1MM5A

Solution nmr structure of the outer membrane enzyme pagp in og micelles
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
170
structure length
170
Chain Sequence
MNADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and Dynamics of the Outer Membrane Enzyme PagP by NMR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords CrcA protein
total genus 24
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.251: Lipid IV(A) palmitoyltransferase.
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07017 PagP Antimicrobial peptide resistance and lipid A acylation protein PagP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1mm5A00
4PUXA 2X27X 4RLCA 2MHLA 1ORMA 1Q9FA 3C5OA 2JMMA 2N2LA 2F1VA 1MM4A 2ERVA 1Q9GA 2N2MA 1MM5A 1G90A 2LHFA 1P4TA 3QRCA 1QJ9A 1THQA 1QJPA 3G7GA 2GE4A 2MNHA 1QJ8A 1BXWA 3QRAA 2M06A 2M07A 3GP6A 2K0LA 2F1TA
chains in the Genus database with same CATH superfamily
1T1LA 3KVDD 4O4UA 2XG6A 2PRNA 3LK2A 3PORA 2MHLA 4BUMX 4FZLA 4FZMA 2W80C 1PRNA 3T24A 4FZNA 2KZ7A 1IZNA 2N2LA 4N75A 2ZFGA 3T0SA 2F1VA 4LSHA 4U9CA 3HW9A 3LK3B 4GHBA 3DA4A 2ERVA 4O3XB 5FVNA 5GTHO 5H2FO 3BRYA 3NSGA 3VZTX 5G38A 1Q9GA 5DL8A 5DL7A 4AYMC 5G26A 3DWNA 3PQSA 4LSEA 5AFUL 1ZHYA 4C69X 4G76A 4FSOA 3SY7A 3LK3A 1P4TA 2JQYA 4N74A 3PRNA 5GTIO 3UAQA 4O3YA 2QTKA 2IWWA 1QJ9A 5D5DA 1THQA 3POUA 4K3CA 4O3ZA 5KAIO 1QJ8A 2FGQX 4FQEA 4FUVA 4N59A 1BXWA 3AAAA 4XNKA 1H6S1 3PF1A 3SYSA 2R8AA 4FRXA 2WJRA 3LK42 2F1TA 4GF4A 2Y0LA 4GCPA 5EE2A 4C4VB 8PRNA 4KR4A 4RLCA 1OPFA 3AAEB 2R88A 4FMSA 4AKRA 3A2SX 2W81C 2Y2XA 3POQA 3FYXA 2KC0A 4K3BA 4D64A 5TISO 3AA7B 1IZNB 1T16A 2Y7SA 4UB8O 4KR8A 4G75A 1HXUA 3PGRA 4B61A 2ZLDA 1GFNA 3NJTA 4AYDC 3HOEA 3AA6A 2LHFA 4KRAA 1GFOA 2KXPB 4RL9A 5ADXL 2F1CX 2R4PA 3QRCA 4FRTA 3POXA 1MPFA 3WI4A 4AYEC 4Z3TA 1QJPA 2XMXA 4PR7A 2MNHA 4FESA 3DWOX 4AYNA 4CTDA 4AKRB 3JTYA 4AFKA 2ODJA 1E54A 3AA0A 3QRAA 2M06A 1BH3A 2M07A 3VE1A 3SYBA 3A0BO 3VY8X 2LFUA 3AA1B 3GP6A 2K0LA 4O4XA 5DL5A 5PRNA 4IL6O 4PUXA 3RBHA 2X27X 3WI5A 1PHOA 