1ML7A

Crystal structure of nitrophorin 4 complexed with 4-iodopyrazole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Axial ligand complexes of the Rhodnius nitrophorins: reduction potentials, binding constants, EPR spectra, and structures of the 4-iodopyrazole and imidazole complexes of NP4
pubmed doi rcsb
molecule keywords nitrophorin 4
molecule tags Ligand binding protein
source organism Rhodnius prolixus
total genus 50
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2002-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1ml7A00
3C76X 2HYSA 2O62A 3CBCA 3B2LA 1LKEA 3VG4A 3TF6A 1GT4A 2QM9A 2LBVA 4BOEA 3B2HA 1G7NA 1BSYA 5DG4A 2XKLA 4A1HA 3P6DA 5IO7A 1S7DA 3VG7A 4AZNA 4DQ4A 3FR2A 1ICMA 5CE4A 5HCEC 1DFVA 4HPBA 1GM6A 1GX9A 4ALOA 5H9AA 4O9SA 4M7MA 4IB6A 1KOIA 1X8PA 3NX2A 4ORXA 2ASNX 1BSOA 3NQ9A 1JJXA 3UEXA 2HZQA 2EU7X 4IMOA 2JU8A 3HWFA 2OVDA 4XMHA 3APUA 1OPBA 1TW4A 1S2PA 4I3BA 2K23A 3PEDA 4NYRA 4YKMA 3APVA 2A13A 5LJHA 2W2BA 1HN2A 1OEKA 2R74A 5F6BA 1G85A 1YWAA 1IFBA 3VG3A 2A2GA 4MVLA 3PPTA 4TKHA 1QABE 1LPJA 2KT4B 4ZH9A 4IAXA 4QZUA 5D48A 5D8JA 4HPAA 3HK1A 4ORRA 4XMFA 3STMX 1QY1A 2ACPX 1QWDA 5H9KA 1U18A 3U9PC 4NP1A 1ZNKA 4QGVA 1YP6A 3FR4A 2QO4A 2L67A 1BM5A 4NNTA 3MBTA 1E00A 3JS1A 3KFHA 1E02A 2BLGA 2AH7X 3ZUOA 1OBUA 4MVKA 3IFBA 1U0XA 3FELA 3CWKA 4TKBA 1QG5A 1ZRYA 1P6PA 3TZSA 1U17A 1HBQA 5HA1A 5HCCC 1QFVA 1EPBA 1X8OA 3CBSA 4TKJA 3WXQA 3BS2A 4AZRA 1LNMA 3I0AA 1SY3A 4XMDA 5B27A 2LKKA 3P6HA 4OS0A 5HTDA 4A8ZA 2OVEA 2WR6A 2WUTA 4GKCA 3JSQA 1DZJA 2LFOA 2GJ5A 3UEUA 1ERBA 3U0DA 2L5PA 1GXAA 4ZHHA 1KT3A 3APXA 4R0BA 1B0OA 5LJEA 4HPDA 1SXUA 1QQSA 4ORSA 1DC9A 5H9LA 1SXXA 3MVFA 4IBAA 2GTFX 1LFOA 3NP1A 1I04A 2G79A 1LIEA 2WWPA 3APWA 4WFUA 3PECA 1FE3A 5LJKA 5F1EA 5D4AA 2AT3X 4AZOA 3FA8A 3NR3A 1NGLA 5LJBA 3G7XA 5HA0A 1UREA 1X8NA 3D96A 3P6GA 1CBQA 1AQBA 1QFTA 2KTDA 4QZTA 4ORYA 1FDQA 2AT8X 4YDBA 1FTPA 3O2YA 3K3LA 3DSZA 4YFQA 4ES7A 4EDEA 1PMPA 1A2DA 3BDRA 1QY2A 2HMBA 1O1UA 2NNQA 1JYJA 1BRQA 5EEEA 1ML7A 4I9SA 4ALBA 5EZ2A 2L9CA 2YG2A 1T0VA 4YMYA 4TLJA 3FEPA 1IFCA 1L6MA 1BWYA 2X46A 2JOZA 3SAOA 1EXSA 2HNXA 2FR3A 1OBPA 3HWDA 1Z24A 1GT1A 2CZUA 1YWDA 1KT6A 3FA7A 3S26A 5IO6A 1QY0A 2DM5A 1RLBE 1O8VA 4YFPA 1TOWA 5HTEA 3UEVA 3WJCA 4AZMA 2ACOA 5LJGA 1DZKA 4GNYA 1SY0A 5D45A 1TVQA 3ELXA 5BVQA 3NADA 1BRPA 3CR6A 1OPAA 3BU1A 3WJGA 3O22A 1KZXA 3PP6A 1KT4A 4YFRA 2F73A 4IB7A 1I06A 1HMRA 5L8IA 1EIIA 2RCTA 1O1VA 4EFGA 2MM3A 3FMZA 1GX8A 5KICA 2WEWA 4LKPA 3BSZE 4YGHA 1CRBA 1SXWA 3RSWA 1S44A 2FWVA 3WJDA 1ICNA 1KXOA 1JV4A 3STKA 1XKIA 4ZR2A 1SXYA 2MJIA 4I3DA 3BX8A 4OS8A 1IKJA 3ZQ3A 4ORUA 2AT0X 1LICA 4AZQA 2FTBA 1PEEA 2NNEA 3O19A 4GNWA 3STNA 1X8UA 5FFHA 2K62A 1YIVA 2L68A 1H91A 2HZRA 4N7CA 5LKEA 1PBOA 2A2UA 2CM9A 4LKTA 1LIFA 3WJEA 5D47A 1EW3A 5EDCA 1MDCA 3KZAA 4QYNA 2X45A 3QKGA 1ZNLA 2R56A 4CK4A 2LBAA 5HBSA 1A3YA 2CM4A 4HPCA 5HZ8A 2P8GA 1T68X 4ODDA 5HAEA 2A0AA 1G74A 1ZNGA 2ANSA 5DPQA 4LZVA 5LKFA 1ADLA 1GT5A 4EXZA 1X89A 3WJFA 3TGCA 1SY2A 4ZGUA 3B2KA 5IO5A 1AELA 5C0NA 3NX1A 3BLGA 5LJDA 2XSTA 4GE1A 4RUNA 1HMSA 1AVGI 4QYPA 1VPRA 1JJJA 1SY1A 3B2JA 3EBKA 5JR8A 3GAQA 3WBGA 1I4UA 4KIIA 1IIUA 1YWCA 5HZ9A 2Q2PA 1GGLA 2WQAE 3BU9A 5H8TA 2FT9A 1EPAA 4YGGA 5EPQA 5FAZA 5HZQA 3NQ3A 2FLJA 5HCDC 2AKQA 4AW8A 1FENA 2PY1A 1JYDA 1OBQA 1CBIA 5EEDA 3OJYC 2CBRA 1CBRA 1KQWA 3KFIA 3PH6A 3RZYA 2RQ0A 3BX7A 1RBPA 1KT7A 1CBSA 1XCAA 2JU7A 2W2AA 3BRNA 1DV9A 4WBKA 1HQPA 4IAWA 1BBPA 1ZNEA 4BQUA 2E4JA 5F58A 1B56A 1NP1A 2POAA 1IKEA 3F9DA 5F7GA 3T1DA 4Y0QA 4TNNA 1D3SA 4TJZA 2RA6A 3P6CA 4D6AA 3DTQA 3IA8A 4QGXA 5KIDA 4GRJA 2CZTA 2R73A 4K19A 4QAEA 2RCQA 1KZWA 1ALBA 1LIDA 4UU3A 3VG5A 2N93A 4XMGA 4YBUA 2FS7A 4A60A 4DQ3A 1ACDA 3EYCA 1E06A 3FLLA 3TGAA 1JZUA 1VYGA 1D2UA 1DZMA 1KGLA 4NLJA 4M6SA 1MX7A 4GETA 1R0UA 5LJCA 4IB9A 3WVMA 2CBSA 1MUPA 3FW4A 1FEMA 5L8NA 2WQ9A 3L4RA 4OS3A 4XMEA 5H9NA 4XMCA 4MVIA 3UEWA 3BY0A 4ZFXA 5KHPA 4A1YA 2LB6A 3FW5A 1CJ5A 1I05A 5BVSA 2QO5A 2AMMX 4YCEA 3EBWA 4YGZA 1DF3A 4ZHFA 2NNDA 3AKMA 4OMXA 3P6EA 2ALLX 3C78X 1SA8A 3B2IA 1LIBA 2MO5A 1NP4A 2Q4NA 1T8VA 1EIOA 4YH0A 3CMPA 4OMWA 2FR2A 3ELZA 1A18A 1B4MA 3U03A 1GKAA 4ORWA 4BVMA 2W2FA 2AT5X 1G5WA 1ZNDA 2Q9SA 4YCHA 3EMMA 4ZHGA 5K06A 3P6FA 4ZJ0A 1UZ2X 1YP7A 1EQDA 4Y0SA 2WSJA 1X8QA 1GT3A 4HFOA 3TGBA 3ZUIA 3AKNA 2JU3A 4YBPA 4N7DA 1EUOA 3NPOA 2RD7C 1IW2A 2A3FX 4ARHA 1B8EA 1FELA 1AB0A 2HLVA 2OVAA 3VG6A 4Y0PA 3C77X 2FRSA 3FENA 2G78A 2NP1A 1JBHA 1KT5A 1E5PA 2G7BA 5HWZA 1PM1X 3KQ0A 4IB8A 5B29A 1TXLA 3FA6A 3FEKA 2WEXA 2Q39A 5HZ5A 3WJBA 4RUUA 4I9RA 1ERXA 3D97A 1HMTA 1ZNHA 3CQRA 3Q6LA 4ZHDA 1BEBA 2AT6X 1DZPA 4YKOA 4GH7A 1BLRA 4NNSA 3PH5A 2QO6A 4I3CA 1OEEA 2IFBA 4D6BA 4IMNA 3HWGA 4ZH6A 1MX8A 4ZHCA 2AL0X 1A57A 1OEJA 2GC9A 3HWEA 4PSQA 3I17A 5L8OA 3EM0A 4ZCBA 2OFMX 1HBPA 3D95A 4QGWA 1VYFA 1GKAB 2OZQA 2QOSC 3KFGA 4Y0RA 5HZ6A 1YUPA 2JN3A 4AZPA 5FENA 4NLIA 2FS6A 3CQNA 1LF7A 3F8AA 4YDAA 3VG2A 4UU2A 5AQ6A 1KQXA 5BVTA 3FR5A 5F6ZA 1N0SA 4LZUA 2Q2MA 1TOUA 4NYQA 1EALA 3FIQA 4TQ2A 1X71A 3KFFA 1MVGA 1BJ7A 4AYHA 1BSQA 5EDBA 1YWBA 3FA9A 2OFRX 4EEJA 4WFVA
chains in the Genus database with same CATH superfamily
