1MMOG

Crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
162
structure length
162
Chain Sequence
LGIHSNDTRDAWVNKIAHVNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase (monooxygenase)
molecule keywords METHANE MONOOXYGENASE HYDROLASE (BETA CHAIN)
total genus 59
structure length 162
sequence length 162
chains with identical sequence H
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1994-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mmoG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mmoG02
1XMHE 1XVDE 1XVCE 1FZ2E 1FZ5E 1FZ6E 1FZ7E 1XVBE 1XVGE 1MHYG 1FZ8E 1MTYG 1XVEE 1XMGE 1MMOG 1FYZE 1FZHE 1FZ4E 4GAMC 1XVFE 1XMFE 1FZ1E 1FZIE 1MHZG 1FZ0E 1FZ9E 1XU3E 1FZ3E 1XU5E
chains in the Genus database with same CATH superfamily
1XMHE 4FJGA 2P1MB 4FJ9A 3SPYA 4DTXA 3CFPA 1FZ2E 1FS1A 3SPZA 4J2EA 3SUOA 2JHPA 4DTMA 2OVQB 3LZIA 2VIXA 2YB5A 4FJ7A 1MHYG 4KHQA 2ATQA 2P1NB 4ICGC 3SQ1A 3NGIA 3HGKE 4M3WA 1MTYG 4QNDA 1XVEE 3TJYA 4DTSA 1MMOG 4HCBA 3UO3A 2H4TA 3QEVA 3TAFA 3RMCA 1Q9XA 1FZHE 2OVRB 4DTUA 1XVFE 4KI6A 4FK0A 3NDKA 2OZSA 3J27A 4HCCA 2RCUA 5H37A 4DU4A 3C95A 4DTPA 2P1OB 3SNNA 4KI4A 2E32A 4FVMA 3SUPA 3SQ0A 4FJHA 3SUQA 4EP9A 3OGMB 4FJLA 3L1NA 4FJKA 4FJIA 3WSOA 2JPNA 1XU3E 4JS5A 3LZJA 3RWUA 3TAEA 4X5NA 3KD5E 3RMDA 1XVDE 4M3UA 5IBKB 5IREA 4M3YA 3V7DB 1XVCE 5IZ7A 3C94A 3SQ2A 4FJJA 2K5SA 4ADNA 4DU3A 2VJ5A 3SQ4A 4E4BA 3C6NB 1P22A 1XVGE 3LDSA 3SCXA 4JRQA 2DTUA 1LDKE 4X5MA 4E3SA 3K2OA 3HP9A 3LDBA 1XMGE 3QEIA 1FYZE 3UIQA 4AI6A 3L2OB 1FZ1E 1FZIE 1WAFA 2HD0A 2JHAA 4B08A 3CQ8A 4JS4A 3RMAA 4J2DA 4KHYA 4AKHA 1FZ0E 2DEBA 4I6JB 3NHGA 3TABA 2B1EA 2JHCA 4DTOA 4EPHA 4ADOA 1FZ9E 4M3RA 4KHWA 2FW3A 2JH8A 2E31A 1XU5E 3E4WA 3N1EA 2LF6A 3J2PA 4I9LA 3L8BA 3HGLA 3N1BA 2P1QB 1N1CA 2MMBA 3S9HA 1FZ5E 4RG8A 1FZ7E 4M3XA 4DTJA 3NCIA 4M41A 1IH7A 4FJXA 4M3ZA 2JH9A 3QEXA 3LD8A 1Q9YA 3SJJA 1WAJA 3NE6A 3C6PB 3C6OB 2B8IA 4EYWA 2OYQA 4KHNA 3E4YA 4RL5A 4AKIA 2PFVA 4FJ8A 4QNCA 3MKSB 3CFRA 3QNNA 2QXFA 3TAGA 4RNGA 2MZWB 4I9QA 4KHUA 1FZ3E 2P5GA 3BVOA 4AKGA 3KD1E 3TL8B 1CLQA 1IG9A 1FZ6E 1XL3C 1JW2A 1XVBE 4FJ5A 4IT5A 3RMBA 2B7MA 3QNOA 2FYOA 2P5OA 4DTRA 3SUNA 1FZ8E 4FJNA 2VJ4A 2PFTA 4J2AA 2JQTA 3UO2A 4J2BA 3OGLB 3CFOA 3SVIA 4KHSA 2OVPB 1FZ4E 4GAMC 4FJMA 4M42A 1XMFE 3HL8A 3OGKB 1FPOA 2LF3A 4JRPA 1MHZG 2OZMA 4M45A 3QESA 3QETA 4FK4A 4DU1A 2MW2A 1FXXA 4DTNA 3NAEA 3QERA 2P1PB 3SI6A 3QEPA 4FK2A 2DY4A 3QEWA 2RKHA 4M3TA 3L0MA 1NEXB
