1MMOG

Crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
162
structure length
162
Chain Sequence
b'LGIHSNDTRDAWVNKIAHVNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE HYDROLASE (BETA CHAIN)
publication title Crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase (monooxygenase)
total genus 59
structure length 162
sequence length 162
chains with identical sequence H
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1994-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mmoG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mmoG02
1FZ3E 1XVFE 1XU5E 1XVGE 1XVEE 1FYZE 1FZ0E 4GAMC 1FZ1E 1MTYG 1FZ9E 1XMFE 1XMHE 1XU3E 1FZ8E 1MHZG 1MHYG 1FZIE 1XVDE 1XMGE 1FZHE 1XVCE 1MMOG 1FZ2E 1FZ5E 1FZ6E 1XVBE 1FZ7E 1FZ4E
chains in the Genus database with same CATH superfamily
3HGLA 4HCBA 2JQTA 1N1CA 4M45A 3NE6A 3CFRA 1FPOA 3S9HA 3OGLB 4FK2A 1MTYG 4FVMA 3RMAA 4KHUA 4KHNA 2HD0A 3HP9A 1WAJA 3UO2A 2OZMA 4FJXA 3C6OB 2E31A 3QNNA 4FJ7A 4AKHA 1CLQA 3LZJA 1JW2A 2MZWB 3TJYA 4FK4A 1XVDE 4RNGA 4DTJA 1XVCE 2JHCA 4M3RA 2JH9A 4FJ8A 3MKSB 4EPHA 4DU1A 5IZ7A 3SPYA 1XVBE 3SJJA 3E4YA 4AKIA 4M41A 3SVIA 4J2BA 3LZIA 3SQ0A 2OVRB 2B8IA 1FZ4E 4E4BA 4M3TA 3V7DB 3SUNA 2LF3A 3RWUA 1FZ3E 4J2AA 1XVGE 3LDSA 3SQ1A 2ATQA 4JS5A 3BVOA 1FZ1E 2OVPB 2JHPA 4FJGA 4J2DA 3L1NA 4AI6A 1XMHE 3KD5E 4M3ZA 1XU3E 3CFPA 4DTSA 3NGIA 3L2OB 2B1EA 4JRQA 3SUOA 4M3XA 2FW3A 2RCUA 2P1QB 3TAFA 4J2EA 1IH7A 2DEBA 3LD8A 3QESA 1XL3C 1FZ2E 5IREA 3TAGA 1FS1A 2MW2A 2VJ4A 3QEWA 3RMCA 2MMBA 3UO3A 2K5SA 3CQ8A 3SQ4A 4X5NA 3OGMB 3HGKE 2P5GA 4FJ9A 4M3YA 2E32A 2QXFA 2B7MA 2OYQA 4KHQA 2DTUA 4M3UA 3C6NB 3KD1E 1XVFE 4FJNA 3NDKA 1XU5E 3SUPA 2JH8A 1FYZE 3SQ2A 3SI6A 3E4WA 3L0MA 4I9LA 3SPZA 4KHWA 5IBKB 1LDKE 2PFVA 1P22A 2VIXA 3TABA 4E3SA 1XMFE 4HCCA 4I9QA 3SNNA 3L8BA 1IG9A 4KI4A 1WAFA 3TAEA 4KHYA 4QNDA 2JHAA 3QEXA 4EYWA 4ADOA 4DTXA 4X5MA 1FZ8E 3N1EA 4EP9A 3C94A 2RKHA 4B08A 1MHYG 2P1PB 3QEPA 3J27A 3NCIA 3N1BA 1Q9XA 4KI6A 3QERA 1XMGE 3TL8B 3RMBA 4FJJA 3QEVA 4IT5A 3NAEA 1FZ6E 2P5OA 3LDBA 4FJMA 2YB5A 4JS4A 3C95A 4DTRA 2P1MB 4FK0A 2H4TA 3J2PA 2OZSA 5H37A 4ADNA 4FJ5A 1NEXB 4DTPA 3QEIA 1Q9YA 2JPNA 4M3WA 3C6PB 4DU4A 1XVEE 2P1OB 3HL8A 3NHGA 1FZ0E 4GAMC 2DY4A 3OGKB 4DTUA 2FYOA 1FXXA 4JRPA 1FZ9E 4FJLA 4QNCA 3QNOA 4FJHA 4M42A 4DTMA 2P1NB 3WSOA 2LF6A 4DTNA 2PFTA 4DU3A 3SCXA 3RMDA 4FJIA 1MHZG 3QETA 4RL5A 1FZIE 4AKGA 3SUQA 3UIQA 1FZHE 4DTOA 2VJ5A 4KHSA 3K2OA 2OVQB 3CFOA 1FZ5E 1MMOG 4FJKA 1FZ7E 4I6JB 4RG8A 4ICGC