3C76X 2HYSA 2O62A 3CBCA 3RBYA 3B2LA 1N43A 1LKEA 3VG4A 2IZKA 3TF6A 1GT4A 2QM9A 1LELA 2AF5A 2LBVA 1LUQA 3S5XA 4BOEA 3B2HA 1G7NA 1BSYA 4JO6A 5DG4A 3VGWA 2XKLA 4BBOA 4A1HA 2QOMA 3P6DA 5IO7A 1S7DA 3VG7A 2OVSA 5CYBA 4AZNA 4DQ4A 3FR2A 1ICMA 1SMPI 3T6LA 2X8SA 4FQBB 4OELA 5CE4A 1HXLA 3F6ZB 4ML7B 5HCEC 1DFVA 4HPBA 4BX5B 1GM6A 4CSBA 1GX9A 2YMSA 4ALOA 1LCVA 5H9AA 4O9SA 1KFFA 4GZVA 4M7MA 4IB6A 1SWFA 1KOIA 5JD2A 1X8PA 3NX2A 4ORXA 4WHIA 2ASNX 1BSOA 3NQ9A 3SZHA 1JJXA 2CAMA 3RE6A 3UEXA 2HZQA 2EU7X 2Z4HA 3KVNA 3LTWA 3Q34A 4ID2A 3SOTA 4IMOA 3ZW1B 3S60A 2JU8A 1I9HA 2OVDA 3HWFA 4XMHA 3APUA 2RTRB 1OPBA 3RWXA 1TW4A 1S2PA 1NQMA 4GUZA 4I3BA 1SRJA 1VWGB 2IZHB 2K23A 3PDFA 3PEDA 3APVA 2A13A 4NYRA 4YKMA 3RDUA 2RTQB 2W2BA 1SWAA 3VU1A 1Y52X 1MM9A 1AVDA 1HN2A 3FDCA 1OEKA 2R74A 3EW1A 5F6BA 1G85A 1YWAA 1IFBA 3VG3A 2A2GA 1GX3A 4MVLA 4I95A 1SWOA 3PPTA 4TKHA 1STSB 1QABE 1LPJA 2KT4B 4ZH9A 4IAXA 4QZUA 5D48A 1SRHA 5D8JA 4HPAA 4KC7A 3HK1A 2C1SA 4ORRA 4XMFA 3STMX 4O4SA 5FQ7E 1QY1A 1WUBA 4QNIA 2ACPX 4HWMA 1QWDA 5H9KA 1U18A 2I5VO 3U9PC 2X4MA 4NP1A 1SWLA 1ZNKA 4QGVA 1YP6A 3FR4A 2QO4A 2L67A 1BM5A 4NNTA 2UYWA 3MBTA 1E00A 4OEMA 3JS1A 3KFHA 1SRGA 2X8FA 1E02A 1SWSA 2BLGA 2AH7X 3ZUOA 1SWJA 1OBUA 4MVKA 3IFBA 4U8UN 1U0XA 3FELA 3CWKA 4COTA 4TKBA 1VWOB 4NV7A 1QG5A 1ZRYA 1P6PA 3TZSA 1U17A 1HBQA 1RXHA 2LA7A 4U46A 2X8TA 5HA1A 5HCCC 4CPHA 1QFVA 1EPBA 1X8OA 3CBSA 4TKJA 3VHIA 3WXQA 3AUMO 3BS2A 1HY2A 4AZRA 1LNMA 4GU8A 3I0AA 3WZNA 4CPEA 1SREA 1SY3A 1RXJA 4XMDA 4BX6B 1JJUA 5B27A 2IZGB 2LKKA 2GTLN 2VFBA 3P6HA 4OS0A 5HTDA 4A8ZA 1VWQB 2OVEA 2WR6A 2WUTA 4YVBA 4GGTA 4GKCA 3JSQA 1DZJA 4DCBA 2LFOA 4I60A 2GJ5A 4BX7A 3UEUA 1NQNA 1ERBA 3VHHA 4B55A 3U0DA 2L5PA 1GXAA 3VHMA 4ZGFA 4ZHHA 1KT3A 3APXA 2ZSCA 4R0BA 1B0OA 5LJEA 4HPDA 1SLGB 1QQSA 1SXUA 2WPUA 1W5RA 4ORSA 1DC9A 5H9LA 1STRB 1SXXA 3MVFA 4IBAA 2GTFX 1LFOA 3NP1A 1I04A 2G79A 1VWMB 1LIEA 2IZDB 2RTIB 1E2TA 2WWPA 2Y3EA 3APWA 4I6SA 4WFUA 3PECA 5IXGA 1FE3A 5LJKA 1VWLB 5F1EA 5AJBA 2AT3X 5D4AA 3SZIA 3T2WA 3FA8A 4AZOA 2FGSA 3NR3A 1NGLA 5LJBA 1UYNX 3G7XA 5HA0A 1JIWI 1UREA 1X8NA 3HTYA 5BYPA 2GTLO 3D96A 3P6GA 1CBQA 1AQBA 1QFTA 1SWDA 2KTDA 4QZTA 2KTSA 4ORYA 3MG5A 1FDQA 2AT8X 4Y5DA 4YDBA 1FTPA 1VWCB 1VWRB 3O2YA 3K3LA 3DSZA 2OY8A 1PBYA 2RTEB 4CV7A 3TGBA 1W4TA 2PI3O 4YFQA 4ES7A 4EDEA 1PMPA 1A2DA 3BDRA 1QY2A 2HMBA 1O1UA 2NNQA 1SRIA 2F01A 2FKJA 1JYJA 4EKVA 1KL3A 1BRQA 1SLEB 5EEEA 1ML7A 5FQ8E 3MM0A 4I9SA 4ALBA 4CPHB 1MOYA 4KCAA 5EZ2A 2L9CA 4O4XA 3ZI8A 2YG2A 4Z28A 4Y59A 1T0VA 2OY1O 4YMYA 4TLJA 3FEPA 2MWHA 4GD9A 1IFCA 1L6MA 1BWYA 5B2AO 2X46A 5LJHA 2JOZA 1VWEB 3SAOA 3SZJA 1EXSA 1W6FA 2HNXA 1NBXA 2FR3A 3D4RA 1VWNB 1OBPA 3HWDA 1Z24A 1GT1A 4BX7B 2CZUA 1YWDA 1KT6A 3FA7A 3S26A 3RY1A 1QY0A 3ZZVA 5IO6A 2DM5A 3RY2A 2QCBA 1RLBE 1O8VA 4YFPA 4BX6A 1TOWA 3PK2A 2RTFB 5HTEA 4JHQA 3RDSA 2KW1A 3UEVA 3WJCA 4AZMA 2ACOA 5LJGA 1DZKA 4GNYA 1SY0A 5D45A 4BJ8A 1TVQA 4L1NA 3ELXA 5BVQA 3NADA 1BRPA 3CR6A 4MIRA 3SLJA 1OPAA 2IZBA 4JGLA 1UYOX 3BU1A 5IRUA 3WJGA 3O22A 1KZXA 3PP6A 2OL8O 3EC5A 1KT4A 4YFRA 2F73A 4IB7A 2HKDA 1I06A 3WZQA 1HMRA 1N9YA 5L8IA 1EIIA 2RCTA 4L3RA 4FBRA 1O1VA 4EFGA 4QRLA 3LHNA 2MM3A 1VYOA 3FMZA 1GX8A 2BT9A 4C5PA 5KICA 4MISA 2WEWA 4LKPA 3BSZE 4YGHA 1CRBA 1VWFB 1SXWA 3RSWA 1S44A 2FWVA 1FJ1E 1HQQA 4JNJA 3WJDA 2RTDB 1ICNA 3QQ2A 1SWNA 1KXOA 1JV4A 4GGRA 5CSEA 1Y9TA 1JQPA 1XKIA 2BHVA 3STKA 1SWGA 4QQ1A 4ZR2A 5F2BA 4FBVA 1SXYA 2MJIA 4I3DA 3BX8A 4OS8A 5K67A 4DNEA 1LCZA 1IKJA 2BC3A 1N7YA 2MHDA 4ORUA 4KC8A 3ZQ3A 1SWHA 1PTSA 2AT0X 1LICA 3RDMA 4CPIA 3ZWEA 4AZQA 2FKGA 4ON1A 2FTBA 1PEEA 5FQ6E 2NNEA 3O19A 4GDAA 4GNWA 4NW4A 3STNA 1X8UA 5FFHA 2OY7A 4Z2VA 1SRFA 1YIVA 1H91A 2HZRA 2JGSA 2K62A 2L68A 4N7CA 5LKEA 1PBOA 2A2UA 2CM9A 4LKTA 1LIFA 2JW1A 3WJEA 5D47A 1EW3A 3LV4A 5EDCA 1MDCA 3KZAA 3CKFA 2X55A 4QYNA 2X45A 2RTGB 3QKGA 1ZNLA 2R56A 4CK4A 2LBAA 5HBSA 1RSTB 1A3YA 2CM4A 3EW2A 1SWQA 3AEHA 4HPCA 3V8UA 1RXKA 5HZ8A 1KL4A 5HZ6A 2IZCB 2P8GA 1T68X 4ODDA 3HOLA 5HAEA 2A0AA 1G74A 1ZNGA 2IZJA 3GE2A 2ANSA 3OE3A 5AJCA 5DPQA 4LZVA 5LKFA 1ADLA 1GT5A 4EXZA 1X89A 3WJFA 4Z2OA 3TGCA 1SY2A 4U8UO 3B2KA 4ZGUA 5IO5A 1AELA 2A5CA 4U8UM 2F09A 5C0NA 3NX1A 1SWTA 4EQAC 3BLGA 2BS6A 5LJDA 2XSTA 2A5BA 2C1QA 1SWBA 4GE1A 4RUNA 1HMSA 1AVGI 2X34A 4QYPA 1VPRA 1JJJA 4Z27A 1SY1A 3B2JA 5AEOA 3EBKA 2OF8A 5JR8A 2MF6A 2VFCA 3GAQA 3WBGA 1I4UA 4KIIA 1IIUA 3NQKA 1YWCA 5HZ9A 4GDZA 2Q2PA 1GGLA 2X56A 2WQAE 3BU9A 2DJGA 3CKGA 2GTLM 4U3QA 2IZIA 5H8TA 2FT9A 3PQUA 1EPAA 2Z4IA 4YGGA 5EPQA 2IZFB 5FAZA 2RTBB 5B3MO 2FHNX 3NQ3A 5HZQA 5IRAA 2FLJA 3NBXX 5HCDC 2AKQA 3RDQA 4AW8A 1FENA 2PY1A 3VPJE 1JYDA 1OBQA 5K68A 1CBIA 4CDEA 2QMIA 5EEDA 3OJYC 1KL5A 2BSZA 4IRWA 2CBRA 2RTOB 3WZPA 1CBRA 1KQWA 3KFIA 3PH6A 3RZYA 2RQ0A 3BX7A 1RBPA 1KT7A 1CBSA 1XCAA 1SLDB 2JU7A 2OFAA 2W2AA 3BRNA 1DV9A 4WBKA 1HQPA 4IAWA 2RTAA 1BBPA 3MX7A 3H3IA 1SLFB 2Y3FA 4CDCA 1ZNEA 4BQUA 1VWJB 2E4JA 5F58A 1B56A 2VDFA 2C4IA 1NP1A 3RE5A 4PJ2A 2POAA 1IKEA 1N9MA 3F9DA 5F7GA 4O49A 2M4LA 4CDFA 1SWPA 4BCSA 3T1DA 4Y0QA 4TNNA 1D3SA 4TJZA 2ZAIA 2GH7A 2RA6A 4GJVA 3HOEA 3P6CA 4D6AA 3DTQA 3IA8A 4QGXA 5KIDA 4GRJA 2CZTA 2R73A 4K19A 3FYFA 2RCQA 4QAEA 1ALBA 3WYQA 1LIDA 4UU3A 3VG5A 1KZWA 1SWCA 2N93A 1VWDB 4XMGA 4FGIB 2FS7A 3D9WA 4YBUA 3ZW0A 4A60A 4DQ3A 2RN4A 1ACDA 1HXZA 2ZAGA 2OF9A 1E06A 3EYCA 3PQSA 4FBOA 1NDJA 1N4JA 3FLLA 3TGAA 5L8NA 1JZUA 1LDQA 1D2UA 1VYGA 1DZMA 1Y55X 1KGLA 4NLJA 3OD9A 4M6SA 1MX7A 4GETA 1R0UA 4MVEA 3RDOA 5LJCA 1NC9A 4IB9A 2CBSA 1MUPA 3FW4A 1FEMA 3P24A 2WQ9A 4NV8A 3S5VA 3L4RA 4OS3A 2IZLB 4XMEA 5H9NA 2RTPB 5B5GA 4XMCA 4MVIA 3UEWA 3BY0A 2BS5A 4ZFXA 4A1YA 5KHPA 2LB6A 3VE1A 1DF8A 3FW5A 1I05A 1CJ5A 5BVSA 5B11O 2QO5A 2AMMX 4YCEA 2OFBA 4INNA 4O3YA 4BGFA 3T6FA 3EBWA 1K24A 4YGZA 3UAQA 1DF3A 1Y53X 3X00A 4ZHFA 4GGZA 2DJFA 2NNDA 3AKMA 4OMXA 1RAVA 3P6EA 4O3ZA 2ALLX 3C78X 1SA8A 3RKGA 3B2IA 1LIBA 2MO5A 4OKAA 3FIDA 1NP4A 2Q4NA 1T8VA 5CHKA 1EIOA 4YH0A 3CMPA 4OMWA 3N91A 