chains in the Genus database with same CATH topology
1XMHE 4FJGA 2P1MB 4FJ9A 3SPYA 4DTXA 3CFPA 1FZ2E 1FS1A 3SPZA 4J2EA 3SUOA 2JHPA 4DTMA 2OVQB 3LZIA 2VIXA 2YB5A 4FJ7A 1MHYG 4KHQA 2ATQA 2P1NB 3SQ1A 3NGIA 3HGKE 4M3WA 1MTYG 4QNDA 1XVEE 3TJYA 4DTSA 1MMOG 4HCBA 3TAFA 2H4TA 3QEVA 3RMCA 1Q9XA 1FZHE 2OVRB 4DTUA 1XVFE 4KI6A 4FK0A 3NDKA 2OZSA 3J27A 4HCCA 2RCUA 5H37A 3C95A 4DTPA 2P1OB 3SNNA 4KI4A 2E32A 4FVMA 3SUPA 3SQ0A 4FJHA 3SUQA 4EP9A 3OGMB 4FJLA 3L1NA 4FJKA 4FJIA 3WSOA 2JPNA 1XU3E 4JS5A 3LZJA 3RWUA 3TAEA 4X5NA 3KD5E 3RMDA 1XVDE 4M3UA 5IBKB 5IREA 4M3YA 3V7DB 1XVCE 5IZ7A 3C94A 3SQ2A 4FJJA 4ADNA 4DU3A 2VJ5A 3SQ4A 4E4BA 3C6NB 1P22A 1XVGE 3LDSA 3SCXA 4JRQA 2DTUA 1LDKE 4X5MA 4E3SA 3K2OA 3HP9A 3LDBA 1XMGE 3QEIA 1FYZE 3UIQA 4AI6A 3L2OB 1FZ1E 1FZIE 1WAFA 2HD0A 2JHAA 4B08A 3CQ8A 4JS4A 3RMAA 4J2DA 4KHYA 4AKHA 1FZ0E 2DEBA 4I6JB 3NHGA 3TABA 2B1EA 2JHCA 4DTOA 4EPHA 4ADOA 1FZ9E 4M3RA 4KHWA 2FW3A 2JH8A 2E31A 1XU5E 3E4WA 3N1EA 2LF6A 3J2PA 4I9LA 3L8BA 3HGLA 3N1BA 2P1QB 2MMBA 3S9HA 1FZ5E 4RG8A 1FZ7E 4M3XA 4DTJA 3NCIA 4M41A 1IH7A 4FJXA 4M3ZA 2JH9A 3QEXA 3LD8A 1Q9YA 3SJJA 1WAJA 3NE6A 3C6PB 3C6OB 2B8IA 4EYWA 2OYQA 4KHNA 3E4YA 4RL5A 4AKIA 2PFVA 4FJ8A 4QNCA 3MKSB 3CFRA 3QNNA 2QXFA 3TAGA 4RNGA 2MZWB 4I9QA 4KHUA 1FZ3E 2P5GA 4AKGA 3KD1E 3TL8B 1CLQA 1IG9A 1FZ6E 1XL3C 1XVBE 4FJ5A 3RMBA 2B7MA 3QNOA 2FYOA 2P5OA 4DTRA 3SUNA 1FZ8E 4FJNA 2VJ4A 2PFTA 4J2AA 4J2BA 3OGLB 3CFOA 3SVIA 4KHSA 2OVPB 1FZ4E 4GAMC 4FJMA 4M42A 1XMFE 3HL8A 3OGKB 2LF3A 4JRPA 1MHZG 2OZMA 4M45A 3QESA 3QETA 4FK4A 4DU1A 1FXXA 4DTNA 3NAEA 3QERA 2P1PB 3SI6A 3QEPA 4FK2A 2DY4A 3QEWA 4DU4A 4M3TA 3L0MA 1NEXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMH E;  1XVD E;  1XVC E;  1FZ2 E;  1FZ5 E;  1FZ6 E;  1FZ7 E;  1XVB E;  1XVG E;  1MHY G;  1FZ8 E;  1MTY G;  1XVE E;  1XMG E;  1MMO G;  1FYZ E;  1FZH E;  1FZ4 E;  4GAM C;  1XVF E;  1XMF E;  1FZ1 E;  1FZI E;  1MHZ G;  1FZ0 E;  1FZ9 E;  1XU3 E;  1FZ3 E;  1XU5 E; 
#chains in the Genus database with same CATH topology
