1MM9A

Streptavidin mutant with insertion of fibronectin hexapeptide, including rgd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPGRGDSPGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Structural characterization and comparison of RGD cell-adhesion recognition sites engineered into streptavidin.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1mm9A00
4BX7B 2RTLA 1VWEB 1SWPA 1N43A 2RTFB 2UYWA 2F01A 1HXZA 3X00A 3FDCA 1SWRA 2G5LA 4BJ8A 5CHKA 1HXLA 1WBIA 1SWJA 1LCZA 2WPUA 4YVBA 2RTCB 1SRHA 1SWHA 3RDQA 5JD2A 4BX7A 1VWCB 2FHNX 3RE6A 5K67A 2MF6A 1SWCA 4GGTA 1KFFA 3RDSA 2C1QA 1SWGA 1NC9A 1VWRB 1NQMA 2IZFB 2RTRB 4I60A 4GGRA 4BCSA 1NQNA 2IZCB 5IRUA 1SWNA 2Y32A 1SRGA 1VWPB 3VGWA 2FHLA 3SZHA 1VWDB 1VWHB 4Z6JA 1NBXA 2RTQB 3WZNA 2OFBA 1VWNB 1VWQB 1N7YA 1MEPA 1RAVA 3T2WA 2RTMA 2IZDB 1RXHA 2IZAA 4Z2VA 1SLEB 2C1SA 2IZIA 1Y53X 1HY2A 4U46A 3RE5A 3RY1A 1LUQA 1KL3A 1SWOA 1STSB 3PK2A 2OF8A 4GD9A 1N4JA 1IJ8A 1N9YA 1VWIB 2RTDB 2IZKA 4CPHB 2GH7A 1AVEA 1SLGB 1VWMB 2JGSA 1STPA 1RXKA 2A5BA 1LCVA 1LELA 3RDOA 2RTAA 2RTNB 4GJSA 5B5GA 1SWAA 1I9HA 5CSEA 2QCBA 2A5CA 1SWKA 4OKAA 2IZGB 3VHMA 3EW2A 4GGZA 3VHIA 4BX6B 1MOYA 2IZLB 1KL4A 1SRJA 2RTKA 4BX5A 3RY2A 3EW1A 4CPHA 5IRWA 1VWKB 1SWQA 3WZOA 4GDAA 2CAMA 1VWAB 2C4IA 2RTIB 4Z28A 1SWFA 4JHQA 1MM9A 3MG5A 1SRIA 1SWDA 3VHHA 1LDOA 2IZHB 2RTHB 1SWTA 1RSTB 1SWEA 1RXJA 1SWSA 1NDJA 1LCWA 1VWJB 2IZJA 4BX6A 1VWLB 3T6FA 1AVDA 4IRWA 1RSUB 4BBOA 4BX5B 2ZSCA 2Y3FA 2RTGB 1SRFA 5K68A 1PTSA 3WYQA 2IZBA 1SWLA 2AVIA 4JNJA 1SLDB 2IZEB 3SZIA 3RDMA 3SZJA 4EKVA 4DNEA 1Y52X 4Z27A 1VWBB 3T2XA 4CPEA 4Z2PA 5L3YA 2A8GA 3RDXA 1LDQA 2BC3A 4CPFA 5F2BA 3RDUA 3T6LA 1DF8A 1N9MA 1HQQA 1MK5A 5B5FA 1STRB 2RTPB 1Y55X 2RTOB 4GJVA 3WZPA 2Y3EA 2RTJA 4Z2OA 2RTBB 4Y59A 4CPIA 1KL5A 2OF9A 2RTEB 1SWUA 3MM0A 1SREA 1VWGB 4Y5DA 4JO6A 5IRAA 2UZ2A 3WYPA 1SLFB 1SWBA 2OFAA 3WZQA 1VWFB 1VYOA 1VWOB
chains in the Genus database with same CATH superfamily
2LKKA 4BX7B 2DJFA 2RTLA 2OZQA 3APVA 1ALBA 2ACPX 3X00A 4ALOA 1HMSA 1SWRA 4LKPA 4NNSA 2G5LA 2WEWA 3NQ9A 4KC8A 2QMIA 5CHKA 2RA6A 3P6FA 4YVBA 2OL7A 3KFGA 4LZVA 4O49A 5D8JA 2ANSA 5HCCC 2WSJA 1G74A 3VPJE 2VFBA 4WBKA 2LFOA 1CRBA 1T68X 2E4JA 4I95A 1FEMA 4RUUA 4CDEA 5HTDA 1BWYA 4O9SA 3NPOA 1SWCA 2HYSA 4YBUA 4GGTA 1KFFA 4IAWA 2OY7A 3TZSA 1BRPA 1ML7A 1SY2A 1U18A 2OVDA 3BS2A 4QGWA 4YCEA 3P24A 3STKA 5C0NA 3F9DA 1LIDA 2AF5A 4GNWA 1JV4A 1Y0GA 4AYHA 3SZHA 4D6AA 1VWHB 1MUPA 4YGGA 3VG4A 5LJHA 2KTDA 2PI3O 2G8CO 1X8PA 3WVMA 2OFBA 3CBSA 1OPBA 1QQSA 1T0VA 4GKCA 1HMTA 3BU9A 4O4UA 5FAZA 3T2WA 3UEVA 2CZUA 1BEBA 5AJBA 2X8FA 1SMPI 1B56A 1RXHA 2AT3X 3PQUA 3SLOA 1ACDA 1BSYA 4BGFA 1OEEA 2OFRX 3FW5A 1LIEA 1LKEA 1YWBA 4EKVA 1Y9TA 3RY1A 1KL3A 2AT5X 2JU7A 2ZAIA 3PK2A 4GD9A 4CPHB 2MJIA 3STMX 1AVEA 3MVFA 3WBGA 2A0AA 5B29A 2A5BA 3PPTA 5EEEA 2X32A 2RTNB 5LKFA 1JJXA 1SA8A 3ZI8A 2GTFX 3WJFA 1SY1A 1BLRA 1SXUA 2BS6A 4TKJA 1KL4A 1ZNHA 2X45A 3EW1A 4M6SA 2FWVA 4OS3A 1E02A 4ORUA 3RWXA 2CAMA 1VWAB 4MIRA 2ACOA 1E5PA 2BT9A 4GK9A 4QNIA 3TGAA 4O3XB 1LDOA 5BVSA 4DQ3A 1SWTA 1X8UA 1SWEA 3NQ3A 1SWSA 2KT4B 2CM4A 3SAOA 4HWMA 1VWJB 2IZJA 1DZJA 2W2AA 2POAA 2RQ0A 5EZ2A 3LHNA 4IRWA 4ES7A 2Q4NA 1A3YA 2Q39A 4QZUA 5H9NA 1YP7A 2X8SA 4IB8A 3RSWA 1UYNX 3HTYA 1SRFA 5FQ7E 1SWLA 2QOSC 5LJGA 1PBOA 3PQSA 1W5RA 1O8VA 4YKOA 1EW3A 4CDDA 2AMMX 4Z27A 3T2XA 2KW1A 2QM9A 