1MMOG

Crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
162
structure length
162
Chain Sequence
LGIHSNDTRDAWVNKIAHVNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase (monooxygenase)
molecule keywords METHANE MONOOXYGENASE HYDROLASE (BETA CHAIN)
total genus 59
structure length 162
sequence length 162
chains with identical sequence H
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1994-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mmoG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mmoG02
1FZ0E 1FZ7E 1FZ8E 1FZ5E 1FZ9E 1FYZE 1FZ6E 1XMFE 1XVEE 1FZIE 1MHYG 1FZHE 1MHZG 1XVGE 4GAMC 1XU5E 1FZ2E 1MTYG 1XVFE 1XVCE 1FZ1E 1XVBE 1XMGE 1MMOG 1XVDE 1FZ3E 1XMHE 1XU3E 1FZ4E
chains in the Genus database with same CATH superfamily
2HD0A 2K5SA 2P1PB 2JH9A 3C95A 2PFTA 4JS5A 3C6OB 4FJIA 4M3XA 2DTUA 4AKIA 4FJMA 2E32A 1FZ4E 1LDKE 1FZ6E 5IREA 4E4BA 1XVEE 4RNGA 4DTJA 2LF3A 2OVRB 3C6PB 4I9QA 4FK0A 4FJXA 3QNOA 1IG9A 1NEXB 4FVMA 4X5MA 1JW2A 3TABA 3V7DB 1XVGE 4RL5A 4M3UA 2RCUA 4I6JB 4FJ7A 3QEXA 3RMCA 2P1OB 4ADNA 3L2OB 4HCCA 4FJNA 4M3ZA 1FZ1E 3SQ2A 3LDBA 4M45A 3RMDA 1Q9YA 4E3SA 3SPYA 4RG8A 4J2AA 1WAJA 3HP9A 3L8BA 4M3RA 4J2BA 4KI6A 1FZ3E 4DTXA 1XU3E 3OGMB 4FJHA 2JQTA 5H37A 2H4TA 3LD8A 5IZ7A 1FZ7E 1FZ8E 3QNNA 2PFVA 5IBKB 3TL8B 4DU1A 3HL8A 1WAFA 3L0MA 3TJYA 1P22A 4KHWA 4FK4A 4DTRA 3SUQA 1FZIE 1MHYG 2JHPA 1FPOA 3KD1E 4JRPA 2JHAA 4DU4A 4GAMC 3HGKE 4DTSA 3SUOA 2B1EA 1XU5E 2JHCA 1FZ2E 1MTYG 3UIQA 4M3YA 3CQ8A 1XMGE 3E4WA 3SQ4A 1FS1A 3K2OA 3N1BA 1IH7A 4DTMA 4DTNA 1XMHE 4QNDA 2YB5A 4EYWA 3RMBA 2B8IA 3TAEA 4FJJA 2JPNA 1FZ0E 2P1MB 3QEIA 4FJ5A 3SUNA 3RMAA 4FK2A 4ADOA 3QERA 4FJ8A 3J27A 3NGIA 2OZMA 4AI6A 2MZWB 4DU3A 3NAEA 4EPHA 4JRQA 4I9LA 2VIXA 2DEBA 3C94A 3BVOA 2P1NB 4AKHA 4JS4A 4FJ9A 3SUPA 2DY4A 3E4YA 4DTOA 2VJ4A 4EP9A 4J2EA 4M42A 2OVQB 3NDKA 3TAGA 3QEVA 1XVFE 1XVCE 3OGLB 2OZSA 3SPZA 3UO3A 4M41A 3J2PA 2P1QB 4ICGC 4QNCA 3QESA 3QETA 2VJ5A 3QEWA 3TAFA 3S9HA 4KHSA 3MKSB 2FYOA 2JH8A 3CFOA 2P5GA 4FJKA 3SJJA 2MMBA 4M3WA 1XL3C 4B08A 4DTUA 3SQ0A 3CFPA 4KHUA 2QXFA 3SVIA 4AKGA 4FJLA 1FZ5E 3QEPA 3LZJA 1FZ9E 1FYZE 3N1EA 4KHYA 2B7MA 4X5NA 3CFRA 1XMFE 2ATQA 4FJGA 3SQ1A 2E31A 2P5OA 2MW2A 3OGKB 3NHGA 1FXXA 3UO2A 2FW3A 4J2DA 1FZHE 1MHZG 3WSOA 2LF6A 1Q9XA 3KD5E 3HGLA 3SCXA 3SI6A 3SNNA 4M3TA 2RKHA 1MMOG 3LDSA 3L1NA 1N1CA 4IT5A 3LZIA 3NCIA 2OYQA 4HCBA 4KI4A 1CLQA 4KHNA 1XVDE 3RWUA 3NE6A 4KHQA 3C6NB 2OVPB 1XVBE 4DTPA
