1MMOG

Crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
162
structure length
162
Chain Sequence
LGIHSNDTRDAWVNKIAHVNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE HYDROLASE (BETA CHAIN)
publication title Crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase (monooxygenase)
total genus 59
structure length 162
sequence length 162
chains with identical sequence H
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1994-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mmoG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mmoG02
1XMFE 1XVEE 1FYZE 1XMGE 1MHYG 1FZHE 1XU3E 1XVCE 1XMHE 1FZ3E 1FZ8E 1XU5E 4GAMC 1FZ0E 1FZ9E 1FZIE 1FZ6E 1MHZG 1FZ5E 1FZ7E 1XVGE 1XVFE 1MTYG 1FZ2E 1XVBE 1XVDE 1FZ1E 1MMOG 1FZ4E
chains in the Genus database with same CATH superfamily
3CQ8A 1XMFE 3NCIA 4DTSA 3TJYA 2DTUA 1XU3E 4KI4A 3RMCA 2DEBA 3QEXA 3BVOA 3NGIA 2H4TA 4FJ7A 4AKIA 4ADOA 2LF3A 3LD8A 2OZSA 2OYQA 1NEXB 4J2BA 1IH7A 3WSOA 3OGLB 3C94A 2P5GA 4M45A 4DTMA 3UO2A 4ICGC 4X5MA 1FZ8E 1XU5E 2OVPB 2K5SA 1P22A 2P1PB 3N1BA 5H37A 4FJKA 3SI6A 3SPYA 3SCXA 3S9HA 1MHZG 5IBKB 4I6JB 4M3TA 4FJGA 1XVFE 3CFPA 3TABA 2JHAA 3OGKB 3TL8B 3LZIA 1XVDE 3HL8A 3QNOA 4B08A 4E4BA 4M3ZA 4KI6A 3V7DB 3TAFA 3LZJA 2DY4A 1FYZE 1MHYG 4FJ9A 4DU4A 4FJNA 4FJIA 5IREA 3SUPA 4FJ8A 3LDBA 1WAFA 3QESA 3TAEA 3SQ0A 4FK4A 3SPZA 3C6NB 3NAEA 1FXXA 2FYOA 3NHGA 4X5NA 3E4YA 4ADNA 1Q9XA 3UIQA 2E31A 3HGKE 1FZ0E 1FZ9E 2OVRB 3J27A 1FZ6E 4DTXA 4FK2A 3K2OA 4EPHA 4IT5A 4RG8A 4DTUA 3L2OB 4RL5A 2PFTA 4AI6A 2VJ4A 4FJHA 4FJMA 4DTJA 1FZ1E 1LDKE 3MKSB 3QEVA 4QNDA 3SQ4A 3NE6A 1FZ4E 2JHPA 4DTOA 3QEPA 4DTPA 2JH8A 3UO3A 4M3RA 2B7MA 1FZHE 1XVCE 2LF6A 3CFOA 2HD0A 3HP9A 3QERA 4AKGA 3C6PB 2YB5A 2QXFA 4M3XA 4JS4A 3NDKA 4DTRA 4KHQA 4M3WA 1Q9YA 1CLQA 4EYWA 2OVQB 2B1EA 4KHNA 3KD1E 2P5OA 3RMDA 3C95A 3E4WA 4M41A 4FVMA 4DTNA 1FZIE 3OGMB 4HCBA 3QETA 3C6OB 4KHWA 3J2PA 2P1NB 2ATQA 2OZMA 1FZ5E 4HCCA 4FJXA 4M42A 4KHYA 4JRPA 4EP9A 1FZ2E 4FJ5A 1XVBE 2PFVA 2MZWB 4J2EA 1FPOA 1WAJA 3L8BA 3SUOA 3SQ1A 4M3UA 2JH9A 3KD5E 2MW2A 3QNNA 2P1OB 2FW3A 2JQTA 3LDSA 3QEIA 1XVEE 3SQ2A 3RWUA 1XMGE 4QNCA 4JS5A 3TAGA 4I9QA 2RCUA 1XMHE 2E32A 4KHSA 4I9LA 2JHCA 3L1NA 3N1EA 4JRQA 3SNNA 4AKHA 1FZ3E 2MMBA 3SUNA 1XL3C 2B8IA 3L0MA 3CFRA 4FJJA 4GAMC 3QEWA 3SVIA 4FK0A 1JW2A 4M3YA 4KHUA 3RMAA 4DU3A 3HGLA 2P1QB 2VIXA 1FZ7E 1XVGE 4DU1A 1N1CA 1MTYG 2P1MB 4RNGA 4E3SA 3RMBA 3SJJA 4J2AA 2JPNA 2VJ5A 4J2DA 2RKHA 4FJLA 1FS1A 5IZ7A 1IG9A 1MMOG 3SUQA