2VFCA 3ZUOA 4CPEA 5L3YA 3VG3A 4CPFA 4IMOA 5LJBA 2FR2A 1KQXA 5HAEA 3EYCA 4O4XA 1KXOA 1MK5A 4OMXA 2Q2PA 4FGIB 2MHDA 5HBSA 3BLGA 5HZ9A 2RTPB 1JZUA 2FKJA 3OE3A 3WZPA 4A1YA 2RTJA 4I3CA 3P6HA 1KT4A 4HPBA 3BX7A 1SWUA 4BQUA 2FLJA 3CKFA 3WYPA 1OSPO 2AH7X 1QY2A 3F8AA 4YFRA 1WUBA 1NGLA 5EDCA 1MVGA 1TOWA 1VWOB 5FFHA 5HCEC 1TXLA 1S7DA 2RTFB 3ZW0B 2F01A 3I17A 3BY0A 4O4OA 1HXLA 1D3SA 1DFVA 1X71A 3PH5A 4I3DA 2G7BA 4YFPA 2ZAGA 3VG5A 4GZVA 1GKAA 1JBHA 4KCAA 1SWHA 3HOEA 3NP1A 4ON1A 4ORXA 4R0BA 3WXQA 1VWCB 4IB9A 1S2PA 3FLLA 3LV4A 2AL0X 2Q2MA 3G7XA 2CBRA 2HLVA 1P6PA 4UU3A 2MF6A 2WQ9A 5H9AA 3SOTA 5F6BA 1SXYA 4QYNA 3RDSA 1YWDA 4NV7A 1SWGA 1NC9A 1VWRB 1PMPA 1EPBA 1OPAA 2IZFB 4I60A 1AB0A 4NYQA 3PEDA 4GDZA 4OELA 5F58A 4GH7A 4YMYA 4ZHHA 4WHIA 1VWPB 2FHLA 4ZHDA 2GTLN 5FQ8E 2GC9A 1NBXA 4A1HA 4COTA 1B8EA 1FTPA 1KT3A 2I5ZO 3JQOA 3OJYC 1EI5A 1XKIA 1HQPA 1BJ7A 1MEPA 1RAVA 2RTMA 3C76X 2LBVA 2JW1A 3ZUIA 3B2KA 3JS1A 1RBPA 5H9KA 3P6DA 2OVAA 2KD2A 1I04A 1MDCA 2C1SA 2X56A 3BSZE 3CQRA 4GNYA 3RE5A 3QKGA 4DQ4A 1SY0A 2OF8A 4ORWA 3UEWA 2IZKA 4KT5A 4O3YA 1SLGB 4ID2A 1QWDA 1VWMB 2JGSA 2W2FA 3D97A 4I9SA 1LCVA 2WR6A 3IA8A 5BVTA 5IO7A 2JMBA 2X46A 4A60A 4GJSA 2CZTA 2F73A 1I9HA 5CSEA 2QCBA 4B55A 1BM5A 1ICMA 4IABA 2VDFA 1ADLA 1W4TA 1KZWA 4WFUA 1SRJA 3EC5A 3D96A 3AEHA 5JR8A 1SY3A 5AQ6A 1SWQA 3WZOA 4GDAA 4OS0A 4TNNA 2RTIB 3WJDA 3ZQ3A 1GX3A 3KFIA 3P6GA 4GUZA 2O62A 2YMSA 3AUMO 1SWDA 4Z28A 3VG6A 1ZNGA 3D9WA 3ZWEA 3APXA 5KICA 2OY5O 1RXJA 1A57A 4Y0RA 1KZXA 3BRNA 3O22A 1X89A 3KQ0A 1LCWA 5LJCA 1S44A 1QFTA 1VWLB 4CV7A 1AVDA 3T6FA 2K23A 1JQPA 1GT1A 1RSUB 5HTEA 3CMPA 4AW8A 4BX5B 1IKEA 2HNXA 4C5PA 2NNEA 1ERBA 1GM6A 2FR3A 2RN4A 2Y3FA 1EALA 4YDBA 1XCAA 4GU8A 1AVGI 1GT4A 2IZBA 1EUOA 2GTLM 1ZNLA 2AT6X 5LKEA 4Y0SA 4NLJA 1VYFA 2IZEB 4ZFXA 4GE1A 4ZGFA 3S26A 3CWKA 1B4MA 3MBTA 3HK1A 4EEJA 4NNTA 3HPEA 1KOIA 2L9CA 4YH0A 1LIFA 4LZUA 1U0XA 2A8GA 3RDXA 4FBOA 5F2BA 3RDUA 4KC7A 4GETA 1R0UA 3BDRA 1N9MA 4O3ZA 3RBYA 3FA8A 4QGVA 5L8OA 1HQQA 4FQBB 3FEKA 4K19A 1HN2A 5B5FA 1U17A 3KVNA 1JIWI 2HZQA 2Y3EA 1Z24A 2YG2A 2ASNX 1ZNDA 2QO5A 5BVQA 3BX8A 1KL5A 2RTEB 1EXSA 1LNMA 1VWGB 3ZW1A 4JO6A 2UZ2A 2G78A 3O2YA 4CSBA 1SLFB 1SWBA 3B2IA 2OFAA 4QZTA 3WZQA 3NQKA 4ZH9A 3UAQA 4M7MA 1VYOA 1OBPA 3HWEA 1PEEA 1VWEB 3WJBA 1N43A 4YDAA 3Q6LA 1OBQA 3FDCA 2HKDA 4ARHA 5LJDA 1WBIA 1IFCA 4EXZA 4ML7B 4O3WA 1SWJA 3S5XA 3VG7A 4CK4A 5LJKA 2RCTA 5HZ6A 4IAXA 2RTCB 1QG5A 3RDQA 1B0OA 1IIUA 2Q9SA 5JD2A 5D4AA 5B27A 1W6FA 4ZHGA 5K06A 4MVIA 2ALLX 1X8QA 1YWAA 2AKQA 3NBXX 1KT5A 1QFVA 1GX9A 2C1QA 1DF3A 5F1EA 4NLIA 1NQMA 4GGRA 2F09A 2IZCB 1SWNA 1VPRA 2Y32A 1SRGA 4BVMA 1VWDB 4RUNA 4U8UN 2CM9A 4Y0QA 2RTQB 1FDQA 3WZNA 3KFFA 1JJJA 1GX8A 3AKMA 4YBPA 1VWNB 1N7YA 1T8VA 1VYGA 4D6BA 4YCHA 1BSQA 2IZDB 2L5PA 1HBPA 3ZZVA 5HZQA 1CBIA 4XMEA 2XSTA 2MM3A 4NV8A 2IZIA 1HY2A 1NP1A 1SWOA 1CBSA 3VE2A 1HBQA 1STSB 5HWZA 5D48A 4N7CA 2RTDB 1FELA 3K3LA 1E2TA 2FRSA 2GH7A 2R74A 3I0AA 3IFBA 4YGZA 4EQAC 3P6CA 4EFGA 4IB7A 1EIIA 3CR6A 1LELA 3U9PC 4DCBA 5IXGA 2N93A 3OBLA 4U9CA 1EPAA 2FGSA 2RTAA 3FMZA 4ORRA 2HZRA 1SWAA 2HMBA 2CBSA 3FR2A 2LA7A 3HWDA 4UU2A 5HA1A 5B5GA 3STNA 4OKAA 3FEPA 4TJZA 1OBUA 4HPCA 3VHIA 3FW4A 1MOYA 1KQWA 2IZLB 3NR3A 3NX2A 4JGLA 3RY2A 5IRWA 1I4UA 4EDEA 1VWKB 1TOUA 1OEJA 2A2GA 2OY8A 2OFMX 4NW4A 1SWFA 1MM9A 3MG5A 1A18A 1SRIA 3VHHA 2IZHB 3KFHA 4AZOA 1CJ5A 5FQ6E 