 1XMH E;  4FJG A;  2P1M B;  4FJ9 A;  3SPY A;  4DTX A;  3CFP A;  1FZ2 E;  1FS1 A;  3SPZ A;  4J2E A;  3SUO A;  2JHP A;  4DTM A;  2OVQ B;  3LZI A;  2VIX A;  2YB5 A;  4FJ7 A;  1MHY G;  4KHQ A;  2ATQ A;  2P1N B;  4ICG C;  3SQ1 A;  3NGI A;  3HGK E;  4M3W A;  1MTY G;  4QND A;  1XVE E;  3TJY A;  4DTS A;  1MMO G;  4HCB A;  3UO3 A;  2H4T A;  3QEV A;  3TAF A;  3RMC A;  1Q9X A;  1FZH E;  2OVR B;  4DTU A;  1XVF E;  4KI6 A;  4FK0 A;  3NDK A;  2OZS A;  3J27 A;  4HCC A;  2RCU A;  5H37 A;  4DU4 A;  3C95 A;  4DTP A;  2P1O B;  3SNN A;  4KI4 A;  2E32 A;  4FVM A;  3SUP A;  3SQ0 A;  4FJH A;  3SUQ A;  4EP9 A;  3OGM B;  4FJL A;  3L1N A;  4FJK A;  4FJI A;  3WSO A;  2JPN A;  1XU3 E;  4JS5 A;  3LZJ A;  3RWU A;  3TAE A;  4X5N A;  3KD5 E;  3RMD A;  1XVD E;  4M3U A;  5IBK B;  5IRE A;  4M3Y A;  3V7D B;  1XVC E;  5IZ7 A;  3C94 A;  3SQ2 A;  4FJJ A;  2K5S A;  4ADN A;  4DU3 A;  2VJ5 A;  3SQ4 A;  4E4B A;  3C6N B;  1P22 A;  1XVG E;  3LDS A;  3SCX A;  4JRQ A;  2DTU A;  1LDK E;  4X5M A;  4E3S A;  3K2O A;  3HP9 A;  3LDB A;  1XMG E;  3QEI A;  1FYZ E;  3UIQ A;  4AI6 A;  3L2O B;  1FZ1 E;  1FZI E;  1WAF A;  2HD0 A;  2JHA A;  4B08 A;  3CQ8 A;  4JS4 A;  3RMA A;  4J2D A;  4KHY A;  4AKH A;  1FZ0 E;  2DEB A;  4I6J B;  3NHG A;  3TAB A;  2B1E A;  2JHC A;  4DTO A;  4EPH A;  4ADO A;  1FZ9 E;  4M3R A;  4KHW A;  2FW3 A;  2JH8 A;  2E31 A;  1XU5 E;  3E4W A;  3N1E A;  2LF6 A;  3J2P A;  4I9L A;  3L8B A;  3HGL A;  3N1B A;  2P1Q B;  1N1C A;  2MMB A;  3S9H A;  1FZ5 E;  4RG8 A;  1FZ7 E;  4M3X A;  4DTJ A;  3NCI A;  4M41 A;  1IH7 A;  4FJX A;  4M3Z A;  2JH9 A;  3QEX A;  3LD8 A;  1Q9Y A;  3SJJ A;  1WAJ A;  3NE6 A;  3C6P B;  3C6O B;  2B8I A;  4EYW A;  2OYQ A;  4KHN A;  3E4Y A;  4RL5 A;  4AKI A;  2PFV A;  4FJ8 A;  4QNC A;  3MKS B;  3CFR A;  3QNN A;  2QXF A;  3TAG A;  4RNG A;  2MZW B;  4I9Q A;  4KHU A;  1FZ3 E;  2P5G A;  3BVO A;  4AKG A;  3KD1 E;  3TL8 B;  1CLQ A;  1IG9 A;  1FZ6 E;  1XL3 C;  1JW2 A;  1XVB E;  4FJ5 A;  4IT5 A;  3RMB A;  2B7M A;  3QNO A;  2FYO A;  2P5O A;  4DTR A;  3SUN A;  1FZ8 E;  4FJN A;  2VJ4 A;  2PFT A;  4J2A A;  2JQT A;  3UO2 A;  4J2B A;  3OGL B;  3CFO A;  3SVI A;  4KHS A;  2OVP B;  1FZ4 E;  4GAM C;  4FJM A;  4M42 A;  1XMF E;  3HL8 A;  3OGK B;  1FPO A;  2LF3 A;  4JRP A;  1MHZ G;  2OZM A;  4M45 A;  3QES A;  3QET A;  4FK4 A;  4DU1 A;  2MW2 A;  1FXX A;  4DTN A;  3NAE A;  3QER A;  2P1P B;  3SI6 A;  3QEP A;  4FK2 A;  2DY4 A;  3QEW A;  2RKH A;  4M3T A;  3L0M A;  1NEX B; 
#chains in the Genus database with same CATH homology