chains in the Genus database with same CATH topology
3HGLA 4HCBA 4M45A 3NE6A 3CFRA 3S9HA 3OGLB 4FK2A 1MTYG 4FVMA 3RMAA 4KHUA 4KHNA 2HD0A 3HP9A 1WAJA 2OZMA 4FJXA 3C6OB 2E31A 3QNNA 4FJ7A 4AKHA 1CLQA 3LZJA 2MZWB 3TJYA 4FK4A 1XVDE 4RNGA 4DTJA 1XVCE 2JHCA 4M3RA 2JH9A 4FJ8A 3MKSB 4EPHA 4DU1A 5IZ7A 3SPYA 1XVBE 3SJJA 3E4YA 4AKIA 4M41A 3SVIA 4J2BA 3LZIA 3SQ0A 2OVRB 2B8IA 1FZ4E 4E4BA 4M3TA 3V7DB 3SUNA 2LF3A 3RWUA 1FZ3E 4J2AA 1XVGE 3LDSA 3SQ1A 2ATQA 4JS5A 1FZ1E 2OVPB 2JHPA 4FJGA 4J2DA 3L1NA 4AI6A 1XMHE 3KD5E 4M3ZA 1XU3E 3CFPA 4DTSA 3NGIA 3L2OB 2B1EA 4JRQA 3SUOA 4M3XA 2FW3A 2RCUA 2P1QB 3TAFA 4J2EA 1IH7A 2DEBA 3LD8A 3QESA 1XL3C 1FZ2E 5IREA 3TAGA 1FS1A 2VJ4A 3QEWA 3RMCA 2MMBA 3CQ8A 3SQ4A 4X5NA 3OGMB 3HGKE 2P5GA 4FJ9A 4M3YA 2E32A 2QXFA 2B7MA 2OYQA 4KHQA 2DTUA 4M3UA 3C6NB 3KD1E 1XVFE 4FJNA 3NDKA 1XU5E 3SUPA 2JH8A 1FYZE 3SQ2A 3SI6A 3E4WA 3L0MA 4I9LA 3SPZA 4KHWA 5IBKB 1LDKE 2PFVA 1P22A 2VIXA 3TABA 4E3SA 1XMFE 4HCCA 4I9QA 3SNNA 3L8BA 1IG9A 4KI4A 1WAFA 3TAEA 4KHYA 4QNDA 2JHAA 3QEXA 4EYWA 4ADOA 4DTXA 4X5MA 1FZ8E 3N1EA 4EP9A 3C94A 4B08A 4FJMA 1MHYG 2P1PB 3QEPA 3J27A 3NCIA 3N1BA 1Q9XA 4KI6A 3QERA 1XMGE 3TL8B 3RMBA 4FJJA 3QEVA 3NAEA 2P5OA 1FZ6E 3LDBA 2YB5A 4JS4A 3C95A 4DTRA 2P1MB 4FK0A 2H4TA 3J2PA 2OZSA 5H37A 4ADNA 4FJ5A 1NEXB 4DTPA 3QEIA 1Q9YA 2JPNA 4M3WA 3C6PB 4DU4A 1XVEE 2P1OB 3HL8A 3NHGA 1FZ0E 4GAMC 2DY4A 3OGKB 4DTUA 2FYOA 1FXXA 4JRPA 1FZ9E 4FJLA 4QNCA 3QNOA 4FJHA 4M42A 4DTMA 2P1NB 3WSOA 2LF6A 4DTNA 2PFTA 4DU3A 3SCXA 3RMDA 4FJIA 1MHZG 3QETA 4RL5A 1FZIE 4AKGA 3SUQA 3UIQA 1FZHE 4DTOA 2VJ5A 4KHSA 3K2OA 2OVQB 3CFOA 1FZ5E 1MMOG 4FJKA 1FZ7E 4I6JB 4RG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ3 E;  1XVF E;  1XU5 E;  1XVG E;  1XVE E;  1FYZ E;  1FZ0 E;  4GAM C;  1FZ1 E;  1MTY G;  1FZ9 E;  1XMF E;  1XMH E;  1XU3 E;  1FZ8 E;  1MHZ G;  1MHY G;  1FZI E;  1XVD E;  1XMG E;  1FZH E;  1XVC E;  1MMO G;  1FZ2 E;  1FZ5 E;  1FZ6 E;  1XVB E;  1FZ7 E;  1FZ4 E; 
#chains in the Genus database with same CATH topology
