1MMBA

Complex of bb94 with the catalytic domain of matrix metalloproteinase-8
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLOPROTEINASE-8
publication title Structure determination and analysis of human neutrophil collagenase complexed with a hydroxamate inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase (metalloprotease)
total genus 45
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1995-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1mmbA00
4JPAA 1IAGA 1JIWP 1WNIA 1OS9A 1IABA 3E8RA 1ZXCA 2X3AA 1BSWA 1KAPP 1ZXVA 1CAQA 2Y6DA 5I43A 2E3XA 1CK7A 1UMTA 2OI0A 1O0TA 2WO9A 3EWJA 1UMSA 3B8ZA 1G49A 4JP4A 2OW0A 1I76A 1MMQA 2JIHA 5D1TA 1XURA 1CIZA 1ROSA 2QPJA 4FU4A 3LQBA 1I1IP 4G0DA 4L6TA 3HDBA 4PKSA 3WV2A 3USNA 1YOUA 2OXUA 4GWMA 1BKCA 1ND1A 1HFSA 1SATA 4H49A 2JNPA 1KUGA 4GWNA 1C8TA 1UTZA 5H8XA 3K7NA 4H84A 4ZR5A 5D3CA 1QIAA 1RM8A 4EFSA 3LMCA 2WOAA 1SMPA 4XM7A 5I0LA 3UVCA 5LABA 3LUNA 3KEJA 5CXAA 1G4KA 4L19A 3GBOA 1FM1A 1JIZA 1KUIA 2AIGP 2RJPA 3EDGA 1MMBA 1A85A 2XS4A 1QIBA 1GO7P 1HTDA 2N8RA 1BUDA 4PKQA 2DW1A 3NX7A 1MMRA 4WK7A 1HY7A 4I03A 1C7KA 2W14A 5BOTA 3L0VA 1PWQA 2XS3A 2D1OA 3KMEA 3DPEA 2V4BA 4JIJA 2D1NA 1XFYA 3HYGA 4Q1LA 4GF1A 3TS4A 1BIWA 1GXDA 2EROA 5B5PA 4L63A 1KUFA 4GR3A 3EHXA 830CA 1OM8A 2O3EA 4AYKA 3LGPA 1BQOA 1JANA 1XFUA 5L79A 2X3CA 2OVZA 2W13A 3LIRA 1K7QA 3TT4A 5BOYA 1KBCA 4H3XA 2X3BA 5I4OA 1QUAA 4ON1A 1YP1A 3ZXHA 2O36A 5I2ZA 2OW9A 1GE6A 3G42A 1IAEA 1EAKA 2ERPA 3TVCA 5D1UA 3HY9A 4J4MA 1HV5A 3I7IA 3RTSA 2JT5A 3HB2P 4AXQA 2JT6A 1B3DA 1D5JA 1D7XA 1KUKA 3HDAP 4I35A 2OY2A 1BKCI 4DPEA 456CA 2A8HA 1OM7A 3OHOA 1R1HA 2OW1A 3KMCA 5D7WA 1JAPA 2DW0A 1Y93A 1BUVM 1EB6A 1K7IA 3LEAA 1PWPA 1R54A 4ILWD 1YQYA 1ATLA 1R1IA 2OXZA 2K9CA 2WO8A 3AYKA 1GE7A 1KUHA 2ERQA 4XM6A 1PWWA 3U1RA 1QICA 2W15A 4FVLA 3MA2A 3ZVSA 1OM6A 1H71P 4DF9A 4WF6A 3F16A 1CGEA 4WZVA 1XFWA 2I47A 2FV9A 2W12A 3LJGA 4IUWA 4PKUA 1DMTA 2J83A 3DSLA 3O64A 2POJA 1GE5A 4H76A 3ZUKA 4GUYA 3V96B 2AYKA 3P1VA 1AYKA 1G12A 1GO8P 1CQRA 1ZP5A 1BZSA 4JA1A 1AKLA 1XUCA 3DL1A 2DW2A 4R3VA 3HY7A 1EUBA 4H82A 1JKYA 1XFXA 4PKRA 4FXQA 3B2ZA 3WV3A 3N2VA 1ZVXA 3ELMA 3LUMA 1XFVA 4PKVA 1RMZA 1CXVA 1SLMA 1SU3A 3DPFA 2CKIA 4XM8A 3O2XA 1O0QA 3WV1A 1S4BP 1GKCA 1CGFA 3SHIA 1USNA 2L0RA 3LJTA 1MNCA 2USNA 1SLNA 1Q3AA 1R1JA 2W0DA 5L7FA 1ZS0A 3P24A 4G9LA 3KECA 1OMJA 1JAQA 4XBHA 1Y8JA 1DTHA 1UTTA 2K2GA 1FBLA 3I7GA 1C3IA 4HX3A 1A86A 1PWUA 1JAOA 2MZEA 4GR0A 4A3WA 1R55A 1HFCA 2YIGA 4IN9A 1ASTA 4WKEA 2YB9A 3F17A 4H1QA 3VI1A 5I3MA 3LE9A 1D8MA 1BQQM 3EHYA 2J0TA 3LQ0A 1JK3A 3DWBA 3AIGA 4XCTA 1YCMA 2E2DA 3CKIA 3Q2GA 2MLRA 4CTHA 3TSKA 5D1SA 4IJOA 4WKIA 1D8FA 1FLSA 1XUDA 3LILA 2MZHA 3K7LA 1IACA 5D2BA 1JH1A 5CUHA 4HMAA 1IADA 4DD8A 2X7MA 2Z2DA 4H2EA 1BKCE 2Y6CA 1SRPA 3Q2HA 3F19A 3LK8A 