1MMSA

Crystal structure of the ribosomal protein l11-rna complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
b'QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title A detailed view of a ribosomal active site: the structure of the L11-RNA complex.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Ribosome
total genus 32
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1mmsA02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 1mmsA01
1VQKI 4UY8I 1VQNI 3CJRB 2H8WA 2ZJPF 2OTLI 3CC2I 3CF5F 3DLLF 3I55I 3CCQI 5JVGF 1WIBA 3EGVB 3CCMI 3CD6I 3G6EI 3I56I 1YHQI 2E35A 3G71I 1HC8A 3CJQB 1FOYA 3PIPF 5GAHJ 1FOXA 1VQ6I 2FOWA 3CCUI 1YI2I 2E36A 5DM6F 4IOCF 1FOWA 1S72I 1VQ9I 3CJSB 1ACIA 1VQ8I 2E34A 3G4SI 3J7YJ 3CMAI 3CCSI 4IO9F 3CCEI 1YIJI 1QA6A 3CJTB 3CMEI 1Y39A 5GAEJ 5GADJ 1VQLI 2NXNB 1VQOI 2QEXI 1VQPI 5DM7F 3PIOF 1YJWI 1YJNI 1VQ4I 1VQ7I 3CCJI 1VQMI 1YJ9I 3CC7I 3CCVI 3CCLI 2JQ7A 1MMSA 5GAGJ 1VQ5I 3CCRI 2K3FA 1YITI 3J7ZI 3CC4I 4IOAF 4V19K 2ZJQF 2ZJRF 2QA4I 2OTJI
chains in the Genus database with same CATH superfamily
2DPDA 3K4MA 2L3DA 3C2HA 1NG6A 2NNYA 4J00A 2VBYA 3H5NA 3L2RA 3DXJF 2JUGA 2DPUA 1R23A 3EYIA 2PX9A 1P7JA 5KAIC 1PJRA 4XLCA 1EH6A 3CLQA 4HSTA 2OTLI 3BTLA 3W2AA 5DV5A 3DLLF 3HIFA 2M2EA 2LVSA 1RZ4A 3S2DJ 3BR5A 1UCRA 3K6GA 3G3ZA 1WIBA 2CW7A 5JR3A 2J5PA 3G6EI 1Y8RB 3I56I 1BC7C 2JVGA 4YIFA 4G9YA 1WSUA 3OIOA 2PLYA 1A5JA 4DGWB 2XGEA 1OR7C 4BE1A 2K86A 2M30A 3I59B 4MEXF 4CCLA 3JAMZ 4HBLA 4XSZF 3HG9A 4AVPA 4A3DJ 5D4RA 2L7ZA 1D5YA 1A31A 2F2EA 1I27A 4KNYA 3SZPA 2R7OA 1FZPB 1P9QC 4NDLA 2KIFA 2EJRA 2L54A 3I5UA 3OYMA 1MW7A 4XR6A 1SFKA 5H20A 2Z9OA 2WAQA 5FKMA 5IOZA 4BDYA 4OWRB 1Z7LA 5EZGA 1U9OA 1B4AA 5L3CA 1Z9CA 5FRNA 4RAFA 1TQMA 2Y2ZA 1XGNA 4R8HA 4XOPA 1Z1DA 2W48A 3RKQA 3NWTA 3IP4B 3RYPA 3CMEI 3V42A 3EUHA 1O4XA 4KT6A 2LD5A 4EJUA 1QZYA 2CU7A 5IT9Z 4XLHA 4BEHA 1U8RA 4P9FA 