1GFQA 3VZUX 3C5OA 1Q9FA 4QQ1A 2IWVA 2JMMA 4FOZA 2R4OA 1BT9A 2KDYA 1MM4A 5E79O 2J4UP 1OSMA 1ZHZA 4E1TA 5T5FA 4AZLA 3LK2B 4XNLA 3JCUO 3VE2A 2XTRA 3LK41 4O3WA 2N2MA 2PORA 2YNKA 3VZWX 3TZGA 4LSIA 2XTQA 4N58A 3AA7A 4JFBA 5G39A 1G90A 2Y0HA 1GFMA 3KZIO 1YS5A 3PGUA 4JCHA 3VY9X 4C00A 2FGRA 4RLBA 3K19A 2O4VA 3AAEA 3EMNX 4O49A 3SY9A 4AUIA 4UB6O 3AA1A 2KXPA 7PRNA 2R4LA 3AA6B 2XE1A 4LSFA 2YPVA 4GCSA 1HXXA 4RJXA 4D5UA 3SZVA 3WU2O 1ORMA 4E1SA 6PRNA 3UPGA 3PQUA 4RJWA 2K4TA 2R89A 3HOLA 4AYID 5ADXK 2XE5A 5KAFO 3SZDA 5B66O 1S5LO 1ZHWA 2R4NA 4F4BA 2OMFA 3A0HO 3BS0A 1HXTA 5JDPA 2XE2A 2XE3A 1ZHXA 2AXTO 2J1NA 1GFPA 2WJQA 1MM5A 4C4VA 5B5EO 3AA0B 3PGSA 4FT6A 5IYUA 4FSPA 2Y0KA 3AAAB 3HWBA 3V8UA 3DZMA 5GV0A 2KZ7B 4D65A 5AFUK 3G7GA 2GE4A 4GCQA 4AKMA 4PJ0O 3T20A 1ZHTA 3UU2A 3DA3A 2X9KA 2WVPA 3BRZA 5G3AA 5DL6A 3O0EA
chains in the Genus database with same CATH topology
3KVDD 4O4UA 2XG6A 2PRNA 3LK2A 3PORA 2MHLA 4BUMX 4FZLA 4FZMA 2W80C 1PRNA 3T24A 4FZNA 2KZ7A 1IZNA 2N2LA 2ZFGA 3T0SA 2F1VA 4LSHA 4U9CA 3HW9A 3LK3B 4GHBA 3DA4A 2ERVA 4O3XB 5FVNA 3NSGA 3VZTX 1Q9GA 5DL8A 5DL7A 4AYMC 5G26A 3PQSA 4LSEA 5AFUL 1ZHYA 4C69X 4G76A 4FSOA 3SY7A 3LK3A 1P4TA 3PRNA 3UAQA 4O3YA 2QTKA 1QJ9A 5D5DA 1THQA 3POUA 4O3ZA 1QJ8A 2FGQX 4FUVA 4N59A 1BXWA 3AAAA 4XNKA 1H6S1 3SYSA 4FRXA 5EE2A 3LK42 2F1TA 4GF4A 2Y0LA 4GCPA 8PRNA 4KR4A 4RLCA 1OPFA 3AAEB 4FMSA 4AKRA 3A2SX 2W81C 2Y2XA 3POQA 3FYXA 2KC0A 4D64A 3AA7B 1IZNB 2Y7SA 4KR8A 4G75A 1HXUA 4B61A 2ZLDA 1GFNA 4AYDC 3HOEA 3AA6A 2LHFA 4KRAA 1GFOA 2KXPB 4RL9A 5ADXL 3QRCA 3WI4A 4Z3TA 4FRTA 3POXA 1MPFA 4AYEC 1QJPA 2XMXA 2MNHA 4FESA 4AYNA 4AKRB 3JTYA 2ODJA 1E54A 3AA0A 3QRAA 2M06A 1BH3A 2M07A 3VE1A 3SYBA 3VY8X 2LFUA 3AA1B 3GP6A 2K0LA 4O4XA 5DL5A 5PRNA 4PUXA 3RBHA 4AFKA 2X27X 3WI5A 1PHOA 1GFQA 3VZUX 3C5OA 1Q9FA 4QQ1A 2JMMA 4FOZA 1BT9A 2KDYA 1MM4A 2J4UP 1OSMA 1ZHZA 4E1TA 5T5FA 4AZLA 3LK2B 4XNLA 3VE2A 2XTRA 3LK41 4O3WA 2N2MA 2PORA 2YNKA 3VZWX 3TZGA 4LSIA 2XTQA 4N58A 3AA7A 4JFBA 1G90A 2Y0HA 1GFMA 1YS5A 4JCHA 3VY9X 2FGRA 4RLBA 3K19A 2O4VA 