3HBUP 1G9KA 3B92A 4H30A 3AYUA 1J7NA 4AUOA 3KWVC 3EDHA 4JQGA 3N2UA 3VTGA 2SRTA 2JSDA 2TCLA 1GKDA 3EDIA 1OO9A 3G5CA 4GR8A 2FV5A 3F15A 1MMPA 1G05A 4PKWA 4PKTA 4QKZA 2RJQA 1Z3JA 1QJIA 2MZIA 2OW2A 1K7GA 4A7BA 1PWVA 2HU6A 1L6JA 3HBVP 1HOVA 1Y0VA 3OHLA 3BA0A 3KEKA 1JJ9A 5CZMA 3KHIA 1XFZA 1QJJA 1UEAA 1CGLA 3L0TA 3DNGA 4AIGA 1I73A 5JMYA 3F1AA 2PJTA 5I12A 2OY4A 2OZRA 1BM6A 3RTTA 2OVXA 2OXWA 4FXYP 2KRJA 2MLSA 2DDYA 1AF0A 966CA 3KRYA 1OS2A 4DV8A 1ZTQA 5BPAA 2DDFA 3F18A 3LKAA 2CLTA 4GQLA 5B5OA 3LJZA 3EDZA 1B8YA 1IAAA 3LIKA
chains in the Genus database with same CATH superfamily
4JPAA 1IAGA 1JIWP 1WNIA 1OS9A 1IABA 3E8RA 1ZXCA 2X3AA 1BSWA 1KAPP 1ZXVA 1CAQA 2Y6DA 5I43A 2E3XA 1CK7A 1UMTA 2OI0A 1O0TA 2WO9A 3EWJA 1UMSA 3B8ZA 1G49A 4JP4A 2OW0A 1I76A 1MMQA 2JIHA 5D1TA 1XURA 1CIZA 1ROSA 2QPJA 4FU4A 3LQBA 1I1IP 4G0DA 4L6TA 3HDBA 4PKSA 3WV2A 3USNA 1YOUA 2OXUA 4GWMA 1BKCA 1ND1A 1HFSA 1SATA 4H49A 2JNPA 1KUGA 4GWNA 1C8TA 1UTZA 5H8XA 3K7NA 4H84A 4ZR5A 5D3CA 1QIAA 1RM8A 4EFSA 3LMCA 2WOAA 1SMPA 4XM7A 5I0LA 3UVCA 5LABA 3LUNA 3KEJA 5CXAA 1G4KA 4L19A 3GBOA 1FM1A 1JIZA 1KUIA 2AIGP 2RJPA 3EDGA 1MMBA 1A85A 2XS4A 1QIBA 1GO7P 1HTDA 2N8RA 1BUDA 4PKQA 2DW1A 3NX7A 1MMRA 4WK7A 1HY7A 4I03A 1C7KA 2W14A 5BOTA 3L0VA 1PWQA 2XS3A 2D1OA 3KMEA 3DPEA 2V4BA 4JIJA 2D1NA 1XFYA 3HYGA 4Q1LA 4GF1A 3TS4A 1BIWA 1GXDA 2EROA 5B5PA 4L63A 3DTIA 1KUFA 4GR3A 3EHXA 830CA 1OM8A 2O3EA 4AYKA 3LGPA 1BQOA 1JANA 1XFUA 5L79A 2X3CA 2OVZA 2W13A 3LIRA 1K7QA 3TT4A 5BOYA 1KBCA 4H3XA 2X3BA 5I4OA 1QUAA 4ON1A 1YP1A 3ZXHA 2O36A 5I2ZA 2OW9A 1GE6A 3G42A 1IAEA 1EAKA 2ERPA 3TVCA 5D1UA 3HY9A 4J4MA 1HV5A 3I7IA 3RTSA 2JT5A 3HB2P 4AXQA 2JT6A 1B3DA 1D5JA 1D7XA 1KUKA 3HDAP 4I35A 2OY2A 1BKCI 4DPEA 456CA 2A8HA 1OM7A 3OHOA 1R1HA 2OW1A 3KMCA 5D7WA 1JAPA 2DW0A 1Y93A 1BUVM 1EB6A 1K7IA 3LEAA 1PWPA 1R54A 4ILWD 1YQYA 1ATLA 1R1IA 2OXZA 2K9CA 2WO8A 3AYKA 1GE7A 1KUHA 2ERQA 4XM6A 2YUFA 1PWWA 3U1RA 1XM5A 1QICA 2W15A 4FVLA 3MA2A 3ZVSA 1OM6A 1OZ9A 1H71P 4DF9A 4WF6A 3F16A 3DTEA 1CGEA 4WZVA 1XFWA 2I47A 2FV9A 2W12A 3LJGA 4IUWA 4PKUA 1DMTA 2J83A 3DSLA 3O64A 2POJA 1GE5A 4H76A 3ZUKA 4GUYA 3V96B 2AYKA 3P1VA 1AYKA 1G12A 1GO8P 1CQRA 1ZP5A 1BZSA 4JA1A 1AKLA 1XUCA 3DL1A 2DW2A 4R3VA 3HY7A 1EUBA 4H82A 1JKYA 1XFXA 4PKRA 4FXQA 3B2ZA 3WV3A 3N2VA 1ZVXA 3ELMA 3LUMA 1XFVA 4PKVA 1RMZA 1CXVA 1SLMA 1SU3A 3DPFA 2CKIA 4XM8A 3O2XA 1O0QA 3WV1A 1S4BP 1GKCA 1CGFA 3SHIA 1USNA 2L0RA 3LJTA 1MNCA 2USNA 1SLNA 1Q3AA 1R1JA 2W0DA 5L7FA 1ZS0A 3P24A 4G9LA 3KECA 1OMJA 1JAQA 4XBHA 1Y8JA 1DTHA 1UTTA 2K2GA 1FBLA 3I7GA 1C3IA 4HX3A 1A86A 1TVIA 1PWUA 1JAOA 2MZEA 4GR0A 4A3WA 1R55A 1HFCA 2YIGA 4IN9A 1ASTA 4WKEA 2YB9A 3F17A 4H1QA 3VI1A 5I3MA 3LE9A 1D8MA 1BQQM 3EHYA 2J0TA 3LQ0A 1JK3A 3DWBA 3AIGA 4XCTA 1YCMA 2E2DA 3CKIA 3Q2GA 2MLRA 4CTHA 3TSKA 5D1SA 4IJOA 