 3HGL A;  4HCB A;  2JQT A;  1N1C A;  4M45 A;  3NE6 A;  3CFR A;  1FPO A;  3S9H A;  3OGL B;  4FK2 A;  1MTY G;  4FVM A;  3RMA A;  4KHU A;  4KHN A;  2HD0 A;  3HP9 A;  1WAJ A;  3UO2 A;  2OZM A;  4FJX A;  3C6O B;  2E31 A;  3QNN A;  4FJ7 A;  4AKH A;  1CLQ A;  3LZJ A;  1JW2 A;  2MZW B;  3TJY A;  4FK4 A;  1XVD E;  4RNG A;  4DTJ A;  1XVC E;  2JHC A;  4M3R A;  2JH9 A;  4FJ8 A;  3MKS B;  4EPH A;  4DU1 A;  5IZ7 A;  3SPY A;  1XVB E;  3SJJ A;  3E4Y A;  4AKI A;  4M41 A;  3SVI A;  4J2B A;  3LZI A;  3SQ0 A;  2OVR B;  2B8I A;  1FZ4 E;  4E4B A;  4M3T A;  3V7D B;  3SUN A;  2LF3 A;  3RWU A;  1FZ3 E;  4J2A A;  1XVG E;  3LDS A;  3SQ1 A;  2ATQ A;  4JS5 A;  3BVO A;  1FZ1 E;  2OVP B;  2JHP A;  4FJG A;  4J2D A;  3L1N A;  4AI6 A;  1XMH E;  3KD5 E;  4M3Z A;  1XU3 E;  3CFP A;  4DTS A;  3NGI A;  3L2O B;  2B1E A;  4JRQ A;  3SUO A;  4M3X A;  2FW3 A;  2RCU A;  2P1Q B;  3TAF A;  4J2E A;  1IH7 A;  2DEB A;  3LD8 A;  3QES A;  1XL3 C;  1FZ2 E;  5IRE A;  3TAG A;  1FS1 A;  2MW2 A;  2VJ4 A;  3QEW A;  3RMC A;  2MMB A;  3UO3 A;  2K5S A;  3CQ8 A;  3SQ4 A;  4X5N A;  3OGM B;  3HGK E;  2P5G A;  4FJ9 A;  4M3Y A;  2E32 A;  2QXF A;  2B7M A;  2OYQ A;  4KHQ A;  2DTU A;  4M3U A;  3C6N B;  3KD1 E;  1XVF E;  4FJN A;  3NDK A;  1XU5 E;  3SUP A;  2JH8 A;  1FYZ E;  3SQ2 A;  3SI6 A;  3E4W A;  3L0M A;  4I9L A;  3SPZ A;  4KHW A;  5IBK B;  1LDK E;  2PFV A;  1P22 A;  2VIX A;  3TAB A;  4E3S A;  1XMF E;  4HCC A;  4I9Q A;  3SNN A;  3L8B A;  1IG9 A;  4KI4 A;  1WAF A;  3TAE A;  4KHY A;  4QND A;  2JHA A;  3QEX A;  4EYW A;  4ADO A;  4DTX A;  4X5M A;  1FZ8 E;  3N1E A;  4EP9 A;  3C94 A;  2RKH A;  4B08 A;  1MHY G;  2P1P B;  3QEP A;  3J27 A;  3NCI A;  3N1B A;  1Q9X A;  4KI6 A;  3QER A;  1XMG E;  3TL8 B;  3RMB A;  4FJJ A;  3QEV A;  4IT5 A;  3NAE A;  1FZ6 E;  2P5O A;  3LDB A;  4FJM A;  2YB5 A;  4JS4 A;  3C95 A;  4DTR A;  2P1M B;  4FK0 A;  2H4T A;  3J2P A;  2OZS A;  5H37 A;  4ADN A;  4FJ5 A;  1NEX B;  4DTP A;  3QEI A;  1Q9Y A;  2JPN A;  4M3W A;  3C6P B;  4DU4 A;  1XVE E;  2P1O B;  3HL8 A;  3NHG A;  1FZ0 E;  4GAM C;  2DY4 A;  3OGK B;  4DTU A;  2FYO A;  1FXX A;  4JRP A;  1FZ9 E;  4FJL A;  4QNC A;  3QNO A;  4FJH A;  4M42 A;  4DTM A;  2P1N B;  3WSO A;  2LF6 A;  4DTN A;  2PFT A;  4DU3 A;  3SCX A;  3RMD A;  4FJI A;  1MHZ G;  3QET A;  4RL5 A;  1FZI E;  4AKG A;  3SUQ A;  3UIQ A;  1FZH E;  4DTO A;  2VJ5 A;  4KHS A;  3K2O A;  2OVQ B;  3CFO A;  1FZ5 E;  1MMO G;  4FJK A;  1FZ7 E;  4I6J B;  4RG8 A;  4ICG C; 
#chains in the Genus database with same CATH homology
