1MM5A

Solution nmr structure of the outer membrane enzyme pagp in og micelles
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
170
structure length
170
Chain Sequence
MNADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CrcA protein
publication title Solution Structure and Dynamics of the Outer Membrane Enzyme PagP by NMR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 24
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.251: Lipid IV(A) palmitoyltransferase.
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07017 PagP Antimicrobial peptide resistance and lipid A acylation protein PagP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1mm5A00
1MM4A 1Q9GA 2M07A 2N2MA 1THQA 2JMMA 1Q9FA 1ORMA 1MM5A 1P4TA 3QRCA 4RLCA 2F1TA 2LHFA 3G7GA 1QJ9A 2M06A 1QJ8A 3QRAA 2K0LA 2GE4A 2MHLA 2X27X 4PUXA 1BXWA 2F1VA 3C5OA 1G90A 3GP6A 2ERVA 2MNHA 1QJPA 2N2LA
chains in the Genus database with same CATH superfamily
2ZLDA 3POUA 1MM4A 1GFMA 1IZNB 1Q9GA 1H6S1 2M07A 4O3XB 5DL7A 4AUIA 1THQA 1ZHZA 4FRXA 2KXPB 1Q9FA 4B61A 4FT6A 4N59A 5TISO 1MM5A 1HXXA 3PORA 4FRTA 4PJ0O 4RLBA 5KAIO 2F1CX 5PRNA 4E1SA 2OMFA 2J4UP 1E54A 5EE2A 3NSGA 4AKMA 3TZGA 1ZHXA 3K19A 5DL5A 4FOZA 4AYMC 4KR8A 4GCQA 1BT9A 3PQSA 1HXUA 2X27X 3AAEA 3DA3A 1T16A 4PUXA 2J1NA 3AA0A 4RL9A 3SYSA 5GV0A 2KZ7A 4BUMX 2XG6A 4FSPA 1PHOA 1S5LO 1G90A 3A0BO 2AXTO 4UB6O 2LFUA 4LSFA 3JCUO 2XE1A 3T24A 4N74A 4GCSA 4AYID 5B66O 5JDPA 6PRNA 4JCHA 4KRAA 4C69X 3T20A 3UPGA 3VZUX 3HW9A 3WI5A 4C00A 3LK41 5GTHO 2IWWA 3EMNX 3LK3A 3AA7B 2ODJA 4FZLA 3DWOX 2R4NA 3A0HO 3RBHA 2PORA 2WJQA 3AA1A 4KR4A 4C4VA 2Y0LA 4AKRB 1P4TA 3LK2B 4K3CA 3BRZA 2W81C 2ZFGA 4GCPA 3WI4A 2PRNA 2R89A 2LHFA 2XTQA 3PQUA 1OPFA 2M06A 4XNKA 4O3YA 3BRYA 5G39A 4Z3TA 3AA6A 3V8UA 4AFKA 3AAAA 3HOLA 5DL6A 2GE4A 5AFUK 4XNLA 8PRNA 4D64A 3JTYA 3UAQA 2FGRA 1ZHYA 1ZHWA 5DL8A 5B5EO 2MNHA 3PRNA 4D65A 1QJPA 5ADXL 3DWNA 2N2LA 3C5OA 3KZIO 4RJXA 5G3AA 4AYDC 2KC0A 4FMSA 3BS0A 7PRNA 3AAEB 2WVPA 5E79O 2YNKA 3SY7A 1GFPA 3AA0B 5G38A 3UU2A 