3AAEA 3EMNX 4O49A 3SY9A 4AUIA 3AA1A 2KXPA 7PRNA 3AA6B 2XE1A 4LSFA 2YPVA 4GCSA 1HXXA 4RJXA 4D5UA 3SZVA 4E1SA 1ORMA 3UPGA 6PRNA 3PQUA 4RJWA 2K4TA 4AYID 3HOLA 5ADXK 2XE5A 3SZDA 1ZHWA 4F4BA 2OMFA 1HXTA 5JDPA 2XE2A 2XE3A 1ZHXA 2J1NA 1GFPA 1MM5A 3AA0B 4FT6A 5IYUA 4FSPA 2Y0KA 3AAAB 3HWBA 3V8UA 5GV0A 2KZ7B 4D65A 5AFUK 3G7GA 2GE4A 4GCQA 4AKMA 3T20A 1ZHTA 3UU2A 3DA3A 5DL6A 3O0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUX A;  2X27 X;  4RLC A;  2MHL A;  1ORM A;  1Q9F A;  3C5O A;  2JMM A;  2N2L A;  2F1V A;  1MM4 A;  2ERV A;  1Q9G A;  2N2M A;  1MM5 A;  1G90 A;  2LHF A;  1P4T A;  3QRC A;  1QJ9 A;  1THQ A;  1QJP A;  3G7G A;  2GE4 A;  2MNH A;  1QJ8 A;  1BXW A;  3QRA A;  2M06 A;  2M07 A;  3GP6 A;  2K0L A;  2F1T A; 
#chains in the Genus database with same CATH topology
 1T1L A;  3KVD D;  4O4U A;  2XG6 A;  2PRN A;  3LK2 A;  3POR A;  2MHL A;  4BUM X;  4FZL A;  4FZM A;  2W80 C;  1PRN A;  3T24 A;  4FZN A;  2KZ7 A;  1IZN A;  2N2L A;  4N75 A;  2ZFG A;  3T0S A;  2F1V A;  4LSH A;  4U9C A;  3HW9 A;  3LK3 B;  4GHB A;  3DA4 A;  2ERV A;  4O3X B;  5FVN A;  5GTH O;  5H2F O;  3BRY A;  3NSG A;  3VZT X;  5G38 A;  1Q9G A;  5DL8 A;  5DL7 A;  4AYM C;  5G26 A;  3DWN A;  3PQS A;  4LSE A;  5AFU L;  1ZHY A;  4C69 X;  4G76 A;  4FSO A;  3SY7 A;  3LK3 A;  1P4T A;  2JQY A;  4N74 A;  3PRN A;  5GTI O;  3UAQ A;  4O3Y A;  2QTK A;  2IWW A;  1QJ9 A;  5D5D A;  1THQ A;  3POU A;  4K3C A;  4O3Z A;  5KAI O;  1QJ8 A;  2FGQ X;  4FQE A;  4FUV A;  4N59 A;  1BXW A;  3AAA A;  4XNK A;  1H6S 1;  3PF1 A;  3SYS A;  2R8A A;  4FRX A;  2WJR A;  3LK4 2;  2F1T A;  4GF4 A;  2Y0L A;  4GCP A;  5EE2 A;  4C4V B;  8PRN A;  4KR4 A;  4RLC A;  1OPF A;  3AAE B;  2R88 A;  4FMS A;  4AKR A;  3A2S X;  2W81 C;  2Y2X A;  3POQ A;  3FYX A;  2KC0 A;  4K3B A;  4D64 A;  5TIS O;  3AA7 B;  1IZN B;  1T16 A;  2Y7S A;  4UB8 O;  4KR8 A;  4G75 A;  1HXU A;  3PGR A;  4B61 A;  2ZLD A;  1GFN A;  3NJT A;  4AYD C;  3HOE A;  3AA6 A;  2LHF A;  4KRA A;  1GFO A;  2KXP B;  4RL9 A;  5ADX L;  2F1C X;  2R4P