1MM5A

Solution nmr structure of the outer membrane enzyme pagp in og micelles
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
170
structure length
170
Chain Sequence
b'MNADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQFLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CrcA protein
publication title Solution Structure and Dynamics of the Outer Membrane Enzyme PagP by NMR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 24
structure length 170
sequence length 170
ec nomenclature ec 2.3.1.251: Lipid IV(A) palmitoyltransferase.
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07017 PagP Antimicrobial peptide resistance and lipid A acylation protein PagP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1mm5A00
1Q9FA 1QJPA 1MM5A 2GE4A 1P4TA 2F1TA 1QJ9A 2JMMA 3QRCA 2N2LA 2LHFA 1Q9GA 4RLCA 2K0LA 3G7GA 2N2MA 2F1VA 2ERVA 3C5OA 1MM4A 2M07A 4PUXA 1QJ8A 1ORMA 2MHLA 2M06A 3QRAA 3GP6A 2X27X 1G90A 1THQA 2MNHA 1BXWA
chains in the Genus database with same CATH superfamily
1OPFA 2WJRA 1MM5A 4QQ1A 2Y0KA 2AXTO 4KR4A 2YPVA 5AFUK 1HXTA 4O4UA 1GFNA 1QJ9A 2KZ7A 2XE5A 4FESA 4KRAA 5EE2A 3PGRA 4E1SA 4O49A 3AA7B 2XMXA 1IZNA 1BH3A 3LK41 4FSPA 4LSFA 4FZMA 4FT6A 4N74A 4RLCA 4AKRA 3NJTA 5AFUL 3DA3A 3AA1B 2J4UP 3BS0A 3AA0B 1ZHYA 3BRZA 1GFPA 3AA6A 4FZNA 4GF4A 3PORA 2J1NA 4FQEA 4LSHA 2F1VA 3UU2A 2W80C 3JCUO 3KZIO 3PQSA 4GHBA 4O3ZA 2F1CX 5DL8A 4AYNA 2Y0LA 4FSOA 3AA7A 2FGQX 4FRXA 5DL6A 5G39A 3VZUX 4BUMX 4N58A 3QRAA 2R89A 5H2FO 2KZ7B 2KXPA 2X27X 3PRNA 4RL9A 2WJQA 4JCHA 7PRNA 1G90A 2QTKA 2W81C 2PRNA 4FUVA 1PRNA 4UB8O 4E1TA 2IWWA 1IZNB 5T5FA 1QJPA 4AKRB 3JTYA 3T20A 3VY8X 2IWVA 2XG6A 4Z3TA 1P4TA 4G76A 2JMMA 2K4TA 3DA4A 4RLBA 5GTIO 3AA6B 3QRCA 5JDPA 3HWBA 4C00A 4AYDC 5GV0A 3RBHA 2XE3A 4O3WA 3HW9A 3FYXA 5FVNA 4K3BA 5G38A 4D64A 2XE2A 3SY9A 2KXPB 2R4PA 1ZHZA 3BRYA 3KVDD 3POUA 5G26A 1PHOA 2PORA 1T16A 2WVPA 1MM4A 2ZLDA 3VY9X 4XNLA 1ORMA 2OMFA 2XTQA 4UB6O 2YNKA 2FGRA 3SY7A 5ADXK 3TZGA 4AKMA 3EMNX 4K3CA 3VE2A 4FRTA 4C69X 1GFOA 5GTHO 4FOZA 3PGSA 