1MMRA

Matrilysin complexed with sulfodiimine inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
167
Chain Sequence
YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRILYSIN
publication title Matrilysin-inhibitor complexes: common themes among metalloproteases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease
total genus 46
structure length 167
sequence length 167
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 1995-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1mmrA00
1MMQA 1B8YA 1KUKA 5D1SA 1CK7A 1K7QA 3F1AA 3KMCA 1G9KA 2X3BA 3WV1A 3EDIA 1YP1A 1H71P 3RTSA 1CGFA 3BA0A 5B5OA 1PWWA 1XUCA 1JIZA 4J4MA 1ZP5A 3EDGA 2DDFA 1QJIA 1Q3AA 4FXYP 1JAPA 4H82A 2MZEA 1BQQM 1QICA 3KRYA 3LJTA 2WOAA 4GF1A 1MMPA 1GE6A 1D5JA 2Y6DA 3KWVC 5I2ZA 3KHIA 4Q1LA 2DW0A 3HYGA 4WF6A 3DPFA 3CKIA 2OI0A 4HMAA 4DD8A 3LQ0A 3UVCA 2O36A 1PWQA 1WNIA 2OW2A 4CTHA 2POJA 1R54A 1D8MA 3EHXA 3LIKA 1CQRA 1I73A 3WV2A 4EFSA 1IAGA 4PKVA 1JIWP 2MLSA 3ZXHA 3KEKA 1MMRA 1JH1A 5L79A 1XFVA 4IJOA 2JT6A 1SATA 2W15A 3WV3A 2OW1A 1DMTA 3LMCA 5BOYA 3DPEA 4ILWD 3VI1A 1BKCI 1YQYA 1DTHA 1OS9A 4H49A 1CGLA 4GWNA 1ZS0A 3LJGA 3LQBA 1FLSA 2K2GA 1C7KA 2X3CA 3TVCA 3DNGA 4AXQA 1GO7P 4PKWA 1CGEA 2DW2A 3HDBA 1JKYA 2OY2A 4ZR5A 1UTZA 4AYKA 2W12A 5I43A 5BPAA 5CZMA 1Y93A 5LABA 4DV8A 1HV5A 1ASTA 2EROA 3E8RA 1FBLA 1USNA 1L6JA 4G9LA 1O0TA 4IN9A 3L0VA 3OHOA 3N2VA 3SHIA 1D8FA 3HBVP 3O64A 1BKCE 3I7IA 3AYKA 4G0DA 1G12A 2MLRA 4H1QA 2PJTA 2ERQA 2CKIA 2D1NA 3L0TA 3EDHA 1XFUA 4H3XA 4HX3A 2O3EA 1XFWA 1R1IA 3DSLA 1HOVA 4I03A 2WO9A 1RM8A 2X3AA 2W13A 3V96B 1I76A 1QIAA 4FVLA 5D1UA 2JNPA 1J7NA 1XURA 1PWUA 3KEJA 1A86A 1S4BP 5B5PA 1AF0A 3LE9A 2V4BA 3LKAA 1JK3A 1UMSA 4XM6A 3K7NA 2Z2DA 4I35A 1KUIA 1BQOA 1BUDA 2N8RA 4FXQA 1ROSA 2OVXA 2L0RA 1SU3A 3VTGA 3LUMA 4AIGA 1PWVA 1XFXA 1C8TA 2ERPA 3LK8A 3F18A 3ELMA 4L19A 1ND1A 3I7GA 3LILA 2W0DA 1OM6A 4GR0A 4H2EA 4WKIA 4IUWA 3ZUKA 1QIBA 4AUOA 2MZHA 3KMEA 1KUFA 4WKEA 1EUBA 2FV9A 1SRPA 1KUGA 4A7BA 5D3CA 3TS4A 1KAPP 4H30A 4GR8A 966CA 2QPJA 2JSDA 3F16A 4JPAA 4FU4A 3P24A 2JT5A 1MMBA 1IACA 1G05A 4H84A 1GKCA 3RTTA 3LGPA 1OS2A 2DW1A 2FV5A 2A8HA 3G42A 4PKQA 1IABA 1MNCA 2OXUA 1KBCA 2TCLA 1BIWA 1EB6A 5I3MA 3KECA 1IAAA 5BOTA 1HTDA 2KRJA 2E2DA 3F15A 1BUVM 1CAQA 3NX7A 1IAEA 3OHLA 1BZSA 1BSWA 3F17A 1HY7A 5I12A 830CA 3LJZA 456CA 1YCMA 2OW0A 5I4OA 3USNA 3K7LA 1ZXVA 2USNA 4GQLA 2JIHA 3DL1A 3P1VA 4GUYA 3EHYA 1OMJA 3U1RA 3Q2HA 1OM8A 2W14A 3AIGA 1G49A 4XM8A 2WO8A 5D7WA 2CLTA 4PKRA 3GBOA 1JJ9A 2OW9A 4XBHA 4PKSA 1UTTA 2K9CA 2OZRA 1JANA 5I0LA 1RMZA 4L6TA 1HFSA 5L7FA 5CXAA 2D1OA 1ZXCA 3TSKA 1QUAA 1CXVA 2J83A 2XS4A 2J0TA 1SMPA 1UMTA 4JQGA 3HB2P 3G5CA 2RJQA 1SLNA 5CUHA 4WZVA 1R55A 4H76A 2YIGA 1JAOA 1ZTQA 1BM6A 2YB9A 4JP4A 1OO9A 5D2BA 1XFZA 1B3DA 1Y0VA 1OM7A 1KUHA 3B2ZA 