2FR2A 3ELZA 1A18A 1B4MA 1VWAB 1EI5A 1GKAA 3U03A 4ORWA 4BVMA 2W2FA 3SLTA 2AT5X 3SLOA 1VWPB 1VWHB 2IZAA 4GJSA 4O3XB 5B10O 1G5WA 1ZNDA 2Q9SA 4LQZA 3EMMA 4YCHA 4ZHGA 5K06A 1VWBB 2OY5O 1Y9LA 2RTLA 3P6FA 4ZJ0A 1UZ2X 1YP7A 1LDOA 1EQDA 1SWKA 3E3CA 3OBLA 3JQOA 1I78A 1VWIB 2RTNB 2AVIA 1X8QA 1GT3A 1RSUB 2WSJA 4Y0SA 2RTKA 4O4UA 2JMBA 4HFOA 1AVEA 4U9CA 3AKNA 4GK9A 1WBIA 2JU3A 3WVMA 3ZUIA 3ZW2A 4CPFA 4YBPA 4N7DA 1EUOA 3HPEA 3NPOA 2RD7C 1IW2A 2A3FX 3VE2A 3ZW0B 3P02A 4ARHA 4Z2PA 1B8EA 1IJ8A 1FELA 1AB0A 2HLVA 2OVAA 3VG6A 4Y0PA 3C77X 2FRSA 4IABA 3FENA 2G78A 2NP1A 1JBHA 1KT5A 1E5PA 2G7BA 2UZ2A 1PM1X 5HWZA 3KQ0A 4IB8A 5B29A 1TXLA 1VWKB 3FA6A 3FEKA 2WEXA 2OL7A 2Q39A 5B5FA 5HZ5A 5L3YA 3WJBA 4BX5A 4RUUA 4I9RA 1ERXA 3D97A 1HMTA 4O4OA 1JMZA 1STPA 1ZNHA 3CQRA 3Q6LA 4ZHDA 1BEBA 2AT6X 1SWUA 1DZPA 4YKOA 3WZOA 4GH7A 4CDDA 1BLRA 4NNSA 2A8GA 2QO6A 3PH5A 4I3CA 3RDXA 1OEEA 2IFBA 4D6BA 4IMNA 3HWGA 4ZH6A 1MX8A 2OYBO 1JMXA 3WYPA 4ZHCA 2AL0X 2Y32A 3ZW1A 1A57A 1OEJA 2G5LA 2GC9A 4MEEA 1K3BA 3HWEA 4PSQA 3I17A 2X32A 3EM0A 1Y0GA 2OFMX 4ZCBA 1HBPA 5L8OA 3D95A 4QGWA 1VYFA 1GKAB 1SWRA 2IZEB 2OZQA 2QOSC 3KFGA 1YUPA 2FHLA 2JN3A 4Y0RA 4AZPA 4NLIA 5FENA 5IRWA 2RTJA 2FS6A 3CQNA 1LF7A 3F8AA 4YDAA 3T2XA 3VG2A 4UU2A 1MK5A 4KH8A 1KQXA 1LCWA 2I5ZO 3FR5A 4KT5A 5AQ6A 5BVTA 2KD2A 5F6ZA 1N0SA 2G8CO 2Q2MA 1TOUA 4LZUA 4NYQA 2RTCB 1EALA 2OL6O 3FIQA 4TQ2A 4Z6JA 1X71A 3KFFA 1MVGA 3WOVA 1BJ7A 4AYHA 1BSQA 1MEPA 5EDBA 1SWEA 4O3WA 1OSPO 1YWBA 3FA9A 2RTHB 2OFRX 2RTMA 4EEJA 4WFVA
chains in the Genus database with same CATH topology
3C76X 2HYSA 2O62A 3CBCA 3RBYA 3B2LA 1LKEA 3VG4A 3TF6A 1GT4A 2QM9A 2LBVA 4BOEA 3S5XA 3B2HA 1G7NA 1BSYA 5DG4A 2XKLA 4A1HA 3P6DA 5IO7A 1S7DA 3VG7A 2OVSA 5CYBA 4AZNA 4DQ4A 3FR2A 1ICMA 1SMPI 2X8SA 4FQBB 5CE4A 3F6ZB 4ML7B 5HCEC 1DFVA 4HPBA 1GM6A 4CSBA 1GX9A 2YMSA 4ALOA 5H9AA 4O9SA 4GZVA 4M7MA 4IB6A 1KOIA 1X8PA 3NX2A 4ORXA 4WHIA 2ASNX 1BSOA 3NQ9A 1JJXA 3UEXA 2HZQA 2EU7X 2Z4HA 4ID2A 3SOTA 4IMOA 3ZW1B 3S60A 2JU8A 3HWFA 2OVDA 4XMHA 3APUA 1OPBA 3RWXA 1TW4A 1S2PA 4I3BA 2K23A 3PEDA 4NYRA 4YKMA 3APVA 2A13A 5LJHA 2W2BA 3VU1A 1HN2A 1OEKA 2R74A 5F6BA 1G85A 1YWAA 1IFBA 3VG3A 2A2GA 4MVLA 4I95A 3PPTA 4TKHA 1QABE 1LPJA 2KT4B 4ZH9A 4IAXA 4QZUA 5D48A 5D8JA 4HPAA 4KC7A 3HK1A 4ORRA 4XMFA 3STMX 4O4SA 5FQ7E 1QY1A 4QNIA 2ACPX 4HWMA 1QWDA 5H9KA 1U18A 3U9PC 4NP1A 1ZNKA 4QGVA 1YP6A 3FR4A 2QO4A 2L67A 1BM5A 4NNTA 3MBTA 1E00A 3JS1A 3KFHA 2X8FA 1E02A 2BLGA 2AH7X 3ZUOA 1OBUA 4MVKA 3IFBA 4U8UN 1U0XA 3FELA 3CWKA 4COTA 4TKBA 1QG5A 1ZRYA 1P6PA 3TZSA 1U17A 1HBQA 2LA7A 5HA1A 2X8TA 5HCCC 1QFVA 1EPBA 1X8OA 3CBSA 4TKJA 3WXQA 3BS2A 4AZRA 1LNMA 4GU8A 3I0AA 1SY3A 4XMDA 5B27A 2LKKA 2GTLN 3P6HA 4OS0A 5HTDA 4A8ZA 2OVEA 2WR6A 2WUTA 4GKCA 3JSQA 1DZJA 2LFOA 2GJ5A 3UEUA 1ERBA 3U0DA 2L5PA 1GXAA 4ZGFA 4ZHHA 1KT3A 3APXA 4R0BA 1B0OA 5LJEA 4HPDA 1SXUA 1QQSA 4ORSA 1DC9A 5H9LA 1SXXA 3MVFA 4IBAA 2GTFX 1LFOA 3NP1A 1I04A 2G79A 1LIEA 2WWPA 3APWA 4WFUA 4I6SA 3PECA 1FE3A 5LJKA 5F1EA 5AJBA 2AT3X 5D4AA 4AZOA 3FA8A 3NR3A 1NGLA 5LJBA 3G7XA 5HA0A 1JIWI 1UREA 1X8NA 3HTYA 5BYPA 2GTLO 3D96A 3P6GA 1CBQA 1AQBA 1QFTA 2KTDA 4QZTA 2KTSA 4ORYA 1FDQA 2AT8X 4YDBA 1FTPA 3O2YA 3K3LA 3DSZA 4CV7A 4YFQA 4ES7A 4EDEA 1PMPA 1A2DA 3BDRA 1QY2A 2HMBA 1O1UA 2NNQA 1JYJA 1BRQA 5EEEA 1ML7A 5FQ8E 4I9SA 4ALBA 3ZI8A 4KCAA 5EZ2A 2L9CA 4O4XA 2YG2A 1T0VA 4YMYA 4TLJA 3FEPA 2MWHA 1IFCA 1L6MA 1BWYA 2X46A 2JOZA 3SAOA 1EXSA 2HNXA 3D4RA 2FR3A 1OBPA 3HWDA 1Z24A 1GT1A 2CZUA 1YWDA 1KT6A 3FA7A 3S26A 5IO6A 1QY0A 3ZZVA 2DM5A 1RLBE 1O8VA 4YFPA 1TOWA 5HTEA 2KW1A 3UEVA 3WJCA 4AZMA 2ACOA 5LJGA 1DZKA 4GNYA 1SY0A 5D45A 1TVQA 4L1NA 3ELXA 5BVQA 3NADA 1BRPA 3CR6A 4MIRA 1OPAA 4JGLA 3BU1A 3WJGA 3O22A 1KZXA 3PP6A 1KT4A 4YFRA 2F73A 4IB7A 1I06A 1HMRA 5L8IA 1EIIA 2RCTA 4L3RA 4FBRA 1O1VA 4EFGA 4QRLA 3LHNA 2MM3A 3FMZA 1GX8A 2BT9A 5KICA 4MISA 2WEWA 4LKPA 3BSZE 4YGHA 1CRBA 1SXWA 3RSWA 1S44A 2FWVA 3WJDA 1ICNA 1KXOA 1JV4A 3STKA 1Y9TA 1XKIA 2BHVA 4ZR2A 4QQ1A 4FBVA 1SXYA 2MJIA 4I3DA 3BX8A 4OS8A 1IKJA 3ZQ3A 2MHDA 4ORUA 4KC8A 2AT0X 1LICA 3ZWEA 4AZQA 4ON1A 2FTBA 1PEEA 5FQ6E 2NNEA 3O19A 4GNWA 4NW4A 3STNA 1X8UA 5FFHA 2K62A 1YIVA 2L68A 1H91A 2HZRA 4N7CA 5LKEA 1PBOA 2A2UA 2CM9A 4LKTA 1LIFA 2JW1A 3WJEA 5D47A 1EW3A 3LV4A 5EDCA 1MDCA 3KZAA 4QYNA 2X45A 3QKGA 1ZNLA 2R56A 4CK4A 2LBAA 5HBSA 1A3YA 2CM4A 4HPCA 3V8UA 5HZ8A 2P8GA 1T68X 4ODDA 3HOLA 5HAEA 2A0AA 1G74A 1ZNGA 3GE2A 2ANSA 3OE3A 5AJCA 5DPQA 4LZVA 5LKFA 1ADLA 1GT5A 4EXZA 1X89A 3WJFA 3TGCA 1SY2A 4U8UO 3B2KA 4ZGUA 5IO5A 1AELA 4U8UM 2F09A 5C0NA 3NX1A 4EQAC 3BLGA 2BS6A 5LJDA 2XSTA 4GE1A 4RUNA 1HMSA 1AVGI 4QYPA 1VPRA 1JJJA 1SY1A 3B2JA 5AEOA 3EBKA 5JR8A 3GAQA 3WBGA 1I4UA 4KIIA 1IIUA 3NQKA 1YWCA 5HZ9A 4GDZA 2Q2PA 1GGLA 2WQAE 3BU9A 4U3QA 2GTLM 5H8TA 2FT9A 3PQUA 1EPAA 2Z4IA 4YGGA 5EPQA 5FAZA 5HZQA 3NQ3A 2FLJA 3NBXX 5HCDC 2AKQA 4AW8A 1FENA 2PY1A 3VPJE 1JYDA 1OBQA 1CBIA 2QMIA 5EEDA 3OJYC 2CBRA 1CBRA 1KQWA 3KFIA 3PH6A 3RZYA 2RQ0A 3BX7A 1RBPA 1KT7A 1CBSA 1XCAA 2JU7A 2W2AA 3BRNA 1DV9A 4WBKA 1HQPA 4IAWA 1BBPA 3MX7A 3H3IA 1ZNEA 4BQUA 2E4JA 5F58A 1B56A 1NP1A 4PJ2A 2POAA 1IKEA 3F9DA 5F7GA 4O49A 2M4LA 3T1DA 4Y0QA 4TNNA 1D3SA 4TJZA 2ZAIA 2RA6A 3HOEA 3P6CA 4D6AA 3DTQA 3IA8A 4QGXA 5KIDA 4GRJA 2CZTA 2R73A 4K19A 3FYFA 2RCQA 4QAEA 1ALBA 1KZWA 1LIDA 4UU3A 3VG5A 2N93A 4XMGA 4FGIB 2FS7A 4YBUA 3ZW0A 4A60A 4DQ3A 2RN4A 1ACDA 2ZAGA 3EYCA 4FBOA 1E06A 3PQSA 3FLLA 3TGAA 1JZUA 1VYGA 1D2UA 1DZMA 1KGLA 4NLJA 3OD9A 4M6SA 1MX7A 4GETA 1R0UA 4MVEA 5LJCA 4IB9A 3WVMA 2CBSA 1MUPA 3FW4A 1FEMA 3P24A 