 1XMH E;  4FJG A;  2P1M B;  4FJ9 A;  3SPY A;  4DTX A;  3CFP A;  1FZ2 E;  1FS1 A;  3SPZ A;  4J2E A;  3SUO A;  2JHP A;  4DTM A;  2OVQ B;  3LZI A;  2VIX A;  2YB5 A;  4FJ7 A;  1MHY G;  4KHQ A;  2ATQ A;  2P1N B;  3SQ1 A;  3NGI A;  3HGK E;  4M3W A;  1MTY G;  4QND A;  1XVE E;  3TJY A;  4DTS A;  1MMO G;  4HCB A;  3TAF A;  2H4T A;  3QEV A;  3RMC A;  1Q9X A;  1FZH E;  2OVR B;  4DTU A;  1XVF E;  4KI6 A;  4FK0 A;  3NDK A;  2OZS A;  3J27 A;  4HCC A;  2RCU A;  5H37 A;  3C95 A;  4DTP A;  2P1O B;  3SNN A;  4KI4 A;  2E32 A;  4FVM A;  3SUP A;  3SQ0 A;  4FJH A;  3SUQ A;  4EP9 A;  3OGM B;  4FJL A;  3L1N A;  4FJK A;  4FJI A;  3WSO A;  2JPN A;  1XU3 E;  4JS5 A;  3LZJ A;  3RWU A;  3TAE A;  4X5N A;  3KD5 E;  3RMD A;  1XVD E;  4M3U A;  5IBK B;  5IRE A;  4M3Y A;  3V7D B;  1XVC E;  5IZ7 A;  3C94 A;  3SQ2 A;  4FJJ A;  4ADN A;  4DU3 A;  2VJ5 A;  3SQ4 A;  4E4B A;  3C6N B;  1P22 A;  1XVG E;  3LDS A;  3SCX A;  4JRQ A;  2DTU A;  1LDK E;  4X5M A;  4E3S A;  3K2O A;  3HP9 A;  3LDB A;  1XMG E;  3QEI A;  1FYZ E;  3UIQ A;  4AI6 A;  3L2O B;  1FZ1 E;  1FZI E;  1WAF A;  2HD0 A;  2JHA A;  4B08 A;  3CQ8 A;  4JS4 A;  3RMA A;  4J2D A;  4KHY A;  4AKH A;  1FZ0 E;  2DEB A;  4I6J B;  3NHG A;  3TAB A;  2B1E A;  2JHC A;  4DTO A;  4EPH A;  4ADO A;  1FZ9 E;  4M3R A;  4KHW A;  2FW3 A;  2JH8 A;  2E31 A;  1XU5 E;  3E4W A;  3N1E A;  2LF6 A;  3J2P A;  4I9L A;  3L8B A;  3HGL A;  3N1B A;  2P1Q B;  2MMB A;  3S9H A;  1FZ5 E;  4RG8 A;  1FZ7 E;  4M3X A;  4DTJ A;  3NCI A;  4M41 A;  1IH7 A;  4FJX A;  4M3Z A;  2JH9 A;  3QEX A;  3LD8 A;  1Q9Y A;  3SJJ A;  1WAJ A;  3NE6 A;  3C6P B;  3C6O B;  2B8I A;  4EYW A;  2OYQ A;  4KHN A;  3E4Y A;  4RL5 A;  4AKI A;  2PFV A;  4FJ8 A;  4QNC A;  3MKS B;  3CFR A;  3QNN A;  2QXF A;  3TAG A;  4RNG A;  2MZW B;  4I9Q A;  4KHU A;  1FZ3 E;  2P5G A;  4AKG A;  3KD1 E;  3TL8 B;  1CLQ A;  1IG9 A;  1FZ6 E;  1XL3 C;  1XVB E;  4FJ5 A;  3RMB A;  2B7M A;  3QNO A;  2FYO A;  2P5O A;  4DTR A;  3SUN A;  1FZ8 E;  4FJN A;  2VJ4 A;  2PFT A;  4J2A A;  4J2B A;  3OGL B;  3CFO A;  3SVI A;  4KHS A;  2OVP B;  1FZ4 E;  4GAM C;  4FJM A;  4M42 A;  1XMF E;  3HL8 A;  3OGK B;  2LF3 A;  4JRP A;  1MHZ G;  2OZM A;  4M45 A;  3QES A;  3QET A;  4FK4 A;  4DU1 A;  1FXX A;  4DTN A;  3NAE A;  3QER A;  2P1P B;  3SI6 A;  3QEP A;  4FK2 A;  2DY4 A;  3QEW A;  4DU4 A;  4M3T A;  3L0M A;  1NEX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...