1ATLA 4L63A 1AYKA 3HBUP 1A85A 1GXDA 2MZIA 1ZVXA 3LUNA 2X7MA 1CIZA 2AIGP 2OXZA 1I1IP 4ON1A 1FM1A 4A3WA 1GE7A 4JA1A 1D7XA 2OY4A 4PKTA 2XS3A 1C3IA 2I47A 5H8XA 4PKUA 3B92A 4DPEA 1GO8P 1EAKA 1R1JA 5JMYA 1AKLA 2OVZA 1UEAA 3MA2A 4WK7A 1PWPA 1QJJA 1XFYA 1Z3JA 3DWBA 4XM7A 1K7IA 2DDYA 2SRTA 3B8ZA 3HDAP 2OXWA 4GR3A 1GE5A 1BKCA 5D1TA 1HFCA 3O2XA 1SLMA 1XUDA 2Y6CA 4QKZA 3ZVSA 2RJPA 4R3VA 4GWMA 3TT4A 3Q2GA 1O0QA 3EDZA 3HY7A 3LIRA 3N2UA 4XCTA 1G4KA 3F19A 3LEAA 1Y8JA 2AYKA 1JAQA 1GKDA 3EWJA 1R1HA 1YOUA 2E3XA 3AYUA 4DF9A 4JIJA 1IADA 2HU6A 3HY9A 1K7GA
chains in the Genus database with same CATH superfamily
1MMQA 1B8YA 1KUKA 5D1SA 1CK7A 1K7QA 3F1AA 3KMCA 1G9KA 2X3BA 3WV1A 3EDIA 1YP1A 1H71P 3RTSA 1CGFA 4L7AA 3BA0A 5B5OA 1PWWA 1XUCA 1JIZA 4J4MA 1ZP5A 3EDGA 2DDFA 1QJIA 1Q3AA 4FXYP 1JAPA 4H82A 2MZEA 1BQQM 1QICA 3KRYA 3LJTA 2WOAA 4GF1A 1MMPA 1GE6A 1D5JA 2Y6DA 3KWVC 5I2ZA 3KHIA 4Q1LA 3HYGA 2DW0A 2YUFA 4WF6A 3DPFA 3CKIA 2OI0A 4HMAA 4DD8A 3LQ0A 3UVCA 2O36A 1PWQA 1WNIA 2OW2A 4CTHA 2POJA 1R54A 1D8MA 3EHXA 3LIKA 1CQRA 1I73A 3WV2A 4EFSA 1IAGA 4PKVA 1JIWP 2MLSA 3ZXHA 3KEKA 1MMRA 1JH1A 5L79A 1XFVA 4IJOA 2JT6A 1SATA 1XAXA 2W15A 3WV3A 2OW1A 1DMTA 3LMCA 5BOYA 3DPEA 4ILWD 3VI1A 1BKCI 1YQYA 1DTHA 1OS9A 4H49A 1CGLA 4GWNA 1ZS0A 3LJGA 3LQBA 1FLSA 2K2GA 1C7KA 2X3CA 3TVCA 1XM5A 3DNGA 4AXQA 1GO7P 4PKWA 1CGEA 2DW2A 3HDBA 1JKYA 2OY2A 4ZR5A 1UTZA 4AYKA 2W12A 5I43A 5BPAA 5CZMA 1Y93A 5LABA 4DV8A 1HV5A 1ASTA 2EROA 3E8RA 1FBLA 1USNA 1L6JA 4G9LA 1O0TA 4IN9A 3L0VA 3OHOA 3N2VA 3SHIA 1D8FA 3HBVP 3O64A 1BKCE 3I7IA 3AYKA 4G0DA 1G12A 2MLRA 4H1QA 2PJTA 2ERQA 2CKIA 2D1NA 3L0TA 3EDHA 1XFUA 4H3XA 4HX3A 2O3EA 1XFWA 1R1IA 3DSLA 1HOVA 4I03A 2WO9A 1RM8A 2X3AA 2W13A 3V96B 1I76A 1QIAA 4FVLA 5D1UA 2JNPA 1J7NA 1XURA 1PWUA 3KEJA 1A86A 1S4BP 5B5PA 1AF0A 3LE9A 2V4BA 3LKAA 1JK3A 1UMSA 4XM6A 3K7NA 2Z2DA 4I35A 1KUIA 1BQOA 1BUDA 2N8RA 4FXQA 1ROSA 2OVXA 2L0RA 1SU3A 3VTGA 3LUMA 4AIGA 1PWVA 1XFXA 1C8TA 2ERPA 3LK8A 3F18A 3ELMA 4L19A 1ND1A 3I7GA 3LILA 2W0DA 1OM6A 4GR0A 4H2EA 4WKIA 4IUWA 3ZUKA 1QIBA 4AUOA 2MZHA 3KMEA 1KUFA 4WKEA 1EUBA 2FV9A 1SRPA 1KUGA 4A7BA 5D3CA 3TS4A 1TVIA 1KAPP 4H30A 4GR8A 966CA 2QPJA 2JSDA 3F16A 4JPAA 4FU4A 3P24A 2JT5A 1MMBA 1IACA 1G05A 4H84A 1GKCA 3RTTA 3LGPA 1OS2A 2DW1A 2FV5A 2A8HA 3G42A 4PKQA 1IABA 1MNCA 2OXUA 1KBCA 2TCLA 1BIWA 1EB6A 5I3MA 3KECA 1IAAA 5BOTA 1HTDA 2KRJA 2E2DA 3F15A 1BUVM 1CAQA 3NX7A 1IAEA 3OHLA 1BZSA 1BSWA 3F17A 1HY7A 5I12A 830CA 3LJZA 456CA 1YCMA 2OW0A 5I4OA 3USNA 3K7LA 1ZXVA 2USNA 4GQLA 2JIHA 3DL1A 3P1VA 4GUYA 3EHYA 1OMJA 3U1RA 3Q2HA 1OM8A 2W14A 3AIGA 1G49A 4XM8A 2WO8A 5D7WA 2CLTA 4PKRA 3GBOA 1JJ9A 2OW9A 3DTKA 4XBHA 4PKSA 1UTTA 2K9CA 2OZRA 1JANA 5I0LA 1RMZA 4L6TA 1HFSA 5L7FA 5CXAA 2D1OA 1ZXCA 3TSKA 1QUAA 1CXVA 2J83A 2XS4A 2J0TA 1SMPA 1UMTA 4JQGA 