4WKIA 1D8FA 1FLSA 1XUDA 3LILA 2MZHA 3K7LA 1IACA 5D2BA 1JH1A 5CUHA 4HMAA 1IADA 4DD8A 2X7MA 2Z2DA 4H2EA 1BKCE 2Y6CA 1SRPA 3Q2HA 3F19A 3LK8A 3HBUP 1G9KA 3B92A 4H30A 3AYUA 1J7NA 4AUOA 3KWVC 3EDHA 4JQGA 3N2UA 3VTGA 2SRTA 2JSDA 2TCLA 1GKDA 3EDIA 1OO9A 3G5CA 4GR8A 2FV5A 3F15A 1MMPA 1G05A 4PKWA 4PKTA 4QKZA 4L7AA 2RJQA 1Z3JA 1QJIA 2MZIA 2OW2A 1K7GA 4A7BA 1PWVA 3DTKA 2HU6A 1L6JA 3HBVP 1HOVA 1Y0VA 3OHLA 3BA0A 3KEKA 1JJ9A 5CZMA 3KHIA 1XFZA 1QJJA 1UEAA 1CGLA 3L0TA 3DNGA 4AIGA 1I73A 5JMYA 3F1AA 2PJTA 5I12A 2OY4A 2OZRA 1BM6A 3RTTA 2OVXA 2OXWA 4FXYP 2KRJA 2MLSA 2DDYA 1AF0A 966CA 3KRYA 1OS2A 1XAXA 4DV8A 1ZTQA 5BPAA 2DDFA 3F18A 3LKAA 2CLTA 4GQLA 5B5OA 3LJZA 3EDZA 1B8YA 1IAAA 3LIKA
chains in the Genus database with same CATH topology
4JPAA 1IAGA 1JIWP 1WNIA 1OS9A 1IABA 3E8RA 1ZXCA 2X3AA 1BSWA 1KAPP 1ZXVA 1CAQA 2Y6DA 5I43A 2E3XA 1CK7A 1UMTA 2OI0A 1O0TA 2WO9A 3EWJA 1UMSA 3B8ZA 1G49A 4JP4A 2OW0A 1I76A 1MMQA 2JIHA 5D1TA 1XURA 1CIZA 1ROSA 2QPJA 4FU4A 3LQBA 1I1IP 4G0DA 4L6TA 3HDBA 4PKSA 3WV2A 3USNA 1YOUA 2OXUA 4GWMA 1BKCA 1ND1A 1HFSA 1SATA 4H49A 2JNPA 1KUGA 4GWNA 1C8TA 1UTZA 5H8XA 3K7NA 4H84A 4ZR5A 5D3CA 1QIAA 1RM8A 4EFSA 3LMCA 2WOAA 1SMPA 4XM7A 5I0LA 3UVCA 5LABA 3LUNA 3KEJA 5CXAA 1G4KA 4L19A 3GBOA 1FM1A 1JIZA 1KUIA 2AIGP 2RJPA 3EDGA 1MMBA 1A85A 2XS4A 1QIBA 1GO7P 1HTDA 2N8RA 1BUDA 4PKQA 2DW1A 3NX7A 1MMRA 4WK7A 1HY7A 4I03A 1C7KA 2W14A 5BOTA 3L0VA 1PWQA 2XS3A 2D1OA 3KMEA 3DPEA 2V4BA 4JIJA 2D1NA 1XFYA 3HYGA 4Q1LA 4GF1A 3TS4A 1BIWA 1GXDA 2EROA 5B5PA 4L63A 3DTIA 1KUFA 4GR3A 3EHXA 830CA 1OM8A 2O3EA 4AYKA 3LGPA 1BQOA 1JANA 1XFUA 5L79A 2X3CA 2OVZA 2W13A 3LIRA 1K7QA 3TT4A 5BOYA 1KBCA 4H3XA 2X3BA 5I4OA 1QUAA 4ON1A 1YP1A 3ZXHA 2O36A 5I2ZA 2OW9A 1GE6A 3G42A 1IAEA 1EAKA 2ERPA 3TVCA 5D1UA 3HY9A 4J4MA 1HV5A 3I7IA 3RTSA 2JT5A 3HB2P 4AXQA 2JT6A 1B3DA 1D5JA 1D7XA 1KUKA 3HDAP 4I35A 2OY2A 1BKCI 4DPEA 456CA 2A8HA 1OM7A 3OHOA 1R1HA 2OW1A 3KMCA 5D7WA 1JAPA 2DW0A 1Y93A 1BUVM 1EB6A 1K7IA 3LEAA 1PWPA 1R54A 4ILWD 1YQYA 1ATLA 1R1IA 2OXZA 2K9CA 2WO8A 3AYKA 1GE7A 1KUHA 2ERQA 4XM6A 2YUFA 1PWWA 3U1RA 1QICA 2W15A 4FVLA 3MA2A 3ZVSA 1OM6A 1H71P 4DF9A 4WF6A 3F16A 3DTEA 1CGEA 4WZVA 1XFWA 2I47A 2FV9A 2W12A 3LJGA 4IUWA 4PKUA 1DMTA 2J83A 3DSLA 3O64A 2POJA 1GE5A 4H76A 3ZUKA 4GUYA 3V96B 2AYKA 3P1VA 1AYKA 1G12A 1GO8P 1CQRA 1ZP5A 1BZSA 4JA1A 1AKLA 1XUCA 3DL1A 2DW2A 4R3VA 3HY7A 1EUBA 4H82A 1JKYA 1XFXA 4PKRA 4FXQA 3B2ZA 3WV3A 3N2VA 1ZVXA 3ELMA 3LUMA 1XFVA 4PKVA 1RMZA 1CXVA 1SLMA 1SU3A 3DPFA 2CKIA 4XM8A 3O2XA 1O0QA 3WV1A 1S4BP 1GKCA 1CGFA 3SHIA 1USNA 2L0RA 3LJTA 1MNCA 2USNA 1SLNA 1Q3AA 1R1JA 2W0DA 5L7FA 1ZS0A 3P24A 4G9LA 3KECA 1OMJA 1JAQA 4XBHA 1Y8JA 1DTHA 1UTTA 2K2GA 1FBLA 3I7GA 1C3IA 4HX3A 1A86A 1PWUA 1JAOA 2MZEA 4GR0A 4A3WA 1R55A 1HFCA 2YIGA 4IN9A 1ASTA 4WKEA 2YB9A 3F17A 