 3HGL A;  4HCB A;  4M45 A;  3NE6 A;  3CFR A;  3S9H A;  3OGL B;  4FK2 A;  1MTY G;  4FVM A;  3RMA A;  4KHU A;  4KHN A;  2HD0 A;  3HP9 A;  1WAJ A;  2OZM A;  4FJX A;  3C6O B;  2E31 A;  3QNN A;  4FJ7 A;  4AKH A;  1CLQ A;  3LZJ A;  2MZW B;  3TJY A;  4FK4 A;  1XVD E;  4RNG A;  4DTJ A;  1XVC E;  2JHC A;  4M3R A;  2JH9 A;  4FJ8 A;  3MKS B;  4EPH A;  4DU1 A;  5IZ7 A;  3SPY A;  1XVB E;  3SJJ A;  3E4Y A;  4AKI A;  4M41 A;  3SVI A;  4J2B A;  3LZI A;  3SQ0 A;  2OVR B;  2B8I A;  1FZ4 E;  4E4B A;  4M3T A;  3V7D B;  3SUN A;  2LF3 A;  3RWU A;  1FZ3 E;  4J2A A;  1XVG E;  3LDS A;  3SQ1 A;  2ATQ A;  4JS5 A;  1FZ1 E;  2OVP B;  2JHP A;  4FJG A;  4J2D A;  3L1N A;  4AI6 A;  1XMH E;  3KD5 E;  4M3Z A;  1XU3 E;  3CFP A;  4DTS A;  3NGI A;  3L2O B;  2B1E A;  4JRQ A;  3SUO A;  4M3X A;  2FW3 A;  2RCU A;  2P1Q B;  3TAF A;  4J2E A;  1IH7 A;  2DEB A;  3LD8 A;  3QES A;  1XL3 C;  1FZ2 E;  5IRE A;  3TAG A;  1FS1 A;  2VJ4 A;  3QEW A;  3RMC A;  2MMB A;  3CQ8 A;  3SQ4 A;  4X5N A;  3OGM B;  3HGK E;  2P5G A;  4FJ9 A;  4M3Y A;  2E32 A;  2QXF A;  2B7M A;  2OYQ A;  4KHQ A;  2DTU A;  4M3U A;  3C6N B;  3KD1 E;  1XVF E;  4FJN A;  3NDK A;  1XU5 E;  3SUP A;  2JH8 A;  1FYZ E;  3SQ2 A;  3SI6 A;  3E4W A;  3L0M A;  4I9L A;  3SPZ A;  4KHW A;  5IBK B;  1LDK E;  2PFV A;  1P22 A;  2VIX A;  3TAB A;  4E3S A;  1XMF E;  4HCC A;  4I9Q A;  3SNN A;  3L8B A;  1IG9 A;  4KI4 A;  1WAF A;  3TAE A;  4KHY A;  4QND A;  2JHA A;  3QEX A;  4EYW A;  4ADO A;  4DTX A;  4X5M A;  1FZ8 E;  3N1E A;  4EP9 A;  3C94 A;  4B08 A;  4FJM A;  1MHY G;  2P1P B;  3QEP A;  3J27 A;  3NCI A;  3N1B A;  1Q9X A;  4KI6 A;  3QER A;  1XMG E;  3TL8 B;  3RMB A;  4FJJ A;  3QEV A;  3NAE A;  2P5O A;  1FZ6 E;  3LDB A;  2YB5 A;  4JS4 A;  3C95 A;  4DTR A;  2P1M B;  4FK0 A;  2H4T A;  3J2P A;  2OZS A;  5H37 A;  4ADN A;  4FJ5 A;  1NEX B;  4DTP A;  3QEI A;  1Q9Y A;  2JPN A;  4M3W A;  3C6P B;  4DU4 A;  1XVE E;  2P1O B;  3HL8 A;  3NHG A;  1FZ0 E;  4GAM C;  2DY4 A;  3OGK B;  4DTU A;  2FYO A;  1FXX A;  4JRP A;  1FZ9 E;  4FJL A;  4QNC A;  3QNO A;  4FJH A;  4M42 A;  4DTM A;  2P1N B;  3WSO A;  2LF6 A;  4DTN A;  2PFT A;  4DU3 A;  3SCX A;  3RMD A;  4FJI A;  1MHZ G;  3QET A;  4RL5 A;  1FZI E;  4AKG A;  3SUQ A;  3UIQ A;  1FZH E;  4DTO A;  2VJ5 A;  4KHS A;  3K2O A;  2OVQ B;  3CFO A;  1FZ5 E;  1MMO G;  4FJK A;  1FZ7 E;  4I6J B;  4RG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...