3HB2P 3G5CA 2RJQA 3DTEA 1SLNA 5CUHA 4WZVA 1R55A 4H76A 2YIGA 1JAOA 1ZTQA 1BM6A 2YB9A 4JP4A 1OO9A 5D2BA 1XFZA 1B3DA 1Y0VA 1OM7A 1KUHA 3B2ZA 1ATLA 4L63A 1AYKA 3HBUP 1A85A 1GXDA 2MZIA 1ZVXA 3LUNA 2X7MA 1CIZA 2AIGP 2OXZA 1I1IP 4ON1A 1FM1A 4A3WA 1GE7A 1OZ9A 4JA1A 1D7XA 2OY4A 4PKTA 2XS3A 1C3IA 2I47A 5H8XA 4PKUA 3B92A 4DPEA 1GO8P 1EAKA 1R1JA 5JMYA 1AKLA 2OVZA 1UEAA 3MA2A 4WK7A 1PWPA 1QJJA 1XFYA 1Z3JA 3DWBA 4XM7A 1K7IA 2DDYA 2SRTA 3B8ZA 3HDAP 2OXWA 4GR3A 1GE5A 1BKCA 5D1TA 1HFCA 3O2XA 1SLMA 1XUDA 2Y6CA 4QKZA 3ZVSA 2RJPA 4R3VA 4GWMA 3TT4A 3Q2GA 1O0QA 3EDZA 3HY7A 3LIRA 3N2UA 4XCTA 1G4KA 3F19A 3DTIA 3LEAA 1Y8JA 2AYKA 1JAQA 1GKDA 3EWJA 1R1HA 1YOUA 2E3XA 3AYUA 4DF9A 4JIJA 1IADA 2HU6A 3HY9A 1K7GA
chains in the Genus database with same CATH topology
1MMQA 1B8YA 1KUKA 5D1SA 1CK7A 1K7QA 3F1AA 3KMCA 1G9KA 2X3BA 3WV1A 3EDIA 1YP1A 1H71P 3RTSA 1CGFA 4L7AA 3BA0A 5B5OA 1PWWA 1XUCA 1JIZA 4J4MA 1ZP5A 3EDGA 2DDFA 1QJIA 1Q3AA 4FXYP 1JAPA 4H82A 2MZEA 1BQQM 1QICA 3KRYA 3LJTA 2WOAA 4GF1A 1MMPA 1GE6A 1D5JA 2Y6DA 3KWVC 5I2ZA 3KHIA 4Q1LA 3HYGA 2DW0A 2YUFA 4WF6A 3DPFA 3CKIA 2OI0A 4HMAA 4DD8A 3LQ0A 3UVCA 2O36A 1PWQA 1WNIA 2OW2A 4CTHA 2POJA 1R54A 1D8MA 3EHXA 3LIKA 1CQRA 1I73A 3WV2A 4EFSA 1IAGA 4PKVA 1JIWP 2MLSA 3ZXHA 3KEKA 1MMRA 1JH1A 5L79A 1XFVA 4IJOA 2JT6A 1SATA 2W15A 3WV3A 2OW1A 1DMTA 3LMCA 5BOYA 3DPEA 4ILWD 3VI1A 1BKCI 1YQYA 1DTHA 1OS9A 4H49A 1CGLA 4GWNA 1ZS0A 3LJGA 3LQBA 1FLSA 2K2GA 1C7KA 2X3CA 3TVCA 3DNGA 4AXQA 1GO7P 4PKWA 1CGEA 2DW2A 3HDBA 1JKYA 2OY2A 4ZR5A 1UTZA 4AYKA 2W12A 5I43A 5BPAA 5CZMA 1Y93A 5LABA 4DV8A 1HV5A 1ASTA 2EROA 3E8RA 1FBLA 1USNA 1L6JA 4G9LA 1O0TA 4IN9A 3L0VA 3OHOA 3N2VA 3SHIA 1D8FA 3HBVP 3O64A 1BKCE 3I7IA 3AYKA 4G0DA 1G12A 2MLRA 4H1QA 2PJTA 2ERQA 2CKIA 2D1NA 3L0TA 3EDHA 1XFUA 4H3XA 4HX3A 2O3EA 1XFWA 1R1IA 3DSLA 1HOVA 4I03A 2WO9A 1RM8A 2X3AA 2W13A 3V96B 1I76A 1QIAA 4FVLA 5D1UA 2JNPA 1J7NA 1XURA 1PWUA 3KEJA 1A86A 1S4BP 5B5PA 1AF0A 3LE9A 2V4BA 3LKAA 1JK3A 1UMSA 4XM6A 3K7NA 2Z2DA 4I35A 1KUIA 1BQOA 1BUDA 2N8RA 4FXQA 1ROSA 2OVXA 2L0RA 1SU3A 3VTGA 3LUMA 4AIGA 1PWVA 1XFXA 1C8TA 2ERPA 3LK8A 3F18A 3ELMA 4L19A 1ND1A 3I7GA 3LILA 2W0DA 1OM6A 4GR0A 4H2EA 4WKIA 4IUWA 3ZUKA 1QIBA 4AUOA 2MZHA 3KMEA 1KUFA 4WKEA 1EUBA 2FV9A 1SRPA 1KUGA 4A7BA 5D3CA 3TS4A 1KAPP 4H30A 4GR8A 966CA 2QPJA 2JSDA 3F16A 4JPAA 4FU4A 3P24A 2JT5A 1MMBA 1IACA 1G05A 4H84A 1GKCA 3RTTA 3LGPA 1OS2A 2DW1A 2FV5A 2A8HA 3G42A 4PKQA 1IABA 1MNCA 2OXUA 1KBCA 2TCLA 1BIWA 1EB6A 5I3MA 3KECA 1IAAA 5BOTA 1HTDA 2KRJA 2E2DA 3F15A 1BUVM 1CAQA 3NX7A 1IAEA 3OHLA 1BZSA 1BSWA 3F17A 1HY7A 5I12A 830CA 3LJZA 456CA 1YCMA 2OW0A 5I4OA 3USNA 3K7LA 1ZXVA 2USNA 4GQLA 2JIHA 3DL1A 3P1VA 4GUYA 3EHYA 1OMJA 3U1RA 3Q2HA 1OM8A 2W14A 3AIGA 1G49A 4XM8A 2WO8A 5D7WA 2CLTA 4PKRA 3GBOA 1JJ9A 2OW9A 3DTKA 4XBHA 