  2LRT A;  1TKD B;  5F05 A;  4IS0 A;  1RK4 A;  4BPY A;  2DJ1 A;  1GUH A;  5IMF A;  3HJP A;  2VCQ A;  5A4U A;  2DIY A;  1KNG A;  4KA0 A;  1XXU A;  1TRW A;  3SBC A;  4HEA 2;  1M0U A;  4EC0 A;  2LKU A;  5ECN B;  4NMU A;  2WFC A;  5J3R A;  5KN3 A;  2AAW A;  3TJJ A;  4XS4 A;  2CVD A;  5CYY A;  5JWO B;  5J41 A;  2MZC A;  2B5E A;  2OAD A;  2YAN A;  2ON7 A;  3NZN A;  2GDR A;  4RQR A;  3L4N A;  2VCZ A;  3GX8 A;  3RHC A;  3EVI A;  5HR0 A;  1FAA A;  8GSS A;  3N5O A;  1SJZ A;  1YEX A;  4EXJ A;  6GSY A;  4LMW A;  1ZYQ B;  2DSA A;  1MDK A;  1ERW A;  1M2D A;  1SD9 A;  4Q5R A;  4L5O A;  1VF2 A;  2FUG 2;  1BED A;  3DD3 A;  2HRF A;  1A24 A;  1GSY A;  2H19 A;  5LNK e;  2VOC A;  5ID2 A;  1SU9 A;  4XRD A;  3F0I A;  2IFQ B;  4J57 E;  2YN1 A;  1QMV A;  3D4M A;  3A2W A;  4L8E A;  4AJ7 A;  5F07 A;  4NHZ A;  1TRS A;  5AGY A;  1ST9 A;  3H8Q A;  4BVY A;  1OKD A;  3ZVJ A;  1XBS A;  4NXI A;  3LOR A;  4WF4 A;  3UVH A;  1PMT A;  2MMN A;  1T1V A;  2EIQ A;  1GH2 A;  2GS3 A;  3BCI A;  4I2U A;  5IMV A;  3TB2 A;  4XRA A;  2LS5 A;  3D6I A;  2WDU A;  4WKW A;  5HFG A;  1KTE A;  2AV4 A;  1A2M A;  1YKC A;  5B6N A;  1XWB A;  1SK2 A;  1PX7 A;  1ZL9 A;  3LQ7 A;  1WOU A;  2VL9 A;  2VIM A;  5GAP D;  3QFA C;  2FY6 A;  4TXV A;  3C73 A;  3HCZ A;  2LJA A;  4ULX A;  4O7H A;  2VLT A;  2J9H A;  3FZ9 A;  1HNC A;  12GS A;  4TRX A;  3APO A;  2AB6 A;  5BMU A;  2JZS A;  3ZVJ D;  2G2Q A;  3KH9 A;  2HRK B;  4ZIL A;  1DBY A;  13GS A;  2L4C A;  1TRV A;  4D73 B;  2R5G A;  1X5C A;  1Z3E A;  4K7I A;  5J9C A;  1O85 A;  5J9B A;  3UVT A;  2IMD A;  3M9J A;  1YZX A;  20GS A;  3KMO A;  3C1R A;  2HXK A;  1YDK A;  1GLP A;  1I5G A;  2GQL A;  2LUS A;  1I9D A;  1U6T A;  2TIR A;  4OD7 A;  4POB A;  4PQ1 A;  2JSY A;  1TTZ A;  3GMF A;  3NIV A;  2H76 A;  2YPM A;  1PL1 A;  4MZB A;  2E2G A;  4OO5 A;  1PL2 A;  3HKR A;  2H1A A;  2P5R A;  1GP1 A;  2YWM A;  3HD5 A;  1V40 A;  5HFK A;  2G0F A;  3F6D A;  2V1M A;  2MMO A;  3IXR A;  1F37 A;  1TP9 A;  1XWC A;  3BBY A;  5CRH A;  2KP2 A;  3HJM A;  1ERU A;  4G9H A;  1EGR A;  3LWA A;  4FYU A;  3L9V A;  3ZRE A;  3MDK A;  2KHP A;  1XZO A;  2LJR A;  3KCM A;  3DYR A;  2C4J A;  1H4O A;  5AIX A;  2H74 A;  4PQH A;  2WCI A;  1GSS A;  4TXO B;  1TK8 B;  2RUE A;  4NPB A;  3PR8 A;  3TKS E;  3DVX A;  3A2X A;  4HI7 A;  4F03 A;  4HOJ A;  1TI3 A;  3J7Y k;  3GYK A;  4QL7 A;  1SJI A;  2IMI A;  3TKP A;  1ILO A;  3C8E A;  4FO5 A;  5DAK A;  4ISD A;  1RQM A;  1S3D A;  3C71 A;  2NDO A;  5H5S A;  3UJ1 A;  4JBB A;  5KN2 A;  3RPN A;  3ED3 A;  3WGE A;  3VWW A;  2R4V A;  4TVE A;  4BL7 A;  4K7N A;  3KTL A;  2VCV A;  4KX4 A;  1XIY A;  3EWL A;  3WT2 A;  1FHE A;  2VM2 A;  5ECQ B;  4WF5 A;  3D0Z A;  1A2L A;  2OBK A;  2VAF A;  4K7O A;  1O8W A;  3ERW A;  3FR3 A;  1GNW A;  4ECJ A;  3LG6 A;  3GNJ A;  3A3T A;  4IGJ A;  2MBT A;  4OFT A;  1BX9 A;  4Q5F A;  2XC2 A;  4EKZ A;  2NPB A;  1ERT A;  2HI7 A;  4MDC A;  3TCO A;  1EV9 A;  3TUE A;  4Z7X A;  2YOI A;  3FZ5 A;  5IIZ A;  2NVL A;  2C1Y A;  4AJ6 A;  5HR3 A;  1JFU A;  2RM5 A;  5AN1 A;  5GSS A;  3G7I A;  1FVK A;  3ZFL A;  4I5Q A;  3FZ4 A;  2VM1 A;  2HZE B;  5DQS A;  2CAQ A;  2HSM A;  2LRC A;  4BVX B;  1SK1 A;  2HSH A;  3IAM 2;  1K0M A;  3VI5 A;  2FA4 A;  3SWL A;  1SL0 B;  1MTC A;  1GUK A;  1AQX A;  2KP1 A;  3HZ8 A;  2B1K A;  3QD9 A;  3TOT A;  4IQA A;  1OE8 A;  4IBP A;  2IWT A;  4IW9 A;  4OCF A;  4DSS A;  1OE7 A;  2M72 A;  4HU9 A;  1YEP A;  1PA3 A;  3IA1 A;  3GFK A;  5G30 A;  1GUL A;  2F9S A;  3U5R E;  3H1N A;  1CQH A;  1JLW A;  1JHB A;  3ME7 A;  1QGV A;  1IYH A;  4ML1 A;  5E4W A;  3TOU A;  4LL1 B;  5JWR B;  2GTU A;  2YWO A;  2LST A;  2I3Y A;  2AHE A;  5JWQ B;  4K9Z A;  2LJK A;  1MEK A;  1TK0 B;  5GAN D;  1OC9 A;  2LRN A;  4KB3 A;  2R37 A;  3KEB A;  3QDN A;  3F9U A;  1HYU A;  1DSB A;  1XW5 A;  5C00 A;  1SYR A;  4K6X A;  2C3Q A;  2V6K A;  2I81 A;  4WR4 A;  5D9V A;  1WPI A;  5DCH A;  3QAG A;  3U6V A;  2JSZ A;  2ES7 A;  4Q5N A;  1GNE A;  4GXZ A;  1R26 A;  1X5E A;  2H71 A;  3VUR A;  2V41 A;  3KP9 A;  5CNW A;  4MZC A;  1QQ2 A;  2DJ3 A;  4ZXG A;  2MMA A;  4TR1 B;  3KD0 A;  4XS4 B;  4IN0 A;  2N5F A;  5LCZ A;  1ML6 A;  1SKW B;  1FG4 A;  5CRW A;  4TKY A;  1U88 A;  4JRR A;  19GS A;  3WYW A;  4IEL A;  2YNX A;  3EMX A;  3H79 A;  2V6O A;  4GLT A;  3GSS A;  3ISO A;  2NBS A;  1AIU A;  1XW9 A;  1BYE A;  1ZZY A;  2H0G A;  2KOK A;  1WE0 A;  3C7M A;  4FQU A;  2PWJ A;  4WET A;  11GS A;  5CRG A;  2L6C A;  1OC3 A;  1A0R P;  2QSI A;  3EU4 A;  5FT3 A;  2MMZ A;  2UZ8 A;  5D73 A;  4EVM A;  5IQY A;  3HJO A;  1Q4J A;  3QCP A;  1JZO A;  3HA9 A;  5HR1 A;  2PGT A;  3TKS A;  5D93 A;  1BG5 A;  2WUL A;  1WJK A;  3GH6 A;  2RUF A;  1NHY A;  4X1U A;  1K0D A;  5LD0 A;  2E0Q A;  4BVY B;  4MJA A;  4XS6 A;  2B1L A;  1O8X A;  1FO5 A;  2F8F A;  4KUN A;  2IL3 A;  4E8H A;  4ZB9 A;  2JZR A;  5IOW A;  2QGV A;  4BA7 A;  5B6M A;  3TDG A;  1YF1 A;  4AGS