4NYRA 3VG2A 1RSTB 2RCQA 2JU3A 4L1NA 2AT0X 4BX6A 2X34A 2W2BA 1Y9LA 4I6SA 4QQ1A 4AZRA 5D45A 3V8UA 4BBOA 1YIVA 1DZPA 4NP1A 3EM0A 1QABE 4IBAA 1KT7A 2GTLO 5K68A 1PTSA 2FT9A 1K3BA 2AVIA 4U8UM 1TW4A 4ZHCA 2OL6O 3HOLA 2AT8X 1QY1A 1UREA 1UYOX 2FKGA 5F6ZA 4ZH6A 2OYBO 1I05A 1Y52X 3FR5A 3RDMA 3SZJA 3WOVA 1VWBB 3FIQA 1EIOA 1JJUA 2KTSA 4Z2PA 2BHVA 2X4MA 2RD7C 1LDQA 3H3IA 1KT6A 3ZW1B 1HMRA 1IFBA 3S60A 1JMXA 3FENA 1JMZA 2WUTA 3FA6A 3L4RA 4ZCBA 3T1DA 1X8OA 2RTOB 3B2JA 3P6EA 2QO6A 4GJVA 3ZW0A 2FS7A 4HPDA 3PP6A 2RTBB 4Y59A 3F6ZB 2BS5A 4CDCA 4CPIA 4TLJA 3MM0A 1SREA 4Y5DA 5IRAA 1A2DA 5CYBA 4ZHFA 4IMNA 1CBQA 2I5VO 5EPQA 5DG4A 3TF6A 4TKHA 4AZQA 1GXAA 2JN3A 4L3RA 4QGXA 1N0SA 3PDFA 4AZPA 1SWPA 4FBRA 3PECA 2UYWA 1HXZA 3TGCA 2MWHA 4TKBA 5H8TA 1YWCA 4YGHA 4BJ8A 1OEKA 1LFOA 2MO5A 1E00A 4MISA 4ALBA 3D95A 1LCZA 2WPUA 4HPAA 4I3BA 4BOEA 3DTQA 3VE1A 3FYFA 4XMFA 1SRHA 4BX7A 5L8NA 2FHNX 2FTBA 5IO5A 1X8NA 3RE6A 1I06A 5K67A 2K62A 1SXXA 3FA7A 4LKTA 1BBPA 2R73A 3N91A 4YKMA 3OD9A 3RZYA 3ELXA 2RTRB 4MVKA 1BRQA 3EBKA 5FENA 4A8ZA 4BCSA 1D2UA 1NQNA 3ELZA 5IRUA 3APUA 1IW2A 4QYPA 3VGWA 2NNDA 4PSQA 5AJCA 1GKAB 4Z6JA 1MX7A 3HWFA 4MVLA 3HWGA 1H91A 1FJ1E 2X55A 4Y0PA 1VWQB 1O1UA 1JYDA 2OVSA 2PY1A 4ZJ0A 1K24A 2IZAA 3CKGA 1IKJA 1LICA 4MEEA 3QQ2A 5EEDA 1RLBE 3EMMA 3FIDA 3NADA 3P02A 2LBAA 2A2UA 2P8GA 4Z2VA 4XMDA 1SLEB 1O1VA 2G79A 3C77X 1Y53X 1LIBA 3FELA 4OMWA 2QOMA 1LUQA 1PBYA 4FBVA 4U46A 1DZKA 4AZMA 1PM1X 4PJ2A 1DC9A 1G85A 1N4JA 1IJ8A 1N9YA 1VWIB 3VU1A 5B3MO 1MX8A 4INNA 1EQDA 2OY1O 4HFOA 3TGBA 1FE3A 1STPA 3S5VA 1RXKA 4IB6A 3KZAA 3ZW2A 1AELA 3C78X 1SXWA 2Z4HA 4XMGA 3RDOA 1E06A 2XKLA 3SLJA 3FA9A 4LQZA 1DZMA 1ZRYA 4U3QA 2DJGA 2A5CA 1SWKA 5B10O 2IZGB 3O19A 1UZ2X 3EW2A 3GE2A 3JSQA 2OVEA 3NX1A 4GGZA 2RTKA 3VHMA 4BX5A 4BX6B 4CPHA 2BLGA 1L6MA 2C4IA 4ZGUA 4JHQA 5L8IA 4N7DA 4AZNA 3WJEA 2WWPA 2R56A 3B2LA 4GRJA 2RTHB 2IFBA 2NP1A 1GT3A 4WFVA 1ZNKA 2JOZA 2QO4A 5HZ5A 1KGLA 4ODDA 2Z4IA 1NDJA 3UEUA 1GT5A 4ORSA 1ERXA 1JYJA 2JU8A 1G7NA 3CQNA 4QRLA 5B11O 1BSOA 3EBWA 4CDFA 3DSZA 5BYPA 4YFQA 3GAQA 1AQBA 2ZSCA 2DM5A 1CBRA 2LB6A 2RTGB 3E3CA 3LTWA 5KIDA 2FS6A 5LJEA 4U8UO 3WYQA 3U0DA 1NP4A 4JNJA 4OS8A 3SLTA 5CE4A 1SLDB 2WEXA 3AKNA 4OEMA 4KH8A 3SZIA 1DV9A 1ZNEA 2NNQA 3APWA 3MX7A 5EDBA 3WJCA 1YUPA 4O4SA 4ORYA 5B2AO 4DNEA 2A3FX 5KHPA 3UEXA 2WQAE 4XMCA 5F7GA 4MVEA 1YP6A 2BC3A 3BU1A 5H9LA 3Q34A 4I9RA 4ZR2A 3T6LA 2EU7X 5AEOA 1DF8A 2OL8O 2X8TA 1FENA 2L68A 3B2HA 5HA0A 1STRB 1Y55X 2M4LA 4QAEA 5IO6A 2A13A 2L67A 1I78A 4Z2OA 1GGLA 1TVQA 4KIIA 2OF9A 3U03A 3WJGA 3D4RA 2BSZA 3CBCA 4TQ2A 1QY0A 1LPJA 3PH6A 2GJ5A 3FR4A 4XMHA 5DPQA 5HZ8A 5HCDC 1ICNA 1G5WA 5D47A 1VWFB 1LF7A 3RKGA
chains in the Genus database with same CATH topology
4BX7B 2RTLA 1VWEB 1SWPA 1N43A 2RTFB 2UYWA 2F01A 1HXZA 3X00A 3FDCA 1SWRA 2G5LA 4BJ8A 5CHKA 1HXLA 1WBIA 1SWJA 1LCZA 2WPUA 4YVBA 2RTCB 1SRHA 1SWHA 3RDQA 5JD2A 4BX7A 1VWCB 2FHNX 3RE6A 5K67A 2MF6A 1SWCA 4GGTA 1KFFA 3RDSA 2C1QA 1SWGA 1NC9A 1VWRB 1NQMA 2IZFB 2RTRB 4I60A 4GGRA 4BCSA 1NQNA 2IZCB 5IRUA 1SWNA 2Y32A 1SRGA 1VWPB 3VGWA 2FHLA 3SZHA 1VWDB 1VWHB 4Z6JA 1NBXA 2RTQB 3WZNA 2OFBA 1VWNB 1VWQB 1N7YA 1MEPA 1RAVA 3T2WA 2RTMA 2IZDB 1RXHA 2IZAA 4Z2VA 1SLEB 2C1SA 2IZIA 1Y53X 1HY2A 4U46A 3RE5A 3RY1A 1LUQA 1KL3A 1SWOA 1STSB 3PK2A 2OF8A 4GD9A 1N4JA 1IJ8A 1N9YA 1VWIB 2RTDB 2IZKA 4CPHB 2GH7A 1AVEA 1SLGB 