chains in the Genus database with same CATH topology
2HD0A 2P1PB 3C95A 2JH9A 2PFTA 4JS5A 4FJIA 3C6OB 4M3XA 2DTUA 4AKIA 4FJMA 2E32A 1FZ4E 1LDKE 1FZ6E 5IREA 4E4BA 1XVEE 4RNGA 4DTJA 2LF3A 2OVRB 3C6PB 4I9QA 4FK0A 4FJXA 3QNOA 1IG9A 1NEXB 4FVMA 4X5MA 3TABA 3V7DB 1XVGE 4RL5A 4M3UA 2RCUA 4I6JB 4FJ7A 3QEXA 3RMCA 2P1OB 4ADNA 3L2OB 4HCCA 4FJNA 4M3ZA 1FZ1E 3SQ2A 3LDBA 4M45A 3RMDA 1Q9YA 4E3SA 3SPYA 4RG8A 4J2AA 1WAJA 3HP9A 3L8BA 4M3RA 4J2BA 4KI6A 1FZ3E 4DTXA 1XU3E 3OGMB 4FJHA 5H37A 2H4TA 3LD8A 5IZ7A 1FZ7E 1FZ8E 3QNNA 2PFVA 5IBKB 3TL8B 4DU1A 3HL8A 1WAFA 3L0MA 3TJYA 1P22A 4KHWA 4FK4A 4DTRA 3SUQA 1FZIE 1MHYG 2JHPA 3KD1E 4JRPA 2JHAA 4DU4A 4GAMC 3HGKE 4DTSA 3SUOA 2B1EA 1XU5E 2JHCA 1FZ2E 1MTYG 3UIQA 4M3YA 3CQ8A 1XMGE 3E4WA 3SQ4A 1FS1A 3K2OA 3N1BA 1IH7A 4DTMA 4DTNA 1XMHE 4QNDA 2YB5A 4EYWA 3RMBA 2B8IA 3TAEA 4FJJA 2JPNA 1FZ0E 2P1MB 3QEIA 4FJ5A 3SUNA 3RMAA 4FK2A 4ADOA 3QERA 4FJ8A 3J27A 3NGIA 2OZMA 4AI6A 2MZWB 4DU3A 3NAEA 4EPHA 4JRQA 4I9LA 2VIXA 2DEBA 3C94A 2P1NB 4AKHA 4JS4A 4FJ9A 3SUPA 2DY4A 3E4YA 4DTOA 2VJ4A 4EP9A 4J2EA 4M42A 2OVQB 3NDKA 3TAGA 3QEVA 1XVFE 1XVCE 3OGLB 2OZSA 3SPZA 4M41A 3J2PA 2P1QB 4QNCA 3QESA 3QETA 2VJ5A 3QEWA 3TAFA 3S9HA 4KHSA 3MKSB 2FYOA 2JH8A 3CFOA 2P5GA 4FJKA 3SJJA 2MMBA 4M3WA 1XL3C 4B08A 4DTUA 3SQ0A 3CFPA 4KHUA 2QXFA 3SVIA 4AKGA 4FJLA 1FZ5E 3QEPA 3LZJA 1FZ9E 1FYZE 3N1EA 4KHYA 2B7MA 4X5NA 3CFRA 1XMFE 2ATQA 4FJGA 3SQ1A 2E31A 2P5OA 3OGKB 3NHGA 1FXXA 2FW3A 4J2DA 1FZHE 1MHZG 3WSOA 2LF6A 1Q9XA 3KD5E 3HGLA 3SCXA 3SI6A 3SNNA 4M3TA 3LDSA 1MMOG 3L1NA 3LZIA 3NCIA 2OYQA 4HCBA 4KI4A 1CLQA 4KHNA 1XVDE 3RWUA 3NE6A 4KHQA 3C6NB 2OVPB 1XVBE 4DTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ0 E;  1FZ7 E;  1FZ8 E;  1FZ5 E;  1FZ9 E;  1FYZ E;  1FZ6 E;  1XMF E;  1XVE E;  1FZI E;  1MHY G;  1FZH E;  1MHZ G;  1XVG E;  4GAM C;  1XU5 E;  1FZ2 E;  1MTY G;  1XVF E;  1XVC E;  1FZ1 E;  1XVB E;  1XMG E;  1MMO G;  1XVD E;  1FZ3 E;  1XMH E;  1XU3 E;  1FZ4 E; 
#chains in the Genus database with same CATH topology