2WQ9A 3S5VA 5L8NA 3L4RA 4OS3A 4XMEA 5H9NA 4XMCA 4MVIA 3UEWA 3BY0A 2BS5A 4ZFXA 4A1YA 5KHPA 2LB6A 3VE1A 3FW5A 1CJ5A 1I05A 5BVSA 2QO5A 2AMMX 4YCEA 4INNA 4O3YA 3EBWA 3UAQA 4YGZA 1DF3A 4ZHFA 2NNDA 3AKMA 4OMXA 3P6EA 4O3ZA 2ALLX 3C78X 1SA8A 3RKGA 3B2IA 1LIBA 2MO5A 1NP4A 2Q4NA 1T8VA 1EIOA 4YH0A 3CMPA 4OMWA 3N91A 2FR2A 3ELZA 1A18A 1B4MA 3U03A 1EI5A 1GKAA 4ORWA 4BVMA 2W2FA 2AT5X 4O3XB 1G5WA 1ZNDA 2Q9SA 4LQZA 3EMMA 4YCHA 4ZHGA 5K06A 1Y9LA 3P6FA 4ZJ0A 1UZ2X 1YP7A 1EQDA 3E3CA 3OBLA 3JQOA 4Y0SA 2WSJA 1X8QA 1GT3A 4O4UA 2JMBA 4HFOA 4U9CA 3ZUIA 3AKNA 4GK9A 3TGBA 2JU3A 3ZW2A 4YBPA 4N7DA 1EUOA 3NPOA 2RD7C 1IW2A 2A3FX 3VE2A 3ZW0B 3P02A 4ARHA 1B8EA 1FELA 1AB0A 2HLVA 2OVAA 3VG6A 4Y0PA 3C77X 2FRSA 4IABA 3FENA 2G78A 2NP1A 1JBHA 1KT5A 1E5PA 2G7BA 5HWZA 1PM1X 3KQ0A 4IB8A 5B29A 1TXLA 3FA6A 3FEKA 2WEXA 2Q39A 5HZ5A 3WJBA 4RUUA 4I9RA 1ERXA 3D97A 1HMTA 4O4OA 1ZNHA 3CQRA 3Q6LA 4ZHDA 1BEBA 2AT6X 1DZPA 4YKOA 4GH7A 1BLRA 4NNSA 3PH5A 2QO6A 4I3CA 1OEEA 2IFBA 4D6BA 4IMNA 3HWGA 4ZH6A 1MX8A 4ZHCA 2AL0X 3ZW1A 1A57A 1OEJA 2GC9A 3HWEA 4PSQA 3I17A 5L8OA 3EM0A 4ZCBA 2OFMX 1HBPA 3D95A 4QGWA 1VYFA 1GKAB 2OZQA 2QOSC 3KFGA 4Y0RA 5HZ6A 1YUPA 2JN3A 4AZPA 5FENA 4NLIA 2FS6A 3CQNA 1LF7A 3F8AA 4YDAA 3VG2A 4UU2A 4KH8A 5AQ6A 1KQXA 4KT5A 3FR5A 5BVTA 2KD2A 5F6ZA 1N0SA 4LZUA 2Q2MA 1TOUA 4NYQA 1EALA 3FIQA 4TQ2A 1X71A 3KFFA 1MVGA 3WOVA 1BJ7A 4AYHA 1BSQA 5EDBA 4O3WA 1YWBA 3FA9A 2OFRX 4EEJA 4WFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C76 X;  2HYS A;  2O62 A;  3CBC A;  3B2L A;  1LKE A;  3VG4 A;  3TF6 A;  1GT4 A;  2QM9 A;  2LBV A;  4BOE A;  3B2H A;  1G7N A;  1BSY A;  5DG4 A;  2XKL A;  4A1H A;  3P6D A;  5IO7 A;  1S7D A;  3VG7 A;  4AZN A;  4DQ4 A;  3FR2 A;  1ICM A;  5CE4 A;  5HCE C;  1DFV A;  4HPB A;  1GM6 A;  1GX9 A;  4ALO A;  5H9A A;  4O9S A;  4M7M A;  4IB6 A;  1KOI A;  1X8P A;  3NX2 A;  4ORX A;  2ASN X;  1BSO A;  3NQ9 A;  1JJX A;  3UEX A;  2HZQ A;  2EU7 X;  4IMO A;  2JU8 A;  3HWF A;  2OVD A;  4XMH A;  3APU A;  1OPB A;  1TW4 A;  1S2P A;  4I3B A;  2K23 A;  3PED A;  4NYR A;  4YKM A;  3APV A;  2A13 A;  5LJH A;  2W2B A;  1HN2 A;  1OEK A;  2R74 A;  5F6B A;  1G85 A;  1YWA A;  1IFB A;  3VG3 A;  2A2G A;  4MVL A;  3PPT A;  4TKH A;  1QAB E;  1LPJ A;  2KT4 B;  4ZH9 A;  4IAX A;  4QZU A;  5D48 A;  5D8J A;  4HPA A;  3HK1 A;  4ORR A;  4XMF A;  3STM X;  1QY1 A;  2ACP X;  1QWD A;  5H9K A;  1U18 A;  3U9P C;  4NP1 A;  1ZNK A;  4QGV A;  1YP6 A;  3FR4 A;  2QO4 A;  2L67 A;  1BM5 A;  4NNT A;  3MBT A;  1E00 A;  3JS1 A;  3KFH A;  1E02 A;  2BLG A;  2AH7 X;  3ZUO A;  1OBU A;  4MVK A;  3IFB A;  1U0X A;  3FEL A;  3CWK A;  4TKB A;  1QG5 A;  1ZRY A;  1P6P A;  3TZS A;  1U17 A;  1HBQ A;  5HA1 A;  5HCC C;  1QFV A;  1EPB A;  1X8O A;  3CBS A;  4TKJ A;  3WXQ A;  3BS2 A;  4AZR A;  1LNM A;  3I0A A;  1SY3 A;  4XMD A;  5B27 A;  2LKK A;  3P6H A;  4OS0 A;  5HTD A;  4A8Z A;  2OVE A;  2WR6 A;  2WUT A;  4GKC A;  3JSQ A;  1DZJ A;  2LFO A;  2GJ5 A;  3UEU A;  1ERB A;  3U0D A;  2L5P A;  1GXA A;  4ZHH A;  1KT3 A;  3APX A;  4R0B A;  1B0O A;  5LJE A;  4HPD A;  1SXU A;  1QQS A;  4ORS A;  1DC9 A;  5H9L A;  1SXX A;  3MVF A;  4IBA A;  2GTF X;  1LFO A;  3NP1 A;  1I04 A;  2G79 A;  1LIE A;  2WWP A;  3APW A;  4WFU A;  3PEC A;  1FE3 A;  5LJK A;  5F1E A;  5D4A A;  2AT3 X;  4AZO A;  3FA8 A;  3NR3 A;  1NGL A;  5LJB A;  3G7X A;  5HA0 A;  1URE A;  1X8N A;  3D96 A;  3P6G A;  1CBQ A;  1AQB A;  1QFT A;  2KTD A;  4QZT A;  4ORY A;  1FDQ A;  2AT8 X;  4YDB A;  1FTP A;  3O2Y A;  3K3L A;  3DSZ A;  4YFQ A;  4ES7 A;  4EDE A;  1PMP A;  1A2D A;  3BDR A;  1QY2 A;  2HMB A;  1O1U A;  2NNQ A;  1JYJ A;  1BRQ A;  5EEE A;  1ML7 A;  4I9S A;  4ALB A;  5EZ2 A;  2L9C A;  2YG2 A;  1T0V A;  4YMY A;  4TLJ A;  3FEP A;  1IFC A;  1L6M A;  1BWY A;  2X46 A;  2JOZ A;  3SAO A;  1EXS A;  2HNX A;  2FR3 A;  1OBP A;  3HWD A;  1Z24 A;  1GT1 A;  2CZU A;  1YWD A;  1KT6 A;  3FA7 A;  3S26 A;  5IO6 A;  1QY0 A;  2DM5 A;  1RLB E;  1O8V A;  4YFP A;  1TOW A;  5HTE A;  3UEV A;  3WJC A;  4AZM A;  2ACO A;  5LJG A;  1DZK A;  4GNY A;  1SY0 A;  5D45 A;  1TVQ A;  3ELX A;  5BVQ A;  3NAD A;  1BRP A;  3CR6 A;  1OPA A;  3BU1 A;  3WJG A;  3O22 A;  1KZX A;  3PP6 A;  1KT4 A;  4YFR A;  2F73 A;  4IB7 A;  1I06 A;  1HMR A;  5L8I A;  1EII A;  2RCT A;  1O1V A;  4EFG A;  2MM3 A;  3FMZ A;  1GX8 A;  5KIC A;  2WEW A;  4LKP A;  3BSZ E;  4YGH A;  1CRB A;  1SXW A;  3RSW A;  1S44 A;  2FWV A;  3WJD A;  1ICN A;  1KXO A;  1JV4 A;  3STK A;  1XKI A;  4ZR2 A;  1SXY A;  2MJI A;  4I3D A;  3BX8 A;  4OS8 A;  1IKJ A;  3ZQ3 A;  4ORU A;  2AT0 X;  1LIC A;  4AZQ A;  2FTB A;  1PEE A;  2NNE A;  3O19 A;  4GNW A;  3STN A;  1X8U A;  5FFH A;  2K62 A;  1YIV A;  2L68 A;  1H91 A;  2HZR A;  4N7C A;  5LKE A;  1PBO A;  2A2U A;  2CM9 A;  4LKT A;  1LIF A;  3WJE A;  5D47 A;  1EW3 A;  5EDC A;  1MDC A;  3KZA A;  4QYN A;  2X45 A;  3QKG A;  1ZNL A;  2R56 A;  4CK4 A;  2LBA A;  5HBS A;  1A3Y A;  2CM4 A;  4HPC A;  5HZ8 A;  2P8G A;  1T68 X;  4ODD A;  5HAE A;  2A0A A;  1G74 A;  1ZNG A;  2ANS A;  5DPQ A;  4LZV A;  5LKF A;  1ADL A;  1GT5 A;  4EXZ A;  1X89 A;  3WJF A;  3TGC A;  1SY2 A;  4ZGU A;  3B2K A;  5IO5 A;  1AEL A;  5C0N A;  3NX1 A;  3BLG A;  5LJD A;  2XST A;  4GE1 A;  4RUN A;  1HMS A;  1AVG I;  4QYP A;  1VPR A;  1JJJ A;  1SY1 A;  3B2J A;  3EBK A;  5JR8 A;  3GAQ A;  3WBG A;  1I4U A;  4KII A;  1IIU A;  1YWC A;  5HZ9 A;  2Q2P A;  1GGL A;  2WQA E;  3BU9 A;  5H8T A;  2FT9 A;  1EPA A;  4YGG A;  5EPQ A;  5FAZ A;  5HZQ A;  3NQ3 A;  2FLJ A;  5HCD C;  