1VWMB 2JGSA 1STPA 1RXKA 2A5BA 1LCVA 1LELA 3RDOA 2RTAA 2RTNB 4GJSA 5B5GA 1SWAA 1I9HA 5CSEA 2QCBA 2A5CA 1SWKA 4OKAA 2IZGB 3VHMA 3EW2A 4GGZA 3VHIA 4BX6B 1MOYA 2IZLB 1KL4A 1SRJA 2RTKA 4BX5A 3RY2A 3EW1A 4CPHA 5IRWA 1VWKB 1SWQA 3WZOA 4GDAA 2CAMA 1VWAB 2C4IA 2RTIB 4Z28A 1SWFA 4JHQA 1MM9A 3MG5A 1SRIA 1SWDA 3VHHA 1LDOA 2IZHB 2RTHB 1SWTA 1RSTB 1SWEA 1RXJA 1SWSA 1NDJA 1LCWA 1VWJB 2IZJA 4BX6A 1VWLB 3T6FA 1AVDA 4IRWA 1RSUB 4BBOA 4BX5B 2ZSCA 2Y3FA 2RTGB 1SRFA 5K68A 1PTSA 3WYQA 2IZBA 1SWLA 2AVIA 4JNJA 1SLDB 2IZEB 3SZIA 3RDMA 3SZJA 4EKVA 4DNEA 1Y52X 4Z27A 1VWBB 3T2XA 4CPEA 4Z2PA 5L3YA 2A8GA 3RDXA 1LDQA 2BC3A 4CPFA 5F2BA 3RDUA 3T6LA 1DF8A 1N9MA 1HQQA 1MK5A 5B5FA 1STRB 2RTPB 1Y55X 2RTOB 4GJVA 3WZPA 2Y3EA 2RTJA 4Z2OA 2RTBB 4Y59A 4CPIA 1KL5A 2OF9A 2RTEB 1SWUA 3MM0A 1SREA 1VWGB 4Y5DA 4JO6A 5IRAA 2UZ2A 3WYPA 1SLFB 1SWBA 2OFAA 3WZQA 1VWFB 1VYOA 1VWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BX7 B;  2RTL A;  1VWE B;  1SWP A;  1N43 A;  2RTF B;  2UYW A;  2F01 A;  1HXZ A;  3X00 A;  3FDC A;  1SWR A;  2G5L A;  4BJ8 A;  5CHK A;  1HXL A;  1WBI A;  1SWJ A;  1LCZ A;  2WPU A;  4YVB A;  2RTC B;  1SRH A;  1SWH A;  3RDQ A;  5JD2 A;  4BX7 A;  1VWC B;  2FHN X;  3RE6 A;  5K67 A;  2MF6 A;  1SWC A;  4GGT A;  1KFF A;  3RDS A;  2C1Q A;  1SWG A;  1NC9 A;  1VWR B;  1NQM A;  2IZF B;  2RTR B;  4I60 A;  4GGR A;  4BCS A;  1NQN A;  2IZC B;  5IRU A;  1SWN A;  2Y32 A;  1SRG A;  1VWP B;  3VGW A;  2FHL A;  3SZH A;  1VWD B;  1VWH B;  4Z6J A;  1NBX A;  2RTQ B;  3WZN A;  2OFB A;  1VWN B;  1VWQ B;  1N7Y A;  1MEP A;  1RAV A;  3T2W A;  2RTM A;  2IZD B;  1RXH A;  2IZA A;  4Z2V A;  1SLE B;  2C1S A;  2IZI A;  1Y53 X;  1HY2 A;  4U46 A;  3RE5 A;  3RY1 A;  1LUQ A;  1KL3 A;  1SWO A;  1STS B;  3PK2 A;  2OF8 A;  4GD9 A;  1N4J A;  1IJ8 A;  1N9Y A;  1VWI B;  2RTD B;  2IZK A;  4CPH B;  2GH7 A;  1AVE A;  1SLG B;  1VWM B;  2JGS A;  1STP A;  1RXK A;  2A5B A;  1LCV A;  1LEL A;  3RDO A;  2RTA A;  2RTN B;  4GJS A;  5B5G A;  1SWA A;  1I9H A;  5CSE A;  2QCB A;  2A5C A;  1SWK A;  4OKA A;  2IZG B;  3VHM A;  3EW2 A;  4GGZ A;  3VHI A;  4BX6 B;  1MOY A;  2IZL B;  1KL4 A;  1SRJ A;  2RTK A;  4BX5 A;  3RY2 A;  3EW1 A;  4CPH A;  5IRW A;  1VWK B;  1SWQ A;  3WZO A;  4GDA A;  2CAM A;  1VWA B;  2C4I A;  2RTI B;  4Z28 A;  1SWF A;  4JHQ A;  1MM9 A;  3MG5 A;  1SRI A;  1SWD A;  3VHH A;  1LDO A;  2IZH B;  2RTH B;  1SWT A;  1RST B;  1SWE A;  1RXJ A;  1SWS A;  1NDJ A;  1LCW A;  1VWJ B;  2IZJ A;  4BX6 A;  1VWL B;  3T6F A;  1AVD A;  4IRW A;  1RSU B;  4BBO A;  4BX5 B;  2ZSC A;  2Y3F A;  2RTG B;  1SRF A;  5K68 A;  1PTS A;  3WYQ A;  2IZB A;  1SWL A;  2AVI A;  4JNJ A;  1SLD B;  2IZE B;  3SZI A;  3RDM A;  3SZJ A;  4EKV A;  4DNE A;  1Y52 X;  4Z27 A;  1VWB B;  3T2X A;  4CPE A;  4Z2P A;  5L3Y A;  2A8G A;  3RDX A;  1LDQ A;  2BC3 A;  4CPF A;  5F2B A;  3RDU A;  3T6L A;  1DF8 A;  1N9M A;  1HQQ A;  1MK5 A;  5B5F A;  1STR B;  2RTP B;  1Y55 X;  2RTO B;  4GJV A;  3WZP A;  2Y3E A;  2RTJ A;  4Z2O A;  2RTB B;  4Y59 A;  4CPI A;  1KL5 A;  2OF9 A;  2RTE B;  1SWU A;  3MM0 A;  1SRE A;  1VWG B;  4Y5D A;  4JO6 A;  5IRA A;  2UZ2 A;  3WYP A;  1SLF B;  1SWB A;  2OFA A;  3WZQ A;  1VWF B;  1VYO A;  1VWO B; 
#chains in the Genus database with same CATH topology