4PKSA 1UTTA 2K9CA 2OZRA 1JANA 5I0LA 1RMZA 4L6TA 1HFSA 5L7FA 5CXAA 2D1OA 1ZXCA 3TSKA 1QUAA 1CXVA 2J83A 2XS4A 2J0TA 1SMPA 1UMTA 4JQGA 3HB2P 3G5CA 2RJQA 3DTEA 1SLNA 5CUHA 4WZVA 1R55A 4H76A 2YIGA 1JAOA 1ZTQA 1BM6A 2YB9A 4JP4A 1OO9A 5D2BA 1XFZA 1B3DA 1Y0VA 1OM7A 1KUHA 3B2ZA 1ATLA 4L63A 1AYKA 3HBUP 1A85A 1GXDA 2MZIA 1ZVXA 3LUNA 2X7MA 1CIZA 2AIGP 2OXZA 1I1IP 4ON1A 1FM1A 4A3WA 1GE7A 4JA1A 1D7XA 2OY4A 4PKTA 2XS3A 1C3IA 2I47A 5H8XA 4PKUA 3B92A 4DPEA 1GO8P 1EAKA 1R1JA 5JMYA 1AKLA 2OVZA 1UEAA 3MA2A 4WK7A 1PWPA 1QJJA 1XFYA 1Z3JA 3DWBA 4XM7A 1K7IA 2DDYA 2SRTA 3B8ZA 3HDAP 2OXWA 4GR3A 1GE5A 1BKCA 5D1TA 1HFCA 3O2XA 1SLMA 1XUDA 2Y6CA 4QKZA 3ZVSA 2RJPA 4R3VA 4GWMA 3TT4A 3Q2GA 1O0QA 3EDZA 3HY7A 3LIRA 3N2UA 4XCTA 1G4KA 3F19A 3DTIA 3LEAA 1Y8JA 2AYKA 1JAQA 1GKDA 3EWJA 1R1HA 1YOUA 2E3XA 3AYUA 4DF9A 4JIJA 1IADA 2HU6A 3HY9A 1K7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMQ A;  1B8Y A;  1KUK A;  5D1S A;  1CK7 A;  1K7Q A;  3F1A A;  3KMC A;  1G9K A;  2X3B A;  3WV1 A;  3EDI A;  1YP1 A;  1H71 P;  3RTS A;  1CGF A;  3BA0 A;  5B5O A;  1PWW A;  1XUC A;  1JIZ A;  4J4M A;  1ZP5 A;  3EDG A;  2DDF A;  1QJI A;  1Q3A A;  4FXY P;  1JAP A;  4H82 A;  2MZE A;  1BQQ M;  1QIC A;  3KRY A;  3LJT A;  2WOA A;  4GF1 A;  1MMP A;  1GE6 A;  1D5J A;  2Y6D A;  3KWV C;  5I2Z A;  3KHI A;  4Q1L A;  2DW0 A;  3HYG A;  4WF6 A;  3DPF A;  3CKI A;  2OI0 A;  4HMA A;  4DD8 A;  3LQ0 A;  3UVC A;  2O36 A;  1PWQ A;  1WNI A;  2OW2 A;  4CTH A;  2POJ A;  1R54 A;  1D8M A;  3EHX A;  3LIK A;  1CQR A;  1I73 A;  3WV2 A;  4EFS A;  1IAG A;  4PKV A;  1JIW P;  2MLS A;  3ZXH A;  3KEK A;  1MMR A;  1JH1 A;  5L79 A;  1XFV A;  4IJO A;  2JT6 A;  1SAT A;  2W15 A;  3WV3 A;  2OW1 A;  1DMT A;  3LMC A;  5BOY A;  3DPE A;  4ILW D;  3VI1 A;  1BKC I;  1YQY A;  1DTH A;  1OS9 A;  4H49 A;  1CGL A;  4GWN A;  1ZS0 A;  3LJG A;  3LQB A;  1FLS A;  2K2G A;  1C7K A;  2X3C A;  3TVC A;  3DNG A;  4AXQ A;  1GO7 P;  4PKW A;  1CGE A;  2DW2 A;  3HDB A;  1JKY A;  2OY2 A;  4ZR5 A;  1UTZ A;  4AYK A;  2W12 A;  5I43 A;  5BPA A;  5CZM A;  1Y93 A;  5LAB A;  4DV8 A;  1HV5 A;  1AST A;  2ERO A;  3E8R A;  1FBL A;  1USN A;  1L6J A;  4G9L A;  1O0T A;  4IN9 A;  3L0V A;  3OHO A;  3N2V A;  3SHI A;  1D8F A;  3HBV P;  3O64 A;  1BKC E;  3I7I A;  3AYK A;  4G0D A;  1G12 A;  2MLR A;  4H1Q A;  2PJT A;  2ERQ A;  2CKI A;  2D1N A;  3L0T A;  3EDH A;  1XFU A;  4H3X A;  4HX3 A;  2O3E A;  1XFW A;  1R1I A;  3DSL A;  1HOV A;  4I03 A;  2WO9 A;  1RM8 A;  2X3A A;  2W13 A;  3V96 B;  1I76 A;  1QIA A;  4FVL A;  5D1U A;  2JNP A;  1J7N A;  1XUR A;  1PWU A;  3KEJ A;  1A86 A;  1S4B P;  5B5P A;  1AF0 A;  3LE9 A;  2V4B A;  3LKA A;  1JK3 A;  1UMS A;  4XM6 A;  3K7N A;  2Z2D A;  4I35 A;  1KUI A;  1BQO A;  1BUD A;  2N8R A;  4FXQ A;  1ROS A;  2OVX A;  2L0R A;  