5HVQC 2L9SA 3K4LA 4LIVA 4AUXA 2G7HA 3HOSA 2KLOA 4KN4X 1JKRC 2M4KA 3E5QA 3CCJI 1MMAA 1YJ9I 1GXQA 1YG2A 1J5YA 2ADUA 2E7WA 2FMYA 4DZPA 4XRSA 3BZKA 2CGPA 3HB9A 3GVAA 3BTJA 2VUMJ 3E5UA 2J5OA 2VL8A 5D8LB 4ESBA 4M3DA 3CCLI 1MMSA 3IL2A 4OIOF 3QPLA 2MLGA 1RKTA 1XS9A 1MBGA 3ZRGA 2VIXA 4V2GA 1KGSA 4MLOA 2K40A 5L3EA 3WGIA 3HKZA 3IWZA 2IVMA 3EUAA 5TGTA 3OYJA 1JT6A 4CICA 2LNBA 4M6VA 2VT3A 5FLMJ 1G2HA 3E97A 3OIPA 2FJ1A 3ZQIA 3CZ6A 1BA5A 2LOOA 3Q3SA 1Z05A 4ZZLA 2CYYA 4A3FJ 1X3UA 4IF4A 4IQJA 3B73A 2F5VA 2NRAC 4XONA 1O3RA 1ZGJA 2DOAA 2R7FA 4E70A 3S93A 4BKXA 1R49A 2PI0A 2KP6A 4WX9A 2XHKA 2EB7A 4PJNA 1FBQA 1RR8C 3DPUA 1AKHA 4W97A 2HTJA 3WE2A 5K7HA 4UUVA 2IGNA 1QZEA 2HYGD 5F64A 3WG9A 1ETWA 1HLVA 3W2WA 1P7IA 3HOUJ 1OCCH 1VI0A 2HGCA 3C7JA 3SQNA 5FGMA 2NS0A 3K1PA 1U78A 4YFXF 1A35A 2QVOA 1PVEA 2JK3A 2EH3A 2MGQA 3ESWB 1ZLJA 1UMQA 4LD5A 3DU6A 3F22A 2CV1A 1L0OC 3GTOJ 1F1ZA 1IUFA 3LSGA 4BU2A 1OKRA 3S1MJ 3F8FA 1S72I 2R92J 1CQTA 1K4TA 3CJSB 2ME0A 4CUGA 5E1ZB 4H0EA 2BY0A 1IN4A 1G3SA 2BVMA 2RKHA 4BJ6C 3JRCA 4LG3A 1RIOH 3ZR8X 2VODA 1XD7A 3C1DA 4B09A 4OAZA 2UV1A 2FUG2 2WTEA 1KU7A 3W2VA 2IS1A 3CDLA 3PNTA 1UHWA 4P55A 5DD4A 2QSHX 3EUKL 5CPRB 2W57A 2QKLB 1NK3P 2KRCA 2ME6A 3VYSB 4EMSA 4C3JJ 1S29A 2XKPA 5HLHA 4B8XA 3DEWA 5H6QA 3JAMK 1F4KA 3I9V2 2EILH 2IPQX 1X19A 2Q2EB 5KCMA 4XKWA 1U5TB 5DDGA 1KU9A 4HV6A 3HOZJ 1Z3YA 3VODA 2EA2A 2M34A 1JUPA 1Z77A 2BOLA 1XGMA 1LE8B 4BHBA 2MC3A 3BJOA 1R71A 2VPLA 3FHNA 3OYHA 2R93J 4YIIA 3AL0C 2E1MC 3I64A 4NQWB 4I2OA 2K3FA 1Y1WJ 4A3MJ 4HRIA 1KQ8A 3V8JA 3TOBA 2BYVE 2NOJB 1Z3XA 2BXZA 2VXDA 2JWTA 4HG2A 5KK1A 5L3DA 3R6SA 2V26A 2CW8A 1BIBA 2XIGA 4XIDA 1YQAA 3GTKJ 5IT9K 2ZJRF 2HQRA 5IP6A 1EV7A 3AG4H 2E5NA 4R1HA 3VSKA 4WF2A 3JR9A 4G7HF 1TLHB 2HKXA 1R6RA 1TT0A 5D5UB 5M5WJ 3M3YJ 2HZTA 4HSRA 4BXFA 2GLOA 4WK8F 2GAUA 3TP3A 2RREA 2Y69H 2Q0OA 2L7KA 1NG7A 2DK5A 1AWCA 2M3AA 2ZNYA 3V8LA 5C4JJ 