A;  3MNG A;  4ECB A;  1BQ7 A;  3FW2 A;  4PX1 A;  1OKT A;  4MH3 A;  4YQV A;  1ZCP A;  3I9V 2;  2OJL A;  2PU9 C;  4GF0 A;  2GVP A;  2H66 A;  1A23 A;  3M3M A;  3CRU A;  1TU7 A;  4LA1 A;  3EYT A;  1K0C A;  4IJI A;  1K0A A;  4MK3 A;  1R4W A;  4KND A;  3ZIT A;  2FWG A;  4LL4 B;  2NTO A;  4BWQ A;  4HS1 A;  5B7C A;  1A8Y A;  4JE1 A;  1TI1 A;  2K6V A;  4MJB A;  4KSM A;  4WBR D;  4G0K A;  2CV4 A;  4GST A;  2CX3 A;  3EUR A;  3GL3 A;  1O81 A;  2CVK A;  4HUA A;  3D21 A;  3IHQ A;  3K8N A;  5FWG A;  2V2G A;  3F6F A;  6GSS A;  2ALB A;  1FB6 A;  2B5X A;  4JED A;  5DAL B;  3FZA A;  5A4W A;  3LYK A;  3LJR A;  5B8B A;  3GHA A;  3KXO A;  1X9M B;  4P3Y B;  1X9W B;  2AUV A;  2VCW A;  2DJK A;  2V32 A;  1GTB A;  1QK8 A;  5IPH A;  4OFM A;  2I4A A;  3GKM A;  4ZL8 A;  4JR4 A;  4GTU A;  1EEJ A;  1TDI A;  1FVJ A;  1NHO A;  4O92 A;  1Z7R A;  5ECI B;  1WRY A;  3PH9 A;  1VGL A;  4F0C A;  3I6A A;  1TK5 B;  2C8U A;  2KLX A;  3PGT A;  6GSU A;  2O87 A;  4FIW A;  1SEN A;  4GRF A;  1Z6N A;  4YAV A;  1YY7 A;  3KTB A;  3GKX A;  2ZCT A;  2OBI A;  4V2L A;  2L4Q A;  3EIN A;  1PSQ A;  1UA5 A;  4ML6 A;  1AAZ A;  3ERF A;  5JCU A;  3UL3 A;  3P8W A;  1GSF A;  5COH A;  3C1S A;  4NV2 A;  4G19 A;  4OWY A;  2H01 A;  3F4T A;  3WT1 A;  6GSW A;  3BOA A;  1J9B A;  4KH7 A;  1HNA A;  2EIO A;  2LV3 A;  4LLR A;  2WJU A;  3JCM L;  5INY A;  3HY2 A;  2I9H A;  2P5Q A;  4GSS A;  3GUS A;  1BAY A;  2RLI A;  5DAK B;  2MBS A;  2FCH A;  3TKQ A;  1SL2 B;  3FRC A;  3TJG A;  3MWH A;  4ZB6 A;  2B7K A;  2HYX A;  4L0U A;  3QAW A;  3O6T A;  5DBQ A;  4QL9 A;  4KW6 A;  5GZZ B;  5ECL B;  4BL7 B;  1PGT A;  2PBJ A;  4Q5Q A;  4IQ1 A;  2FA8 A;  3MAK A;  3GN3 A;  1DE1 A;  1R7H A;  5AIS A;  3TRQ A;  3FYG A;  3LEF A;  1KBN A;  2IFQ A;  4GQF A;  2VLV A;  2YWI A;  3UEM A;  1K3Y A;  3HZ4 A;  5ECP B;  5CP1 A;  1HNB A;  2A2S A;  2DJ2 A;  4X43 A;  3IPZ A;  4ZL7 A;  4MH2 A;  1FOV A;  2RM6 A;  2C0E A;  3R2Q A;  1Z7P A;  2H1B A;  1NSW A;  1Y25 A;  4PQI A;  4G2E A;  2FGX A;  3RHB A;  6GSV A;  3WD6 A;  3KMN A;  2D2Z A;  4N0V A;  1EZK A;  4IKH A;  5DJL A;  2E2M A;  3IOS A;  3GH9 A;  1ZOF A;  2CQ9 A;  4QQ7 A;  2O89 A;  4G10 A;  2LTK A;  5F8B A;  3APQ A;  2QC7 A;  1CQG A;  4ZBD A;  3IC4 A;  1UVZ A;  3HVV A;  2VCX A;  2RII A;  1F9M A;  3M1G A;  3ZIV A;  3ZLP A;  2GGT A;  3IBH A;  2H30 A;  2FD3 A;  2ZNM A;  2XPD A;  2Z9S A;  1XW6 A;  1F6M C;  1U3A A;  2N5B A;  1H75 A;  2YP6 A;  3CYN A;  4HZ2 A;  4EUY A;  3BD2 A;  5EL8 A;  3Q6O A;  2HRK A;  3KM6 A;  4F0B A;  2HFD A;  4CDO A;  1U87 A;  4D73 A;  3H93 A;  3HDC A;  3QMX A;  2OA7 A;  4CHS A;  3G7Y A;  1YF0 A;  1EP8 A;  2KUC A;  3L0H A;  3L9U A;  1T7P B;  1VF3 A;  2DJ0 A;  5CO3 A;  1G7O A;  4L0W A;  1J08 A;  1F3B A;  2JU5 A;  3W6G A;  4NWY A;  4MPG A;  2LQO A;  1EV4 A;  1B9X C;  3ZIJ A;  4LMV A;  1ACV A;  4MLY A;  3TJK A;  4J56 E;  1HD2 A;  2XPE A;  1TXX A;  2VL2 C;  1J0F A;  4OMV A;  1OYJ A;  4H86 A;  3M8N A;  4EO3 A;  6GST A;  4I97 A;  4EDZ A;  3D5J A;  3IR4 A;  1K0N A;  4TOP A;  1PKW A;  3L78 A;  4PXO A;  4PGT A;  5F0G A;  5CRD A;  1C72 A;  1AQV A;  3LXT A;  3UAP A;  3UAR A;  5JCW A;  3LSZ A;  2C0D A;  4MAB A; 
#chains in the Genus database with same CATH topology
 2C0F A;  1IYI A;  4MF5 A;  4KGI A;  2H1D A;  2GQK A;  1YJ6 A;  2PER A;  3ERG A;  4XCS A;  1TJD A;  4TXO A;  1XCC A;  1XWA A;  2PPT A;  1NW2 A;  1AQW A;  1B8X A;  5D9W A;  3OR5 A;  2L6D A;  3WGX A;  2C80 A;  1U3I A;  1GSD A;  3P2A A;  3BJ5 A;  3F3Q A;  4V2M A;  1M9B A;  4K2X A;  4MJC A;  5ABR A;  2AJQ B;  3IDV A;  4TR4 A;  3HVS A;  3RDW A;  5ECR B;  2HNL A;  2C3N A;  1A2J A;  4DVC A;  5IMC A;  5HFI A;  1WWJ A;  1EGO A;  1PRX A;  3KP8 A;  4KCA A;  1TU8 A;  16GS A;  2YZU A;  1GRX A;  4GSN A;  2IN3 A;  4A5P A;  2H6X A;  4K8M A;  2WZS A;  2DML A;  2IJY A;  4WXT A;  1XFL A;  5IPG A;  4EIP A;  5ECM B;  4BWS A;  1K0B A;  3F3R A;  3HMJ G;  3S9F A;  3ZYW A;  1AW9 A;  1FOH A;  1GSU A;  4FYC A;  1EOG A;  4O5R A;  4J2F A;  3M9K A;  3I43 A;  5D8I A;  4MF6 A;  1O7U A;  5DJM A;  2UV8 G;  3V1W A;  1S4B P;  4N10 A;  1ZYP A;  2IPA A;  4YAP A;  4ECC A;  2F8A A;  3VWU A;  5ELG A;  1XWG A;  2B3S A;  2IIY A;  4FYB A;  2R2J A;  4O32 A;  2GZY A;  5C04 A;  3FY7 A;  5D9X A;  1G7E A;  1LJR A;  1A0F A;  2GSS A;  1JZR A;  2CT6 A;  4I2T A;  2HZE A;  3HXS A;  4TW5 A;  5ID2 B;  5AIV A;  5ECK B;  3LXZ A;  3LYP A;  2P31 A;  2FNO A;  4EE0 A;  1VRS D;  4TR0 A;  2IMF A;  2FHE A;  4HQZ A;  1PN9 A;  4N30 A;  4AJ8 A;  3GX0 A;  1M9A A;  4K1F A;  1DE2 A;  2LNT A;  1G6Y A;  5DVB A;  4KCE A;  4AKX B;  3PIN A;  4XS1 A;  2YV7 A;  4GQC A;  4KDY A;  1YQ1 A;  1VF1 A;  3FKF A;  2HLS A;  2E7P A;  2JAD A;  2LQQ A;  1JZD A;  4NV5 A;  3LFL A;  4USS A;  2IMK A;  1NM3 A;  3TJB A;  5HQP A;  3DKS A;  5IO0 A;  4PHZ C;  2MYG A;  2YJH A;  5ELA A;  1GTU A;  4PUR A;  1M2B A;  3DEX A;  3VPQ A;  4K5S A;  1V9W A;  4AF2 A;  1DUG