 2LKK A;  4BX7 B;  2DJF A;  2RTL A;  2OZQ A;  3APV A;  1ALB A;  2ACP X;  3X00 A;  4ALO A;  1HMS A;  1SWR A;  4LKP A;  4NNS A;  2G5L A;  2WEW A;  3NQ9 A;  4KC8 A;  2QMI A;  5CHK A;  2RA6 A;  3P6F A;  4YVB A;  2OL7 A;  3KFG A;  4LZV A;  4O49 A;  5D8J A;  2ANS A;  5HCC C;  2WSJ A;  1G74 A;  3VPJ E;  2VFB A;  4WBK A;  2LFO A;  1CRB A;  1T68 X;  2E4J A;  4I95 A;  1FEM A;  4RUU A;  4CDE A;  5HTD A;  1BWY A;  4O9S A;  3NPO A;  1SWC A;  2HYS A;  4YBU A;  4GGT A;  1KFF A;  4IAW A;  2OY7 A;  3TZS A;  1BRP A;  1ML7 A;  1SY2 A;  1U18 A;  2OVD A;  3BS2 A;  4QGW A;  4YCE A;  3P24 A;  3STK A;  5C0N A;  3F9D A;  1LID A;  2AF5 A;  4GNW A;  1JV4 A;  1Y0G A;  4AYH A;  3SZH A;  4D6A A;  1VWH B;  1MUP A;  4YGG A;  3VG4 A;  5LJH A;  2KTD A;  2PI3 O;  2G8C O;  1X8P A;  3WVM A;  2OFB A;  3CBS A;  1OPB A;  1QQS A;  1T0V A;  4GKC A;  1HMT A;  3BU9 A;  4O4U A;  5FAZ A;  3T2W A;  3UEV A;  2CZU A;  1BEB A;  5AJB A;  2X8F A;  1SMP I;  1B56 A;  1RXH A;  2AT3 X;  3PQU A;  3SLO A;  1ACD A;  1BSY A;  4BGF A;  1OEE A;  2OFR X;  3FW5 A;  1LIE A;  1LKE A;  1YWB A;  4EKV A;  1Y9T A;  3RY1 A;  1KL3 A;  2AT5 X;  2JU7 A;  2ZAI A;  3PK2 A;  4GD9 A;  4CPH B;  2MJI A;  3STM X;  1AVE A;  3MVF A;  3WBG A;  2A0A A;  5B29 A;  2A5B A;  3PPT A;  5EEE A;  2X32 A;  2RTN B;  5LKF A;  1JJX A;  1SA8 A;  3ZI8 A;  2GTF X;  3WJF A;  1SY1 A;  1BLR A;  1SXU A;  2BS6 A;  4TKJ A;  1KL4 A;  1ZNH A;  2X45 A;  3EW1 A;  4M6S A;  2FWV A;  4OS3 A;  1E02 A;  4ORU A;  3RWX A;  2CAM A;  1VWA B;  4MIR A;  2ACO A;  1E5P A;  2BT9 A;  4GK9 A;  4QNI A;  3TGA A;  4O3X B;  1LDO A;  5BVS A;  4DQ3 A;  1SWT A;  1X8U A;  1SWE A;  3NQ3 A;  1SWS A;  2KT4 B;  2CM4 A;  3SAO A;  4HWM A;  1VWJ B;  2IZJ A;  1DZJ A;  2W2A A;  2POA A;  2RQ0 A;  5EZ2 A;  3LHN A;  4IRW A;  4ES7 A;  2Q4N A;  1A3Y A;  2Q39 A;  4QZU A;  5H9N A;  1YP7 A;  2X8S A;  4IB8 A;  3RSW A;  1UYN X;  3HTY A;  1SRF A;  5FQ7 E;  1SWL A;  2QOS C;  5LJG A;  1PBO A;  3PQS A;  1W5R A;  1O8V A;  4YKO A;  1EW3 A;  4CDD A;  2AMM X;  4Z27 A;  3T2X A;  2KW1 A;  2QM9 A;  2VFC A;  3ZUO A;  4CPE A;  5L3Y A;  3VG3 A;  4CPF A;  4IMO A;  5LJB A;  2FR2 A;  1KQX A;  5HAE A;  3EYC A;  4O4X A;  1KXO A;  1MK5 A;  4OMX A;  2Q2P A;  4FGI B;  2MHD A;  5HBS A;  3BLG A;  5HZ9 A;  2RTP B;  1JZU A;  2FKJ A;  3OE3 A;  3WZP A;  4A1Y A;  2RTJ A;  4I3C A;  3P6H A;  1KT4 A;  4HPB A;  3BX7 A;  1SWU A;  4BQU A;  2FLJ A;  3CKF A;  3WYP A;  1OSP O;  2AH7 X;  1QY2 A;  3F8A A;  4YFR A;  1WUB A;  1NGL A;  5EDC A;  1MVG A;  1TOW A;  1VWO B;  5FFH A;  5HCE C;  1TXL A;  1S7D A;  2RTF B;  3ZW0 B;  2F01 A;  3I17 A;  3BY0 A;  4O4O A;  1HXL A;  1D3S A;  1DFV A;  1X71 A;  3PH5 A;  4I3D A;  2G7B A;  4YFP A;  2ZAG A;  3VG5 A;  4GZV A;  1GKA A;  1JBH A;  4KCA A;  1SWH A;  3HOE A;  3NP1 A;  4ON1 A;  4ORX A;  4R0B A;  3WXQ A;  1VWC B;  4IB9 A;  1S2P A;  3FLL A;  3LV4 A;  2AL0 X;  2Q2M A;  3G7X A;  2CBR A;  2HLV A;  1P6P A;  4UU3 A;  2MF6 A;  2WQ9 A;  5H9A A;  3SOT A;  5F6B A;  1SXY A;  4QYN A;  3RDS A;  1YWD A;  4NV7 A;  1SWG A;  1NC9 A;  1VWR B;  1PMP A;  1EPB A;  1OPA A;  2IZF B;  4I60 A;  1AB0 A;  4NYQ A;  3PED A;  4GDZ A;  4OEL A;  5F58 A;  4GH7 A;  4YMY A;  4ZHH A;  4WHI A;  1VWP B;  2FHL A;  4ZHD A;  2GTL N;  5FQ8 E;  2GC9 A;  1NBX A;  4A1H A;  4COT A;  1B8E A;  1FTP A;  1KT3 A;  2I5Z O;  3JQO A;  3OJY C;  1EI5 A;  1XKI A;  1HQP A;  1BJ7 A;  1MEP A;  1RAV A;  2RTM