3V7CA 2NVQJ 4B43A 5HDNA 1QZZA 4EM0B 3AFHA 2F5EA 4LGWA 5EGOA 3CJQB 4A3GJ 1FOYA 3H1CA 4L9VA 1VQ6I 3J7AY 1GDTA 1ZN2A 4KITB 3A0BC 1V55H 3BZ6A 4AIDA 2WB1N 1F9NA 1DU0A 2HOEA 3NWSA 1WFXA 1WI3A 2FQ4A 4C2UA 3WTSC 2VASA 4XLEA 5DM6F 1S5LC 1K79A 1DUXC 2ELJA 2EFPA 2Y31A 1FBUA 3U2RA 2NVXJ 1VQ8I 3QQAA 1SAXA 1UJ8A 2DMQA 3DP7A 5LGTA 2CUJA 3G4SI 4NHJA 1FP2A 1SVOA 1IDYA 2NAZA 3TOAA 1ITYA 2CQKA 3GZNB 1TQPA 3IWFA 4XNFA 1ON1A 2NNNA 1HKTA 1I6XA 2ZXJA 3BDDA 1IRXA 3VYTB 1FIPA 4I02A 2RVCA 1TNSA 1Y39A 1QBJA 2ID3A 5M3FJ 2CJJA 2Z5UA 4XN0A 3ULQB 4QWQA 1OYIA 3ZOBA 1OCTC 3MKZA 2XROA 3WU2C 2BEOA 2V9VA 4EJTA 4D5FA 3OOUA 2QF7A 3R0JA 4KMUX 2UUZA 4FASD 1SEUA 1R22A 1P4WA 3CCVI 3AAFA 4KN7X 3GFJA 3V4GA 4IVNA 3FHZA 2PEXA 4XM3A 1DP3A 3K4KA 1ETXA 4HLXA 3ZCOA 2E2HJ 3TGNA 4M73A 5GAGJ 2YX4A 3T5XA 5FROA 4UVBA 2L5QA 3WTTC 3TO9A 2L0KA 4CCJA 3WHBA 2PN6A 2AQEA 2QYOA 2LTPA 2HEOA 2JPBA 1HSJA 2LBFA 2STWA 5TISC 4HAMA 4AIJA 2MYSA 4V19K 2BW3A 1OYWA 1SVLA 1IV8A 2TRTA 2Z1DA 2R5ZA 4D5CA 9ANTA 1STZA 3RSNA 5GTIC 5K5OA 4PFOA 3HSEA 3MZHA 2JVHA 5EDNA 1U8BA 1ZQ3P 1LPQA 2A68F 4G7OF 2OU2A 3LWFA 3MWMA 1SMTA 1IRZA 1Y0NA 2BY3A 1G3TA 1D8KA 2MH9A 3GTQJ 2VLAA 2OUMA 4HNTA 4BQNA 1QHHD 4MIMA 1IRGA 2OQRA 3E1SA 3DU5A 1RETA 5E18F 3HUGB 5CVUA 5IT3A 3QRFF 1YO5C 4HYEA 1YRNB 4XL9A 1E0EA 1R4NB 4YELA 3COAC 2O3FA 3OYNA 4MTDA 2W85A 2QZ8A 4FISA 1C0WA 3KEOA 2XKOA 3ABMH 3IKTA 3C2BA 2PJRB 2VJ5A 5BMZA 4F93B 3CDHA 1J59A 3RKYA 3L2WA 1TW2A 4EJVA 4Y7NJ 1D5VA 3H5RA 2HPIA 4GFBA 4JOMA 4CZZA 3N4MA 4MO7A 3S2WA 2V1XA 1YS7A 5J8CA 5D5VB 1FT9A 2DMTA 1ZG3A 3J7YJ 3ONQA 2L9VA 2X51A 4D0PA 4ENKA 3BG3A 4H4KC 4I09A 1JTYA 1EF4A 3RKXA 5JLWA 3LL7A 3OYKA 1ON2A 1YE9A 3MKYB 4EJOA 2EQRA 2W82A 4MNUA 4M9SA 3W3CA 1OMIA 2X9DA 3LSMA 3QYEA 5DS9A 2XSJC 3JRHA 4J01A 3TQNA 2XRNA 2BXYA 1FBSA 4DBQA 2JA5J 4RGRA 1EH7A 4NC7A 1VQ4I 4LB5A 3FXRA 3NARA 2KHMA 1B9NA 4ZC3A 1X3WB 3CC7I 1WJAA 2HDDA 2IBDA 