3DZMA 4N59A 3O0EA 2F1TA 3LK42 4G75A 4AUIA 4XNKA 3LK2A 4N75A 2R8AA 5E79O 3VE1A 2N2LA 5ADXL 5IYUA 4FMSA 2ZFGA 4O3XB 4PR7A 3WI4A 1Q9GA 3NSGA 4O4XA 5TISO 2R4NA 4AYEC 2K0LA 1GFQA 3G7GA 1H6S1 2XE1A 3AAEB 3SZVA 4AFKA 3UPGA 1T1LA 4AYID 3SZDA 3HOLA 6PRNA 5DL7A 4KR8A 3PF1A 3SYBA 2R4LA 2M07A 4PUXA 3AAAA 4AZLA 4CTDA 1BT9A 1QJ8A 4LSEA 4F4BA 3HOEA 2LFUA 3A2SX 3AAEA 3GP6A 4IL6O 2Y0HA 3V8UA 4D65A 3LK2B 3VZTX 1GFMA 2MNHA 3K19A 4GCQA 3PGUA 1OSMA 5B66O 1Q9FA 5D5DA 1MPFA 8PRNA 3T24A 2GE4A 3SYSA 5B5EO 3LK3A 1E54A 3VZWX 2R88A 5KAIO 5G3AA 4FZLA 5PRNA 4LSIA 2LHFA 4PJ0O 4RJWA 3WI5A 4C4VB 4GCPA 1ZHWA 2R4OA 1HXUA 3A0BO 4GCSA 3AAAB 2X9KA 3POQA 3WU2O 2ODJA 2JQYA 2XTRA 4O3YA 2KDYA 3A0HO 4U9CA 2N2MA 3DWOX 3UAQA 4AYMC 2Y7SA 3PQUA 2ERVA 4RJXA 4D5UA 5DL5A 3C5OA 2Y2XA 3POXA 1HXXA 1ZHTA 2MHLA 2O4VA 3AA1A 1ZHXA 2M06A 2KC0A 3AA0A 3LK3B 4JFBA 1S5LO 1THQA 1YS5A 4B61A 3DWNA 5KAFO 4C4VA 1BXWA 3T0SA
chains in the Genus database with same CATH topology
1OPFA 1MM5A 4QQ1A 2Y0KA 4KR4A 5AFUK 2YPVA 1HXTA 4O4UA 1GFNA 1QJ9A 2KZ7A 2XE5A 4FESA 4KRAA 5EE2A 4E1SA 4O49A 3AA7B 2XMXA 1IZNA 1BH3A 3LK41 4FSPA 4LSFA 4FZMA 4FT6A 4RLCA 4AKRA 5AFUL 3DA3A 3AA1B 2J4UP 3AA0B 1ZHYA 1GFPA 3AA6A 4FZNA 4GF4A 3PORA 2J1NA 4LSHA 2F1VA 3UU2A 2W80C 3PQSA 4GHBA 4O3ZA 4AYNA 5DL8A 2Y0LA 4FSOA 3AA7A 2FGQX 4FRXA 5DL6A 3VZUX 4BUMX 4N58A 3QRAA 2KZ7B 2KXPA 2X27X 3PRNA 4RL9A 7PRNA 4JCHA 1G90A 2QTKA 2W81C 2PRNA 4FUVA 1PRNA 4E1TA 1IZNB 5T5FA 1QJPA 4AKRB 3JTYA 3T20A 3VY8X 2XG6A 4Z3TA 1P4TA 4G76A 2JMMA 2K4TA 3DA4A 4RLBA 3AA6B 3QRCA 5JDPA 3HWBA 4AYDC 5GV0A 3RBHA 2XE3A 4O3WA 3HW9A 3FYXA 5FVNA 4D64A 2XE2A 3SY9A 2KXPB 1ZHZA 3KVDD 3POUA 5G26A 1PHOA 2PORA 2ZLDA 3VY9X 1MM4A 4XNLA 1ORMA 2XTQA 2OMFA 2YNKA 2FGRA 3SY7A 5ADXK 3TZGA 4AKMA 3EMNX 3VE2A 4FRTA 4C69X 1GFOA 4FOZA 4N59A 3O0EA 2F1TA 3LK42 4G75A 4AUIA 4XNKA 3LK2A 3VE1A 5IYUA 5ADXL 2N2LA 4FMSA 2ZFGA 4O3XB 4AYEC 1Q9GA 3NSGA 4O4XA 2K0LA 1GFQA 3G7GA 1H6S1 2XE1A 3AAEB 3SZVA 4AFKA 3UPGA 4AYID 3SZDA 3HOLA 6PRNA 5DL7A 4KR8A 3SYBA 4AZLA 2M07A 4PUXA 3AAAA 1BT9A 1QJ8A 4LSEA 