4H1QA 3VI1A 5I3MA 3LE9A 1D8MA 1BQQM 3EHYA 2J0TA 3LQ0A 1JK3A 3DWBA 3AIGA 4XCTA 1YCMA 2E2DA 3CKIA 3Q2GA 2MLRA 4CTHA 3TSKA 5D1SA 4IJOA 4WKIA 1D8FA 1FLSA 1XUDA 3LILA 2MZHA 3K7LA 1IACA 5D2BA 1JH1A 5CUHA 4HMAA 1IADA 4DD8A 2X7MA 2Z2DA 4H2EA 1BKCE 2Y6CA 1SRPA 3Q2HA 3F19A 3LK8A 3HBUP 1G9KA 3B92A 4H30A 3AYUA 1J7NA 4AUOA 3KWVC 3EDHA 4JQGA 3N2UA 3VTGA 2SRTA 2JSDA 2TCLA 1GKDA 3EDIA 1OO9A 3G5CA 4GR8A 2FV5A 3F15A 1MMPA 1G05A 4PKWA 4PKTA 4QKZA 4L7AA 2RJQA 1Z3JA 1QJIA 2MZIA 2OW2A 1K7GA 4A7BA 1PWVA 3DTKA 2HU6A 1L6JA 3HBVP 1HOVA 1Y0VA 3OHLA 3BA0A 3KEKA 1JJ9A 5CZMA 3KHIA 1XFZA 1QJJA 1UEAA 1CGLA 3L0TA 3DNGA 4AIGA 1I73A 5JMYA 3F1AA 2PJTA 5I12A 2OY4A 2OZRA 1BM6A 3RTTA 2OVXA 2OXWA 4FXYP 2KRJA 2MLSA 2DDYA 1AF0A 966CA 3KRYA 1OS2A 4DV8A 1ZTQA 5BPAA 2DDFA 3F18A 3LKAA 2CLTA 4GQLA 5B5OA 3LJZA 3EDZA 1B8YA 1IAAA 3LIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JPA A;  1IAG A;  1JIW P;  1WNI A;  1OS9 A;  1IAB A;  3E8R A;  1ZXC A;  2X3A A;  1BSW A;  1KAP P;  1ZXV A;  1CAQ A;  2Y6D A;  5I43 A;  2E3X A;  1CK7 A;  1UMT A;  2OI0 A;  1O0T A;  2WO9 A;  3EWJ A;  1UMS A;  3B8Z A;  1G49 A;  4JP4 A;  2OW0 A;  1I76 A;  1MMQ A;  2JIH A;  5D1T A;  1XUR A;  1CIZ A;  1ROS A;  2QPJ A;  4FU4 A;  3LQB A;  1I1I P;  4G0D A;  4L6T A;  3HDB A;  4PKS A;  3WV2 A;  3USN A;  1YOU A;  2OXU A;  4GWM A;  1BKC A;  1ND1 A;  1HFS A;  1SAT A;  4H49 A;  2JNP A;  1KUG A;  4GWN A;  1C8T A;  1UTZ A;  5H8X A;  3K7N A;  4H84 A;  4ZR5 A;  5D3C A;  1QIA A;  1RM8 A;  4EFS A;  3LMC A;  2WOA A;  1SMP A;  4XM7 A;  5I0L A;  3UVC A;  5LAB A;  3LUN A;  3KEJ A;  5CXA A;  1G4K A;  4L19 A;  3GBO A;  1FM1 A;  1JIZ A;  1KUI A;  2AIG P;  2RJP A;  3EDG A;  1MMB A;  1A85 A;  2XS4 A;  1QIB A;  1GO7 P;  1HTD A;  2N8R A;  1BUD A;  4PKQ A;  2DW1 A;  3NX7 A;  1MMR A;  4WK7 A;  1HY7 A;  4I03 A;  1C7K A;  2W14 A;  5BOT A;  3L0V A;  1PWQ A;  2XS3 A;  2D1O A;  3KME A;  3DPE A;  2V4B A;  4JIJ A;  2D1N A;  1XFY A;  3HYG A;  4Q1L A;  4GF1 A;  3TS4 A;  1BIW A;  1GXD A;  2ERO A;  5B5P A;  4L63 A;  1KUF A;  4GR3 A;  3EHX A;  830C A;  1OM8 A;  2O3E A;  4AYK A;  3LGP A;  1BQO A;  1JAN A;  1XFU A;  5L79 A;  2X3C A;  2OVZ A;  2W13 A;  3LIR A;  1K7Q A;  3TT4 A;  5BOY A;  1KBC A;  4H3X A;  2X3B A;  5I4O A;  1QUA A;  4ON1 A;  1YP1 A;  3ZXH A;  2O36 A;  5I2Z A;  2OW9 A;  1GE6 A;  3G42 A;  1IAE A;  1EAK A;  2ERP A;  3TVC A;  5D1U A;  3HY9 A;  4J4M A;  1HV5 A;  3I7I A;  3RTS A;  2JT5 A;  3HB2 P;  4AXQ A;  2JT6 A;  1B3D A;  1D5J A;  1D7X A;  1KUK A;  3HDA P;  4I35 A;  2OY2 A;  1BKC I;  4DPE A;  456C A;  2A8H A;  1OM7 A;  3OHO A;  1R1H A;  2OW1 A;  3KMC A;  5D7W A;  1JAP A;  2DW0 A;  1Y93 A;  1BUV M;  1EB6 A;  1K7I A;  3LEA A;  1PWP A;  1R54 A;  4ILW D;  1YQY A;  1ATL A;  1R1I A;  2OXZ A;  2K9C A;  2WO8 A;  3AYK