 2HD0 A;  2K5S A;  2P1P B;  2JH9 A;  3C95 A;  2PFT A;  4JS5 A;  3C6O B;  4FJI A;  4M3X A;  2DTU A;  4AKI A;  4FJM A;  2E32 A;  1FZ4 E;  1LDK E;  1FZ6 E;  5IRE A;  4E4B A;  1XVE E;  4RNG A;  4DTJ A;  2LF3 A;  2OVR B;  3C6P B;  4I9Q A;  4FK0 A;  4FJX A;  3QNO A;  1IG9 A;  1NEX B;  4FVM A;  4X5M A;  1JW2 A;  3TAB A;  3V7D B;  1XVG E;  4RL5 A;  4M3U A;  2RCU A;  4I6J B;  4FJ7 A;  3QEX A;  3RMC A;  2P1O B;  4ADN A;  3L2O B;  4HCC A;  4FJN A;  4M3Z A;  1FZ1 E;  3SQ2 A;  3LDB A;  4M45 A;  3RMD A;  1Q9Y A;  4E3S A;  3SPY A;  4RG8 A;  4J2A A;  1WAJ A;  3HP9 A;  3L8B A;  4M3R A;  4J2B A;  4KI6 A;  1FZ3 E;  4DTX A;  1XU3 E;  3OGM B;  4FJH A;  2JQT A;  5H37 A;  2H4T A;  3LD8 A;  5IZ7 A;  1FZ7 E;  1FZ8 E;  3QNN A;  2PFV A;  5IBK B;  3TL8 B;  4DU1 A;  3HL8 A;  1WAF A;  3L0M A;  3TJY A;  1P22 A;  4KHW A;  4FK4 A;  4DTR A;  3SUQ A;  1FZI E;  1MHY G;  2JHP A;  1FPO A;  3KD1 E;  4JRP A;  2JHA A;  4DU4 A;  4GAM C;  3HGK E;  4DTS A;  3SUO A;  2B1E A;  1XU5 E;  2JHC A;  1FZ2 E;  1MTY G;  3UIQ A;  4M3Y A;  3CQ8 A;  1XMG E;  3E4W A;  3SQ4 A;  1FS1 A;  3K2O A;  3N1B A;  1IH7 A;  4DTM A;  4DTN A;  1XMH E;  4QND A;  2YB5 A;  4EYW A;  3RMB A;  2B8I A;  3TAE A;  4FJJ A;  2JPN A;  1FZ0 E;  2P1M B;  3QEI A;  4FJ5 A;  3SUN A;  3RMA A;  4FK2 A;  4ADO A;  3QER A;  4FJ8 A;  3J27 A;  3NGI A;  2OZM A;  4AI6 A;  2MZW B;  4DU3 A;  3NAE A;  4EPH A;  4JRQ A;  4I9L A;  2VIX A;  2DEB A;  3C94 A;  3BVO A;  2P1N B;  4AKH A;  4JS4 A;  4FJ9 A;  3SUP A;  2DY4 A;  3E4Y A;  4DTO A;  2VJ4 A;  4EP9 A;  4J2E A;  4M42 A;  2OVQ B;  3NDK A;  3TAG A;  3QEV A;  1XVF E;  1XVC E;  3OGL B;  2OZS A;  3SPZ A;  3UO3 A;  4M41 A;  3J2P A;  2P1Q B;  4ICG C;  4QNC A;  3QES A;  3QET A;  2VJ5 A;  3QEW A;  3TAF A;  3S9H A;  4KHS A;  3MKS B;  2FYO A;  2JH8 A;  3CFO A;  2P5G A;  4FJK A;  3SJJ A;  2MMB A;  4M3W A;  1XL3 C;  4B08 A;  4DTU A;  3SQ0 A;  3CFP A;  4KHU A;  2QXF A;  3SVI A;  4AKG A;  4FJL A;  1FZ5 E;  3QEP A;  3LZJ A;  1FZ9 E;  1FYZ E;  3N1E A;  4KHY A;  2B7M A;  4X5N A;  3CFR A;  1XMF E;  2ATQ A;  4FJG A;  3SQ1 A;  2E31 A;  2P5O A;  2MW2 A;  3OGK B;  3NHG A;  1FXX A;  3UO2 A;  2FW3 A;  4J2D A;  1FZH E;  1MHZ G;  3WSO A;  2LF6 A;  1Q9X A;  3KD5 E;  3HGL A;  3SCX A;  3SI6 A;  3SNN A;  4M3T A;  2RKH A;  1MMO G;  3LDS A;  3L1N A;  1N1C A;  4IT5 A;  3LZI A;  3NCI A;  2OYQ A;  4HCB A;  4KI4 A;  1CLQ A;  4KHN A;  1XVD E;  3RWU A;  3NE6 A;  4KHQ A;  3C6N B;  2OVP B;  1XVB E;  4DTP A; 
#chains in the Genus database with same CATH homology