A;  3ZML A;  4ZIJ A;  2R0G A;  4EL1 A;  4K2D A;  2X64 A;  3CXG A;  3IC8 A;  5ECH B;  3VWX A;  5E59 A;  2R0C A;  5EVO A;  1T00 A;  4G0L A;  4PUA A;  1GL8 A;  5A5H A;  3FEU A;  4KAE A;  3BCK A;  5J4Y A;  1ZYN A;  2BTO T;  1V98 A;  2BMX A;  2TRX A;  2OE1 A;  2H6Y A;  4PTS A;  3QPM A;  5G1L A;  4TR1 A;  2HZF A;  2VLU A;  1ON4 A;  22GS A;  2O5V A;  5G5F A;  3CQF A;  3F4R A;  5F06 A;  1USB A;  4EDY A;  2HSN B;  5G5E A;  2O3E A;  1GSQ A;  1K3L A;  5BMU B;  2PVO C;  3E9J B;  2ZUP A;  2GLR A;  1UN2 A;  5G31 A;  5J47 A;  1VF4 A;  2FLS A;  3KIJ A;  1GLQ A;  4YH2 A;  5IO2 A;  1W4V A;  3EC3 A;  3NOF A;  1YEW C;  1M3I A;  3A5I A;  2A4V A;  3QFB C;  5EPF A;  4ILF A;  2H1L A;  1F3A A;  1A8L A;  2L59 A;  1W89 A;  5A4V A;  4ECI A;  10GS A;  2HSY A;  3ZMK A;  4V1A p;  3AY8 A;  4PNF A;  4GCI A;  4WR5 A;  3O76 A;  1S3A A;  2HT9 A;  3A2V A;  4IP6 A;  4OO4 A;  2LEG A;  4HZ4 A;  3P7X A;  4F82 A;  1PQN A;  3GTU A;  3CRT A;  2JZT A;  4AKH A;  1N2A A;  2M46 A;  2GQM A;  1RW1 A;  3A5W A;  4EF0 A;  5CAX A;  4JR6 A;  3N9J A;  3RBT A;  1N8J A;  4MCU A;  2X8G A;  3H4K A;  5A1N B;  3GST A;  3US3 A;  1SJ6 A;  3QR6 A;  3VLN A;  4TN8 A;  3GUR A;  3FR9 A;  5HR2 A;  5GST A;  4V2N A;  2HE3 A;  3ZTL A;  1B4Q A;  3VWV A;  2YCD A;  5H5R A;  4V1A g;  3UIW A;  5IMD A;  4ZBA A;  1PD2 1;  2OE0 A;  4HDE A;  3EMP A;  2DJJ A;  2R6K A;  4E68 A;  2K18 A;  1EWX A;  4K0N A;  4PNG A;  3ZFB A;  2L5L A;  2TRC P;  4AKG A;  4OFN A;  4W66 A;  2H0I A;  5ECS A;  1B48 A;  4FH8 A;  2H1G A;  5JCG A;  3CTF A;  4JU5 A;  3KGK A;  2REM A;  1QUW A;  2GT6 A;  3KH7 A;  3IAS 2;  1EP7 A;  1Z6M A;  2PN8 A;  1HQO A;  3CSI A;  2F3M A;  1SVM A;  4AKI A;  1GTI A;  14GS A;  2EIR A;  3MSZ A;  3DIE A;  4HU7 A;  1JZW A;  1WIK A;  3CSH A;  2LNS A;  4TR3 A;  2VO4 A;  1BJX A;  4MJE A;  5DAL A;  2WRT A;  2P0G A;  3F63 A;  1XVW A;  5IM9 A;  1EOH A;  1JLV A;  2DC5 A;  4POK A;  1R5A A;  2JAC A;  4YKG A;  2B5Y A;  2OKA A;  3DML A;  1UC7 A;  4GWR A;  3D4T A;  4YQM A;  17GS A;  1GWC A;  2H75 A;  2YV9 A;  3DWV A;  3GL5 A;  3QOU A;  4CW9 A;  2XBI A;  1O73 A;  2X99 A;  2XHF A;  1ERV A;  2PUK C;  2M80 A;  1Z5Y E;  1YKA A;  2X8H A;  1KEB A;  2GST A;  5H5Q A;  4ZB8 A;  2CZ2 A;  2WVX A;  1M2A A;  2GSQ A;  1X9S B;  2CA8 A;  5DQY A;  3HHV A;  1OVN A;  3G7J A;  2L57 A;  4WBJ A;  2AYT A;  4RUV A;  3HVX A;  5IMA A;  1V2A A;  3W8J A;  2HSM B;  4KSO A;  3E0U A;  5KEJ A;  4POL A;  4MMM A;  4HJ2 A;  1TW9 A;  3CTG A;  2DLX A;  1EEM A;  1X5D A;  1AXD A;  1ZMA A;  3DRN A;  2VKZ G;  1FW1 A;  3O3T A;  4RI7 A;  2X4A A;  1SYX A;  5D9T A;  2B6M A;  3ZRD A;  1AC1 A;  2WZ9 A;  3E3E A;  1GTA A;  4Z2U A;  2HQT A;  3TGZ A;  5J40 A;  4DSS B;  3D22 A;  3M0F A;  3HYP A;  2WW1 A;  2DMM A;  2F51 A;  2J23 A;  2PVQ A;  3FHK A;  1GUM A;  1SD8 A;  5ECO B;  3TRP A;  3CMI A;  3UOM A;  1K3O A;  2R3X A;  7GSS A;  4WEY A;  4YQU A;  1E6B A;  1G6W A;  4MNN A;  3IK7 A;  5EY6 A;  1XOA A;  3DGQ A;  3F8U A;  5B8A A;  4ZBB A;  2GT5 A;  1G0T A;  1M99 A;  2X49 A;  3EPT A;  1OC9 B;  3KZQ A;  4X0X A;  1QXH A;  1ABA A;  4ZL9 A;  4HQS A;  1SL1 B;  4N0Z A;  2VD1 A;  2CX4 A;  2CAI A;  2H0H A;  1TRU A;  4F2I A;  4PI0 C;  3IV4 A;  4PUF C;  4DEJ A;  2GSR A;  2OE3 A;  3TKS C;  3GIX A;  2OAC A;  1ZYE A;  3Q18 A;  3Q74 A;  2EC4 A;  6GSX A;  5A34 A;  1PN0 A;  5L71 A;  1T3B A;  5DDL A;  1V58 A;  3CWG A;  2A2R A;  3CHX C;  4CY6 A;  2QKE A;  1SK0 A;  3CBU A;  2K9F A;  3UBK A;  5J4U A;  4IHU A;  4DSR A;  4I8B A;  1Y6E A;  2K8V A;  1AUC A;  2FWE A;  1S3R A;  1THX A;  2WW0 A;  3MIX A;  4XIH A;  5CRE A;  4POM A;  2X8C A;  3KJY A;  3VFI A;  1V57 A;  1M7T A;  3ME8 A;  3IRA A;  4IJ3 A;  4NAX A;  4GDF A;  4ACS A;  1X0R A;  3GV1 A;  2N5A A;  1OAZ A;  2WW2 A;  2FWH A;  1OC8 A;  2DIZ A;  1Z9H A;  5FHI A;  3F4S A;  3I69 A;  2WGR A;  4XHM A;  1SKR B;  1WMJ A;  5IMZ A;  2B7J A;  2OT3 A;  4MPF A;  1WP0 A;  1XPV A;  3L9S A;  1Q98 A;  2CZ3 A;  3DVW A;  3DXB A;  4NHW A;  2C3T A;  5J5N A;  5D96 A;  2FWF A;  4HJM A;  5BRT A;  3W8S A;  3UMA A;  3UBL A;  5G1K A;  3WGD A;  3CSJ A;  1XG8 A;  4FXY P;  2O8V B;  3RFR C;  1XVQ A;  3TRX A;  2HRA A;  4I6X A;  2PMT A;  1LU4 A;  1QFN A;  4IVF A;  2VCT A;  1E2Y A;  3P90 A;  2YJ7 A;  2H72 A;  1THO A;  3RPP A;  4KDX A;  1GSE A;  1T4Y A;  1ZGN A;  1TXU A;  4DSQ A;  3EU3 A;  1PX6 A;  3J7Y b;  2GZP A;  4K0G A;  5DCG A;  3GA4 A;  2O7K A;  4MF7 A;  1T4Z A;  3TJF A;  1T8E B;  1LBK A;  2VL3 A;  3FR6 A;  2I1U A;  4JZQ A;  4ID0 A;  4KE3 A;  4E8E A;  1MDI A;  2BJX A;  2VD0 A;  4MP4 A;  1F2E A;  1FB0 A;  2H70 A;  3G9B A;  1XWK A;  9GSS A;  4MZW A;  3VPT A;  2O85 A;  1MD4 A;  2ON5 A;  1TOF A;  1B4P A;  1MDJ A;  2HRN A;  2GZZ A;  2YZH A;  4RQX A;  1B9Y C;  4N11 A;  4KDU A;  3APS A;  5IOX A;  2CVB A;  3PPU A;  4RI6 A;  2DKI A;  3R3E A;  1PKZ A;  1URM A;  3IE3 A;  2K8S A;  2DBC A;  2JL4 A;  4G0I A;  4BVX A;  2H6Z A;  3QAV