chains in the Genus database with same CATH topology
3CQ8A 1XMFE 3NCIA 4DTSA 3TJYA 2DTUA 1XU3E 4KI4A 3RMCA 2DEBA 3QEXA 4FJ7A 3NGIA 2H4TA 4AKIA 4ADOA 2LF3A 3LD8A 2OZSA 2OYQA 1NEXB 4J2BA 1IH7A 3WSOA 3OGLB 3C94A 2P5GA 4M45A 4DTMA 4X5MA 1FZ8E 1XU5E 2OVPB 1P22A 2P1PB 3N1BA 5H37A 4FJKA 3SI6A 3SPYA 3SCXA 3S9HA 1MHZG 5IBKB 4I6JB 4M3TA 4FJGA 1XVFE 3CFPA 3TABA 2JHAA 3OGKB 3TL8B 3LZIA 1XVDE 3HL8A 3QNOA 4B08A 4E4BA 4M3ZA 4KI6A 3V7DB 3TAFA 3LZJA 2DY4A 1FYZE 1MHYG 4FJ9A 4DU4A 4FJNA 4FJIA 5IREA 3SUPA 4FJ8A 3LDBA 1WAFA 3QESA 3TAEA 3SQ0A 4FK4A 3SPZA 3C6NB 3NAEA 1FXXA 2FYOA 3NHGA 4X5NA 3E4YA 4ADNA 1Q9XA 3UIQA 2E31A 3HGKE 1FZ0E 1FZ9E 2OVRB 3J27A 1FZ6E 4DTXA 4FK2A 3K2OA 4EPHA 4DTUA 4RG8A 4AI6A 3L2OB 4RL5A 2PFTA 2VJ4A 4FJHA 4FJMA 4DTJA 1FZ1E 1LDKE 3MKSB 3QEVA 4QNDA 3SQ4A 3NE6A 1FZ4E 2JHPA 4DTOA 3QEPA 4DTPA 2JH8A 4M3RA 2B7MA 1FZHE 1XVCE 2LF6A 3CFOA 2HD0A 3HP9A 3QERA 4AKGA 3C6PB 2YB5A 2QXFA 4M3XA 4JS4A 3NDKA 4DTRA 4KHQA 4M3WA 1Q9YA 1CLQA 4EYWA 2OVQB 2B1EA 4KHNA 3KD1E 2P5OA 3RMDA 3C95A 3E4WA 4M41A 4FVMA 4DTNA 1FZIE 3OGMB 4HCBA 3QETA 3C6OB 4KHWA 3J2PA 2P1NB 2ATQA 2OZMA 1FZ5E 4HCCA 4FJXA 4M42A 4KHYA 4JRPA 4EP9A 1FZ2E 4FJ5A 1XVBE 2PFVA 2MZWB 4J2EA 3L8BA 1WAJA 3SUOA 3SQ1A 4M3UA 2JH9A 3KD5E 3QNNA 2P1OB 2FW3A 3QEIA 3LDSA 3SQ2A 1XVEE 3RWUA 1XMGE 4QNCA 4JS5A 3TAGA 4I9QA 2RCUA 1XMHE 2E32A 4KHSA 4I9LA 2JHCA 3L1NA 3N1EA 4JRQA 3SNNA 4AKHA 1FZ3E 2MMBA 3SUNA 1XL3C 2B8IA 3L0MA 3CFRA 4FJJA 4GAMC 3QEWA 3SVIA 4FK0A 4M3YA 4KHUA 3RMAA 4DU3A 3HGLA 2P1QB 2VIXA 1FZ7E 1XVGE 4DU1A 1MTYG 2P1MB 4RNGA 4E3SA 3RMBA 3SJJA 4J2AA 2JPNA 2VJ5A 4J2DA 4FJLA 1FS1A 5IZ7A 1IG9A 1MMOG 3SUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMF E;  1XVE E;  1FYZ E;  1XMG E;  1MHY G;  1FZH E;  1XU3 E;  1XVC E;  1XMH E;  1FZ3 E;  1FZ8 E;  1XU5 E;  4GAM C;  1FZ0 E;  1FZ9 E;  1FZI E;  1FZ6 E;  1MHZ G;  1FZ5 E;  1FZ7 E;  1XVG E;  1XVF E;  1MTY G;  1FZ2 E;  1XVB E;  1XVD E;  1FZ1 E;  1MMO G;  1FZ4 E; 
#chains in the Genus database with same CATH topology