1SU3 A;  3VTG A;  3LUM A;  4AIG A;  1PWV A;  1XFX A;  1C8T A;  2ERP A;  3LK8 A;  3F18 A;  3ELM A;  4L19 A;  1ND1 A;  3I7G A;  3LIL A;  2W0D A;  1OM6 A;  4GR0 A;  4H2E A;  4WKI A;  4IUW A;  3ZUK A;  1QIB A;  4AUO A;  2MZH A;  3KME A;  1KUF A;  4WKE A;  1EUB A;  2FV9 A;  1SRP A;  1KUG A;  4A7B A;  5D3C A;  3TS4 A;  1KAP P;  4H30 A;  4GR8 A;  966C A;  2QPJ A;  2JSD A;  3F16 A;  4JPA A;  4FU4 A;  3P24 A;  2JT5 A;  1MMB A;  1IAC A;  1G05 A;  4H84 A;  1GKC A;  3RTT A;  3LGP A;  1OS2 A;  2DW1 A;  2FV5 A;  2A8H A;  3G42 A;  4PKQ A;  1IAB A;  1MNC A;  2OXU A;  1KBC A;  2TCL A;  1BIW A;  1EB6 A;  5I3M A;  3KEC A;  1IAA A;  5BOT A;  1HTD A;  2KRJ A;  2E2D A;  3F15 A;  1BUV M;  1CAQ A;  3NX7 A;  1IAE A;  3OHL A;  1BZS A;  1BSW A;  3F17 A;  1HY7 A;  5I12 A;  830C A;  3LJZ A;  456C A;  1YCM A;  2OW0 A;  5I4O A;  3USN A;  3K7L A;  1ZXV A;  2USN A;  4GQL A;  2JIH A;  3DL1 A;  3P1V A;  4GUY A;  3EHY A;  1OMJ A;  3U1R A;  3Q2H A;  1OM8 A;  2W14 A;  3AIG A;  1G49 A;  4XM8 A;  2WO8 A;  5D7W A;  2CLT A;  4PKR A;  3GBO A;  1JJ9 A;  2OW9 A;  4XBH A;  4PKS A;  1UTT A;  2K9C A;  2OZR A;  1JAN A;  5I0L A;  1RMZ A;  4L6T A;  1HFS A;  5L7F A;  5CXA A;  2D1O A;  1ZXC A;  3TSK A;  1QUA A;  1CXV A;  2J83 A;  2XS4 A;  2J0T A;  1SMP A;  1UMT A;  4JQG A;  3HB2 P;  3G5C A;  2RJQ A;  1SLN A;  5CUH A;  4WZV A;  1R55 A;  4H76 A;  2YIG A;  1JAO A;  1ZTQ A;  1BM6 A;  2YB9 A;  4JP4 A;  1OO9 A;  5D2B A;  1XFZ A;  1B3D A;  1Y0V A;  1OM7 A;  1KUH A;  3B2Z A;  1ATL A;  4L63 A;  1AYK A;  3HBU P;  1A85 A;  1GXD A;  2MZI A;  1ZVX A;  3LUN A;  2X7M A;  1CIZ A;  2AIG P;  2OXZ A;  1I1I P;  4ON1 A;  1FM1 A;  4A3W A;  1GE7 A;  4JA1 A;  1D7X A;  2OY4 A;  4PKT A;  2XS3 A;  1C3I A;  2I47 A;  5H8X A;  4PKU A;  3B92 A;  4DPE A;  1GO8 P;  1EAK A;  1R1J A;  5JMY A;  1AKL A;  2OVZ A;  1UEA A;  3MA2 A;  4WK7 A;  1PWP A;  1QJJ A;  1XFY A;  1Z3J A;  3DWB A;  4XM7 A;  1K7I A;  2DDY A;  2SRT A;  3B8Z A;  3HDA P;  2OXW A;  4GR3 A;  1GE5 A;  1BKC A;  5D1T A;  1HFC A;  3O2X A;  1SLM A;  1XUD A;  2Y6C A;  4QKZ A;  3ZVS A;  2RJP A;  4R3V A;  4GWM A;  3TT4 A;  3Q2G A;  1O0Q A;  3EDZ A;  3HY7 A;  3LIR A;  3N2U A;  4XCT A;  1G4K A;  3F19 A;  3LEA A;  1Y8J A;  2AYK A;  1JAQ A;  1GKD A;  3EWJ A;  1R1H A;  1YOU A;  2E3X A;  3AYU A;  4DF9 A;  4JIJ A;  1IAD A;  2HU6 A;  3HY9 A;  1K7G A; 
#chains in the Genus database with same CATH topology