A;  2A2P A;  2O36 A;  3GKK A;  4XTS A;  5G2Z A;  1XOB A;  5ENU A;  5KN1 A;  1MD3 A;  3Q19 A;  4L5L A;  2L5O A;  3VK9 A;  5KN0 A;  2H8L A;  3GTU B;  4KF9 A;  1O6J A;  2YWN A;  4IP1 A;  3MYD A;  3GKN A;  4F9Z A;  1SKS B;  4MA9 A;  1R5P A;  1S3C A;  3ZL5 A;  2WS2 A;  4OCE A;  2XBQ A;  3LGC A;  3RAZ A;  2C0G A;  18GS A;  2VUP A;  3TKR A;  3GRX A;  2IME A;  3IK9 A;  3ZZX A;  2VL2 A;  3FK8 A;  2WB9 A;  3VI7 A;  1K0O A;  5A5K A;  3EE2 A;  2H73 A;  2LRT A;  1TKD B;  5F05 A;  4IS0 A;  1RK4 A;  4BPY A;  2DJ1 A;  2EFD A;  1GUH A;  5IMF A;  3HJP A;  2VCQ A;  5A4U A;  2DIY A;  1KNG A;  4KA0 A;  1XXU A;  1TRW A;  3SBC A;  4HEA 2;  1M0U A;  4EC0 A;  2LKU A;  5ECN B;  4NMU A;  2WFC A;  5J3R A;  5KN3 A;  2AAW A;  3TJJ A;  4XS4 A;  2CVD A;  5CYY A;  2A4H A;  5JWO B;  5J41 A;  2MZC A;  2B5E A;  2OAD A;  2YAN A;  2ON7 A;  3NZN A;  2GDR A;  4RQR A;  2VCZ A;  3GX8 A;  3L4N A;  3RHC A;  3EVI A;  5HR0 A;  1FAA A;  8GSS A;  3N5O A;  1SJZ A;  1YEX A;  4EXJ A;  6GSY A;  4ZB7 A;  4LMW A;  3HVN A;  1ZYQ B;  2DSA A;  1MDK A;  1ERW A;  1M2D A;  1SD9 A;  4Q5R A;  4L5O A;  1VF2 A;  2FUG 2;  1BED A;  3DD3 A;  2HRF A;  1A24 A;  4QMK A;  1GSY A;  2H19 A;  5LNK e;  2VOC A;  5ID2 A;  1SU9 A;  4XRD A;  3F0I A;  2IFQ B;  3LW9 A;  4J57 E;  2YN1 A;  1QMV A;  3D4M A;  3A2W A;  4L8E A;  4AJ7 A;  5F07 A;  4NHZ A;  1TRS A;  5AGY A;  1ST9 A;  3H8Q A;  4BVY A;  1OKD A;  3ZVJ A;  1XBS A;  4NXI A;  4K5R A;  3LOR A;  4WF4 A;  2EFC A;  3UVH A;  1PMT A;  2MMN A;  1T1V A;  2EIQ A;  1GH2 A;  2GS3 A;  3BCI A;  4I2U A;  5IMV A;  3TB2 A;  4XRA A;  2LS5 A;  3D6I A;  2WDU A;  4WKW A;  5HFG A;  1KTE A;  2AV4 A;  1A2M A;  1YKC A;  4N3Z A;  5B6N A;  1XWB A;  1SK2 A;  1PX7 A;  1ZL9 A;  3LQ7 A;  1WOU A;  2VL9 A;  2VIM A;  5GAP D;  3QFA C;  2FY6 A;  4TXV A;  3C73 A;  3HCZ A;  2LJA A;  2WVY A;  4ULX A;  4O7H A;  2VLT A;  2J9H A;  3FZ9 A;  1HNC A;  12GS A;  2HSN A;  4TRX A;  5KOW A;  3APO A;  2AB6 A;  5BMU A;  2JZS A;  3FMW A;  3ZVJ D;  2G2Q A;  3KH9 A;  1N25 A;  2HRK B;  4ZIL A;  1DBY A;  13GS A;  2L4C A;  1TRV A;  4D73 B;  2R5G A;  1X5C A;  1Z3E A;  4K7I A;  5J9C A;  1O85 A;  5J9B A;  3UVT A;  2IMD A;  3M9J A;  1YZX A;  20GS A;  3KMO A;  3C1R A;  2HXK A;  1YDK A;  1GLP A;  1I5G A;  2GQL A;  2LUS A;  1I9D A;  1U6T A;  2TIR A;  4OD7 A;  4POB A;  4PQ1 A;  2JSY A;  1TTZ A;  3GMF A;  3NIV A;  2H76 A;  2YPM A;  1PL1 A;  4MZB A;  2E2G A;  4OO5 A;  4PI2 C;  1PL2 A;  3HKR A;  2H1A A;  2P5R A;  1GP1 A;  2YWM A;  3HD5 A;  1V40 A;  5HFK A;  2G0F A;  4O5U A;  3F6D A;  2V1M A;  2MMO A;  3IXR A;  1F37 A;  1TP9 A;  1XWC A;  3BBY A;  5CRH A;  2KP2 A;  3HJM A;  1ERU A;  4G9H A;  1EGR A;  3LWA A;  4FYU A;  3L9V A;  3ZRE A;  3MDK A;  2KHP A;  1XZO A;  2LJR A;  3KCM A;  3DYR A;  2C4J A;  1H4O A;  5AIX A;  2H74 A;  1PFO A;  4PQH A;  2WCI A;  1GSS A;  4TXO B;  1TK8 B;  2RUE A;  4NPB A;  3PR8 A;  3TKS E;  3DVX A;  3A2X A;  4HI7 A;  4F03 A;  4HOJ A;  1TI3 A;  3J7Y k;  3GYK A;  4QL7 A;  1SJI A;  2IMI A;  3TKP A;  1ILO A;  3C8E A;  4FO5 A;  5DAK A;  4ISD A;  1RQM A;  1S3D A;  3C71 A;  2NDO A;  5H5S A;  3UJ1 A;  4JBB A;  5KN2 A;  3RPN A;  3ED3 A;  3WGE A;  3VWW A;  2R4V A;  4TVE A;  4BL7 A;  3KTL A;  4K7N A;  2VCV A;  4KX4 A;  1XIY A;  2DKH A;  3TU3 B;  3EWL A;  3WT2 A;  1FHE A;  2VM2 A;  5ECQ B;  4WF5 A;  3RGB C;  3D0Z A;  1A2L A;  2OBK A;  2VAF A;  4K7O A;  1O8W A;  3ERW A;  3FR3 A;  1GNW A;  4ECJ A;  3LG6 A;  3GNJ A;  3A3T A;  4IGJ A;  2MBT A;  4OFT A;  1BX9 A;  2QA1 A;  4Q5F A;  4O5Q A;  2XC2 A;  4EKZ A;  2NPB A;  1ERT A;  2HI7 A;  4MDC A;  3TCO A;  1EV9 A;  3TUE A;  4Z7X A;  2YOI A;  3FZ5 A;  5IIZ A;  2NVL A;  2C1Y A;  4AJ6 A;  5HR3 A;  1JFU A;  2RM5 A;  5AN1 A;  5GSS A;  1BF5 A;  3G7I A;  1FVK A;  3ZFL A;  4I5Q A;  3FZ4 A;  2VM1 A;  2HZE B;  5DQS A;  2CAQ A;  2HSM A;  2LRC A;  4BVX B;  1SK1 A;  2HSH A;  3IAM 2;  1K0M A;  3VI5 A;  2FA4 A;  3SWL A;  1SL0 B;  1MTC A;  1GUK A;  1AQX A;  2KP1 A;  3HZ8 A;  2B1K A;  3QD9 A;  3TOT A;  4IQA A;  1OE8 A;  4IBP A;  2IWT A;  5J4V A;  4IW9 A;  4OCF A;  4DSS A;  1OE7 A;  2M72 A;  4HU9 A;  1YEP A;  1PA3 A;  3IA1 A;  3GFK A;  5G30 A;  1GUL A;  2F9S A;  3U5R E;  3H1N A;  1CQH A;  1JLW A;  1JHB A;  3ME7 A;  1QGV A;  1IYH A;  4ML1 A;  5E4W A;  3TOU A;  5KOX A;  4LL1 B;  4ICY A;  5JWR B;  2GTU A;  2YWO A;  2LST A;  2I3Y A;  2AHE A;  4G01 A;  5JWQ B;  4K9Z A;  2LJK A;  1MEK A;  1TK0 B;  5GAN D;  1OC9 A;  2LRN A;  4KB3 A;  2R37 A;  3KEB A;  3QDN A;  3F9U A;  1HYU A;  2EFH A;  1DSB A;  1XW5 A;  5C00 A;  1SYR A;  2V6K A;  2C3Q A;  4K6X A;  2I81 A;  4WR4 A;  5D9V A;  1WPI A;  5DCH A;  3QAG A;  3U6V A;  2JSZ A;  5A5H B;  2ES7 A;  2WVZ A;  4Q5N A;  1GNE A;  4GXZ A;  1R26 A;  1X5E A;  2H71 A;  3VUR A;  2V41 A;  3KP9 A;  5CNW A;  4MZC A;  1QQ2 A;  2DJ3 A;  4ZXG A;  2MMA A;  4TR1 B;  3KD0 A;  4XS4 B;  1I1I P;  2WW3 A;  4IN0 A;  