2JMMA 2KZ7B 2K4TA 4O3ZA 2XTRA 3QRCA 4FESA 3DZMA 4E1TA 3FYXA 2F1TA 4FQEA 4IL6O 3HOEA 2R8AA 2Y0KA 1QJ9A 4CTDA 1QJ8A 2XE2A 3QRAA 3LK3B 4K3BA 3A2SX 4GF4A 4O4UA 3PF1A 5FVNA 2FGQX 2MHLA 1ZHTA 3HWBA 4GHBA 1IZNA 3AA1B 2O4VA 2XE5A 3POXA 3PGSA 4FUVA 4C4VB 4LSEA 4FZNA 2F1VA 4JFBA 4O49A 1PRNA 2KXPA 4PR7A 3DA4A 4U9CA 4AZLA 3GP6A 2ERVA 3LK42 3PGRA 3SZVA 2W80C 5GTIO 3AA6B 3VY8X 1HXTA 3AAAB 2WJRA 4G76A 4QQ1A 3VE1A 5H2FO 5KAFO 3POQA 2N2MA 1MPFA 4FZMA 4LSHA 3WU2O 2Y2XA 1ORMA 3T0SA 2R4PA 5AFUL 1YS5A 4G75A 1BH3A 4RLCA 4FSOA 3KVDD 3VZWX 3NJTA 3G7GA 3SYBA 2R4LA 2R88A 4UB8O 2QTKA 2IWVA 5D5DA 2JQYA 2K0LA 2XE3A 3SZDA 2Y7SA 4RJWA 4F4BA 1GFQA 5T5FA 3VY9X 4AYEC 3AA7A 4O3WA 3SY9A 2XMXA 1T1LA 5IYUA 1BXWA 5ADXK 3O0EA 1GFOA 2KDYA 2X9KA 4LSIA 2YPVA 5G26A 4AKRA 4D5UA 1OSMA 3LK2A 3PGUA 3VZTX 1GFNA 3VE2A 4N75A 4N58A 4AYNA 4O4XA 2R4OA 2Y0HA
chains in the Genus database with same CATH topology
2ZLDA 3POUA 1MM4A 1GFMA 1IZNB 1Q9GA 1H6S1 2M07A 4O3XB 5DL7A 4AUIA 1THQA 1ZHZA 4FRXA 2KXPB 1Q9FA 4B61A 4FT6A 4N59A 5ADXK 1MM5A 1HXXA 3PORA 4FRTA 4RLBA 5PRNA 4E1SA 2OMFA 2J4UP 1E54A 5EE2A 3NSGA 4AKMA 3TZGA 1ZHXA 3K19A 5DL5A 4FOZA 4AYMC 4KR8A 4GCQA 1BT9A 3PQSA 1HXUA 2X27X 3AAEA 3DA3A 4PUXA 2J1NA 3AA0A 4RL9A 3SYSA 5GV0A 2KZ7A 4BUMX 2XG6A 4FSPA 1PHOA 1G90A 2LFUA 4LSFA 2XE1A 3T24A 4AYID 4GCSA 5JDPA 6PRNA 4JCHA 4KRAA 4C69X 3T20A 3UPGA 3VZUX 3HW9A 3WI5A 3LK41 3EMNX 3LK3A 3AA7B 2ODJA 4FZLA 3RBHA 2PORA 3AA1A 4KR4A 2Y0LA 4AKRB 1P4TA 3LK2B 2W81C 2ZFGA 4GCPA 3WI4A 2PRNA 2LHFA 2XTQA 3PQUA 1OPFA 2M06A 4XNKA 4O3YA 4Z3TA 3AA6A 3V8UA 4AFKA 3AAAA 3HOLA 5DL6A 2GE4A 5AFUK 4XNLA 8PRNA 4D64A 3JTYA 3UAQA 2FGRA 1ZHYA 1ZHWA 5DL8A 5ADXL 2MNHA 3PRNA 4D65A 1QJPA 2N2LA 3C5OA 4RJXA 4AYDC 2KC0A 4FMSA 7PRNA 3AAEB 3SY7A 2YNKA 1GFPA 3AA0B 3UU2A 2JMMA 2KZ7B 2K4TA 4O3ZA 2XTRA 3QRCA 4FESA 4E1TA 3FYXA 2F1TA 3HOEA 2Y0KA 1QJ9A 1QJ8A 2XE2A 3QRAA 3LK3B 3A2SX 4GF4A 4O4UA 5FVNA 2FGQX 2MHLA 1ZHTA 3HWBA 4GHBA 1IZNA 3AA1B 2O4VA 2XE5A 3POXA 4FUVA 4LSEA 4FZNA 2F1VA 4JFBA 4O49A 1PRNA 2KXPA 3DA4A 4U9CA 4AZLA 