 1MMQ A;  1B8Y A;  1KUK A;  5D1S A;  1CK7 A;  1K7Q A;  3F1A A;  3KMC A;  1G9K A;  2X3B A;  3WV1 A;  3EDI A;  1YP1 A;  1H71 P;  3RTS A;  1CGF A;  4L7A A;  3BA0 A;  5B5O A;  1PWW A;  1XUC A;  1JIZ A;  4J4M A;  1ZP5 A;  3EDG A;  2DDF A;  1QJI A;  1Q3A A;  4FXY P;  1JAP A;  4H82 A;  2MZE A;  1BQQ M;  1QIC A;  3KRY A;  3LJT A;  2WOA A;  4GF1 A;  1MMP A;  1GE6 A;  1D5J A;  2Y6D A;  3KWV C;  5I2Z A;  3KHI A;  4Q1L A;  3HYG A;  2DW0 A;  2YUF A;  4WF6 A;  3DPF A;  3CKI A;  2OI0 A;  4HMA A;  4DD8 A;  3LQ0 A;  3UVC A;  2O36 A;  1PWQ A;  1WNI A;  2OW2 A;  4CTH A;  2POJ A;  1R54 A;  1D8M A;  3EHX A;  3LIK A;  1CQR A;  1I73 A;  3WV2 A;  4EFS A;  1IAG A;  4PKV A;  1JIW P;  2MLS A;  3ZXH A;  3KEK A;  1MMR A;  1JH1 A;  5L79 A;  1XFV A;  4IJO A;  2JT6 A;  1SAT A;  1XAX A;  2W15 A;  3WV3 A;  2OW1 A;  1DMT A;  3LMC A;  5BOY A;  3DPE A;  4ILW D;  3VI1 A;  1BKC I;  1YQY A;  1DTH A;  1OS9 A;  4H49 A;  1CGL A;  4GWN A;  1ZS0 A;  3LJG A;  3LQB A;  1FLS A;  2K2G A;  1C7K A;  2X3C A;  3TVC A;  1XM5 A;  3DNG A;  4AXQ A;  1GO7 P;  4PKW A;  1CGE A;  2DW2 A;  3HDB A;  1JKY A;  2OY2 A;  4ZR5 A;  1UTZ A;  4AYK A;  2W12 A;  5I43 A;  5BPA A;  5CZM A;  1Y93 A;  5LAB A;  4DV8 A;  1HV5 A;  1AST A;  2ERO A;  3E8R A;  1FBL A;  1USN A;  1L6J A;  4G9L A;  1O0T A;  4IN9 A;  3L0V A;  3OHO A;  3N2V A;  3SHI A;  1D8F A;  3HBV P;  3O64 A;  1BKC E;  3I7I A;  3AYK A;  4G0D A;  1G12 A;  2MLR A;  4H1Q A;  2PJT A;  2ERQ A;  2CKI A;  2D1N A;  3L0T A;  3EDH A;  1XFU A;  4H3X A;  4HX3 A;  2O3E A;  1XFW A;  1R1I A;  3DSL A;  1HOV A;  4I03 A;  2WO9 A;  1RM8 A;  2X3A A;  2W13 A;  3V96 B;  1I76 A;  1QIA A;  4FVL A;  5D1U A;  2JNP A;  1J7N A;  1XUR A;  1PWU A;  3KEJ A;  1A86 A;  1S4B P;  5B5P A;  1AF0 A;  3LE9 A;  2V4B A;  3LKA A;  1JK3 A;  1UMS A;  4XM6 A;  3K7N A;  2Z2D A;  4I35 A;  1KUI A;  1BQO A;  1BUD A;  2N8R A;  4FXQ A;  1ROS A;  2OVX A;  2L0R A;  1SU3 A;  3VTG A;  3LUM A;  4AIG A;  1PWV A;  1XFX A;  1C8T A;  2ERP A;  3LK8 A;  3F18 A;  3ELM A;  4L19 A;  1ND1 A;  3I7G A;  3LIL A;  2W0D A;  1OM6 A;  4GR0 A;  4H2E A;  4WKI A;  4IUW A;  3ZUK A;  1QIB A;  4AUO A;  2MZH A;  3KME A;  1KUF A;  4WKE A;  1EUB A;  2FV9 A;  1SRP A;  1KUG A;  4A7B A;  5D3C A;  3TS4 A;  1TVI A;  1KAP P;  4H30 A;  4GR8 A;  966C A;  2QPJ A;  2JSD A;  3F16 A;  4JPA A;  4FU4 A;  3P24 A;  2JT5 A;  1MMB A;  1IAC A;  1G05 A;  4H84 A;  1GKC A;  3RTT A;  3LGP A;  1OS2 A;  2DW1 A;  2FV5 A;  2A8H A;  3G42 A;  4PKQ A;  1IAB A;  1MNC A;  2OXU A;  1KBC A;  2TCL A;  1BIW A;  1EB6 A;  5I3M A;  3KEC A;  1IAA A;  5BOT A;  1HTD A;  2KRJ A;  2E2D A;  3F15 A;  1BUV M;  1CAQ A;  3NX7 A;  1IAE A;  3OHL A;  1BZS A;  1BSW A;  3F17 A;  1HY7 A;  5I12 A;  830C A;  3LJZ A;  456C A;  1YCM A;  2OW0 A;  5I4O A;  3USN A;  3K7L A;  1ZXV A;  2USN A;  4GQL A;  2JIH A;  3DL1 A;  3P1V A;  4GUY A;  3EHY A;  1OMJ A;  3U1R A;  3Q2H A;  1OM8 A;  2W14 A;  3AIG A;  1G49 A;  4XM8 A;  2WO8 A;  5D7W A;  2CLT A;  4PKR A;  3GBO A;  1JJ9 A;  2OW9 A;  3DTK A;  4XBH A;  4PKS A;  1UTT A;  2K9C A;  2OZR A;  1JAN A;  5I0L A;  1RMZ A;  4L6T A;  1HFS A;  5L7F A;  5CXA A;  2D1O A;  1ZXC A;  