2N5F A;  5LCZ A;  1ML6 A;  1SKW B;  1FG4 A;  5CRW A;  4TKY A;  1U88 A;  4JRR A;  19GS A;  3WYW A;  4IEL A;  2YNX A;  3EMX A;  3H79 A;  2V6O A;  4GLT A;  3GSS A;  3ISO A;  2NBS A;  1AIU A;  1XW9 A;  1BYE A;  1ZZY A;  2H0G A;  2KOK A;  1WE0 A;  3C7M A;  4FQU A;  2PWJ A;  4WET A;  11GS A;  5CRG A;  2L6C A;  1OC3 A;  1A0R P;  2QSI A;  3EU4 A;  5FT3 A;  2MMZ A;  2UZ8 A;  5D73 A;  4EVM A;  5IQY A;  3HJO A;  1Q4J A;  3QCP A;  1JZO A;  3HA9 A;  5HR1 A;  2PGT A;  3TKS A;  5D93 A;  1BG5 A;  2WUL A;  4CY8 A;  1WJK A;  3GH6 A;  2RUF A;  1NHY A;  4Z2T A;  4X1U A;  1K0D A;  5LD0 A;  2E0Q A;  4BVY B;  4MJA A;  4XS6 A;  2B1L A;  1O8X A;  1FO5 A;  2F8F A;  4KUN A;  2IL3 A;  4E8H A;  4ZB9 A;  2JZR A;  5IOW A;  2QGV A;  4BA7 A;  5B6M A;  3TDG A;  1YF1 A;  4AGS A;  3MNG A;  4ECB A;  1BQ7 A;  3FW2 A;  4PX1 A;  1OKT A;  4MH3 A;  4YQV A;  1ZCP A;  3I9V 2;  2OJL A;  2PU9 C;  4GF0 A;  2GVP A;  2H66 A;  1A23 A;  3M3M A;  4HSC X;  3CRU A;  1TU7 A;  4LA1 A;  3EYT A;  1K0C A;  4IJI A;  1K0A A;  4MK3 A;  1R4W A;  4KND A;  3ZIT A;  2FWG A;  4LL4 B;  2NTO A;  4BWQ A;  4HS1 A;  5B7C A;  1A8Y A;  4JE1 A;  1Y1U A;  1TI1 A;  2K6V A;  4MJB A;  4KSM A;  4WBR D;  4G0K A;  2CV4 A;  4GST A;  2CX3 A;  3EUR A;  2QA2 A;  3GL3 A;  1O81 A;  2CVK A;  4HUA A;  3D21 A;  3IHQ A;  3K8N A;  5FWG A;  2V2G A;  3F6F A;  6GSS A;  2ALB A;  1FB6 A;  2B5X A;  4JED A;  5DAL B;  3FZA A;  5A4W A;  3LYK A;  3LJR A;  5B8B A;  3GHA A;  3KXO A;  1X9M B;  4P3Y B;  1X9W B;  2AUV A;  2VCW A;  2DJK A;  2V32 A;  1GTB A;  1QK8 A;  5IPH A;  4OFM A;  2I4A A;  3GKM A;  4ZL8 A;  4JR4 A;  4GTU A;  1EEJ A;  1TDI A;  1FVJ A;  1NHO A;  4O92 A;  1Z7R A;  5ECI B;  1WRY A;  3PH9 A;  1VGL A;  4F0C A;  3I6A A;  1TK5 B;  2C8U A;  2KLX A;  2WVX B;  3PGT A;  6GSU A;  2O87 A;  4FIW A;  1SEN A;  4GRF A;  1Z6N A;  4YAV A;  1YY7 A;  3KTB A;  3GKX A;  2ZCT A;  2OBI A;  4V2L A;  2L4Q A;  3EIN A;  1SVO A;  1PSQ A;  1UA5 A;  4ML6 A;  1AAZ A;  3ERF A;  5JCU A;  3UL3 A;  3P8W A;  1GSF A;  5COH A;  3C1S A;  4NV2 A;  4G19 A;  4OWY A;  2H01 A;  3F4T A;  3WT1 A;  6GSW A;  4BIK A;  3BOA A;  4EIQ A;  1J9B A;  4KH7 A;  1HNA A;  2EIO A;  2LV3 A;  4LLR A;  2WJU A;  3JCM L;  5INY A;  3HY2 A;  4YKF A;  2I9H A;  2P5Q A;  4GSS A;  3GUS A;  1BAY A;  2RLI A;  5DAK B;  2MBS A;  2FCH A;  3TKQ A;  1SL2 B;  3FRC A;  3TJG A;  3MWH A;  4ZB6 A;  2B7K A;  2HYX A;  4L0U A;  4X4J A;  3QAW A;  3O6T A;  5DBQ A;  4QL9 A;  4KW6 A;  5GZZ B;  5ECL B;  4BL7 B;  1PGT A;  2PBJ A;  4Q5Q A;  4IQ1 A;  2FA8 A;  3MAK A;  3GN3 A;  1DE1 A;  1R7H A;  5AIS A;  3TRQ A;  3FYG A;  3LEF A;  1KBN A;  2IFQ A;  5A34 B;  2VLV A;  4GQF A;  2YWI A;  3UEM A;  1K3Y A;  3HZ4 A;  5ECP B;  5CP1 A;  5A1N A;  1HNB A;  2A2S A;  2DJ2 A;  4X43 A;  2EFE A;  3IPZ A;  4ZL7 A;  4MH2 A;  1FOV A;  2RM6 A;  2C0E A;  3R2Q A;  1Z7P A;  2H1B A;  1NSW A;  1Y25 A;  4PQI A;  4G2E A;  2FGX A;  1YVL A;  3RHB A;  6GSV A;  3WD6 A;  3KMN A;  2D2Z A;  4N0V A;  1EZK A;  4IKH A;  5DJL A;  2E2M A;  3IOS A;  3GH9 A;  1BG1 A;  1ZOF A;  2CQ9 A;  4QQ7 A;  2O89 A;  4G10 A;  2LTK A;  5F8B A;  3APQ A;  2QC7 A;  1CQG A;  4ZBD A;  3IHG A;  3IC4 A;  1UVZ A;  3HVV A;  2VCX A;  2RII A;  1F9M A;  3M1G A;  3ZIV A;  3ZLP A;  1M3J A;  2GGT A;  3IBH A;  2H30 A;  2FD3 A;  2ZNM A;  2XPD A;  2Z9S A;  1XW6 A;  1F6M C;  1U3A A;  2N5B A;  1H75 A;  2YP6 A;  3CYN A;  4HZ2 A;  4EUY A;  3BD2 A;  5EL8 A;  2HRK A;  3Q6O A;  3KM6 A;  4F0B A;  2HFD A;  4CDO A;  1U87 A;  4D73 A;  4Z2R A;  3H93 A;  3HDC A;  3QMX A;  2OA7 A;  4CHS A;  3G7Y A;  1YF0 A;  1EP8 A;  2KUC A;  3L0H A;  3L9U A;  1SVL A;  1T7P B;  1VF3 A;  2DJ0 A;  5CO3 A;  1G7O A;  4L0W A;  1J08 A;  2R0P A;  1F3B A;  2JU5 A;  3W6G A;  4NWY A;  4MPG A;  2LQO A;  1EV4 A;  1B9X C;  4AI6 A;  3ZIJ A;  4LMV A;  1ACV A;  4MLY A;  3TJK A;  4J56 E;  1HD2 A;  2XPE A;  1TXX A;  2VL2 C;  1J0F A;  4OMV A;  1OYJ A;  4H86 A;  3M8N A;  4EO3 A;  6GST A;  4I97 A;  4EDZ A;  3D5J A;  3IR4 A;  1K0N A;  4TOP A;  1PKW A;  3L78 A;  4PXO A;  4PGT A;  5F0G A;  5CRD A;  1C72 A;  1AQV A;  3LXT A;  3UAP A;  3UAR A;  5JCW A;  3LSZ A;  2C0D A;  4MAB A; 
#chains in the Genus database with same CATH homology