A;  3QRC A;  4FRT A;  3POX A;  1MPF A;  3WI4 A;  4AYE C;  4Z3T A;  1QJP A;  2XMX A;  4PR7 A;  2MNH A;  4FES A;  3DWO X;  4AYN A;  4CTD A;  4AKR B;  3JTY A;  4AFK A;  2ODJ A;  1E54 A;  3AA0 A;  3QRA A;  2M06 A;  1BH3 A;  2M07 A;  3VE1 A;  3SYB A;  3A0B O;  3VY8 X;  2LFU A;  3AA1 B;  3GP6 A;  2K0L A;  4O4X A;  5DL5 A;  5PRN A;  4IL6 O;  4PUX A;  3RBH A;  2X27 X;  3WI5 A;  1PHO A;  1GFQ A;  3VZU X;  3C5O A;  1Q9F A;  4QQ1 A;  2IWV A;  2JMM A;  4FOZ A;  2R4O A;  1BT9 A;  2KDY A;  1MM4 A;  5E79 O;  2J4U P;  1OSM A;  1ZHZ A;  4E1T A;  5T5F A;  4AZL A;  3LK2 B;  4XNL A;  3JCU O;  3VE2 A;  2XTR A;  3LK4 1;  4O3W A;  2N2M A;  2POR A;  2YNK A;  3VZW X;  3TZG A;  4LSI A;  2XTQ A;  4N58 A;  3AA7 A;  4JFB A;  5G39 A;  1G90 A;  2Y0H A;  1GFM A;  3KZI O;  1YS5 A;  3PGU A;  4JCH A;  3VY9 X;  4C00 A;  2FGR A;  4RLB A;  3K19 A;  2O4V A;  3AAE A;  3EMN X;  4O49 A;  3SY9 A;  4AUI A;  4UB6 O;  3AA1 A;  2KXP A;  7PRN A;  2R4L A;  3AA6 B;  2XE1 A;  4LSF A;  2YPV A;  4GCS A;  1HXX A;  4RJX A;  4D5U A;  3SZV A;  3WU2 O;  1ORM A;  4E1S A;  6PRN A;  3UPG A;  3PQU A;  4RJW A;  2K4T A;  2R89 A;  3HOL A;  4AYI D;  5ADX K;  2XE5 A;  5KAF O;  3SZD A;  5B66 O;  1S5L O;  1ZHW A;  2R4N A;  4F4B A;  2OMF A;  3A0H O;  3BS0 A;  1HXT A;  5JDP A;  2XE2 A;  2XE3 A;  1ZHX A;  2AXT O;  2J1N A;  1GFP A;  2WJQ A;  1MM5 A;  4C4V A;  5B5E O;  3AA0 B;  3PGS A;  4FT6 A;  5IYU A;  4FSP A;  2Y0K A;  3AAA B;  3HWB A;  3V8U A;  3DZM A;  5GV0 A;  2KZ7 B;  4D65 A;  5AFU K;  3G7G A;  2GE4 A;  4GCQ A;  4AKM A;  4PJ0 O;  3T20 A;  1ZHT A;  3UU2 A;  3DA3 A;  2X9K A;  2WVP A;  3BRZ A;  5G3A A;  5DL6 A;  3O0E A; 
#chains in the Genus database with same CATH homology
 3KVD D;  4O4U A;  2XG6 A;  2PRN A;  3LK2 A;  3POR A;  2MHL A;  4BUM X;  4FZL A;  4FZM A;  2W80 C;  1PRN A;  3T24 A;  4FZN A;  2KZ7 A;  1IZN A;  2N2L A;  2ZFG A;  3T0S A;  2F1V A;  4LSH A;  4U9C A;  3HW9 A;  3LK3 B;  4GHB A;  3DA4 A;  2ERV A;  4O3X B;  5FVN A;  3NSG A;  3VZT X;  1Q9G A;  5DL8 A;  5DL7 A;  