A;  1GE7 A;  1KUH A;  2ERQ A;  4XM6 A;  1PWW A;  3U1R A;  1QIC A;  2W15 A;  4FVL A;  3MA2 A;  3ZVS A;  1OM6 A;  1H71 P;  4DF9 A;  4WF6 A;  3F16 A;  1CGE A;  4WZV A;  1XFW A;  2I47 A;  2FV9 A;  2W12 A;  3LJG A;  4IUW A;  4PKU A;  1DMT A;  2J83 A;  3DSL A;  3O64 A;  2POJ A;  1GE5 A;  4H76 A;  3ZUK A;  4GUY A;  3V96 B;  2AYK A;  3P1V A;  1AYK A;  1G12 A;  1GO8 P;  1CQR A;  1ZP5 A;  1BZS A;  4JA1 A;  1AKL A;  1XUC A;  3DL1 A;  2DW2 A;  4R3V A;  3HY7 A;  1EUB A;  4H82 A;  1JKY A;  1XFX A;  4PKR A;  4FXQ A;  3B2Z A;  3WV3 A;  3N2V A;  1ZVX A;  3ELM A;  3LUM A;  1XFV A;  4PKV A;  1RMZ A;  1CXV A;  1SLM A;  1SU3 A;  3DPF A;  2CKI A;  4XM8 A;  3O2X A;  1O0Q A;  3WV1 A;  1S4B P;  1GKC A;  1CGF A;  3SHI A;  1USN A;  2L0R A;  3LJT A;  1MNC A;  2USN A;  1SLN A;  1Q3A A;  1R1J A;  2W0D A;  5L7F A;  1ZS0 A;  3P24 A;  4G9L A;  3KEC A;  1OMJ A;  1JAQ A;  4XBH A;  1Y8J A;  1DTH A;  1UTT A;  2K2G A;  1FBL A;  3I7G A;  1C3I A;  4HX3 A;  1A86 A;  1PWU A;  1JAO A;  2MZE A;  4GR0 A;  4A3W A;  1R55 A;  1HFC A;  2YIG A;  4IN9 A;  1AST A;  4WKE A;  2YB9 A;  3F17 A;  4H1Q A;  3VI1 A;  5I3M A;  3LE9 A;  1D8M A;  1BQQ M;  3EHY A;  2J0T A;  3LQ0 A;  1JK3 A;  3DWB A;  3AIG A;  4XCT A;  1YCM A;  2E2D A;  3CKI A;  3Q2G A;  2MLR A;  4CTH A;  3TSK A;  5D1S A;  4IJO A;  4WKI A;  1D8F A;  1FLS A;  1XUD A;  3LIL A;  2MZH A;  3K7L A;  1IAC A;  5D2B A;  1JH1 A;  5CUH A;  4HMA A;  1IAD A;  4DD8 A;  2X7M A;  2Z2D A;  4H2E A;  1BKC E;  2Y6C A;  1SRP A;  3Q2H A;  3F19 A;  3LK8 A;  3HBU P;  1G9K A;  3B92 A;  4H30 A;  3AYU A;  1J7N A;  4AUO A;  3KWV C;  3EDH A;  4JQG A;  3N2U A;  3VTG A;  2SRT A;  2JSD A;  2TCL A;  1GKD A;  3EDI A;  1OO9 A;  3G5C A;  4GR8 A;  2FV5 A;  3F15 A;  1MMP A;  1G05 A;  4PKW A;  4PKT A;  4QKZ A;  2RJQ A;  1Z3J A;  1QJI A;  2MZI A;  2OW2 A;  1K7G A;  4A7B A;  1PWV A;  2HU6 A;  1L6J A;  3HBV P;  1HOV A;  1Y0V A;  3OHL A;  3BA0 A;  3KEK A;  1JJ9 A;  5CZM A;  3KHI A;  1XFZ A;  1QJJ A;  1UEA A;  1CGL A;  3L0T A;  3DNG A;  4AIG A;  1I73 A;  5JMY A;  3F1A A;  2PJT A;  5I12 A;  2OY4 A;  2OZR A;  1BM6 A;  3RTT A;  2OVX A;  2OXW A;  4FXY P;  2KRJ A;  2MLS A;  2DDY A;  1AF0 A;  966C A;  3KRY A;  1OS2 A;  4DV8 A;  1ZTQ A;  5BPA A;  2DDF A;  3F18 A;  3LKA A;  2CLT A;  4GQL A;  5B5O A;  3LJZ A;  3EDZ A;  1B8Y A;  1IAA A;  3LIK A; 
#chains in the Genus database with same CATH topology