 3CQ8 A;  1XMF E;  3NCI A;  4DTS A;  3TJY A;  2DTU A;  1XU3 E;  4KI4 A;  3RMC A;  2DEB A;  3QEX A;  3BVO A;  3NGI A;  2H4T A;  4FJ7 A;  4AKI A;  4ADO A;  2LF3 A;  3LD8 A;  2OZS A;  2OYQ A;  1NEX B;  4J2B A;  1IH7 A;  3WSO A;  3OGL B;  3C94 A;  2P5G A;  4M45 A;  4DTM A;  3UO2 A;  4ICG C;  4X5M A;  1FZ8 E;  1XU5 E;  2OVP B;  2K5S A;  1P22 A;  2P1P B;  3N1B A;  5H37 A;  4FJK A;  3SI6 A;  3SPY A;  3SCX A;  3S9H A;  1MHZ G;  5IBK B;  4I6J B;  4M3T A;  4FJG A;  1XVF E;  3CFP A;  3TAB A;  2JHA A;  3OGK B;  3TL8 B;  3LZI A;  1XVD E;  3HL8 A;  3QNO A;  4B08 A;  4E4B A;  4M3Z A;  4KI6 A;  3V7D B;  3TAF A;  3LZJ A;  2DY4 A;  1FYZ E;  1MHY G;  4FJ9 A;  4DU4 A;  4FJN A;  4FJI A;  5IRE A;  3SUP A;  4FJ8 A;  3LDB A;  1WAF A;  3QES A;  3TAE A;  3SQ0 A;  4FK4 A;  3SPZ A;  3C6N B;  3NAE A;  1FXX A;  2FYO A;  3NHG A;  4X5N A;  3E4Y A;  4ADN A;  1Q9X A;  3UIQ A;  2E31 A;  3HGK E;  1FZ0 E;  1FZ9 E;  2OVR B;  3J27 A;  1FZ6 E;  4DTX A;  4FK2 A;  3K2O A;  4EPH A;  4IT5 A;  4RG8 A;  4DTU A;  3L2O B;  4RL5 A;  2PFT A;  4AI6 A;  2VJ4 A;  4FJH A;  4FJM A;  4DTJ A;  1FZ1 E;  1LDK E;  3MKS B;  3QEV A;  4QND A;  3SQ4 A;  3NE6 A;  1FZ4 E;  2JHP A;  4DTO A;  3QEP A;  4DTP A;  2JH8 A;  3UO3 A;  4M3R A;  2B7M A;  1FZH E;  1XVC E;  2LF6 A;  3CFO A;  2HD0 A;  3HP9 A;  3QER A;  4AKG A;  3C6P B;  2YB5 A;  2QXF A;  4M3X A;  4JS4 A;  3NDK A;  4DTR A;  4KHQ A;  4M3W A;  1Q9Y A;  1CLQ A;  4EYW A;  2OVQ B;  2B1E A;  4KHN A;  3KD1 E;  2P5O A;  3RMD A;  3C95 A;  3E4W A;  4M41 A;  4FVM A;  4DTN A;  1FZI E;  3OGM B;  4HCB A;  3QET A;  3C6O B;  4KHW A;  3J2P A;  2P1N B;  2ATQ A;  2OZM A;  1FZ5 E;  4HCC A;  4FJX A;  4M42 A;  4KHY A;  4JRP A;  4EP9 A;  1FZ2 E;  4FJ5 A;  1XVB E;  2PFV A;  2MZW B;  4J2E A;  1FPO A;  1WAJ A;  3L8B A;  3SUO A;  3SQ1 A;  4M3U A;  2JH9 A;  3KD5 E;  2MW2 A;  3QNN A;  2P1O B;  2FW3 A;  2JQT A;  3LDS A;  3QEI A;  1XVE E;  3SQ2 A;  3RWU A;  1XMG E;  4QNC A;  4JS5 A;  3TAG A;  4I9Q A;  2RCU A;  1XMH E;  2E32 A;  4KHS A;  4I9L A;  2JHC A;  3L1N A;  3N1E A;  4JRQ A;  3SNN A;  4AKH A;  1FZ3 E;  2MMB A;  3SUN A;  1XL3 C;  2B8I A;  3L0M A;  3CFR A;  4FJJ A;  4GAM C;  3QEW A;  3SVI A;  4FK0 A;  1JW2 A;  4M3Y A;  4KHU A;  3RMA A;  4DU3 A;  3HGL A;  2P1Q B;  2VIX A;  1FZ7 E;  1XVG E;  4DU1 A;  1N1C A;  1MTY G;  2P1M B;  4RNG A;  4E3S A;  3RMB A;  3SJJ A;  4J2A A;  2JPN A;  2VJ5 A;  4J2D A;  2RKH A;  4FJL A;  1FS1 A;  5IZ7 A;  1IG9 A;  1MMO G;  3SUQ A; 
#chains in the Genus database with same CATH homology