2AKQ A;  4AW8 A;  1FEN A;  2PY1 A;  1JYD A;  1OBQ A;  1CBI A;  5EED A;  3OJY C;  2CBR A;  1CBR A;  1KQW A;  3KFI A;  3PH6 A;  3RZY A;  2RQ0 A;  3BX7 A;  1RBP A;  1KT7 A;  1CBS A;  1XCA A;  2JU7 A;  2W2A A;  3BRN A;  1DV9 A;  4WBK A;  1HQP A;  4IAW A;  1BBP A;  1ZNE A;  4BQU A;  2E4J A;  5F58 A;  1B56 A;  1NP1 A;  2POA A;  1IKE A;  3F9D A;  5F7G A;  3T1D A;  4Y0Q A;  4TNN A;  1D3S A;  4TJZ A;  2RA6 A;  3P6C A;  4D6A A;  3DTQ A;  3IA8 A;  4QGX A;  5KID A;  4GRJ A;  2CZT A;  2R73 A;  4K19 A;  4QAE A;  2RCQ A;  1KZW A;  1ALB A;  1LID A;  4UU3 A;  3VG5 A;  2N93 A;  4XMG A;  4YBU A;  2FS7 A;  4A60 A;  4DQ3 A;  1ACD A;  3EYC A;  1E06 A;  3FLL A;  3TGA A;  1JZU A;  1VYG A;  1D2U A;  1DZM A;  1KGL A;  4NLJ A;  4M6S A;  1MX7 A;  4GET A;  1R0U A;  5LJC A;  4IB9 A;  3WVM A;  2CBS A;  1MUP A;  3FW4 A;  1FEM A;  5L8N A;  2WQ9 A;  3L4R A;  4OS3 A;  4XME A;  5H9N A;  4XMC A;  4MVI A;  3UEW A;  3BY0 A;  4ZFX A;  5KHP A;  4A1Y A;  2LB6 A;  3FW5 A;  1CJ5 A;  1I05 A;  5BVS A;  2QO5 A;  2AMM X;  4YCE A;  3EBW A;  4YGZ A;  1DF3 A;  4ZHF A;  2NND A;  3AKM A;  4OMX A;  3P6E A;  2ALL X;  3C78 X;  1SA8 A;  3B2I A;  1LIB A;  2MO5 A;  1NP4 A;  2Q4N A;  1T8V A;  1EIO A;  4YH0 A;  3CMP A;  4OMW A;  2FR2 A;  3ELZ A;  1A18 A;  1B4M A;  3U03 A;  1GKA A;  4ORW A;  4BVM A;  2W2F A;  2AT5 X;  1G5W A;  1ZND A;  2Q9S A;  4YCH A;  3EMM A;  4ZHG A;  5K06 A;  3P6F A;  4ZJ0 A;  1UZ2 X;  1YP7 A;  1EQD A;  4Y0S A;  2WSJ A;  1X8Q A;  1GT3 A;  4HFO A;  3TGB A;  3ZUI A;  3AKN A;  2JU3 A;  4YBP A;  4N7D A;  1EUO A;  3NPO A;  2RD7 C;  1IW2 A;  2A3F X;  4ARH A;  1B8E A;  1FEL A;  1AB0 A;  2HLV A;  2OVA A;  3VG6 A;  4Y0P A;  3C77 X;  2FRS A;  3FEN A;  2G78 A;  2NP1 A;  1JBH A;  1KT5 A;  1E5P A;  2G7B A;  5HWZ A;  1PM1 X;  3KQ0 A;  4IB8 A;  5B29 A;  1TXL A;  3FA6 A;  3FEK A;  2WEX A;  2Q39 A;  5HZ5 A;  3WJB A;  4RUU A;  4I9R A;  1ERX A;  3D97 A;  1HMT A;  1ZNH A;  3CQR A;  3Q6L A;  4ZHD A;  1BEB A;  2AT6 X;  1DZP A;  4YKO A;  4GH7 A;  1BLR A;  4NNS A;  3PH5 A;  2QO6 A;  4I3C A;  1OEE A;  2IFB A;  4D6B A;  4IMN A;  3HWG A;  4ZH6 A;  1MX8 A;  4ZHC A;  2AL0 X;  1A57 A;  1OEJ A;  2GC9 A;  3HWE A;  4PSQ A;  3I17 A;  5L8O A;  3EM0 A;  4ZCB A;  2OFM X;  1HBP A;  3D95 A;  4QGW A;  1VYF A;  1GKA B;  2OZQ A;  2QOS C;  3KFG A;  4Y0R A;  5HZ6 A;  1YUP A;  2JN3 A;  4AZP A;  5FEN A;  4NLI A;  2FS6 A;  3CQN A;  1LF7 A;  3F8A A;  4YDA A;  3VG2 A;  4UU2 A;  5AQ6 A;  1KQX A;  5BVT A;  3FR5 A;  5F6Z A;  1N0S A;  4LZU A;  2Q2M A;  1TOU A;  4NYQ A;  1EAL A;  3FIQ A;  4TQ2 A;  1X71 A;  3KFF A;  1MVG A;  1BJ7 A;  4AYH A;  1BSQ A;  5EDB A;  1YWB A;  3FA9 A;  2OFR X;  4EEJ A;  4WFV A; 
#chains in the Genus database with same CATH topology
 3C76 X;  2HYS A;  2O62 A;  3CBC A;  3RBY A;  3B2L A;  1N43 A;  1LKE A;  3VG4 A;  2IZK A;  3TF6 A;  1GT4 A;  2QM9 A;  1LEL A;  2AF5 A;  2LBV A;  1LUQ A;  3S5X A;  4BOE A;  3B2H A;  1G7N A;  1BSY A;  4JO6 A;  5DG4 A;  3VGW A;  2XKL A;  4BBO A;  4A1H A;  2QOM A;  3P6D A;  5IO7 A;  1S7D A;  3VG7 A;  2OVS A;  5CYB A;  4AZN A;  4DQ4 A;  3FR2 A;  1ICM A;  1SMP I;  3T6L A;  2X8S A;  4FQB B;  4OEL A;  5CE4 A;  1HXL A;  3F6Z B;  4ML7 B;  5HCE C;  1DFV A;  4HPB A;  4BX5 B;  1GM6 A;  4CSB A;  1GX9 A;  2YMS A;  4ALO A;  1LCV A;  5H9A A;  4O9S A;  1KFF A;  4GZV A;  4M7M A;  4IB6 A;  1SWF A;  1KOI A;  5JD2 A;  1X8P A;  3NX2 A;  4ORX A;  4WHI A;  2ASN X;  1BSO A;  3NQ9 A;  3SZH A;  1JJX A;  2CAM A;  3RE6 A;  3UEX A;  2HZQ A;  2EU7 X;  2Z4H A;  3KVN A;  3LTW A;  3Q34 A;  4ID2 A;  3SOT A;  4IMO A;  3ZW1 B;  3S60 A;  2JU8 A;  1I9H A;  2OVD A;  3HWF A;  4XMH A;  3APU A;  2RTR B;  1OPB A;  3RWX A;  1TW4 A;  1S2P A;  1NQM A;  4GUZ A;  4I3B A;  1SRJ A;  1VWG B;  2IZH B;  2K23 A;  3PDF A;  3PED A;  3APV A;  2A13 A;  4NYR A;  4YKM A;  3RDU A;  2RTQ B;  2W2B A;  1SWA A;  3VU1 A;  1Y52 X;  1MM9 A;  1AVD A;  1HN2 A;  3FDC A;  1OEK A;  2R74 A;  3EW1 A;  5F6B A;  1G85 A;  1YWA A;  1IFB A;  3VG3 A;  2A2G A;  1GX3 A;  4MVL A;  4I95 A;  1SWO A;  3PPT A;  4TKH A;  1STS B;  1QAB E;  1LPJ A;  2KT4 B;  4ZH9 A;  4IAX A;  4QZU A;  5D48 A;  1SRH A;  5D8J A;  4HPA A;  4KC7 A;  3HK1 A;  2C1S A;  4ORR A;  4XMF A;  3STM X;  4O4S A;  5FQ7 E;  1QY1 A;  1WUB A;  4QNI A;  2ACP X;  4HWM A;  1QWD A;  5H9K A;  1U18 A;  2I5V O;  3U9P C;  2X4M A;  4NP1 A;  1SWL A;  1ZNK A;  4QGV A;  1YP6 A;  3FR4 A;  2QO4 A;  2L67 A;  1BM5 A;  4NNT A;  2UYW A;  3MBT A;  1E00 A;  4OEM A;  3JS1 A;  3KFH A;  1SRG A;  2X8F A;  1E02 A;  1SWS A;  2BLG A;  2AH7 X;  3ZUO A;  1SWJ A;  1OBU A;  4MVK A;  3IFB A;  4U8U N;  1U0X A;  3FEL A;  3CWK A;  4COT A;  4TKB A;  1VWO B;  4NV7 A;  1QG5 A;  1ZRY A;  1P6P A;  3TZS A;  1U17 A;  1HBQ A;  1RXH A;  2LA7 A;  4U46 A;  2X8T A;  5HA1 A;  5HCC C;  4CPH A;  1QFV A;  1EPB A;  1X8O A;  3CBS A;  4TKJ A;  3VHI A;  3WXQ A;  3AUM O;  3BS2 A;  1HY2 A;  4AZR A;  1LNM A;  4GU8 A;  3I0A A;  3WZN A;  4CPE A;  1SRE A;  1SY3 A;  1RXJ A;  4XMD A;  4BX6 B;  1JJU A;  5B27 A;  2IZG B;  2LKK A;  2GTL N;  2VFB A;  3P6H A;  4OS0 A;  5HTD A;  4A8Z A;  1VWQ B;  2OVE A;  2WR6 A;  2WUT A;  4YVB A;  4GGT A;  4GKC A;  3JSQ A;  1DZJ A;  4DCB A;  2LFO A;  4I60 A;  2GJ5 A;  4BX7 A;  3UEU A;  1NQN A;  1ERB A;  3VHH A;  4B55 A;  3U0D A;  2L5P A;  1GXA A;  3VHM A;  4ZGF A;  4ZHH A;  1KT3 A;  3APX A;  2ZSC A;  4R0B A;  1B0O A;  5LJE A;  4HPD A;  1SLG B;  1QQS A;  1SXU A;  2WPU A;  1W5R A;  4ORS A;  1DC9 A;  5H9L A;  1STR B;  1SXX