A;  3C76 X;  2LBV A;  2JW1 A;  3ZUI A;  3B2K A;  3JS1 A;  1RBP A;  5H9K A;  3P6D A;  2OVA A;  2KD2 A;  1I04 A;  1MDC A;  2C1S A;  2X56 A;  3BSZ E;  3CQR A;  4GNY A;  3RE5 A;  3QKG A;  4DQ4 A;  1SY0 A;  2OF8 A;  4ORW A;  3UEW A;  2IZK A;  4KT5 A;  4O3Y A;  1SLG B;  4ID2 A;  1QWD A;  1VWM B;  2JGS A;  2W2F A;  3D97 A;  4I9S A;  1LCV A;  2WR6 A;  3IA8 A;  5BVT A;  5IO7 A;  2JMB A;  2X46 A;  4A60 A;  4GJS A;  2CZT A;  2F73 A;  1I9H A;  5CSE A;  2QCB A;  4B55 A;  1BM5 A;  1ICM A;  4IAB A;  2VDF A;  1ADL A;  1W4T A;  1KZW A;  4WFU A;  1SRJ A;  3EC5 A;  3D96 A;  3AEH A;  5JR8 A;  1SY3 A;  5AQ6 A;  1SWQ A;  3WZO A;  4GDA A;  4OS0 A;  4TNN A;  2RTI B;  3WJD A;  3ZQ3 A;  1GX3 A;  3KFI A;  3P6G A;  4GUZ A;  2O62 A;  2YMS A;  3AUM O;  1SWD A;  4Z28 A;  3VG6 A;  1ZNG A;  3D9W A;  3ZWE A;  3APX A;  5KIC A;  2OY5 O;  1RXJ A;  1A57 A;  4Y0R A;  1KZX A;  3BRN A;  3O22 A;  1X89 A;  3KQ0 A;  1LCW A;  5LJC A;  1S44 A;  1QFT A;  1VWL B;  4CV7 A;  1AVD A;  3T6F A;  2K23 A;  1JQP A;  1GT1 A;  1RSU B;  5HTE A;  3CMP A;  4AW8 A;  4BX5 B;  1IKE A;  2HNX A;  4C5P A;  2NNE A;  1ERB A;  1GM6 A;  2FR3 A;  2RN4 A;  2Y3F A;  1EAL A;  4YDB A;  1XCA A;  4GU8 A;  1AVG I;  1GT4 A;  2IZB A;  1EUO A;  2GTL M;  1ZNL A;  2AT6 X;  5LKE A;  4Y0S A;  4NLJ A;  1VYF A;  2IZE B;  4ZFX A;  4GE1 A;  4ZGF A;  3S26 A;  3CWK A;  1B4M A;  3MBT A;  3HK1 A;  4EEJ A;  4NNT A;  3HPE A;  1KOI A;  2L9C A;  4YH0 A;  1LIF A;  4LZU A;  1U0X A;  2A8G A;  3RDX A;  4FBO A;  5F2B A;  3RDU A;  4KC7 A;  4GET A;  1R0U A;  3BDR A;  1N9M A;  4O3Z A;  3RBY A;  3FA8 A;  4QGV A;  5L8O A;  1HQQ A;  4FQB B;  3FEK A;  4K19 A;  1HN2 A;  5B5F A;  1U17 A;  3KVN A;  1JIW I;  2HZQ A;  2Y3E A;  1Z24 A;  2YG2 A;  2ASN X;  1ZND A;  2QO5 A;  5BVQ A;  3BX8 A;  1KL5 A;  2RTE B;  1EXS A;  1LNM A;  1VWG B;  3ZW1 A;  4JO6 A;  2UZ2 A;  2G78 A;  3O2Y A;  4CSB A;  1SLF B;  1SWB A;  3B2I A;  2OFA A;  4QZT A;  3WZQ A;  3NQK A;  4ZH9 A;  3UAQ A;  4M7M A;  1VYO A;  1OBP A;  3HWE A;  1PEE A;  1VWE B;  3WJB A;  1N43 A;  4YDA A;  3Q6L A;  1OBQ A;  3FDC A;  2HKD A;  4ARH A;  5LJD A;  1WBI A;  1IFC A;  4EXZ A;  4ML7 B;  4O3W A;  1SWJ A;  3S5X A;  3VG7 A;  4CK4 A;  5LJK A;  2RCT A;  5HZ6 A;  4IAX A;  2RTC B;  1QG5 A;  3RDQ A;  1B0O A;  1IIU A;  2Q9S A;  5JD2 A;  5D4A A;  5B27 A;  1W6F A;  4ZHG A;  5K06 A;  4MVI A;  2ALL X;  1X8Q A;  1YWA A;  2AKQ A;  3NBX X;  1KT5 A;  1QFV A;  1GX9 A;  2C1Q A;  1DF3 A;  5F1E A;  4NLI A;  1NQM A;  4GGR A;  2F09 A;  2IZC B;  1SWN A;  1VPR A;  2Y32 A;  1SRG A;  4BVM A;  1VWD B;  4RUN A;  4U8U N;  2CM9 A;  4Y0Q A;  2RTQ B;  1FDQ A;  3WZN A;  3KFF A;  1JJJ A;  1GX8 A;  3AKM A;  4YBP A;  1VWN B;  1N7Y A;  1T8V A;  1VYG A;  4D6B A;  4YCH A;  1BSQ A;  2IZD B;  2L5P A;  1HBP A;  3ZZV A;  5HZQ A;  1CBI A;  4XME A;  2XST A;  2MM3 A;  4NV8 A;  2IZI A;  1HY2 A;  1NP1 A;  1SWO A;  1CBS A;  3VE2 A;  1HBQ A;  1STS B;  5HWZ A;  5D48 A;  4N7C A;  2RTD B;  1FEL A;  3K3L A;  1E2T A;  2FRS A;  2GH7 A;  2R74 A;  3I0A A;  3IFB A;  4YGZ A;  4EQA C;  3P6C A;  4EFG A;  4IB7 A;  1EII A;  3CR6 A;  1LEL A;  3U9P C;  4DCB A;  5IXG A;  2N93 A;  3OBL A;  4U9C A;  1EPA A;  2FGS A;  2RTA A;  3FMZ A;  4ORR A;  2HZR A;  1SWA A;  2HMB A;  2CBS A;  3FR2 A;  2LA7 A;  3HWD A;  4UU2 A;  5HA1 A;  5B5G A;  3STN A;  4OKA A;  3FEP