 2C0F A;  1IYI A;  4MF5 A;  4KGI A;  2H1D A;  2GQK A;  1YJ6 A;  2PER A;  3ERG A;  4XCS A;  1TJD A;  4TXO A;  1XCC A;  1XWA A;  2PPT A;  1NW2 A;  1AQW A;  1B8X A;  5D9W A;  3OR5 A;  2L6D A;  3WGX A;  2C80 A;  1U3I A;  1GSD A;  3P2A A;  3BJ5 A;  3F3Q A;  4V2M A;  1M9B A;  4K2X A;  4MJC A;  5ABR A;  2AJQ B;  3IDV A;  4TR4 A;  3HVS A;  3RDW A;  5ECR B;  2HNL A;  2C3N A;  1A2J A;  4DVC A;  5IMC A;  5HFI A;  1WWJ A;  1EGO A;  1PRX A;  3KP8 A;  4KCA A;  1TU8 A;  16GS A;  2YZU A;  1GRX A;  4GSN A;  2IN3 A;  4A5P A;  2H6X A;  4K8M A;  2DML A;  2IJY A;  4WXT A;  1XFL A;  5IPG A;  4EIP A;  5ECM B;  4BWS A;  1K0B A;  3F3R A;  3HMJ G;  3S9F A;  3ZYW A;  1AW9 A;  1FOH A;  1GSU A;  4FYC A;  1EOG A;  4O5R A;  4J2F A;  3M9K A;  3I43 A;  5D8I A;  4MF6 A;  1O7U A;  5DJM A;  2UV8 G;  3V1W A;  4N10 A;  1ZYP A;  2IPA A;  4YAP A;  4ECC A;  2F8A A;  3VWU A;  5ELG A;  1XWG A;  2B3S A;  2IIY A;  4FYB A;  2R2J A;  4O32 A;  2GZY A;  5C04 A;  3FY7 A;  5D9X A;  1G7E A;  1LJR A;  1A0F A;  2GSS A;  1JZR A;  2CT6 A;  4I2T A;  2HZE A;  3HXS A;  4TW5 A;  5ID2 B;  5AIV A;  5ECK B;  3LXZ A;  3LYP A;  2P31 A;  2FNO A;  4EE0 A;  1VRS D;  4TR0 A;  2IMF A;  2FHE A;  4HQZ A;  1PN9 A;  4N30 A;  4AJ8 A;  3GX0 A;  1M9A A;  4K1F A;  1DE2 A;  2LNT A;  1G6Y A;  5DVB A;  4KCE A;  4AKX B;  3PIN A;  4XS1 A;  2YV7 A;  4GQC A;  4KDY A;  1YQ1 A;  1VF1 A;  3FKF A;  2HLS A;  2E7P A;  2JAD A;  2LQQ A;  1JZD A;  4NV5 A;  3LFL A;  4USS A;  2IMK A;  1NM3 A;  3TJB A;  5HQP A;  3DKS A;  5IO0 A;  2MYG A;  2YJH A;  5ELA A;  1GTU A;  4PUR A;  1M2B A;  3DEX A;  3VPQ A;  4K5S A;  1V9W A;  4AF2 A;  1DUG A;  3ZML A;  4ZIJ A;  2R0G A;  4EL1 A;  4K2D A;  2X64 A;  3CXG A;  3IC8 A;  5ECH B;  3VWX A;  5E59 A;  2R0C A;  5EVO A;  1T00 A;  4G0L A;  4PUA A;  1GL8 A;  5A5H A;  3FEU A;  4KAE A;  3BCK A;  5J4Y A;  1ZYN A;  2BTO T;  1V98 A;  2BMX A;  2TRX A;  2OE1 A;  2H6Y A;  4PTS A;  3QPM A;  5G1L A;  4TR1 A;  2HZF A;  2VLU A;  1ON4 A;  22GS A;  2O5V A;  5G5F A;  3F4R A;  5F06 A;  1USB A;  4EDY A;  2HSN B;  5G5E A;  1GSQ A;  1K3L A;  5BMU B;  2PVO C;  3E9J B;  2ZUP A;  2GLR A;  1UN2 A;  5G31 A;  5J47 A;  1VF4 A;  2FLS A;  3KIJ A;  1GLQ A;  4YH2 A;  5IO2 A;  1W4V A;  3EC3 A;  3NOF A;  3A5I A;  2A4V A;  3QFB C;  5EPF A;  4ILF A;  2H1L A;  1F3A A;  1A8L A;  2L59 A;  1W89 A;  5A4V A;  4ECI A;  10GS A;  2HSY A;  3ZMK A;  4V1A p;  3AY8 A;  4PNF A;  4GCI A;  4WR5 A;  3O76 A;  1S3A A;  2HT9 A;  3A2V A;  4IP6 A;  4OO4 A;  2LEG A;  4HZ4 A;  3P7X A;  4F82 A;  1PQN A;  3GTU A;  3CRT A;  2JZT A;  4AKH A;  1N2A A;  2M46 A;  2GQM A;  1RW1 A;  3A5W A;  4EF0 A;  5CAX A;  4JR6 A;  3N9J A;  3RBT A;  1N8J A;  4MCU A;  2X8G A;  3H4K A;  5A1N B;  3GST A;  3US3 A;  1SJ6 A;  3QR6 A;  3VLN A;  4TN8 A;  3GUR A;  3FR9 A;  5HR2 A;  5GST A;  4V2N A;  2HE3 A;  3ZTL A;  1B4Q A;  3VWV A;  2YCD A;  5H5R A;  4V1A g;  3UIW A;  5IMD A;  4ZBA A;  1PD2 1;  2OE0 A;  4HDE A;  3EMP A;  2DJJ A;  2R6K A;  4E68 A;  2K18 A;  1EWX A;  4K0N A;  4PNG A;  3ZFB A;  2L5L A;  2TRC P;  4AKG A;  4OFN A;  4W66 A;  2H0I A;  5ECS A;  1B48 A;  4FH8 A;  2H1G A;  5JCG A;  3CTF A;  4JU5 A;  3KGK A;  2REM A;  1QUW A;  2GT6 A;  3KH7 A;  3IAS 2;  1EP7 A;  1Z6M A;  2PN8 A;  1HQO A;  3CSI A;  2F3M A;  1SVM A;  4AKI A;  1GTI A;  14GS A;  2EIR A;  3MSZ A;  3DIE A;  4HU7 A;  1JZW A;  1WIK A;  3CSH A;  2LNS A;  4TR3 A;  2VO4 A;  1BJX A;  4MJE A;  5DAL A;  2WRT A;  2P0G A;  3F63 A;  1XVW A;  5IM9 A;  1EOH A;  1JLV A;  2DC5 A;  4POK A;  1R5A A;  2JAC A;  4YKG A;  2B5Y A;  2OKA A;  3DML A;  1UC7 A;  4GWR A;  3D4T A;  4YQM A;  17GS A;  1GWC A;  2H75 A;  2YV9 A;  3DWV A;  3GL5 A;  3QOU A;  4CW9 A;  2XBI A;  1O73 A;  2X99 A;  2XHF A;  1ERV A;  2PUK C;  2M80 A;  1Z5Y E;  1YKA A;  2X8H A;  1KEB A;  2GST A;  5H5Q A;  4ZB8 A;  2CZ2 A;  1M2A A;  2GSQ A;  1X9S B;  2CA8 A;  5DQY A;  3HHV A;  1OVN A;  3G7J A;  2L57 A;  4WBJ A;  2AYT A;  4RUV A;  3HVX A;  5IMA A;  1V2A A;  3W8J A;  2HSM B;  4KSO A;  3E0U A;  5KEJ A;  4POL A;  4MMM A;  4HJ2 A;  1TW9 A;  3CTG A;  2DLX A;  1EEM A;  1X5D A;  1AXD A;  1ZMA A;  3DRN A;  2VKZ G;  1FW1 A;  3O3T A;  4RI7 A;  2X4A A;  1SYX A;  5D9T A;  2B6M A;  3ZRD A;  1AC1 A;  2WZ9 A;  3E3E A;  1GTA A;  4Z2U A;  2HQT A;  3TGZ A;  5J40 A;  4DSS B;  3D22 A;  3M0F A;  3HYP A;  2DMM A;  2F51 A;  2J23 A;  2PVQ A;  3FHK A;  1GUM A;  1SD8 A;  5ECO B;  3TRP A;  3CMI A;  3UOM A;  1K3O A;  2R3X A;  7GSS A;  4WEY A;  4YQU A;  1E6B A;  1G6W A;  4MNN A;  3IK7 A;  5EY6 A;  1XOA A;  3DGQ A;  3F8U A;  5B8A A;  4ZBB A;  2GT5 A;  1G0T A;  1M99 A;  2X49 A;  3EPT A;  1OC9 B;  3KZQ A;  4X0X A;  1QXH A;  1ABA A;  4ZL9 A;  4HQS A;  1SL1 B;  4N0Z A;  2VD1 A;  2CX4 A;  2CAI A;  2H0H A;  1TRU A;  4F2I A;  3IV4 A;  4PUF C;  4DEJ A;  2GSR A;  2OE3 A;  3TKS C;  3GIX A;  2OAC A;  1ZYE A;  3Q18 A;  3Q74 A;  2EC4 A;  6GSX A;  5A34 A;  1PN0 A;  5L71 A;  1T3B A;  5DDL A;  1V58 A;  3CWG A;  2A2R A;  4CY6 A;  2QKE A;  1SK0 A;  3CBU A;  2K9F A;  3UBK A;  5J4U A;  4IHU A;  4DSR A;  4I8B A;  1Y6E A;  2K8V A;  1AUC A;  2FWE A;  1THX A;  3MIX A;  4XIH A;  5CRE A;  4POM A;  2X8C A;  3KJY A;  3VFI A;  1V57 A;  1M7T A;  3ME8 A;  3IRA A;  4IJ3 A;  4NAX A;  4GDF A;  4ACS A;  1X0R A;  3GV1 A;  2N5A A;  1OAZ A;  2FWH A;  1OC8 A;  2DIZ A;  1Z9H A;  5FHI A;  3F4S A;  3I69 A;  2WGR A;  4XHM A;  1SKR B;  1WMJ A;  5IMZ A;  2B7J A;  2OT3 A;  4MPF A;  1WP0 A;  1XPV A;  3L9S A;  1Q98 A;  2CZ3 A;  3DVW A;  3DXB A;  4NHW A;  2C3T A;  5J5N A;  5D96 A;  2FWF A;  4HJM A;  5BRT A;  3W8S A;  3UMA A;  3UBL A;  