3TSK A;  1QUA A;  1CXV A;  2J83 A;  2XS4 A;  2J0T A;  1SMP A;  1UMT A;  4JQG A;  3HB2 P;  3G5C A;  2RJQ A;  3DTE A;  1SLN A;  5CUH A;  4WZV A;  1R55 A;  4H76 A;  2YIG A;  1JAO A;  1ZTQ A;  1BM6 A;  2YB9 A;  4JP4 A;  1OO9 A;  5D2B A;  1XFZ A;  1B3D A;  1Y0V A;  1OM7 A;  1KUH A;  3B2Z A;  1ATL A;  4L63 A;  1AYK A;  3HBU P;  1A85 A;  1GXD A;  2MZI A;  1ZVX A;  3LUN A;  2X7M A;  1CIZ A;  2AIG P;  2OXZ A;  1I1I P;  4ON1 A;  1FM1 A;  4A3W A;  1GE7 A;  1OZ9 A;  4JA1 A;  1D7X A;  2OY4 A;  4PKT A;  2XS3 A;  1C3I A;  2I47 A;  5H8X A;  4PKU A;  3B92 A;  4DPE A;  1GO8 P;  1EAK A;  1R1J A;  5JMY A;  1AKL A;  2OVZ A;  1UEA A;  3MA2 A;  4WK7 A;  1PWP A;  1QJJ A;  1XFY A;  1Z3J A;  3DWB A;  4XM7 A;  1K7I A;  2DDY A;  2SRT A;  3B8Z A;  3HDA P;  2OXW A;  4GR3 A;  1GE5 A;  1BKC A;  5D1T A;  1HFC A;  3O2X A;  1SLM A;  1XUD A;  2Y6C A;  4QKZ A;  3ZVS A;  2RJP A;  4R3V A;  4GWM A;  3TT4 A;  3Q2G A;  1O0Q A;  3EDZ A;  3HY7 A;  3LIR A;  3N2U A;  4XCT A;  1G4K A;  3F19 A;  3DTI A;  3LEA A;  1Y8J A;  2AYK A;  1JAQ A;  1GKD A;  3EWJ A;  1R1H A;  1YOU A;  2E3X A;  3AYU A;  4DF9 A;  4JIJ A;  1IAD A;  2HU6 A;  3HY9 A;  1K7G A; 
#chains in the Genus database with same CATH homology
 1MMQ A;  1B8Y A;  1KUK A;  5D1S A;  1CK7 A;  1K7Q A;  3F1A A;  3KMC A;  1G9K A;  2X3B A;  3WV1 A;  3EDI A;  1YP1 A;  1H71 P;  3RTS A;  1CGF A;  4L7A A;  3BA0 A;  5B5O A;  1PWW A;  1XUC A;  1JIZ A;  4J4M A;  1ZP5 A;  3EDG A;  2DDF A;  1QJI A;  1Q3A A;  4FXY P;  1JAP A;  4H82 A;  2MZE A;  1BQQ M;  1QIC A;  3KRY A;  3LJT A;  2WOA A;  4GF1 A;  1MMP A;  1GE6 A;  1D5J A;  2Y6D A;  3KWV C;  5I2Z A;  3KHI A;  4Q1L A;  3HYG A;  2DW0 A;  2YUF A;  4WF6 A;  3DPF A;  3CKI A;  2OI0 A;  4HMA A;  4DD8 A;  3LQ0 A;  3UVC A;  2O36 A;  1PWQ A;  1WNI A;  2OW2 A;  4CTH A;  2POJ A;  1R54 A;  1D8M A;  3EHX A;  3LIK A;  1CQR A;  1I73 A;  3WV2 A;  4EFS A;  1IAG A;  4PKV A;  1JIW P;  2MLS A;  3ZXH A;  3KEK A;  1MMR A;  1JH1 A;  5L79 A;  1XFV A;  4IJO A;  2JT6 A;  1SAT A;  2W15 A;  3WV3 A;  2OW1 A;  1DMT A;  3LMC A;  5BOY A;  3DPE A;  4ILW D;  3VI1 A;  1BKC I;  1YQY A;  1DTH A;  1OS9 A;  4H49 A;  1CGL A;  4GWN A;  1ZS0 A;  3LJG A;  3LQB A;  1FLS A;  2K2G A;  1C7K A;  2X3C A;  3TVC A;  3DNG A;  4AXQ A;  1GO7 P;  4PKW A;  1CGE A;  2DW2 A;  3HDB A;  1JKY A;  2OY2 A;  4ZR5 A;  1UTZ A;  4AYK A;  2W12 A;  5I43 A;  5BPA A;  5CZM A;  1Y93 A;  5LAB A;  4DV8 A;  1HV5 A;  1AST A;  2ERO A;  3E8R A;  1FBL A;  1USN A;  1L6J A;  4G9L A;  1O0T A;  4IN9 A;  3L0V A;  3OHO A;  3N2V A;  3SHI A;  1D8F A;  3HBV P;  3O64 A;  1BKC E;  3I7I A;  3AYK A;  4G0D A;  1G12 A;  2MLR A;  4H1Q A;  2PJT A;  2ERQ A;  2CKI A;  2D1N A;  3L0T A;  3EDH A;  1XFU A;  4H3X A;  4HX3 A;  2O3E A;  1XFW A;  1R1I A;  3DSL A;  1HOV