4F4BA 3HOEA 2LFUA 3A2SX 3AAEA 3GP6A 2Y0HA 3V8UA 4D65A 3LK2B 3VZTX 1GFMA 2MNHA 3K19A 4GCQA 1OSMA 1Q9FA 5D5DA 1MPFA 8PRNA 3T24A 2GE4A 3SYSA 3LK3A 1E54A 3VZWX 4FZLA 5PRNA 4LSIA 2LHFA 4RJWA 3WI5A 4GCPA 1ZHWA 1HXUA 4GCSA 3AAAB 3POQA 2ODJA 2XTRA 4O3YA 4U9CA 2KDYA 2N2MA 3UAQA 4AYMC 2Y7SA 3PQUA 2ERVA 4RJXA 4D5UA 5DL5A 3C5OA 2Y2XA 3POXA 1HXXA 1ZHTA 2MHLA 2O4VA 3AA1A 1ZHXA 2M06A 2KC0A 3AA0A 3LK3B 4JFBA 1THQA 4B61A 1YS5A 3WI4A 1BXWA 3T0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9F A;  1QJP A;  1MM5 A;  2GE4 A;  1P4T A;  2F1T A;  1QJ9 A;  2JMM A;  3QRC A;  2N2L A;  2LHF A;  1Q9G A;  4RLC A;  2K0L A;  3G7G A;  2N2M A;  2F1V A;  2ERV A;  3C5O A;  1MM4 A;  2M07 A;  4PUX A;  1QJ8 A;  1ORM A;  2MHL A;  2M06 A;  3QRA A;  3GP6 A;  2X27 X;  1G90 A;  1THQ A;  2MNH A;  1BXW A; 
#chains in the Genus database with same CATH topology
 1OPF A;  2WJR A;  1MM5 A;  4QQ1 A;  2Y0K A;  2AXT O;  4KR4 A;  2YPV A;  5AFU K;  1HXT A;  4O4U A;  1GFN A;  1QJ9 A;  2KZ7 A;  2XE5 A;  4FES A;  4KRA A;  5EE2 A;  3PGR A;  4E1S A;  4O49 A;  3AA7 B;  2XMX A;  1IZN A;  1BH3 A;  3LK4 1;  4FSP A;  4LSF A;  4FZM A;  4FT6 A;  4N74 A;  4RLC A;  4AKR A;  3NJT A;  5AFU L;  3DA3 A;  3AA1 B;  2J4U P;  3BS0 A;  3AA0 B;  1ZHY A;  3BRZ A;  1GFP A;  3AA6 A;  4FZN A;  4GF4 A;  3POR A;  2J1N A;  4FQE A;  4LSH A;  2F1V A;  3UU2 A;  2W80 C;  3JCU O;  3KZI O;  3PQS A;  4GHB A;  4O3Z A;  2F1C X;  5DL8 A;  4AYN A;  2Y0L A;  4FSO A;  3AA7 A;  2FGQ X;  4FRX A;  5DL6 A;  5G39 A;  3VZU X;  4BUM X;  4N58 A;  3QRA A;  2R89 A;  5H2F O;  2KZ7 B;  2KXP A;  2X27 X;  3PRN A;  4RL9 A;  2WJQ A;  4JCH A;  7PRN A;  1G90 A;  2QTK A;  2W81 C;  2PRN A;  4FUV A;  1PRN A;  4UB8 O;  4E1T A;  2IWW A;  1IZN B;  5T5F A;  1QJP A;  4AKR B;  3JTY A;  3T20 A;  3VY8 X;  2IWV A;  2XG6 A;  4Z3T A;  1P4T A;  4G76 A;  2JMM A;  2K4T A;  3DA4 A;  4RLB A;  5GTI O;  3AA6 B;  3QRC A;  5JDP A;  3HWB A;  4C00 A;  4AYD C;  5GV0 A;  3RBH A;  2XE3 A;  4O3W A;  3HW9 A;  3FYX A;  5FVN A;  4K3B A;  5G38 A;  4D64 A;  2XE2 A;  3SY9 