3GP6A 2ERVA 3LK42 3SZVA 2W80C 3AA6B 3VY8X 1HXTA 3AAAB 4G76A 4QQ1A 3VE1A 3POQA 2N2MA 1MPFA 4FZMA 4LSHA 2Y2XA 1ORMA 3T0SA 5AFUL 1YS5A 4G75A 1BH3A 4RLCA 4FSOA 3KVDD 3VZWX 3G7GA 3SYBA 2QTKA 5D5DA 3SZDA 2K0LA 2XE3A 2Y7SA 4RJWA 4F4BA 1GFQA 5T5FA 3VY9X 4AYEC 3AA7A 4O3WA 3SY9A 2XMXA 5IYUA 1BXWA 3O0EA 1GFOA 2KDYA 4LSIA 2YPVA 5G26A 4AKRA 4D5UA 1OSMA 3LK2A 3VZTX 1GFNA 3VE2A 4N58A 4AYNA 4O4XA 2Y0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM4 A;  1Q9G A;  2M07 A;  2N2M A;  1THQ A;  2JMM A;  1Q9F A;  1ORM A;  1MM5 A;  1P4T A;  3QRC A;  4RLC A;  2F1T A;  2LHF A;  3G7G A;  1QJ9 A;  2M06 A;  1QJ8 A;  3QRA A;  2K0L A;  2GE4 A;  2MHL A;  2X27 X;  4PUX A;  1BXW A;  2F1V A;  3C5O A;  1G90 A;  3GP6 A;  2ERV A;  2MNH A;  1QJP A;  2N2L A; 
#chains in the Genus database with same CATH topology
 2ZLD A;  3POU A;  1MM4 A;  1GFM A;  1IZN B;  1Q9G A;  1H6S 1;  2M07 A;  4O3X B;  5DL7 A;  4AUI A;  1THQ A;  1ZHZ A;  4FRX A;  2KXP B;  1Q9F A;  4B61 A;  4FT6 A;  4N59 A;  5TIS O;  1MM5 A;  1HXX A;  3POR A;  4FRT A;  4PJ0 O;  4RLB A;  5KAI O;  2F1C X;  5PRN A;  4E1S A;  2OMF A;  2J4U P;  1E54 A;  5EE2 A;  3NSG A;  4AKM A;  3TZG A;  1ZHX A;  3K19 A;  5DL5 A;  4FOZ A;  4AYM C;  4KR8 A;  4GCQ A;  1BT9 A;  3PQS A;  1HXU A;  2X27 X;  3AAE A;  3DA3 A;  1T16 A;  4PUX A;  2J1N A;  3AA0 A;  4RL9 A;  3SYS A;  5GV0 A;  2KZ7 A;  4BUM X;  2XG6 A;  4FSP A;  1PHO A;  1S5L O;  1G90 A;  3A0B O;  2AXT O;  4UB6 O;  2LFU A;  4LSF A;  3JCU O;  2XE1 A;  3T24 A;  4N74 A;  4GCS A;  4AYI D;  5B66 O;  5JDP A;  6PRN A;  4JCH A;  4KRA A;  4C69 X;  3T20 A;  3UPG A;  3VZU X;  3HW9 A;  3WI5 A;  4C00 A;  3LK4 1;  5GTH O;  2IWW A;  3EMN X;  3LK3 A;  3AA7 B;  2ODJ A;  4FZL A;  3DWO X;  2R4N A;  3A0H O;  3RBH A;  2POR A;  2WJQ A;  3AA1 A;  4KR4 A;  4C4V A;  2Y0L A;  4AKR B;  1P4T A;  3LK2 B;  4K3C A;  3BRZ A;  2W81 C;  2ZFG A;  4GCP A;  3WI4 A;  2PRN A;  2R89 A;  2LHF A;  2XTQ A;  3PQU A;  1OPF A;  2M06 A;  4XNK A;  4O3Y A;  3BRY A;  5G39 A;  4Z3T A;  3AA6 A;  3V8U A;  4AFK