5G1K A;  3WGD A;  3CSJ A;  2O8V B;  1XVQ A;  3TRX A;  2HRA A;  4I6X A;  2PMT A;  1LU4 A;  1QFN A;  4IVF A;  2VCT A;  1E2Y A;  3P90 A;  2YJ7 A;  2H72 A;  1THO A;  3RPP A;  4KDX A;  1GSE A;  1T4Y A;  1ZGN A;  1TXU A;  4DSQ A;  3EU3 A;  1PX6 A;  3J7Y b;  2GZP A;  4K0G A;  5DCG A;  3GA4 A;  2O7K A;  4MF7 A;  1T4Z A;  3TJF A;  1T8E B;  1LBK A;  2VL3 A;  3FR6 A;  2I1U A;  4JZQ A;  4ID0 A;  4KE3 A;  4E8E A;  1MDI A;  2BJX A;  2VD0 A;  4MP4 A;  1F2E A;  1FB0 A;  2H70 A;  3G9B A;  1XWK A;  9GSS A;  4MZW A;  3VPT A;  2O85 A;  1MD4 A;  2ON5 A;  1TOF A;  1B4P A;  1MDJ A;  2HRN A;  2GZZ A;  2YZH A;  4RQX A;  1B9Y C;  4N11 A;  4KDU A;  3APS A;  5IOX A;  2CVB A;  3PPU A;  4RI6 A;  2DKI A;  3R3E A;  1PKZ A;  1URM A;  3IE3 A;  2K8S A;  2DBC A;  2JL4 A;  4G0I A;  4BVX A;  2H6Z A;  3QAV A;  2A2P A;  3GKK A;  4XTS A;  5G2Z A;  1XOB A;  5ENU A;  5KN1 A;  1MD3 A;  3Q19 A;  4L5L A;  2L5O A;  3VK9 A;  5KN0 A;  2H8L A;  3GTU B;  4KF9 A;  1O6J A;  2YWN A;  4IP1 A;  3MYD A;  3GKN A;  4F9Z A;  1SKS B;  4MA9 A;  1R5P A;  1S3C A;  3ZL5 A;  2WS2 A;  4OCE A;  2XBQ A;  3LGC A;  3RAZ A;  2C0G A;  18GS A;  2VUP A;  3TKR A;  3GRX A;  2IME A;  3IK9 A;  3ZZX A;  2VL2 A;  3FK8 A;  2WB9 A;  3VI7 A;  1K0O A;  5A5K A;  3EE2 A;  2H73 A;  2LRT A;  1TKD B;  5F05 A;  4IS0 A;  1RK4 A;  4BPY A;  2DJ1 A;  2EFD A;  1GUH A;  5IMF A;  3HJP A;  2VCQ A;  5A4U A;  2DIY A;  1KNG A;  4KA0 A;  1XXU A;  1TRW A;  3SBC A;  4HEA 2;  1M0U A;  4EC0 A;  2LKU A;  5ECN B;  4NMU A;  2WFC A;  5J3R A;  5KN3 A;  2AAW A;  3TJJ A;  4XS4 A;  2CVD A;  5CYY A;  2A4H A;  5JWO B;  5J41 A;  2MZC A;  2B5E A;  2OAD A;  2YAN A;  2ON7 A;  3NZN A;  2GDR A;  4RQR A;  3L4N A;  2VCZ A;  3GX8 A;  3RHC A;  3EVI A;  5HR0 A;  1FAA A;  8GSS A;  3N5O A;  1SJZ A;  1YEX A;  4EXJ A;  6GSY A;  4ZB7 A;  4LMW A;  1ZYQ B;  2DSA A;  1MDK A;  1ERW A;  1M2D A;  1SD9 A;  4Q5R A;  4L5O A;  1VF2 A;  2FUG 2;  1BED A;  3DD3 A;  2HRF A;  1A24 A;  4QMK A;  1GSY A;  2H19 A;  5LNK e;  2VOC A;  5ID2 A;  1SU9 A;  4XRD A;  3F0I A;  2IFQ B;  3LW9 A;  4J57 E;  2YN1 A;  1QMV A;  3D4M A;  3A2W A;  4L8E A;  4AJ7 A;  5F07 A;  4NHZ A;  1TRS A;  5AGY A;  1ST9 A;  3H8Q A;  4BVY A;  1OKD A;  3ZVJ A;  1XBS A;  4NXI A;  4K5R A;  3LOR A;  4WF4 A;  2EFC A;  3UVH A;  1PMT A;  2MMN A;  1T1V A;  2EIQ A;  1GH2 A;  2GS3 A;  3BCI A;  4I2U A;  5IMV A;  3TB2 A;  4XRA A;  2LS5 A;  3D6I A;  2WDU A;  4WKW A;  5HFG A;  1KTE A;  2AV4 A;  1A2M A;  1YKC A;  4N3Z A;  5B6N A;  1XWB A;  1SK2 A;  1PX7 A;  1ZL9 A;  3LQ7 A;  1WOU A;  2VL9 A;  2VIM A;  5GAP D;  3QFA C;  2FY6 A;  4TXV A;  3C73 A;  3HCZ A;  2LJA A;  4ULX A;  4O7H A;  2VLT A;  2J9H A;  3FZ9 A;  1HNC A;  12GS A;  2HSN A;  4TRX A;  5KOW A;  3APO A;  2AB6 A;  5BMU A;  2JZS A;  3FMW A;  3ZVJ D;  2G2Q A;  3KH9 A;  1N25 A;  2HRK B;  4ZIL A;  1DBY A;  13GS A;  2L4C A;  1TRV A;  4D73 B;  2R5G A;  1X5C A;  1Z3E A;  4K7I A;  5J9C A;  1O85 A;  5J9B A;  3UVT A;  2IMD A;  3M9J A;  1YZX A;  20GS A;  3KMO A;  3C1R A;  2HXK A;  1YDK A;  1GLP A;  1I5G A;  2GQL A;  2LUS A;  1I9D A;  1U6T A;  2TIR A;  4OD7 A;  4POB A;  4PQ1 A;  2JSY A;  1TTZ A;  3GMF A;  3NIV A;  2H76 A;  2YPM A;  1PL1 A;  4MZB A;  2E2G A;  4OO5 A;  1PL2 A;  3HKR A;  2H1A A;  2P5R A;  1GP1 A;  2YWM A;  3HD5 A;  1V40 A;  5HFK A;  2G0F A;  4O5U A;  3F6D A;  2V1M A;  2MMO A;  3IXR A;  1F37 A;  1TP9 A;  1XWC A;  3BBY A;  5CRH A;  2KP2 A;  3HJM A;  1ERU A;  4G9H A;  1EGR A;  3LWA A;  4FYU A;  3L9V A;  3ZRE A;  3MDK A;  2KHP A;  1XZO A;  2LJR A;  3KCM A;  3DYR A;  2C4J A;  1H4O A;  5AIX A;  2H74 A;  4PQH A;  2WCI A;  1GSS A;  4TXO B;  1TK8 B;  2RUE A;  4NPB A;  3PR8 A;  3TKS E;  3DVX A;  3A2X A;  4HI7 A;  4F03 A;  4HOJ A;  1TI3 A;  3J7Y k;  3GYK A;  4QL7 A;  1SJI A;  2IMI A;  3TKP A;  1ILO A;  3C8E A;  4FO5 A;  5DAK A;  4ISD A;  1RQM A;  1S3D A;  3C71 A;  2NDO A;  5H5S A;  3UJ1 A;  4JBB A;  5KN2 A;  3RPN A;  3ED3 A;  3WGE A;  3VWW A;  2R4V A;  4TVE A;  4BL7 A;  3KTL A;  4K7N A;  2VCV A;  4KX4 A;  1XIY A;  2DKH A;  3TU3 B;  3EWL A;  3WT2 A;  1FHE A;  2VM2 A;  5ECQ B;  4WF5 A;  3D0Z A;  1A2L A;  2OBK A;  2VAF A;  4K7O A;  1O8W A;  3ERW A;  3FR3 A;  1GNW A;  4ECJ A;  3LG6 A;  3GNJ A;  3A3T A;  4IGJ A;  2MBT A;  4OFT A;  1BX9 A;  2QA1 A;  4Q5F A;  4O5Q A;  2XC2 A;  4EKZ A;  2NPB A;  1ERT A;  2HI7 A;  4MDC A;  3TCO A;  1EV9 A;  3TUE A;  4Z7X A;  2YOI A;  3FZ5 A;  5IIZ A;  2NVL A;  2C1Y A;  4AJ6 A;  5HR3 A;  1JFU A;  2RM5 A;  5AN1 A;  5GSS A;  1BF5 A;  3G7I A;  1FVK A;  3ZFL A;  4I5Q A;  3FZ4 A;  2VM1 A;  2HZE B;  5DQS A;  2CAQ A;  2HSM A;  2LRC A;  4BVX B;  1SK1 A;  2HSH A;  3IAM 2;  1K0M A;  3VI5 A;  2FA4 A;  3SWL A;  1SL0 B;  1MTC A;  1GUK A;  1AQX A;  2KP1 A;  3HZ8 A;  2B1K A;  3QD9 A;  3TOT A;  4IQA A;  1OE8 A;  4IBP A;  2IWT A;  5J4V A;  4IW9 A;  4OCF A;  4DSS A;  1OE7 A;  2M72 A;  4HU9 A;  1YEP A;  1PA3 