A;  4TJZ A;  1OBU A;  4HPC A;  3VHI A;  3FW4 A;  1MOY A;  1KQW A;  2IZL B;  3NR3 A;  3NX2 A;  4JGL A;  3RY2 A;  5IRW A;  1I4U A;  4EDE A;  1VWK B;  1TOU A;  1OEJ A;  2A2G A;  2OY8 A;  2OFM X;  4NW4 A;  1SWF A;  1MM9 A;  3MG5 A;  1A18 A;  1SRI A;  3VHH A;  2IZH B;  3KFH A;  4AZO A;  1CJ5 A;  5FQ6 E;  4NYR A;  3VG2 A;  1RST B;  2RCQ A;  2JU3 A;  4L1N A;  2AT0 X;  4BX6 A;  2X34 A;  2W2B A;  1Y9L A;  4I6S A;  4QQ1 A;  4AZR A;  5D45 A;  3V8U A;  4BBO A;  1YIV A;  1DZP A;  4NP1 A;  3EM0 A;  1QAB E;  4IBA A;  1KT7 A;  2GTL O;  5K68 A;  1PTS A;  2FT9 A;  1K3B A;  2AVI A;  4U8U M;  1TW4 A;  4ZHC A;  2OL6 O;  3HOL A;  2AT8 X;  1QY1 A;  1URE A;  1UYO X;  2FKG A;  5F6Z A;  4ZH6 A;  2OYB O;  1I05 A;  1Y52 X;  3FR5 A;  3RDM A;  3SZJ A;  3WOV A;  1VWB B;  3FIQ A;  1EIO A;  1JJU A;  2KTS A;  4Z2P A;  2BHV A;  2X4M A;  2RD7 C;  1LDQ A;  3H3I A;  1KT6 A;  3ZW1 B;  1HMR A;  1IFB A;  3S60 A;  1JMX A;  3FEN A;  1JMZ A;  2WUT A;  3FA6 A;  3L4R A;  4ZCB A;  3T1D A;  1X8O A;  2RTO B;  3B2J A;  3P6E A;  2QO6 A;  4GJV A;  3ZW0 A;  2FS7 A;  4HPD A;  3PP6 A;  2RTB B;  4Y59 A;  3F6Z B;  2BS5 A;  4CDC A;  4CPI A;  4TLJ A;  3MM0 A;  1SRE A;  4Y5D A;  5IRA A;  1A2D A;  5CYB A;  4ZHF A;  4IMN A;  1CBQ A;  2I5V O;  5EPQ A;  5DG4 A;  3TF6 A;  4TKH A;  4AZQ A;  1GXA A;  2JN3 A;  4L3R A;  4QGX A;  1N0S A;  3PDF A;  4AZP A;  1SWP A;  4FBR A;  3PEC A;  2UYW A;  1HXZ A;  3TGC A;  2MWH A;  4TKB A;  5H8T A;  1YWC A;  4YGH A;  4BJ8 A;  1OEK A;  1LFO A;  2MO5 A;  1E00 A;  4MIS A;  4ALB A;  3D95 A;  1LCZ A;  2WPU A;  4HPA A;  4I3B A;  4BOE A;  3DTQ A;  3VE1 A;  3FYF A;  4XMF A;  1SRH A;  4BX7 A;  5L8N A;  2FHN X;  2FTB A;  5IO5 A;  1X8N A;  3RE6 A;  1I06 A;  5K67 A;  2K62 A;  1SXX A;  3FA7 A;  4LKT A;  1BBP A;  2R73 A;  3N91 A;  4YKM A;  3OD9 A;  3RZY A;  3ELX A;  2RTR B;  4MVK A;  1BRQ A;  3EBK A;  5FEN A;  4A8Z A;  4BCS A;  1D2U A;  1NQN A;  3ELZ A;  5IRU A;  3APU A;  1IW2 A;  4QYP A;  3VGW A;  2NND A;  4PSQ A;  5AJC A;  1GKA B;  4Z6J A;  1MX7 A;  3HWF A;  4MVL A;  3HWG A;  1H91 A;  1FJ1 E;  2X55 A;  4Y0P A;  1VWQ B;  1O1U A;  1JYD A;  2OVS A;  2PY1 A;  4ZJ0 A;  1K24 A;  2IZA A;  3CKG A;  1IKJ A;  1LIC A;  4MEE A;  3QQ2 A;  5EED A;  1RLB E;  3EMM A;  3FID A;  3NAD A;  3P02 A;  2LBA A;  2A2U A;  2P8G A;  4Z2V A;  4XMD A;  1SLE B;  1O1V A;  2G79 A;  3C77 X;  1Y53 X;  1LIB A;  3FEL A;  4OMW A;  2QOM A;  1LUQ A;  1PBY A;  4FBV A;  4U46 A;  1DZK A;  4AZM A;  1PM1 X;  4PJ2 A;  1DC9 A;  1G85 A;  1N4J A;  1IJ8 A;  1N9Y A;  1VWI B;  3VU1 A;  5B3M O;  1MX8 A;  4INN A;  1EQD A;  2OY1 O;  4HFO A;  3TGB A;  1FE3 A;  1STP A;  3S5V A;  1RXK A;  4IB6 A;  3KZA A;  3ZW2 A;  1AEL A;  3C78 X;  1SXW A;  2Z4H A;  4XMG A;  3RDO A;  1E06 A;  2XKL A;  3SLJ A;  3FA9 A;  4LQZ A;  1DZM A;  1ZRY A;  4U3Q A;  2DJG A;  2A5C A;  1SWK A;  5B10 O;  2IZG B;  3O19 A;  1UZ2 X;  3EW2 A;  3GE2 A;  3JSQ A;  2OVE A;  3NX1 A;  4GGZ A;  2RTK A;  3VHM A;  4BX5 A;  4BX6 B;  4CPH A;  2BLG A;  1L6M A;  2C4I A;  4ZGU A;  4JHQ A;  5L8I A;  4N7D A;  4AZN A;  3WJE A;  2WWP A;  2R56 A;  3B2L A;  4GRJ A;  2RTH B;  2IFB A;  2NP1 A;  1GT3 A;  4WFV A;  1ZNK A;  2JOZ A;  2QO4 A;  5HZ5 A;  1KGL A;  4ODD A;  2Z4I A;  1NDJ A;  3UEU A;  1GT5 A;  4ORS A;  1ERX A;  1JYJ A;  2JU8 A;  1G7N A;  3CQN A;  4QRL A;  5B11 O;  