A;  3AAA A;  3HOL A;  5DL6 A;  2GE4 A;  5AFU K;  4XNL A;  8PRN A;  4D64 A;  3JTY A;  3UAQ A;  2FGR A;  1ZHY A;  1ZHW A;  5DL8 A;  5B5E O;  2MNH A;  3PRN A;  4D65 A;  1QJP A;  5ADX L;  3DWN A;  2N2L A;  3C5O A;  3KZI O;  4RJX A;  5G3A A;  4AYD C;  2KC0 A;  4FMS A;  3BS0 A;  7PRN A;  3AAE B;  2WVP A;  5E79 O;  2YNK A;  3SY7 A;  1GFP A;  3AA0 B;  5G38 A;  3UU2 A;  2JMM A;  2KZ7 B;  2K4T A;  4O3Z A;  2XTR A;  3QRC A;  4FES A;  3DZM A;  4E1T A;  3FYX A;  2F1T A;  4FQE A;  4IL6 O;  3HOE A;  2R8A A;  2Y0K A;  1QJ9 A;  4CTD A;  1QJ8 A;  2XE2 A;  3QRA A;  3LK3 B;  4K3B A;  3A2S X;  4GF4 A;  4O4U A;  3PF1 A;  5FVN A;  2FGQ X;  2MHL A;  1ZHT A;  3HWB A;  4GHB A;  1IZN A;  3AA1 B;  2O4V A;  2XE5 A;  3POX A;  3PGS A;  4FUV A;  4C4V B;  4LSE A;  4FZN A;  2F1V A;  4JFB A;  4O49 A;  1PRN A;  2KXP A;  4PR7 A;  3DA4 A;  4U9C A;  4AZL A;  3GP6 A;  2ERV A;  3LK4 2;  3PGR A;  3SZV A;  2W80 C;  5GTI O;  3AA6 B;  3VY8 X;  1HXT A;  3AAA B;  2WJR A;  4G76 A;  4QQ1 A;  3VE1 A;  5H2F O;  5KAF O;  3POQ A;  2N2M A;  1MPF A;  4FZM A;  4LSH A;  3WU2 O;  2Y2X A;  1ORM A;  3T0S A;  2R4P A;  5AFU L;  1YS5 A;  4G75 A;  1BH3 A;  4RLC A;  4FSO A;  3KVD D;  3VZW X;  3NJT A;  3G7G A;  3SYB A;  2R4L A;  2R88 A;  4UB8 O;  2QTK A;  2IWV A;  5D5D A;  2JQY A;  2K0L A;  2XE3 A;  3SZD A;  2Y7S A;  4RJW A;  4F4B A;  1GFQ A;  5T5F A;  3VY9 X;  4AYE C;  3AA7 A;  4O3W A;  3SY9 A;  2XMX A;  1T1L A;  5IYU A;  1BXW A;  5ADX K;  3O0E A;  1GFO A;  2KDY A;  2X9K A;  4LSI A;  2YPV A;  5G26 A;  4AKR A;  4D5U A;  1OSM A;  3LK2 A;  3PGU A;  3VZT X;  1GFN A;  3VE2 A;  4N75 A;  4N58 A;  4AYN A;  4O4X A;  2R4O A;  2Y0H A; 
#chains in the Genus database with same CATH homology
 2ZLD A;  3POU A;  1MM4 A;  1GFM A;  1IZN B;  1Q9G A;  1H6S 1;  2M07 A;  4O3X B;  5DL7 A;  4AUI A;  1THQ A;  1ZHZ A;  4FRX A;  2KXP B;  1Q9F A;  4B61 A;  4FT6 A;  4N59 A;  5ADX K;  1MM5 A;  1HXX A;  3POR A;  4FRT A;  4RLB A;  5PRN A;  4E1S A;  2OMF A;  2J4U P;  1E54 A;  5EE2 A;  3NSG A;  4AKM A;  3TZG