A;  3IA1 A;  3GFK A;  5G30 A;  1GUL A;  2F9S A;  3U5R E;  3H1N A;  1CQH A;  1JLW A;  1JHB A;  3ME7 A;  1QGV A;  1IYH A;  4ML1 A;  5E4W A;  3TOU A;  5KOX A;  4LL1 B;  4ICY A;  5JWR B;  2GTU A;  2YWO A;  2LST A;  2I3Y A;  2AHE A;  4G01 A;  5JWQ B;  4K9Z A;  2LJK A;  1MEK A;  1TK0 B;  5GAN D;  1OC9 A;  2LRN A;  4KB3 A;  2R37 A;  3KEB A;  3QDN A;  3F9U A;  1HYU A;  2EFH A;  1DSB A;  1XW5 A;  5C00 A;  1SYR A;  2V6K A;  2C3Q A;  4K6X A;  2I81 A;  4WR4 A;  5D9V A;  1WPI A;  5DCH A;  3QAG A;  3U6V A;  2JSZ A;  5A5H B;  2ES7 A;  4Q5N A;  1GNE A;  4GXZ A;  1R26 A;  1X5E A;  2H71 A;  3VUR A;  2V41 A;  3KP9 A;  5CNW A;  4MZC A;  1QQ2 A;  2DJ3 A;  4ZXG A;  2MMA A;  4TR1 B;  3KD0 A;  4XS4 B;  4IN0 A;  2N5F A;  5LCZ A;  1ML6 A;  1SKW B;  1FG4 A;  5CRW A;  4TKY A;  1U88 A;  4JRR A;  19GS A;  3WYW A;  4IEL A;  2YNX A;  3EMX A;  3H79 A;  2V6O A;  4GLT A;  3GSS A;  3ISO A;  2NBS A;  1AIU A;  1XW9 A;  1BYE A;  1ZZY A;  2H0G A;  2KOK A;  1WE0 A;  3C7M A;  4FQU A;  2PWJ A;  4WET A;  11GS A;  5CRG A;  2L6C A;  1OC3 A;  1A0R P;  2QSI A;  3EU4 A;  5FT3 A;  2MMZ A;  2UZ8 A;  5D73 A;  4EVM A;  5IQY A;  3HJO A;  1Q4J A;  3QCP A;  1JZO A;  3HA9 A;  5HR1 A;  2PGT A;  3TKS A;  5D93 A;  1BG5 A;  2WUL A;  4CY8 A;  1WJK A;  3GH6 A;  2RUF A;  1NHY A;  4Z2T A;  4X1U A;  1K0D A;  5LD0 A;  2E0Q A;  4BVY B;  4MJA A;  4XS6 A;  2B1L A;  1O8X A;  1FO5 A;  2F8F A;  4KUN A;  2IL3 A;  4E8H A;  4ZB9 A;  2JZR A;  5IOW A;  2QGV A;  4BA7 A;  5B6M A;  3TDG A;  1YF1 A;  4AGS A;  3MNG A;  4ECB A;  1BQ7 A;  3FW2 A;  4PX1 A;  1OKT A;  4MH3 A;  4YQV A;  1ZCP A;  3I9V 2;  2OJL A;  2PU9 C;  4GF0 A;  2GVP A;  2H66 A;  1A23 A;  3M3M A;  3CRU A;  1TU7 A;  4LA1 A;  3EYT A;  1K0C A;  4IJI A;  1K0A A;  4MK3 A;  1R4W A;  4KND A;  3ZIT A;  2FWG A;  4LL4 B;  2NTO A;  4BWQ A;  4HS1 A;  5B7C A;  1A8Y A;  4JE1 A;  1Y1U A;  1TI1 A;  2K6V A;  4MJB A;  4KSM A;  4WBR D;  4G0K A;  2CV4 A;  4GST A;  2CX3 A;  3EUR A;  2QA2 A;  3GL3 A;  1O81 A;  2CVK A;  4HUA A;  3D21 A;  3IHQ A;  3K8N A;  5FWG A;  2V2G A;  3F6F A;  6GSS A;  2ALB A;  1FB6 A;  2B5X A;  4JED A;  5DAL B;  3FZA A;  5A4W A;  3LYK A;  3LJR A;  5B8B A;  3GHA A;  3KXO A;  1X9M B;  4P3Y B;  1X9W B;  2AUV A;  2VCW A;  2DJK A;  2V32 A;  1GTB A;  1QK8 A;  5IPH A;  4OFM A;  2I4A A;  3GKM A;  4ZL8 A;  4JR4 A;  4GTU A;  1EEJ A;  1TDI A;  1FVJ A;  1NHO A;  4O92 A;  1Z7R A;  5ECI B;  1WRY A;  3PH9 A;  1VGL A;  4F0C A;  3I6A A;  1TK5 B;  2C8U A;  2KLX A;  3PGT A;  6GSU A;  2O87 A;  4FIW A;  1SEN A;  4GRF A;  1Z6N A;  4YAV A;  1YY7 A;  3KTB A;  3GKX A;  2ZCT A;  2OBI A;  4V2L A;  2L4Q A;  3EIN A;  1SVO A;  1PSQ A;  1UA5 A;  4ML6 A;  1AAZ A;  3ERF A;  5JCU A;  3UL3 A;  3P8W A;  1GSF A;  5COH A;  3C1S A;  4NV2 A;  4G19 A;  4OWY A;  2H01 A;  3F4T A;  3WT1 A;  6GSW A;  3BOA A;  4EIQ A;  1J9B A;  4KH7 A;  1HNA A;  2EIO A;  2LV3 A;  4LLR A;  2WJU A;  3JCM L;  5INY A;  3HY2 A;  4YKF A;  2I9H A;  2P5Q A;  4GSS A;  3GUS A;  1BAY A;  2RLI A;  5DAK B;  2MBS A;  2FCH A;  3TKQ A;  1SL2 B;  3FRC A;  3TJG A;  3MWH A;  4ZB6 A;  2B7K A;  2HYX A;  4L0U A;  4X4J A;  3QAW A;  3O6T A;  5DBQ A;  4QL9 A;  4KW6 A;  5GZZ B;  5ECL B;  4BL7 B;  1PGT A;  2PBJ A;  4Q5Q A;  4IQ1 A;  2FA8 A;  3MAK A;  3GN3 A;  1DE1 A;  1R7H A;  5AIS A;  3TRQ A;  3FYG A;  3LEF A;  1KBN A;  2IFQ A;  5A34 B;  2VLV A;  4GQF A;  2YWI A;  3UEM A;  1K3Y A;  3HZ4 A;  5ECP B;  5CP1 A;  5A1N A;  1HNB A;  2A2S A;  2DJ2 A;  4X43 A;  2EFE A;  3IPZ A;  4ZL7 A;  4MH2 A;  1FOV A;  2RM6 A;  2C0E A;  3R2Q A;  1Z7P A;  2H1B A;  1NSW A;  1Y25 A;  4PQI A;  4G2E A;  2FGX A;  1YVL A;  3RHB A;  6GSV A;  3WD6 A;  3KMN A;  2D2Z A;  4N0V A;  1EZK A;  4IKH A;  5DJL A;  2E2M A;  3IOS A;  3GH9 A;  1BG1 A;  1ZOF A;  2CQ9 A;  4QQ7 A;  2O89 A;  4G10 A;  2LTK A;  5F8B A;  3APQ A;  2QC7 A;  1CQG A;  4ZBD A;  3IHG A;  3IC4 A;  1UVZ A;  3HVV A;  2VCX A;  2RII A;  1F9M A;  3M1G A;  3ZIV A;  3ZLP A;  2GGT A;  3IBH A;  2H30 A;  2FD3 A;  2ZNM A;  2XPD A;  2Z9S A;  1XW6 A;  1F6M C;  1U3A A;  2N5B A;  1H75 A;  2YP6 A;  3CYN A;  4HZ2 A;  4EUY A;  3BD2 A;  5EL8 A;  2HRK A;  3Q6O A;  3KM6 A;  4F0B A;  2HFD A;  4CDO A;  1U87 A;  4D73 A;  4Z2R A;  3H93 A;  3HDC A;  3QMX A;  2OA7 A;  4CHS A;  3G7Y A;  1YF0 A;  1EP8 A;  2KUC A;  3L0H A;  3L9U A;  1SVL A;  1T7P B;  1VF3 A;  2DJ0 A;  5CO3 A;  1G7O A;  4L0W A;  1J08 A;  2R0P A;  1F3B A;  2JU5 A;  3W6G A;  4NWY A;  4MPG A;  2LQO A;  1EV4 A;  1B9X C;  4AI6 A;  3ZIJ A;  4LMV A;  1ACV A;  4MLY A;  3TJK A;  4J56 E;  1HD2 A;  2XPE A;  1TXX A;  2VL2 C;  1J0F A;  4OMV A;  1OYJ A;  4H86 A;  3M8N A;  4EO3 A;  6GST A;  4I97 A;  4EDZ A;  3D5J A;  3IR4 A;  1K0N A;  4TOP A;  1PKW A;  3L78 A;  4PXO A;  4PGT A;  5F0G A;  5CRD A;  1C72 A;  1AQV A;  3LXT A;  3UAP A;  3UAR A;  5JCW A;  3LSZ A;  2C0D A;  4MAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...