 3CQ8 A;  1XMF E;  3NCI A;  4DTS A;  3TJY A;  2DTU A;  1XU3 E;  4KI4 A;  3RMC A;  2DEB A;  3QEX A;  4FJ7 A;  3NGI A;  2H4T A;  4AKI A;  4ADO A;  2LF3 A;  3LD8 A;  2OZS A;  2OYQ A;  1NEX B;  4J2B A;  1IH7 A;  3WSO A;  3OGL B;  3C94 A;  2P5G A;  4M45 A;  4DTM A;  4X5M A;  1FZ8 E;  1XU5 E;  2OVP B;  1P22 A;  2P1P B;  3N1B A;  5H37 A;  4FJK A;  3SI6 A;  3SPY A;  3SCX A;  3S9H A;  1MHZ G;  5IBK B;  4I6J B;  4M3T A;  4FJG A;  1XVF E;  3CFP A;  3TAB A;  2JHA A;  3OGK B;  3TL8 B;  3LZI A;  1XVD E;  3HL8 A;  3QNO A;  4B08 A;  4E4B A;  4M3Z A;  4KI6 A;  3V7D B;  3TAF A;  3LZJ A;  2DY4 A;  1FYZ E;  1MHY G;  4FJ9 A;  4DU4 A;  4FJN A;  4FJI A;  5IRE A;  3SUP A;  4FJ8 A;  3LDB A;  1WAF A;  3QES A;  3TAE A;  3SQ0 A;  4FK4 A;  3SPZ A;  3C6N B;  3NAE A;  1FXX A;  2FYO A;  3NHG A;  4X5N A;  3E4Y A;  4ADN A;  1Q9X A;  3UIQ A;  2E31 A;  3HGK E;  1FZ0 E;  1FZ9 E;  2OVR B;  3J27 A;  1FZ6 E;  4DTX A;  4FK2 A;  3K2O A;  4EPH A;  4DTU A;  4RG8 A;  4AI6 A;  3L2O B;  4RL5 A;  2PFT A;  2VJ4 A;  4FJH A;  4FJM A;  4DTJ A;  1FZ1 E;  1LDK E;  3MKS B;  3QEV A;  4QND A;  3SQ4 A;  3NE6 A;  1FZ4 E;  2JHP A;  4DTO A;  3QEP A;  4DTP A;  2JH8 A;  4M3R A;  2B7M A;  1FZH E;  1XVC E;  2LF6 A;  3CFO A;  2HD0 A;  3HP9 A;  3QER A;  4AKG A;  3C6P B;  2YB5 A;  2QXF A;  4M3X A;  4JS4 A;  3NDK A;  4DTR A;  4KHQ A;  4M3W A;  1Q9Y A;  1CLQ A;  4EYW A;  2OVQ B;  2B1E A;  4KHN A;  3KD1 E;  2P5O A;  3RMD A;  3C95 A;  3E4W A;  4M41 A;  4FVM A;  4DTN A;  1FZI E;  3OGM B;  4HCB A;  3QET A;  3C6O B;  4KHW A;  3J2P A;  2P1N B;  2ATQ A;  2OZM A;  1FZ5 E;  4HCC A;  4FJX A;  4M42 A;  4KHY A;  4JRP A;  4EP9 A;  1FZ2 E;  4FJ5 A;  1XVB E;  2PFV A;  2MZW B;  4J2E A;  3L8B A;  1WAJ A;  3SUO A;  3SQ1 A;  4M3U A;  2JH9 A;  3KD5 E;  3QNN A;  2P1O B;  2FW3 A;  3QEI A;  3LDS A;  3SQ2 A;  1XVE E;  3RWU A;  1XMG E;  4QNC A;  4JS5 A;  3TAG A;  4I9Q A;  2RCU A;  1XMH E;  2E32 A;  4KHS A;  4I9L A;  2JHC A;  3L1N A;  3N1E A;  4JRQ A;  3SNN A;  4AKH A;  1FZ3 E;  2MMB A;  3SUN A;  1XL3 C;  2B8I A;  3L0M A;  3CFR A;  4FJJ A;  4GAM C;  3QEW A;  3SVI A;  4FK0 A;  4M3Y A;  4KHU A;  3RMA A;  4DU3 A;  3HGL A;  2P1Q B;  2VIX A;  1FZ7 E;  1XVG E;  4DU1 A;  1MTY G;  2P1M B;  4RNG A;  4E3S A;  3RMB A;  3SJJ A;  4J2A A;  2JPN A;  2VJ5 A;  4J2D A;  4FJL A;  1FS1 A;  5IZ7 A;  1IG9 A;  1MMO G;  3SUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...