A;  1ZHX A;  3K19 A;  5DL5 A;  4FOZ A;  4AYM C;  4KR8 A;  4GCQ A;  1BT9 A;  3PQS A;  1HXU A;  2X27 X;  3AAE A;  3DA3 A;  4PUX A;  2J1N A;  3AA0 A;  4RL9 A;  3SYS A;  5GV0 A;  2KZ7 A;  4BUM X;  2XG6 A;  4FSP A;  1PHO A;  1G90 A;  2LFU A;  4LSF A;  2XE1 A;  3T24 A;  4AYI D;  4GCS A;  5JDP A;  6PRN A;  4JCH A;  4KRA A;  4C69 X;  3T20 A;  3UPG A;  3VZU X;  3HW9 A;  3WI5 A;  3LK4 1;  3EMN X;  3LK3 A;  3AA7 B;  2ODJ A;  4FZL A;  3RBH A;  2POR A;  3AA1 A;  4KR4 A;  2Y0L A;  4AKR B;  1P4T A;  3LK2 B;  2W81 C;  2ZFG A;  4GCP A;  3WI4 A;  2PRN A;  2LHF A;  2XTQ A;  3PQU A;  1OPF A;  2M06 A;  4XNK A;  4O3Y A;  4Z3T A;  3AA6 A;  3V8U A;  4AFK A;  3AAA A;  3HOL A;  5DL6 A;  2GE4 A;  5AFU K;  4XNL A;  8PRN A;  4D64 A;  3JTY A;  3UAQ A;  2FGR A;  1ZHY A;  1ZHW A;  5DL8 A;  5ADX L;  2MNH A;  3PRN A;  4D65 A;  1QJP A;  2N2L A;  3C5O A;  4RJX A;  4AYD C;  2KC0 A;  4FMS A;  7PRN A;  3AAE B;  3SY7 A;  2YNK A;  1GFP A;  3AA0 B;  3UU2 A;  2JMM A;  2KZ7 B;  2K4T A;  4O3Z A;  2XTR A;  3QRC A;  4FES A;  4E1T A;  3FYX A;  2F1T A;  3HOE A;  2Y0K A;  1QJ9 A;  1QJ8 A;  2XE2 A;  3QRA A;  3LK3 B;  3A2S X;  4GF4 A;  4O4U A;  5FVN A;  2FGQ X;  2MHL A;  1ZHT A;  3HWB A;  4GHB A;  1IZN A;  3AA1 B;  2O4V A;  2XE5 A;  3POX A;  4FUV A;  4LSE A;  4FZN A;  2F1V A;  4JFB A;  4O49 A;  1PRN A;  2KXP A;  3DA4 A;  4U9C A;  4AZL A;  3GP6 A;  2ERV A;  3LK4 2;  3SZV A;  2W80 C;  3AA6 B;  3VY8 X;  1HXT A;  3AAA B;  4G76 A;  4QQ1 A;  3VE1 A;  3POQ A;  2N2M A;  1MPF A;  4FZM A;  4LSH A;  2Y2X A;  1ORM A;  3T0S A;  5AFU L;  1YS5 A;  4G75 A;  1BH3 A;  4RLC A;  4FSO A;  3KVD D;  3VZW X;  3G7G A;  3SYB A;  2QTK A;  5D5D A;  3SZD A;  2K0L A;  2XE3 A;  2Y7S A;  4RJW A;  4F4B A;  1GFQ A;  5T5F A;  3VY9 X;  4AYE C;  3AA7 A;  4O3W A;  3SY9 A;  2XMX A;  5IYU A;  1BXW A;  3O0E A;  1GFO A;  2KDY A;  4LSI A;  2YPV A;  5G26 A;  4AKR A;  4D5U A;  1OSM A;  3LK2 A;  3VZT X;  1GFN A;  3VE2 A;  4N58 A;  4AYN A;  4O4X A;  2Y0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...