2MH2A 2WAFA 2A69F 4JBAA 3MFKA 3F9KA 2QLZA 1OCOH 2VQCA 3FISA 3LMMA 4ESJA 2DA7A 4F91B 3K2AA 3CO6C 3ASOH 2BY1A 3QP5A 1OISA 3BWGA 2BGCA 3PM1A 4RGSA 3OS0A 2DTRA 2RAEA 2ZJQF 1X58A 4RS8A 1IRFA 1X1DA 2XAQA 2IGMA 3S3OA 3OYGA 2E1CA 4RAGA 3HPHA 1MIJA 3O3KA 3SYTA 2XRLA 1TC3C 3ML6A 4UB6C 3JSPA 2H94A 2DA2A 3FKIJ 4M3GA 4U0WA 5IOYA 3D5SC 4ZDPA 3H9QA 4XICA 4BJ5C 1MDMA 1QU3A 1YX3A 2MA3A 2GIZA 5DCMB 4IPAA 1A36A 3X2QH 3HSRA 3JCUC 1T98A 1HKQA 3DBRB 4KA4A 1UELB 4ABZA 5D4SA 4F7ZA 1BOBA 1XC5A 3H9GA 1JJ6C 6PAXA 1YHQI 1F36A 2TDXA 4O5VA 1SMYF 5IP9J 1T95A 2KT0A 2FOWA 1H8AC 1OQYA 2Z3YA 3Q0WA 4HOBA 1QQIA 2X0LA 1T56A 1MGTA 1OCZH 1U5TC 2JTVA 3EDPA 4XKBA 1XDUA 1AU7A 2FBHA 3GMEA 2KDOA 3GEZA 3CESA 2VT2A 3F3XA 4UUSB 3FM5A 1YI2I 3ZMUA 3MKWB 2HQNA 2F48A 1FOKA 3E5XA 1XDSA 5BOXA 1ACIA 5AONA 5IYBJ 1SVMA 3HBLA 3S2HJ 3I0TA 4M9XA 4IXAA 5CKTA 2LKPA 3ECHA 3AL0B 2MD0A 2ZXIA 2VBXA 3QOEA 2IS4A 1IJWC 4OMYA 2ZMEB 2Q1ZB 2KFDA 4BAYA 3JRDA 2DXIA 3CCSI 1NK2P 1ETYA 1BR4A 2G9WA 2D1VA 3HSFA 2L4AA 4G94A 3JRIA 1R9TJ 2NOGA 4IHXA 2N8GA 5F0CA 1ETKA 3F6VA 3TW6A 2Y0SA 1OR7A 5GPAA 2PFBA 2MBFA 4IEJA 3H0DA 2HTSA 4DQ2A 2QEXI 2XAUA 2DO7A 4ESFA 1DGWY 1S8NA 3QODA 3RYRA 3KYCB 1YX5A 1MJ9A 2HOAA 4MTEA 2P5LC 1I5ZA 1SD6A 4HX8A 2R3SA 4HA8A 1TP4A 1LDJA 4BBRJ 5BS6A 5L3GA 1XTAA 1ZHFA 4Y4RA 4XRSG 1U2WA 3FMRA 4JP0A 3EQLF 1YLFA 3CCRI 1G6NA 1CF7A 4XRMA 2K9MA 2M1BA 1YITI 4L0YB 4U87A 4BE2A 2H6BA 1B59A 2COBA 2R5YB 4PSXA 3OY9A 2IW5A 3IKVA 4IRHA 3OWTA 3L2UA 3KX2A 5EYRA 4BGDA 1NTCA 1TNTA 2W1OA 4P9UA 2FX0A 2X6WA 2NS8A 1VQNI 3HL2A 1K78B 3SDGA 3IH2A 5J1YA 1BIAA 2DW4A 4GYGA 2LKSA 5CQGA 2VKDA 1GVJA 1S7OA 1G8XA 4IX7A 2D2WA 4M3EA 2CFXA 2UXXA 1R5ID 4LG0B 4D7NA 4II2A 2RQPA 1HBXG 5FLXZ 4G6TB 1E3OC 4D1QA 4IRGA 1WCMJ 4GXOA 4XLPF 1MMDA 1PUFB 2IXSA 2R7WA 1HW2A 1OLTA 2K02A 2WA0A 3W6JB 5FD6A 5LLQA 1B72B 2VPRA 2E36A 3LSJA 5DUIA 1W5TA 3GUDA 3GFIA 1L3LA 2AXTC 4B1RA 3T8RA 2D45A 