A;  3MVF A;  4IBA A;  2GTF X;  1LFO A;  3NP1 A;  1I04 A;  2G79 A;  1VWM B;  1LIE A;  2IZD B;  2RTI B;  1E2T A;  2WWP A;  2Y3E A;  3APW A;  4I6S A;  4WFU A;  3PEC A;  5IXG A;  1FE3 A;  5LJK A;  1VWL B;  5F1E A;  5AJB A;  2AT3 X;  5D4A A;  3SZI A;  3T2W A;  3FA8 A;  4AZO A;  2FGS A;  3NR3 A;  1NGL A;  5LJB A;  1UYN X;  3G7X A;  5HA0 A;  1JIW I;  1URE A;  1X8N A;  3HTY A;  5BYP A;  2GTL O;  3D96 A;  3P6G A;  1CBQ A;  1AQB A;  1QFT A;  1SWD A;  2KTD A;  4QZT A;  2KTS A;  4ORY A;  3MG5 A;  1FDQ A;  2AT8 X;  4Y5D A;  4YDB A;  1FTP A;  1VWC B;  1VWR B;  3O2Y A;  3K3L A;  3DSZ A;  2OY8 A;  1PBY A;  2RTE B;  4CV7 A;  3TGB A;  1W4T A;  2PI3 O;  4YFQ A;  4ES7 A;  4EDE A;  1PMP A;  1A2D A;  3BDR A;  1QY2 A;  2HMB A;  1O1U A;  2NNQ A;  1SRI A;  2F01 A;  2FKJ A;  1JYJ A;  4EKV A;  1KL3 A;  1BRQ A;  1SLE B;  5EEE A;  1ML7 A;  5FQ8 E;  3MM0 A;  4I9S A;  4ALB A;  4CPH B;  1MOY A;  4KCA A;  5EZ2 A;  2L9C A;  4O4X A;  3ZI8 A;  2YG2 A;  4Z28 A;  4Y59 A;  1T0V A;  2OY1 O;  4YMY A;  4TLJ A;  3FEP A;  2MWH A;  4GD9 A;  1IFC A;  1L6M A;  1BWY A;  5B2A O;  2X46 A;  5LJH A;  2JOZ A;  1VWE B;  3SAO A;  3SZJ A;  1EXS A;  1W6F A;  2HNX A;  1NBX A;  2FR3 A;  3D4R A;  1VWN B;  1OBP A;  3HWD A;  1Z24 A;  1GT1 A;  4BX7 B;  2CZU A;  1YWD A;  1KT6 A;  3FA7 A;  3S26 A;  3RY1 A;  1QY0 A;  3ZZV A;  5IO6 A;  2DM5 A;  3RY2 A;  2QCB A;  1RLB E;  1O8V A;  4YFP A;  4BX6 A;  1TOW A;  3PK2 A;  2RTF B;  5HTE A;  4JHQ A;  3RDS A;  2KW1 A;  3UEV A;  3WJC A;  4AZM A;  2ACO A;  5LJG A;  1DZK A;  4GNY A;  1SY0 A;  5D45 A;  4BJ8 A;  1TVQ A;  4L1N A;  3ELX A;  5BVQ A;  3NAD A;  1BRP A;  3CR6 A;  4MIR A;  3SLJ A;  1OPA A;  2IZB A;  4JGL A;  1UYO X;  3BU1 A;  5IRU A;  3WJG A;  3O22 A;  1KZX A;  3PP6 A;  2OL8 O;  3EC5 A;  1KT4 A;  4YFR A;  2F73 A;  4IB7 A;  2HKD A;  1I06 A;  3WZQ A;  1HMR A;  1N9Y A;  5L8I A;  1EII A;  2RCT A;  4L3R A;  4FBR A;  1O1V A;  4EFG A;  4QRL A;  3LHN A;  2MM3 A;  1VYO A;  3FMZ A;  1GX8 A;  2BT9 A;  4C5P A;  5KIC A;  4MIS A;  2WEW A;  4LKP A;  3BSZ E;  4YGH A;  1CRB A;  1VWF B;  1SXW A;  3RSW A;  1S44 A;  2FWV A;  1FJ1 E;  1HQQ A;  4JNJ A;  3WJD A;  2RTD B;  1ICN A;  3QQ2 A;  1SWN A;  1KXO A;  1JV4 A;  4GGR A;  5CSE A;  1Y9T A;  1JQP A;  1XKI A;  2BHV A;  3STK A;  1SWG A;  4QQ1 A;  4ZR2 A;  5F2B A;  4FBV A;  1SXY A;  2MJI A;  4I3D A;  3BX8 A;  4OS8 A;  5K67 A;  4DNE A;  1LCZ A;  1IKJ A;  2BC3 A;  1N7Y A;  2MHD A;  4ORU A;  4KC8 A;  3ZQ3 A;  1SWH A;  1PTS A;  2AT0 X;  1LIC A;  3RDM A;  4CPI A;  3ZWE A;  4AZQ A;  2FKG A;  4ON1 A;  2FTB A;  1PEE A;  5FQ6 E;  2NNE A;  3O19 A;  4GDA A;  4GNW A;  4NW4 A;  3STN A;  1X8U A;  5FFH A;  2OY7 A;  4Z2V A;  1SRF A;  1YIV A;  1H91 A;  2HZR A;  2JGS A;  2K62 A;  2L68 A;  4N7C A;  5LKE A;  1PBO A;  2A2U A;  2CM9 A;  4LKT A;  1LIF A;  2JW1 A;  3WJE A;  5D47 A;  1EW3 A;  3LV4 A;  5EDC A;  1MDC A;  3KZA A;  3CKF A;  2X55 A;  4QYN A;  2X45 A;  2RTG B;  3QKG A;  1ZNL A;  2R56 A;  4CK4 A;  2LBA A;  5HBS A;  1RST B;  1A3Y A;  2CM4 A;  3EW2 A;  1SWQ A;  3AEH A;  4HPC A;  3V8U A;  1RXK A;  5HZ8 A;  1KL4 A;  5HZ6 A;  2IZC B;  2P8G A;  1T68 X;  4ODD A;  3HOL A;  5HAE A;  2A0A A;  1G74 A;  1ZNG A;  2IZJ A;  3GE2 A;  2ANS A;  3OE3 A;  5AJC A;  5DPQ A;  4LZV A;  5LKF A;  1ADL A;  1GT5 A;  4EXZ A;  1X89 A;  3WJF A;  4Z2O A;  3TGC A;  1SY2 A;  4U8U O;  3B2K A;  4ZGU A;  5IO5 A;  1AEL A;  2A5C A;  4U8U M;  2F09 A;  5C0N A;  3NX1 A;  1SWT A;  4EQA C;  3BLG A;  2BS6 A;  5LJD A;  2XST A;  2A5B A;  2C1Q A;  1SWB A;  4GE1 A;  4RUN A;  1HMS A;  1AVG I;  2X34 A;  4QYP A;  1VPR A;  1JJJ A;  4Z27 A;  1SY1 A;  3B2J A;  5AEO A;  3EBK A;  2OF8 A;  5JR8 A;  2MF6 A;  2VFC A;  3GAQ A;  3WBG A;  1I4U A;  4KII A;  1IIU A;  3NQK A;  1YWC A;  5HZ9 A;  4GDZ A;  2Q2P A;  1GGL A;  2X56 A;  2WQA E;  3BU9 A;  2DJG A;  3CKG A;  2GTL M;  4U3Q A;  2IZI A;  5H8T A;  2FT9 A;  3PQU A;  1EPA A;  2Z4I A;  4YGG A;  5EPQ A;  2IZF B;  5FAZ A;  2RTB B;  5B3M O;  2FHN X;  3NQ3 A;  5HZQ A;  5IRA A;  2FLJ A;  3NBX X;  5HCD C;  2AKQ A;  3RDQ A;  4AW8 A;  1FEN A;  2PY1 A;  3VPJ E;  1JYD A;  1OBQ A;  5K68 A;  1CBI A;  4CDE A;  2QMI A;  5EED A;  3OJY C;  1KL5 A;  2BSZ A;  4IRW A;  2CBR A;  2RTO B;  3WZP A;  1CBR A;  1KQW A;  3KFI A;  3PH6 A;  3RZY A;  2RQ0 A;  3BX7 A;  1RBP A;  1KT7 A;  1CBS A;  1XCA A;  1SLD B;  2JU7 A;  2OFA A;  2W2A A;  3BRN A;  1DV9 A;  4WBK A;  1HQP A;  4IAW A;  2RTA A;  1BBP A;  3MX7 A;  3H3I A;  1SLF B;  2Y3F A;  4CDC A;  1ZNE A;  4BQU A;  1VWJ B;  2E4J A;  5F58 A;  1B56 A;  2VDF A;  2C4I A;  1NP1 A;  3RE5 A;  4PJ2 A;  2POA A;  1IKE A;  1N9M A;  3F9D A;  5F7G A;  4O49 A;  2M4L A;  4CDF A;  1SWP A;  4BCS A;  3T1D A;  4Y0Q A;  4TNN A;  1D3S A;  4TJZ A;  2ZAI A;  2GH7 A;  2RA6 A;  4GJV A;  3HOE A;  3P6C A;  4D6A A;  3DTQ A;  3IA8 A;  4QGX A;  5KID A;  4GRJ A;  2CZT A;  2R73 A;  4K19 A;  3FYF A;  2RCQ A;  4QAE A;  1ALB A;  3WYQ A;  1LID A;  4UU3 A;  3VG5 A;  1KZW A;  1SWC A;  2N93 A;  1VWD B;  4XMG A;  4FGI B;  2FS7 A;  3D9W A;  4YBU A;  3ZW0 A;  4A60 A;  4DQ3 A;  2RN4 A;  1ACD A;  1HXZ A;  2ZAG A;  2OF9 A;  1E06 A;  3EYC A;  3PQS A;  4FBO A;  1NDJ A;  1N4J A;  3FLL A;  3TGA A;  5L8N A;  1JZU A;  1LDQ A;  1D2U A;  1VYG A;  1DZM A;  1Y55 X;  1KGL A;  4NLJ A;  3OD9 A;  4M6S A;  1MX7 A;  4GET A;  1R0U A;  4MVE A;  3RDO A;  5LJC A;  1NC9 A;  4IB9 A;  2CBS A;  1MUP A;  3FW4 A;  1FEM A;  3P24 A;  2WQ9 A;  4NV8 A;  3S5V A;  3L4R A;  4OS3 A;  2IZL B;  4XME A;  