A;  2KXP B;  2R4P A;  1ZHZ A;  3BRY A;  3KVD D;  3POU A;  5G26 A;  1PHO A;  2POR A;  1T16 A;  2WVP A;  1MM4 A;  2ZLD A;  3VY9 X;  4XNL A;  1ORM A;  2OMF A;  2XTQ A;  4UB6 O;  2YNK A;  2FGR A;  3SY7 A;  5ADX K;  3TZG A;  4AKM A;  3EMN X;  4K3C A;  3VE2 A;  4FRT A;  4C69 X;  1GFO A;  5GTH O;  4FOZ A;  3PGS A;  3DZM A;  4N59 A;  3O0E A;  2F1T A;  3LK4 2;  4G75 A;  4AUI A;  4XNK A;  3LK2 A;  4N75 A;  2R8A A;  5E79 O;  3VE1 A;  2N2L A;  5ADX L;  5IYU A;  4FMS A;  2ZFG A;  4O3X B;  4PR7 A;  3WI4 A;  1Q9G A;  3NSG A;  4O4X A;  5TIS O;  2R4N A;  4AYE C;  2K0L A;  1GFQ A;  3G7G A;  1H6S 1;  2XE1 A;  3AAE B;  3SZV A;  4AFK A;  3UPG A;  1T1L A;  4AYI D;  3SZD A;  3HOL A;  6PRN A;  5DL7 A;  4KR8 A;  3PF1 A;  3SYB A;  2R4L A;  2M07 A;  4PUX A;  3AAA A;  4AZL A;  4CTD A;  1BT9 A;  1QJ8 A;  4LSE A;  4F4B A;  3HOE A;  2LFU A;  3A2S X;  3AAE A;  3GP6 A;  4IL6 O;  2Y0H A;  3V8U A;  4D65 A;  3LK2 B;  3VZT X;  1GFM A;  2MNH A;  3K19 A;  4GCQ A;  3PGU A;  1OSM A;  5B66 O;  1Q9F A;  5D5D A;  1MPF A;  8PRN A;  3T24 A;  2GE4 A;  3SYS A;  5B5E O;  3LK3 A;  1E54 A;  3VZW X;  2R88 A;  5KAI O;  5G3A A;  4FZL A;  5PRN A;  4LSI A;  2LHF A;  4PJ0 O;  4RJW A;  3WI5 A;  4C4V B;  4GCP A;  1ZHW A;  2R4O A;  1HXU A;  3A0B O;  4GCS A;  3AAA B;  2X9K A;  3POQ A;  3WU2 O;  2ODJ A;  2JQY A;  2XTR A;  4O3Y A;  2KDY A;  3A0H O;  4U9C A;  2N2M A;  3DWO X;  3UAQ A;  4AYM C;  2Y7S A;  3PQU A;  2ERV A;  4RJX A;  4D5U A;  5DL5 A;  3C5O A;  2Y2X A;  3POX A;  1HXX A;  1ZHT A;  2MHL A;  2O4V A;  3AA1 A;  1ZHX A;  2M06 A;  2KC0 A;  3AA0 A;  3LK3 B;  4JFB A;  1S5L O;  1THQ A;  1YS5 A;  4B61 A;  3DWN A;  5KAF O;  4C4V A;  1BXW A;  3T0S A; 
#chains in the Genus database with same CATH homology