 4JPA A;  1IAG A;  1JIW P;  1WNI A;  1OS9 A;  1IAB A;  3E8R A;  1ZXC A;  2X3A A;  1BSW A;  1KAP P;  1ZXV A;  1CAQ A;  2Y6D A;  5I43 A;  2E3X A;  1CK7 A;  1UMT A;  2OI0 A;  1O0T A;  2WO9 A;  3EWJ A;  1UMS A;  3B8Z A;  1G49 A;  4JP4 A;  2OW0 A;  1I76 A;  1MMQ A;  2JIH A;  5D1T A;  1XUR A;  1CIZ A;  1ROS A;  2QPJ A;  4FU4 A;  3LQB A;  1I1I P;  4G0D A;  4L6T A;  3HDB A;  4PKS A;  3WV2 A;  3USN A;  1YOU A;  2OXU A;  4GWM A;  1BKC A;  1ND1 A;  1HFS A;  1SAT A;  4H49 A;  2JNP A;  1KUG A;  4GWN A;  1C8T A;  1UTZ A;  5H8X A;  3K7N A;  4H84 A;  4ZR5 A;  5D3C A;  1QIA A;  1RM8 A;  4EFS A;  3LMC A;  2WOA A;  1SMP A;  4XM7 A;  5I0L A;  3UVC A;  5LAB A;  3LUN A;  3KEJ A;  5CXA A;  1G4K A;  4L19 A;  3GBO A;  1FM1 A;  1JIZ A;  1KUI A;  2AIG P;  2RJP A;  3EDG A;  1MMB A;  1A85 A;  2XS4 A;  1QIB A;  1GO7 P;  1HTD A;  2N8R A;  1BUD A;  4PKQ A;  2DW1 A;  3NX7 A;  1MMR A;  4WK7 A;  1HY7 A;  4I03 A;  1C7K A;  2W14 A;  5BOT A;  3L0V A;  1PWQ A;  2XS3 A;  2D1O A;  3KME A;  3DPE A;  2V4B A;  4JIJ A;  2D1N A;  1XFY A;  3HYG A;  4Q1L A;  4GF1 A;  3TS4 A;  1BIW A;  1GXD A;  2ERO A;  5B5P A;  4L63 A;  3DTI A;  1KUF A;  4GR3 A;  3EHX A;  830C A;  1OM8 A;  2O3E A;  4AYK A;  3LGP A;  1BQO A;  1JAN A;  1XFU A;  5L79 A;  2X3C A;  2OVZ A;  2W13 A;  3LIR A;  1K7Q A;  3TT4 A;  5BOY A;  1KBC A;  4H3X A;  2X3B A;  5I4O A;  1QUA A;  4ON1 A;  1YP1 A;  3ZXH A;  2O36 A;  5I2Z A;  2OW9 A;  1GE6 A;  3G42 A;  1IAE A;  1EAK A;  2ERP A;  3TVC A;  5D1U A;  3HY9 A;  4J4M A;  1HV5 A;  3I7I A;  3RTS A;  2JT5 A;  3HB2 P;  4AXQ A;  2JT6 A;  1B3D A;  1D5J A;  1D7X A;  1KUK A;  3HDA P;  4I35 A;  2OY2 A;  1BKC I;  4DPE A;  456C A;  2A8H A;  1OM7 A;  3OHO A;  1R1H A;  2OW1 A;  3KMC A;  5D7W A;  1JAP A;  2DW0 A;  1Y93 A;  1BUV M;  1EB6 A;  1K7I A;  3LEA A;  1PWP A;  1R54 A;  4ILW D;  1YQY A;  1ATL A;  1R1I A;  2OXZ A;  2K9C A;  2WO8 A;  3AYK A;  1GE7 A;  1KUH A;  2ERQ A;  4XM6 A;  2YUF A;  1PWW A;  3U1R A;  1XM5 A;  1QIC A;  2W15 A;  4FVL A;  3MA2 A;  3ZVS A;  1OM6 A;  1OZ9 A;  1H71 P;  4DF9 A;  4WF6 A;  3F16 A;  3DTE A;  1CGE A;  4WZV A;  1XFW A;  2I47 A;  2FV9 A;  2W12 A;  3LJG A;  4IUW A;  4PKU A;  1DMT A;  2J83 A;  3DSL A;  3O64 A;  2POJ A;  1GE5 A;  4H76 A;  3ZUK A;  4GUY A;  3V96 B;  2AYK A;  3P1V A;  1AYK A;  1G12 A;  1GO8 P;  1CQR A;  1ZP5 A;  1BZS A;  4JA1 A;  1AKL A;  1XUC A;  3DL1 A;  2DW2 A;  4R3V A;  3HY7 A;  1EUB A;  4H82 A;  1JKY A;  1XFX A;  4PKR A;  4FXQ A;  3B2Z A;  3WV3 A;  3N2V A;  1ZVX A;  3ELM A;  3LUM A;  1XFV A;  4PKV A;  1RMZ A;  1CXV A;  1SLM A;  1SU3 A;  3DPF A;  2CKI A;  4XM8 A;  3O2X A;  1O0Q A;  3WV1 A;  1S4B P;  1GKC A;  1CGF A;  3SHI A;  1USN A;  2L0R A;  3LJT A;  1MNC A;  2USN A;  1SLN A;  1Q3A A;  1R1J A;  2W0D A;  5L7F A;  1ZS0 A;  3P24 A;  4G9L A;  3KEC A;  1OMJ A;  1JAQ A;  4XBH A;  1Y8J A;  1DTH A;  1UTT A;  2K2G A;  1FBL A;  3I7G A;  1C3I A;  4HX3 A;  1A86 A;  1TVI A;  1PWU A;  1JAO A;  2MZE A;  4GR0 A;  4A3W A;  1R55 A;  1HFC A;  2YIG A;  4IN9 A;  1AST A;  4WKE A;  2YB9 A;  3F17 A;  4H1Q A;  3VI1 A;  5I3M A;  3LE9 A;  1D8M A;  1BQQ M;  3EHY A;  2J0T A;  3LQ0 A;  1JK3 A;  3DWB