1BSO A;  3EBW A;  4CDF A;  3DSZ A;  5BYP A;  4YFQ A;  3GAQ A;  1AQB A;  2ZSC A;  2DM5 A;  1CBR A;  2LB6 A;  2RTG B;  3E3C A;  3LTW A;  5KID A;  2FS6 A;  5LJE A;  4U8U O;  3WYQ A;  3U0D A;  1NP4 A;  4JNJ A;  4OS8 A;  3SLT A;  5CE4 A;  1SLD B;  2WEX A;  3AKN A;  4OEM A;  4KH8 A;  3SZI A;  1DV9 A;  1ZNE A;  2NNQ A;  3APW A;  3MX7 A;  5EDB A;  3WJC A;  1YUP A;  4O4S A;  4ORY A;  5B2A O;  4DNE A;  2A3F X;  5KHP A;  3UEX A;  2WQA E;  4XMC A;  5F7G A;  4MVE A;  1YP6 A;  2BC3 A;  3BU1 A;  5H9L A;  3Q34 A;  4I9R A;  4ZR2 A;  3T6L A;  2EU7 X;  5AEO A;  1DF8 A;  2OL8 O;  2X8T A;  1FEN A;  2L68 A;  3B2H A;  5HA0 A;  1STR B;  1Y55 X;  2M4L A;  4QAE A;  5IO6 A;  2A13 A;  2L67 A;  1I78 A;  4Z2O A;  1GGL A;  1TVQ A;  4KII A;  2OF9 A;  3U03 A;  3WJG A;  3D4R A;  2BSZ A;  3CBC A;  4TQ2 A;  1QY0 A;  1LPJ A;  3PH6 A;  2GJ5 A;  3FR4 A;  4XMH A;  5DPQ A;  5HZ8 A;  5HCD C;  1ICN A;  1G5W A;  5D47 A;  1VWF B;  1LF7 A;  3RKG A; 
#chains in the Genus database with same CATH homology
 4BX7 B;  2RTL A;  1VWE B;  1SWP A;  1N43 A;  2RTF B;  2UYW A;  2F01 A;  1HXZ A;  3X00 A;  3FDC A;  1SWR A;  2G5L A;  4BJ8 A;  5CHK A;  1HXL A;  1WBI A;  1SWJ A;  1LCZ A;  2WPU A;  4YVB A;  2RTC B;  1SRH A;  1SWH A;  3RDQ A;  5JD2 A;  4BX7 A;  1VWC B;  2FHN X;  3RE6 A;  5K67 A;  2MF6 A;  1SWC A;  4GGT A;  1KFF A;  3RDS A;  2C1Q A;  1SWG A;  1NC9 A;  1VWR B;  1NQM A;  2IZF B;  2RTR B;  4I60 A;  4GGR A;  4BCS A;  1NQN A;  2IZC B;  5IRU A;  1SWN A;  2Y32 A;  1SRG A;  1VWP B;  3VGW A;  2FHL A;  3SZH A;  1VWD B;  1VWH B;  4Z6J A;  1NBX A;  2RTQ B;  3WZN A;  2OFB A;  1VWN B;  1VWQ B;  1N7Y A;  1MEP A;  1RAV A;  3T2W A;  2RTM A;  2IZD B;  1RXH A;  2IZA A;  4Z2V A;  1SLE B;  2C1S A;  2IZI A;  1Y53 X;  1HY2 A;  4U46 A;  3RE5 A;  3RY1 A;  1LUQ A;  1KL3 A;  1SWO A;  1STS B;  3PK2 A;  2OF8 A;  4GD9 A;  1N4J A;  1IJ8 A;  1N9Y A;  1VWI B;  2RTD B;  2IZK A;  4CPH B;  2GH7 A;  1AVE A;  1SLG B;  1VWM B;  2JGS A;  1STP A;  1RXK A;  2A5B A;  1LCV A;  1LEL A;  3RDO A;  2RTA A;  2RTN B;  4GJS A;  5B5G A;  1SWA A;  1I9H A;  5CSE A;  2QCB A;  2A5C A;  1SWK A;  4OKA A;  2IZG B;  3VHM A;  3EW2 A;  4GGZ A;  3VHI A;  4BX6 B;  1MOY A;  2IZL B;  1KL4 A;  1SRJ A;  2RTK A;  4BX5 A;  3RY2 A;  3EW1 A;  4CPH A;  5IRW A;  1VWK B;  1SWQ A;  3WZO A;  4GDA A;  2CAM A;  1VWA B;  2C4I A;  2RTI B;  4Z28 A;  1SWF A;  4JHQ A;  1MM9 A;  3MG5 A;  1SRI A;  1SWD A;  3VHH A;  1LDO A;  2IZH B;  2RTH B;  1SWT A;  1RST B;  1SWE A;  1RXJ A;  1SWS A;  1NDJ A;  1LCW A;  1VWJ B;  2IZJ A;  4BX6 A;  1VWL B;  3T6F A;  1AVD A;  4IRW A;  1RSU B;  4BBO A;  4BX5 B;  2ZSC A;  2Y3F A;  2RTG B;  1SRF A;  5K68 A;  1PTS A;  3WYQ A;  2IZB A;  1SWL A;  2AVI A;  4JNJ A;  1SLD B;  2IZE B;  3SZI A;  3RDM A;  3SZJ A;  4EKV A;  4DNE A;  1Y52 X;  4Z27 A;  1VWB B;  3T2X A;  4CPE A;  4Z2P A;  5L3Y A;  2A8G A;  3RDX A;  1LDQ A;  2BC3 A;  4CPF A;  5F2B A;  3RDU A;  3T6L A;  1DF8 A;  1N9M A;  1HQQ A;  1MK5 A;  5B5F A;  1STR B;  2RTP B;  1Y55 X;  2RTO B;  4GJV A;  3WZP A;  2Y3E A;  2RTJ A;  4Z2O A;  2RTB B;  4Y59 A;  4CPI A;  1KL5 A;  2OF9 A;  2RTE B;  1SWU A;  3MM0 A;  1SRE A;  1VWG B;  4Y5D A;  4JO6 A;  5IRA A;  2UZ2 A;  3WYP A;  1SLF B;  1SWB A;  2OFA A;  3WZQ A;  1VWF B;  1VYO A;  1VWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...