 2HD0 A;  2P1P B;  3C95 A;  2JH9 A;  2PFT A;  4JS5 A;  4FJI A;  3C6O B;  4M3X A;  2DTU A;  4AKI A;  4FJM A;  2E32 A;  1FZ4 E;  1LDK E;  1FZ6 E;  5IRE A;  4E4B A;  1XVE E;  4RNG A;  4DTJ A;  2LF3 A;  2OVR B;  3C6P B;  4I9Q A;  4FK0 A;  4FJX A;  3QNO A;  1IG9 A;  1NEX B;  4FVM A;  4X5M A;  3TAB A;  3V7D B;  1XVG E;  4RL5 A;  4M3U A;  2RCU A;  4I6J B;  4FJ7 A;  3QEX A;  3RMC A;  2P1O B;  4ADN A;  3L2O B;  4HCC A;  4FJN A;  4M3Z A;  1FZ1 E;  3SQ2 A;  3LDB A;  4M45 A;  3RMD A;  1Q9Y A;  4E3S A;  3SPY A;  4RG8 A;  4J2A A;  1WAJ A;  3HP9 A;  3L8B A;  4M3R A;  4J2B A;  4KI6 A;  1FZ3 E;  4DTX A;  1XU3 E;  3OGM B;  4FJH A;  5H37 A;  2H4T A;  3LD8 A;  5IZ7 A;  1FZ7 E;  1FZ8 E;  3QNN A;  2PFV A;  5IBK B;  3TL8 B;  4DU1 A;  3HL8 A;  1WAF A;  3L0M A;  3TJY A;  1P22 A;  4KHW A;  4FK4 A;  4DTR A;  3SUQ A;  1FZI E;  1MHY G;  2JHP A;  3KD1 E;  4JRP A;  2JHA A;  4DU4 A;  4GAM C;  3HGK E;  4DTS A;  3SUO A;  2B1E A;  1XU5 E;  2JHC A;  1FZ2 E;  1MTY G;  3UIQ A;  4M3Y A;  3CQ8 A;  1XMG E;  3E4W A;  3SQ4 A;  1FS1 A;  3K2O A;  3N1B A;  1IH7 A;  4DTM A;  4DTN A;  1XMH E;  4QND A;  2YB5 A;  4EYW A;  3RMB A;  2B8I A;  3TAE A;  4FJJ A;  2JPN A;  1FZ0 E;  2P1M B;  3QEI A;  4FJ5 A;  3SUN A;  3RMA A;  4FK2 A;  4ADO A;  3QER A;  4FJ8 A;  3J27 A;  3NGI A;  2OZM A;  4AI6 A;  2MZW B;  4DU3 A;  3NAE A;  4EPH A;  4JRQ A;  4I9L A;  2VIX A;  2DEB A;  3C94 A;  2P1N B;  4AKH A;  4JS4 A;  4FJ9 A;  3SUP A;  2DY4 A;  3E4Y A;  4DTO A;  2VJ4 A;  4EP9 A;  4J2E A;  4M42 A;  2OVQ B;  3NDK A;  3TAG A;  3QEV A;  1XVF E;  1XVC E;  3OGL B;  2OZS A;  3SPZ A;  4M41 A;  3J2P A;  2P1Q B;  4QNC A;  3QES A;  3QET A;  2VJ5 A;  3QEW A;  3TAF A;  3S9H A;  4KHS A;  3MKS B;  2FYO A;  2JH8 A;  3CFO A;  2P5G A;  4FJK A;  3SJJ A;  2MMB A;  4M3W A;  1XL3 C;  4B08 A;  4DTU A;  3SQ0 A;  3CFP A;  4KHU A;  2QXF A;  3SVI A;  4AKG A;  4FJL A;  1FZ5 E;  3QEP A;  3LZJ A;  1FZ9 E;  1FYZ E;  3N1E A;  4KHY A;  2B7M A;  4X5N A;  3CFR A;  1XMF E;  2ATQ A;  4FJG A;  3SQ1 A;  2E31 A;  2P5O A;  3OGK B;  3NHG A;  1FXX A;  2FW3 A;  4J2D A;  1FZH E;  1MHZ G;  3WSO A;  2LF6 A;  1Q9X A;  3KD5 E;  3HGL A;  3SCX A;  3SI6 A;  3SNN A;  4M3T A;  3LDS A;  1MMO G;  3L1N A;  3LZI A;  3NCI A;  2OYQ A;  4HCB A;  4KI4 A;  1CLQ A;  4KHN A;  1XVD E;  3RWU A;  3NE6 A;  4KHQ A;  3C6N B;  2OVP B;  1XVB E;  4DTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...