A;  3AIG A;  4XCT A;  1YCM A;  2E2D A;  3CKI A;  3Q2G A;  2MLR A;  4CTH A;  3TSK A;  5D1S A;  4IJO A;  4WKI A;  1D8F A;  1FLS A;  1XUD A;  3LIL A;  2MZH A;  3K7L A;  1IAC A;  5D2B A;  1JH1 A;  5CUH A;  4HMA A;  1IAD A;  4DD8 A;  2X7M A;  2Z2D A;  4H2E A;  1BKC E;  2Y6C A;  1SRP A;  3Q2H A;  3F19 A;  3LK8 A;  3HBU P;  1G9K A;  3B92 A;  4H30 A;  3AYU A;  1J7N A;  4AUO A;  3KWV C;  3EDH A;  4JQG A;  3N2U A;  3VTG A;  2SRT A;  2JSD A;  2TCL A;  1GKD A;  3EDI A;  1OO9 A;  3G5C A;  4GR8 A;  2FV5 A;  3F15 A;  1MMP A;  1G05 A;  4PKW A;  4PKT A;  4QKZ A;  4L7A A;  2RJQ A;  1Z3J A;  1QJI A;  2MZI A;  2OW2 A;  1K7G A;  4A7B A;  1PWV A;  3DTK A;  2HU6 A;  1L6J A;  3HBV P;  1HOV A;  1Y0V A;  3OHL A;  3BA0 A;  3KEK A;  1JJ9 A;  5CZM A;  3KHI A;  1XFZ A;  1QJJ A;  1UEA A;  1CGL A;  3L0T A;  3DNG A;  4AIG A;  1I73 A;  5JMY A;  3F1A A;  2PJT A;  5I12 A;  2OY4 A;  2OZR A;  1BM6 A;  3RTT A;  2OVX A;  2OXW A;  4FXY P;  2KRJ A;  2MLS A;  2DDY A;  1AF0 A;  966C A;  3KRY A;  1OS2 A;  1XAX A;  4DV8 A;  1ZTQ A;  5BPA A;  2DDF A;  3F18 A;  3LKA A;  2CLT A;  4GQL A;  5B5O A;  3LJZ A;  3EDZ A;  1B8Y A;  1IAA A;  3LIK A; 
#chains in the Genus database with same CATH homology
 4JPA A;  1IAG A;  1JIW P;  1WNI A;  1OS9 A;  1IAB A;  3E8R A;  1ZXC A;  2X3A A;  1BSW A;  1KAP P;  1ZXV A;  1CAQ A;  2Y6D A;  5I43 A;  2E3X A;  1CK7 A;  1UMT A;  2OI0 A;  1O0T A;  2WO9 A;  3EWJ A;  1UMS A;  3B8Z A;  1G49 A;  4JP4 A;  2OW0 A;  1I76 A;  1MMQ A;  2JIH A;  5D1T A;  1XUR A;  1CIZ A;  1ROS A;  2QPJ A;  4FU4 A;  3LQB A;  1I1I P;  4G0D A;  4L6T A;  3HDB A;  4PKS A;  3WV2 A;  3USN A;  1YOU A;  2OXU A;  4GWM A;  1BKC A;  1ND1 A;  1HFS A;  1SAT A;  4H49 A;  2JNP A;  1KUG A;  4GWN A;  1C8T A;  1UTZ A;  5H8X A;  3K7N A;  4H84 A;  4ZR5 A;  5D3C A;  1QIA A;  1RM8 A;  4EFS A;  3LMC A;  2WOA A;  1SMP A;  4XM7 A;  5I0L A;  3UVC A;  5LAB A;  3LUN A;  3KEJ A;  5CXA A;  1G4K A;  4L19 A;  3GBO A;  1FM1 A;  1JIZ A;  1KUI A;  2AIG P;  2RJP A;  3EDG A;  1MMB A;  1A85 A;  2XS4 A;  1QIB A;  1GO7 P;  1HTD A;  2N8R A;  1BUD A;  4PKQ A;  2DW1 A;  3NX7 A;  1MMR A;  4WK7 A;  1HY7 A;  4I03 A;  1C7K A;  2W14 A;  5BOT A;  3L0V A;  1PWQ A;  2XS3 A;  2D1O A;  3KME A;  3DPE A;  2V4B A;  4JIJ A;  2D1N A;  1XFY A;  3HYG A;  4Q1L A;  4GF1 A;  3TS4 A;  1BIW A;  1GXD A;  2ERO A;  5B5P A;  4L63 A;  3DTI A;  1KUF A;  4GR3 A;  3EHX A;  830C A;  1OM8 A;  2O3E A;  4AYK A;  3LGP A;  1BQO A;  1JAN A;  1XFU A;  5L79 A;  2X3C A;  2OVZ A;  2W13 A;  3LIR A;  1K7Q A;  3TT4 A;  5BOY A;  1KBC A;  4H3X A;  2X3B A;  5I4O A;  1QUA A;  4ON1 A;  1YP1 A;  3ZXH A;  2O36 A;  5I2Z A;  2OW9 A;  1GE6 A;  3G42 A;  1IAE A;  1EAK A;  2ERP A;  3TVC A;  5D1U A;  3HY9 A;  4J4M A;  1HV5 A;  3I7I A;  3RTS A;  2JT5 A;  