5H9N A;  2RTP B;  5B5G A;  4XMC A;  4MVI A;  3UEW A;  3BY0 A;  2BS5 A;  4ZFX A;  4A1Y A;  5KHP A;  2LB6 A;  3VE1 A;  1DF8 A;  3FW5 A;  1I05 A;  1CJ5 A;  5BVS A;  5B11 O;  2QO5 A;  2AMM X;  4YCE A;  2OFB A;  4INN A;  4O3Y A;  4BGF A;  3T6F A;  3EBW A;  1K24 A;  4YGZ A;  3UAQ A;  1DF3 A;  1Y53 X;  3X00 A;  4ZHF A;  4GGZ A;  2DJF A;  2NND A;  3AKM A;  4OMX A;  1RAV A;  3P6E A;  4O3Z A;  2ALL X;  3C78 X;  1SA8 A;  3RKG A;  3B2I A;  1LIB A;  2MO5 A;  4OKA A;  3FID A;  1NP4 A;  2Q4N A;  1T8V A;  5CHK A;  1EIO A;  4YH0 A;  3CMP A;  4OMW A;  3N91 A;  2FR2 A;  3ELZ A;  1A18 A;  1B4M A;  1VWA B;  1EI5 A;  1GKA A;  3U03 A;  4ORW A;  4BVM A;  2W2F A;  3SLT A;  2AT5 X;  3SLO A;  1VWP B;  1VWH B;  2IZA A;  4GJS A;  4O3X B;  5B10 O;  1G5W A;  1ZND A;  2Q9S A;  4LQZ A;  3EMM A;  4YCH A;  4ZHG A;  5K06 A;  1VWB B;  2OY5 O;  1Y9L A;  2RTL A;  3P6F A;  4ZJ0 A;  1UZ2 X;  1YP7 A;  1LDO A;  1EQD A;  1SWK A;  3E3C A;  3OBL A;  3JQO A;  1I78 A;  1VWI B;  2RTN B;  2AVI A;  1X8Q A;  1GT3 A;  1RSU B;  2WSJ A;  4Y0S A;  2RTK A;  4O4U A;  2JMB A;  4HFO A;  1AVE A;  4U9C A;  3AKN A;  4GK9 A;  1WBI A;  2JU3 A;  3WVM A;  3ZUI A;  3ZW2 A;  4CPF A;  4YBP A;  4N7D A;  1EUO A;  3HPE A;  3NPO A;  2RD7 C;  1IW2 A;  2A3F X;  3VE2 A;  3ZW0 B;  3P02 A;  4ARH A;  4Z2P A;  1B8E A;  1IJ8 A;  1FEL A;  1AB0 A;  2HLV A;  2OVA A;  3VG6 A;  4Y0P A;  3C77 X;  2FRS A;  4IAB A;  3FEN A;  2G78 A;  2NP1 A;  1JBH A;  1KT5 A;  1E5P A;  2G7B A;  2UZ2 A;  1PM1 X;  5HWZ A;  3KQ0 A;  4IB8 A;  5B29 A;  1TXL A;  1VWK B;  3FA6 A;  3FEK A;  2WEX A;  2OL7 A;  2Q39 A;  5B5F A;  5HZ5 A;  5L3Y A;  3WJB A;  4BX5 A;  4RUU A;  4I9R A;  1ERX A;  3D97 A;  1HMT A;  4O4O A;  1JMZ A;  1STP A;  1ZNH A;  3CQR A;  3Q6L A;  4ZHD A;  1BEB A;  2AT6 X;  1SWU A;  1DZP A;  4YKO A;  3WZO A;  4GH7 A;  4CDD A;  1BLR A;  4NNS A;  2A8G A;  2QO6 A;  3PH5 A;  4I3C A;  3RDX A;  1OEE A;  2IFB A;  4D6B A;  4IMN A;  3HWG A;  4ZH6 A;  1MX8 A;  2OYB O;  1JMX A;  3WYP A;  4ZHC A;  2AL0 X;  2Y32 A;  3ZW1 A;  1A57 A;  1OEJ A;  2G5L A;  2GC9 A;  4MEE A;  1K3B A;  3HWE A;  4PSQ A;  3I17 A;  2X32 A;  3EM0 A;  1Y0G A;  2OFM X;  4ZCB A;  1HBP A;  5L8O A;  3D95 A;  4QGW A;  1VYF A;  1GKA B;  1SWR A;  2IZE B;  2OZQ A;  2QOS C;  3KFG A;  1YUP A;  2FHL A;  2JN3 A;  4Y0R A;  4AZP A;  4NLI A;  5FEN A;  5IRW A;  2RTJ A;  2FS6 A;  3CQN A;  1LF7 A;  3F8A A;  4YDA A;  3T2X A;  3VG2 A;  4UU2 A;  1MK5 A;  4KH8 A;  1KQX A;  1LCW A;  2I5Z O;  3FR5 A;  4KT5 A;  5AQ6 A;  5BVT A;  2KD2 A;  5F6Z A;  1N0S A;  2G8C O;  2Q2M A;  1TOU A;  4LZU A;  4NYQ A;  2RTC B;  1EAL A;  2OL6 O;  3FIQ A;  4TQ2 A;  4Z6J A;  1X71 A;  3KFF A;  1MVG A;  3WOV A;  1BJ7 A;  4AYH A;  1BSQ A;  1MEP A;  5EDB A;  1SWE A;  4O3W A;  1OSP O;  1YWB A;  3FA9 A;  2RTH B;  2OFR X;  2RTM A;  4EEJ A;  4WFV A; 
#chains in the Genus database with same CATH homology
 3C76 X;  2HYS A;  2O62 A;  3CBC A;  3RBY A;  3B2L A;  1LKE A;  3VG4 A;  3TF6 A;  1GT4 A;  2QM9 A;  2LBV A;  4BOE A;  3S5X A;  3B2H A;  1G7N A;  1BSY A;  5DG4 A;  2XKL A;  4A1H A;  3P6D A;  5IO7 A;  1S7D A;  3VG7 A;  2OVS A;  5CYB A;  4AZN A;  4DQ4 A;  3FR2 A;  1ICM A;  1SMP I;  2X8S A;  4FQB B;  5CE4 A;  3F6Z B;  4ML7 B;  5HCE C;  1DFV A;  4HPB A;  1GM6 A;  4CSB A;  1GX9 A;  2YMS A;  4ALO A;  5H9A A;  4O9S A;  4GZV A;  4M7M A;  4IB6 A;  1KOI A;  1X8P A;  3NX2 A;  4ORX A;  4WHI A;  2ASN X;  1BSO A;  3NQ9 A;  1JJX A;  3UEX A;  2HZQ A;  2EU7 X;  2Z4H A;  4ID2 A;  3SOT A;  4IMO A;  3ZW1 B;  3S60 A;  2JU8 A;  3HWF A;  2OVD A;  4XMH A;  3APU A;  1OPB A;  3RWX A;  1TW4 A;  1S2P A;  4I3B A;  2K23 A;  3PED A;  4NYR A;  4YKM A;  3APV A;  2A13 A;  5LJH A;  2W2B A;  3VU1 A;  1HN2 A;  1OEK A;  2R74 A;  5F6B A;  1G85 A;  1YWA A;  1IFB A;  3VG3 A;  2A2G A;  4MVL A;  4I95 A;  3PPT A;  4TKH A;  1QAB E;  1LPJ A;  2KT4 B;  4ZH9 A;  4IAX A;  4QZU A;  5D48 A;  5D8J A;  4HPA A;  4KC7 A;  3HK1 A;  4ORR A;  4XMF A;  3STM X;  4O4S A;  5FQ7 E;  1QY1 A;  4QNI A;  2ACP X;  4HWM A;  1QWD A;  5H9K A;  1U18 A;  3U9P C;  4NP1 A;  1ZNK A;  4QGV A;  1YP6 A;  3FR4 A;  2QO4 A;  2L67 A;  1BM5 A;  4NNT A;  3MBT A;  1E00 A;  3JS1 A;  3KFH A;  2X8F A;  1E02 A;  2BLG A;  2AH7 X;  3ZUO A;  1OBU A;  4MVK A;  3IFB A;  4U8U N;  1U0X A;  3FEL A;  3CWK A;  4COT A;  4TKB A;  1QG5 A;  1ZRY A;  1P6P A;  3TZS A;  1U17 A;  1HBQ A;  2LA7 A;  5HA1 A;  2X8T A;  5HCC C;  1QFV A;  1EPB A;  1X8O A;  3CBS A;  4TKJ A;  3WXQ A;  3BS2 A;  4AZR A;  1LNM A;  4GU8 A;  3I0A A;  1SY3 A;  4XMD A;  5B27 A;  2LKK A;  2GTL N;  3P6H A;  4OS0 A;  5HTD A;  4A8Z A;  2OVE A;  2WR6 A;  2WUT A;  4GKC A;  3JSQ A;  1DZJ A;  2LFO A;  2GJ5 A;  3UEU A;  1ERB A;  3U0D A;  2L5P A;  1GXA A;  4ZGF A;  4ZHH A;  1KT3 A;  3APX A;  4R0B A;  1B0O A;  5LJE A;  4HPD A;  1SXU A;  1QQS A;  4ORS A;  1DC9 A;  5H9L A;  1SXX A;  3MVF A;  4IBA A;  2GTF X;  1LFO A;  3NP1 A;  1I04 A;  2G79 A;  1LIE A;  2WWP A;  3APW A;  4WFU A;  4I6S A;  3PEC A;  1FE3 A;  5LJK A;  5F1E A;  5AJB A;  2AT3 X;  5D4A A;  4AZO A;  3FA8 A;  3NR3 A;  1NGL A;  5LJB A;  3G7X A;  5HA0 A;  1JIW I;  1URE A;  1X8N A;  3HTY A;  5BYP A;  2GTL O;  3D96 A;  3P6G A;  1CBQ A;  1AQB A;  1QFT A;  2KTD A;  4QZT A;  2KTS A;  4ORY A;  1FDQ A;  2AT8 X;  4YDB A;  1FTP A;  3O2Y A;  3K3L A;  3DSZ A;  4CV7 A;  4YFQ A;  4ES7 A;  4EDE A;  1PMP A;  1A2D A;  3BDR A;  1QY2 A;  2HMB A;  1O1U A;  2NNQ A;  1JYJ A;  1BRQ A;  5EEE A;  1ML7 A;  5FQ8 E;  4I9S A;  4ALB A;  