A;  4I03 A;  2WO9 A;  1RM8 A;  2X3A A;  2W13 A;  3V96 B;  1I76 A;  1QIA A;  4FVL A;  5D1U A;  2JNP A;  1J7N A;  1XUR A;  1PWU A;  3KEJ A;  1A86 A;  1S4B P;  5B5P A;  1AF0 A;  3LE9 A;  2V4B A;  3LKA A;  1JK3 A;  1UMS A;  4XM6 A;  3K7N A;  2Z2D A;  4I35 A;  1KUI A;  1BQO A;  1BUD A;  2N8R A;  4FXQ A;  1ROS A;  2OVX A;  2L0R A;  1SU3 A;  3VTG A;  3LUM A;  4AIG A;  1PWV A;  1XFX A;  1C8T A;  2ERP A;  3LK8 A;  3F18 A;  3ELM A;  4L19 A;  1ND1 A;  3I7G A;  3LIL A;  2W0D A;  1OM6 A;  4GR0 A;  4H2E A;  4WKI A;  4IUW A;  3ZUK A;  1QIB A;  4AUO A;  2MZH A;  3KME A;  1KUF A;  4WKE A;  1EUB A;  2FV9 A;  1SRP A;  1KUG A;  4A7B A;  5D3C A;  3TS4 A;  1KAP P;  4H30 A;  4GR8 A;  966C A;  2QPJ A;  2JSD A;  3F16 A;  4JPA A;  4FU4 A;  3P24 A;  2JT5 A;  1MMB A;  1IAC A;  1G05 A;  4H84 A;  1GKC A;  3RTT A;  3LGP A;  1OS2 A;  2DW1 A;  2FV5 A;  2A8H A;  3G42 A;  4PKQ A;  1IAB A;  1MNC A;  2OXU A;  1KBC A;  2TCL A;  1BIW A;  1EB6 A;  5I3M A;  3KEC A;  1IAA A;  5BOT A;  1HTD A;  2KRJ A;  2E2D A;  3F15 A;  1BUV M;  1CAQ A;  3NX7 A;  1IAE A;  3OHL A;  1BZS A;  1BSW A;  3F17 A;  1HY7 A;  5I12 A;  830C A;  3LJZ A;  456C A;  1YCM A;  2OW0 A;  5I4O A;  3USN A;  3K7L A;  1ZXV A;  2USN A;  4GQL A;  2JIH A;  3DL1 A;  3P1V A;  4GUY A;  3EHY A;  1OMJ A;  3U1R A;  3Q2H A;  1OM8 A;  2W14 A;  3AIG A;  1G49 A;  4XM8 A;  2WO8 A;  5D7W A;  2CLT A;  4PKR A;  3GBO A;  1JJ9 A;  2OW9 A;  3DTK A;  4XBH A;  4PKS A;  1UTT A;  2K9C A;  2OZR A;  1JAN A;  5I0L A;  1RMZ A;  4L6T A;  1HFS A;  5L7F A;  5CXA A;  2D1O A;  1ZXC A;  3TSK A;  1QUA A;  1CXV A;  2J83 A;  2XS4 A;  2J0T A;  1SMP A;  1UMT A;  4JQG A;  3HB2 P;  3G5C A;  2RJQ A;  3DTE A;  1SLN A;  5CUH A;  4WZV A;  1R55 A;  4H76 A;  2YIG A;  1JAO A;  1ZTQ A;  1BM6 A;  2YB9 A;  4JP4 A;  1OO9 A;  5D2B A;  1XFZ A;  1B3D A;  1Y0V A;  1OM7 A;  1KUH A;  3B2Z A;  1ATL A;  4L63 A;  1AYK A;  3HBU P;  1A85 A;  1GXD A;  2MZI A;  1ZVX A;  3LUN A;  2X7M A;  1CIZ A;  2AIG P;  2OXZ A;  1I1I P;  4ON1 A;  1FM1 A;  4A3W A;  1GE7 A;  4JA1 A;  1D7X A;  2OY4 A;  4PKT A;  2XS3 A;  1C3I A;  2I47 A;  5H8X A;  4PKU A;  3B92 A;  4DPE A;  1GO8 P;  1EAK A;  1R1J A;  5JMY A;  1AKL A;  2OVZ A;  1UEA A;  3MA2 A;  4WK7 A;  1PWP A;  1QJJ A;  1XFY A;  1Z3J A;  3DWB A;  4XM7 A;  1K7I A;  2DDY A;  2SRT A;  3B8Z A;  3HDA P;  2OXW A;  4GR3 A;  1GE5 A;  1BKC A;  5D1T A;  1HFC A;  3O2X A;  1SLM A;  1XUD A;  2Y6C A;  4QKZ A;  3ZVS A;  2RJP A;  4R3V A;  4GWM A;  3TT4 A;  3Q2G A;  1O0Q A;  3EDZ A;  3HY7 A;  3LIR A;  3N2U A;  4XCT A;  1G4K A;  3F19 A;  3DTI A;  3LEA A;  1Y8J A;  2AYK A;  1JAQ A;  1GKD A;  3EWJ A;  1R1H A;  1YOU A;  2E3X A;  3AYU A;  4DF9 A;  4JIJ A;  1IAD A;  2HU6 A;  3HY9 A;  1K7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...