3HB2 P;  4AXQ A;  2JT6 A;  1B3D A;  1D5J A;  1D7X A;  1KUK A;  3HDA P;  4I35 A;  2OY2 A;  1BKC I;  4DPE A;  456C A;  2A8H A;  1OM7 A;  3OHO A;  1R1H A;  2OW1 A;  3KMC A;  5D7W A;  1JAP A;  2DW0 A;  1Y93 A;  1BUV M;  1EB6 A;  1K7I A;  3LEA A;  1PWP A;  1R54 A;  4ILW D;  1YQY A;  1ATL A;  1R1I A;  2OXZ A;  2K9C A;  2WO8 A;  3AYK A;  1GE7 A;  1KUH A;  2ERQ A;  4XM6 A;  2YUF A;  1PWW A;  3U1R A;  1QIC A;  2W15 A;  4FVL A;  3MA2 A;  3ZVS A;  1OM6 A;  1H71 P;  4DF9 A;  4WF6 A;  3F16 A;  3DTE A;  1CGE A;  4WZV A;  1XFW A;  2I47 A;  2FV9 A;  2W12 A;  3LJG A;  4IUW A;  4PKU A;  1DMT A;  2J83 A;  3DSL A;  3O64 A;  2POJ A;  1GE5 A;  4H76 A;  3ZUK A;  4GUY A;  3V96 B;  2AYK A;  3P1V A;  1AYK A;  1G12 A;  1GO8 P;  1CQR A;  1ZP5 A;  1BZS A;  4JA1 A;  1AKL A;  1XUC A;  3DL1 A;  2DW2 A;  4R3V A;  3HY7 A;  1EUB A;  4H82 A;  1JKY A;  1XFX A;  4PKR A;  4FXQ A;  3B2Z A;  3WV3 A;  3N2V A;  1ZVX A;  3ELM A;  3LUM A;  1XFV A;  4PKV A;  1RMZ A;  1CXV A;  1SLM A;  1SU3 A;  3DPF A;  2CKI A;  4XM8 A;  3O2X A;  1O0Q A;  3WV1 A;  1S4B P;  1GKC A;  1CGF A;  3SHI A;  1USN A;  2L0R A;  3LJT A;  1MNC A;  2USN A;  1SLN A;  1Q3A A;  1R1J A;  2W0D A;  5L7F A;  1ZS0 A;  3P24 A;  4G9L A;  3KEC A;  1OMJ A;  1JAQ A;  4XBH A;  1Y8J A;  1DTH A;  1UTT A;  2K2G A;  1FBL A;  3I7G A;  1C3I A;  4HX3 A;  1A86 A;  1PWU A;  1JAO A;  2MZE A;  4GR0 A;  4A3W A;  1R55 A;  1HFC A;  2YIG A;  4IN9 A;  1AST A;  4WKE A;  2YB9 A;  3F17 A;  4H1Q A;  3VI1 A;  5I3M A;  3LE9 A;  1D8M A;  1BQQ M;  3EHY A;  2J0T A;  3LQ0 A;  1JK3 A;  3DWB A;  3AIG A;  4XCT A;  1YCM A;  2E2D A;  3CKI A;  3Q2G A;  2MLR A;  4CTH A;  3TSK A;  5D1S A;  4IJO A;  4WKI A;  1D8F A;  1FLS A;  1XUD A;  3LIL A;  2MZH A;  3K7L A;  1IAC A;  5D2B A;  1JH1 A;  5CUH A;  4HMA A;  1IAD A;  4DD8 A;  2X7M A;  2Z2D A;  4H2E A;  1BKC E;  2Y6C A;  1SRP A;  3Q2H A;  3F19 A;  3LK8 A;  3HBU P;  1G9K A;  3B92 A;  4H30 A;  3AYU A;  1J7N A;  4AUO A;  3KWV C;  3EDH A;  4JQG A;  3N2U A;  3VTG A;  2SRT A;  2JSD A;  2TCL A;  1GKD A;  3EDI A;  1OO9 A;  3G5C A;  4GR8 A;  2FV5 A;  3F15 A;  1MMP A;  1G05 A;  4PKW A;  4PKT A;  4QKZ A;  4L7A A;  2RJQ A;  1Z3J A;  1QJI A;  2MZI A;  2OW2 A;  1K7G A;  4A7B A;  1PWV A;  3DTK A;  2HU6 A;  1L6J A;  3HBV P;  1HOV A;  1Y0V A;  3OHL A;  3BA0 A;  3KEK A;  1JJ9 A;  5CZM A;  3KHI A;  1XFZ A;  1QJJ A;  1UEA A;  1CGL A;  3L0T A;  3DNG A;  4AIG A;  1I73 A;  5JMY A;  3F1A A;  2PJT A;  5I12 A;  2OY4 A;  2OZR A;  1BM6 A;  3RTT A;  2OVX A;  2OXW A;  4FXY P;  2KRJ A;  2MLS A;  2DDY A;  1AF0 A;  966C A;  3KRY A;  1OS2 A;  4DV8 A;  1ZTQ A;  5BPA A;  2DDF A;  3F18 A;  3LKA A;  2CLT A;  4GQL A;  5B5O A;  3LJZ A;  3EDZ A;  1B8Y A;  1IAA A;  3LIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...