 1OPF A;  1MM5 A;  4QQ1 A;  2Y0K A;  4KR4 A;  5AFU K;  2YPV A;  1HXT A;  4O4U A;  1GFN A;  1QJ9 A;  2KZ7 A;  2XE5 A;  4FES A;  4KRA A;  5EE2 A;  4E1S A;  4O49 A;  3AA7 B;  2XMX A;  1IZN A;  1BH3 A;  3LK4 1;  4FSP A;  4LSF A;  4FZM A;  4FT6 A;  4RLC A;  4AKR A;  5AFU L;  3DA3 A;  3AA1 B;  2J4U P;  3AA0 B;  1ZHY A;  1GFP A;  3AA6 A;  4FZN A;  4GF4 A;  3POR A;  2J1N A;  4LSH A;  2F1V A;  3UU2 A;  2W80 C;  3PQS A;  4GHB A;  4O3Z A;  4AYN A;  5DL8 A;  2Y0L A;  4FSO A;  3AA7 A;  2FGQ X;  4FRX A;  5DL6 A;  3VZU X;  4BUM X;  4N58 A;  3QRA A;  2KZ7 B;  2KXP A;  2X27 X;  3PRN A;  4RL9 A;  7PRN A;  4JCH A;  1G90 A;  2QTK A;  2W81 C;  2PRN A;  4FUV A;  1PRN A;  4E1T A;  1IZN B;  5T5F A;  1QJP A;  4AKR B;  3JTY A;  3T20 A;  3VY8 X;  2XG6 A;  4Z3T A;  1P4T A;  4G76 A;  2JMM A;  2K4T A;  3DA4 A;  4RLB A;  3AA6 B;  3QRC A;  5JDP A;  3HWB A;  4AYD C;  5GV0 A;  3RBH A;  2XE3 A;  4O3W A;  3HW9 A;  3FYX A;  5FVN A;  4D64 A;  2XE2 A;  3SY9 A;  2KXP B;  1ZHZ A;  3KVD D;  3POU A;  5G26 A;  1PHO A;  2POR A;  2ZLD A;  3VY9 X;  1MM4 A;  4XNL A;  1ORM A;  2XTQ A;  2OMF A;  2YNK A;  2FGR A;  3SY7 A;  5ADX K;  3TZG A;  4AKM A;  3EMN X;  3VE2 A;  4FRT A;  4C69 X;  1GFO A;  4FOZ A;  4N59 A;  3O0E A;  2F1T A;  3LK4 2;  4G75 A;  4AUI A;  4XNK A;  3LK2 A;  3VE1 A;  5IYU A;  5ADX L;  2N2L A;  4FMS A;  2ZFG A;  4O3X B;  4AYE C;  1Q9G A;  3NSG A;  4O4X A;  2K0L A;  1GFQ A;  3G7G A;  1H6S 1;  2XE1 A;  3AAE B;  3SZV A;  4AFK A;  3UPG A;  4AYI D;  3SZD A;  3HOL A;  6PRN A;  5DL7 A;  4KR8 A;  3SYB A;  4AZL A;  2M07 A;  4PUX A;  3AAA A;  1BT9 A;  1QJ8 A;  4LSE A;  4F4B A;  3HOE A;  2LFU A;  3A2S X;  3AAE A;  3GP6 A;  2Y0H A;  3V8U A;  4D65 A;  3LK2 B;  3VZT X;  1GFM A;  2MNH A;  3K19 A;  4GCQ A;  1OSM A;  1Q9F A;  5D5D A;  1MPF A;  8PRN A;  3T24 A;  2GE4 A;  3SYS A;  3LK3 A;  1E54 A;  3VZW X;  4FZL A;  5PRN A;  4LSI A;  2LHF A;  4RJW A;  3WI5 A;  4GCP A;  1ZHW A;  1HXU A;  4GCS A;  3AAA B;  3POQ A;  2ODJ A;  2XTR A;  4O3Y A;  4U9C A;  2KDY A;  2N2M A;  3UAQ A;  4AYM C;  2Y7S A;  3PQU A;  2ERV A;  4RJX A;  4D5U A;  5DL5 A;  3C5O A;  2Y2X A;  3POX A;  1HXX A;  1ZHT A;  2MHL A;  2O4V A;  3AA1 A;  1ZHX A;  2M06 A;  2KC0 A;  3AA0 A;  3LK3 B;  4JFB A;  1THQ A;  4B61 A;  1YS5 A;  3WI4 A;  1BXW A;  3T0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...