4AYM C;  5G26 A;  3PQS A;  4LSE A;  5AFU L;  1ZHY A;  4C69 X;  4G76 A;  4FSO A;  3SY7 A;  3LK3 A;  1P4T A;  3PRN A;  3UAQ A;  4O3Y A;  2QTK A;  1QJ9 A;  5D5D A;  1THQ A;  3POU A;  4O3Z A;  1QJ8 A;  2FGQ X;  4FUV A;  4N59 A;  1BXW A;  3AAA A;  4XNK A;  1H6S 1;  3SYS A;  4FRX A;  5EE2 A;  3LK4 2;  2F1T A;  4GF4 A;  2Y0L A;  4GCP A;  8PRN A;  4KR4 A;  4RLC A;  1OPF A;  3AAE B;  4FMS A;  4AKR A;  3A2S X;  2W81 C;  2Y2X A;  3POQ A;  3FYX A;  2KC0 A;  4D64 A;  3AA7 B;  1IZN B;  2Y7S A;  4KR8 A;  4G75 A;  1HXU A;  4B61 A;  2ZLD A;  1GFN A;  4AYD C;  3HOE A;  3AA6 A;  2LHF A;  4KRA A;  1GFO A;  2KXP B;  4RL9 A;  5ADX L;  3QRC A;  3WI4 A;  4Z3T A;  4FRT A;  3POX A;  1MPF A;  4AYE C;  1QJP A;  2XMX A;  2MNH A;  4FES A;  4AYN A;  4AKR B;  3JTY A;  2ODJ A;  1E54 A;  3AA0 A;  3QRA A;  2M06 A;  1BH3 A;  2M07 A;  3VE1 A;  3SYB A;  3VY8 X;  2LFU A;  3AA1 B;  3GP6 A;  2K0L A;  4O4X A;  5DL5 A;  5PRN A;  4PUX A;  3RBH A;  4AFK A;  2X27 X;  3WI5 A;  1PHO A;  1GFQ A;  3VZU X;  3C5O A;  1Q9F A;  4QQ1 A;  2JMM A;  4FOZ A;  1BT9 A;  2KDY A;  1MM4 A;  2J4U P;  1OSM A;  1ZHZ A;  4E1T A;  5T5F A;  4AZL A;  3LK2 B;  4XNL A;  3VE2 A;  2XTR A;  3LK4 1;  4O3W A;  2N2M A;  2POR A;  2YNK A;  3VZW X;  3TZG A;  4LSI A;  2XTQ A;  4N58 A;  3AA7 A;  4JFB A;  1G90 A;  2Y0H A;  1GFM A;  1YS5 A;  4JCH A;  3VY9 X;  2FGR A;  4RLB A;  3K19 A;  2O4V A;  3AAE A;  3EMN X;  4O49 A;  3SY9 A;  4AUI A;  3AA1 A;  2KXP A;  7PRN A;  3AA6 B;  2XE1 A;  4LSF A;  2YPV A;  4GCS A;  1HXX A;  4RJX A;  4D5U A;  3SZV A;  4E1S A;  1ORM A;  3UPG A;  6PRN A;  3PQU A;  4RJW A;  2K4T A;  4AYI D;  3HOL A;  5ADX K;  2XE5 A;  3SZD A;  1ZHW A;  4F4B A;  2OMF A;  1HXT A;  5JDP A;  2XE2 A;  2XE3 A;  1ZHX A;  2J1N A;  1GFP A;  1MM5 A;  3AA0 B;  4FT6 A;  5IYU A;  4FSP A;  2Y0K A;  3AAA B;  3HWB A;  3V8U A;  5GV0 A;  2KZ7 B;  4D65 A;  5AFU K;  3G7G A;  2GE4 A;  4GCQ A;  4AKM A;  3T20 A;  1ZHT A;  3UU2 A;  3DA3 A;  5DL6 A;  3O0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...