3ZI8 A;  4KCA A;  5EZ2 A;  2L9C A;  4O4X A;  2YG2 A;  1T0V A;  4YMY A;  4TLJ A;  3FEP A;  2MWH A;  1IFC A;  1L6M A;  1BWY A;  2X46 A;  2JOZ A;  3SAO A;  1EXS A;  2HNX A;  3D4R A;  2FR3 A;  1OBP A;  3HWD A;  1Z24 A;  1GT1 A;  2CZU A;  1YWD A;  1KT6 A;  3FA7 A;  3S26 A;  5IO6 A;  1QY0 A;  3ZZV A;  2DM5 A;  1RLB E;  1O8V A;  4YFP A;  1TOW A;  5HTE A;  2KW1 A;  3UEV A;  3WJC A;  4AZM A;  2ACO A;  5LJG A;  1DZK A;  4GNY A;  1SY0 A;  5D45 A;  1TVQ A;  4L1N A;  3ELX A;  5BVQ A;  3NAD A;  1BRP A;  3CR6 A;  4MIR A;  1OPA A;  4JGL A;  3BU1 A;  3WJG A;  3O22 A;  1KZX A;  3PP6 A;  1KT4 A;  4YFR A;  2F73 A;  4IB7 A;  1I06 A;  1HMR A;  5L8I A;  1EII A;  2RCT A;  4L3R A;  4FBR A;  1O1V A;  4EFG A;  4QRL A;  3LHN A;  2MM3 A;  3FMZ A;  1GX8 A;  2BT9 A;  5KIC A;  4MIS A;  2WEW A;  4LKP A;  3BSZ E;  4YGH A;  1CRB A;  1SXW A;  3RSW A;  1S44 A;  2FWV A;  3WJD A;  1ICN A;  1KXO A;  1JV4 A;  3STK A;  1Y9T A;  1XKI A;  2BHV A;  4ZR2 A;  4QQ1 A;  4FBV A;  1SXY A;  2MJI A;  4I3D A;  3BX8 A;  4OS8 A;  1IKJ A;  3ZQ3 A;  2MHD A;  4ORU A;  4KC8 A;  2AT0 X;  1LIC A;  3ZWE A;  4AZQ A;  4ON1 A;  2FTB A;  1PEE A;  5FQ6 E;  2NNE A;  3O19 A;  4GNW A;  4NW4 A;  3STN A;  1X8U A;  5FFH A;  2K62 A;  1YIV A;  2L68 A;  1H91 A;  2HZR A;  4N7C A;  5LKE A;  1PBO A;  2A2U A;  2CM9 A;  4LKT A;  1LIF A;  2JW1 A;  3WJE A;  5D47 A;  1EW3 A;  3LV4 A;  5EDC A;  1MDC A;  3KZA A;  4QYN A;  2X45 A;  3QKG A;  1ZNL A;  2R56 A;  4CK4 A;  2LBA A;  5HBS A;  1A3Y A;  2CM4 A;  4HPC A;  3V8U A;  5HZ8 A;  2P8G A;  1T68 X;  4ODD A;  3HOL A;  5HAE A;  2A0A A;  1G74 A;  1ZNG A;  3GE2 A;  2ANS A;  3OE3 A;  5AJC A;  5DPQ A;  4LZV A;  5LKF A;  1ADL A;  1GT5 A;  4EXZ A;  1X89 A;  3WJF A;  3TGC A;  1SY2 A;  4U8U O;  3B2K A;  4ZGU A;  5IO5 A;  1AEL A;  4U8U M;  2F09 A;  5C0N A;  3NX1 A;  4EQA C;  3BLG A;  2BS6 A;  5LJD A;  2XST A;  4GE1 A;  4RUN A;  1HMS A;  1AVG I;  4QYP A;  1VPR A;  1JJJ A;  1SY1 A;  3B2J A;  5AEO A;  3EBK A;  5JR8 A;  3GAQ A;  3WBG A;  1I4U A;  4KII A;  1IIU A;  3NQK A;  1YWC A;  5HZ9 A;  4GDZ A;  2Q2P A;  1GGL A;  2WQA E;  3BU9 A;  4U3Q A;  2GTL M;  5H8T A;  2FT9 A;  3PQU A;  1EPA A;  2Z4I A;  4YGG A;  5EPQ A;  5FAZ A;  5HZQ A;  3NQ3 A;  2FLJ A;  3NBX X;  5HCD C;  2AKQ A;  4AW8 A;  1FEN A;  2PY1 A;  3VPJ E;  1JYD A;  1OBQ A;  1CBI A;  2QMI A;  5EED A;  3OJY C;  2CBR A;  1CBR A;  1KQW A;  3KFI A;  3PH6 A;  3RZY A;  2RQ0 A;  3BX7 A;  1RBP A;  1KT7 A;  1CBS A;  1XCA A;  2JU7 A;  2W2A A;  3BRN A;  1DV9 A;  4WBK A;  1HQP A;  4IAW A;  1BBP A;  3MX7 A;  3H3I A;  1ZNE A;  4BQU A;  2E4J A;  5F58 A;  1B56 A;  1NP1 A;  4PJ2 A;  2POA A;  1IKE A;  3F9D A;  5F7G A;  4O49 A;  2M4L A;  3T1D A;  4Y0Q A;  4TNN A;  1D3S A;  4TJZ A;  2ZAI A;  2RA6 A;  3HOE A;  3P6C A;  4D6A A;  3DTQ A;  3IA8 A;  4QGX A;  5KID A;  4GRJ A;  2CZT A;  2R73 A;  4K19 A;  3FYF A;  2RCQ A;  4QAE A;  1ALB A;  1KZW A;  1LID A;  4UU3 A;  3VG5 A;  2N93 A;  4XMG A;  4FGI B;  2FS7 A;  4YBU A;  3ZW0 A;  4A60 A;  4DQ3 A;  2RN4 A;  1ACD A;  2ZAG A;  3EYC A;  4FBO A;  1E06 A;  3PQS A;  3FLL A;  3TGA A;  1JZU A;  1VYG A;  1D2U A;  1DZM A;  1KGL A;  4NLJ A;  3OD9 A;  4M6S A;  1MX7 A;  4GET A;  1R0U A;  4MVE A;  5LJC A;  4IB9 A;  3WVM A;  2CBS A;  1MUP A;  3FW4 A;  1FEM A;  3P24 A;  2WQ9 A;  3S5V A;  5L8N A;  3L4R A;  4OS3 A;  4XME A;  5H9N A;  4XMC A;  4MVI A;  3UEW A;  3BY0 A;  2BS5 A;  4ZFX A;  4A1Y A;  5KHP A;  2LB6 A;  3VE1 A;  3FW5 A;  1CJ5 A;  1I05 A;  5BVS A;  2QO5 A;  2AMM X;  4YCE A;  4INN A;  4O3Y A;  3EBW A;  3UAQ A;  4YGZ A;  1DF3 A;  4ZHF A;  2NND A;  3AKM A;  4OMX A;  3P6E A;  4O3Z A;  2ALL X;  3C78 X;  1SA8 A;  3RKG A;  3B2I A;  1LIB A;  2MO5 A;  1NP4 A;  2Q4N A;  1T8V A;  1EIO A;  4YH0 A;  3CMP A;  4OMW A;  3N91 A;  2FR2 A;  3ELZ A;  1A18 A;  1B4M A;  3U03 A;  1EI5 A;  1GKA A;  4ORW A;  4BVM A;  2W2F A;  2AT5 X;  4O3X B;  1G5W A;  1ZND A;  2Q9S A;  4LQZ A;  3EMM A;  4YCH A;  4ZHG A;  5K06 A;  1Y9L A;  3P6F A;  4ZJ0 A;  1UZ2 X;  1YP7 A;  1EQD A;  3E3C A;  3OBL A;  3JQO A;  4Y0S A;  2WSJ A;  1X8Q A;  1GT3 A;  4O4U A;  2JMB A;  4HFO A;  4U9C A;  3ZUI A;  3AKN A;  4GK9 A;  3TGB A;  2JU3 A;  3ZW2 A;  4YBP A;  4N7D A;  1EUO A;  3NPO A;  2RD7 C;  1IW2 A;  2A3F X;  3VE2 A;  3ZW0 B;  3P02 A;  4ARH A;  1B8E A;  1FEL A;  1AB0 A;  2HLV A;  2OVA A;  3VG6 A;  4Y0P A;  3C77 X;  2FRS A;  4IAB A;  3FEN A;  2G78 A;  2NP1 A;  1JBH A;  1KT5 A;  1E5P A;  2G7B A;  5HWZ A;  1PM1 X;  3KQ0 A;  4IB8 A;  5B29 A;  1TXL A;  3FA6 A;  3FEK A;  2WEX A;  2Q39 A;  5HZ5 A;  3WJB A;  4RUU A;  4I9R A;  1ERX A;  3D97 A;  1HMT A;  4O4O A;  1ZNH A;  3CQR A;  3Q6L A;  4ZHD A;  1BEB A;  2AT6 X;  1DZP A;  4YKO A;  4GH7 A;  1BLR A;  4NNS A;  3PH5 A;  2QO6 A;  4I3C A;  1OEE A;  2IFB A;  4D6B A;  4IMN A;  3HWG A;  4ZH6 A;  1MX8 A;  4ZHC A;  2AL0 X;  3ZW1 A;  1A57 A;  1OEJ A;  2GC9 A;  3HWE A;  4PSQ A;  3I17 A;  5L8O A;  3EM0 A;  4ZCB A;  2OFM X;  1HBP A;  3D95 A;  4QGW A;  1VYF A;  1GKA B;  2OZQ A;  2QOS C;  3KFG A;  4Y0R A;  5HZ6 A;  1YUP A;  2JN3 A;  4AZP A;  5FEN A;  4NLI A;  2FS6 A;  3CQN A;  1LF7 A;  3F8A A;  4YDA A;  3VG2 A;  4UU2 A;  4KH8 A;  5AQ6 A;  1KQX A;  4KT5 A;  3FR5 A;  5BVT A;  2KD2 A;  5F6Z A;  1N0S A;  4LZU A;  2Q2M A;  1TOU A;  4NYQ A;  1EAL A;  3FIQ A;  4TQ2 A;  1X71 A;  3KFF A;  1MVG A;  3WOV A;  1BJ7 A;  4AYH A;  1BSQ A;  5EDB A;  4O3W A;  1YWB A;  3FA9 A;  2OFR X;  4EEJ A;  4WFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...