4TV7A 2A61A 4YFKF 1S3JA 3K1NA 2A07F 1TZLA 2DMUA 2M87A 2UXNA 1YIJI 2Y75A 2IP2A 5B66C 2HYFA 3E6DA 3BPVA 3WU1B 3ZQLA 1UFMA 4CCMA 3FX3A 1TBXA 5IYCJ 3DTEA 3L00A 3MZYA 1P4AA 2Y30A 3HHHA 3F0CA 1B8IA 2DLLA 1UHSA 2I10A 2ZC2A 5B1BH 1GUUA 5FRMA 3ROUA 5LHGA 2E2IJ 5E3LA 2LF8A 2V79A 3CUQB 2HXIA 4PJ0C 2BV6A 3U1KA 5GPCA 5JVTA 1HF0A 4ZDLA 3OYCA 4ANJA 2KIUA 3CP8A 2GZWA 2EIJH 1VNDA 3G1OA 1W0UA 2BVLA 2ZJ2A 4RB0A 3MKLA 5EZHA 2X6XA 2WC2A 4B44A 2EZIA 4XQFA 3BR0A 5IY5H 4IRIA 1SFEA 2VJ4A 3KZIC 5K1YA 4MEYF 4A12A 2ZFWA 2QQ8A 3J7ZI 3EYYA 2P5KA 3J80Z 3CC4I 3NEUA 3HYIA 2ZO4A 4RA2A 3LSPA 3OYEA 3R0AA 1LFBA 1D0ZA 1T0FC 3LFKA 1LB2A 2XPUA 4ITVA 2O03A 2XGCA 3WG7H 1X2NA 1SFUA 2B63J 1K4SA 3PUBA 4E7JA 1DPRA 3HC7A 3S16J 3JRFA 4A3JJ 4AU7A 5LEJA 2H8RA 4D7MA 5HNFA 3F23A 2JA8J 2I8DA 3RQIA 3HRTA 5D5XB 4IKFA 4A3LJ 1J09A 2FRHA 1ZG1A 4FTHA 2CS3A 1J2XA 1QRYA 3LSKA 1IN7A 2E35A 3GFLA 2H1KA 1UG0A 1XMXA 3A01A 4BXXJ 1E17A 3S32A 3QU6A 3BR2A 4PJMA 2GOXB 1JKPC 1EH8A 1W7PB 5EEAA 4U0YA 3FMSA 1I1GA 1R1TA 2M45A 1PUEE 2HYJA 4M6YA 3V8KA 2VOOA 3F8CA 1YW7A 4M74A 2JT1A 2DT5A 2H1LA 1DP7P 2E5ZA 2K7LA 4NUBA 1OPCA 2Z33A 1V5GA 2P6SA 1X1CA 4CZCA 4E7LA 1J75A 5EG0B 4B3AA 4PFPA 3IV5A 4HEA2 5FLXK 1N78A 2L7MP 3S3NA 3CCEI 4A93J 2RN7A 4RLFA 1X4PA 3ZN0A 3BPXA 4B3XA 2AXLA 3MCZA 2VJIA 3SFIA 1J9IA 3PNVA 2EV6A 2NXNB 3QPHA 1K83J 5LGUA 1VQPI 2EK5A 2K9LA 5DM7F 2V1NA 1JHFA 3SEQA 2A5YB 3KP3A 1JE8A 4C2TA 2OBPA 2BHZA 3G73A 4XRFA 1D1CA 2CSOA 3PSFA 3KZYA 5KAFC 4X0GA 3K70D 2PMZN 4MFDA 1YOVB 3KP5A 1FSHA 2CRGA 4RAYA 3RJPA 4L5IA 4Z6YA 3ERMA 2DCEA 5FJ8J 3OYIA 3K4NA 4IOAF 3GTMJ 1LEBA 5BPDA 2X1DA 4XORA 3UNGC 3EUHC 3SZGA 3E6MA 3F6OA 1ZK8A 4CYCA 2CG4A 1PYVA 4X1EA 2ZBKA 1MNDA 1Q1HA 4KJZA 2QBYB 1TQIA 1ZGAA 1VQKI 1IG7A 1W0TA 2XASA 2DA3A 4UUTA 2XV4S 2H8WA 1TWGJ 2DDBA 1ZH5A 2AQFA 2XVCA 3GZ5A 2VE9A 1T08B 2FBIA 3KFWX 5KNLA 1HA8A 2QM3A 4XOTA 2ETHA 5JVGF 2ZMEC 5EF6A 1MNEA 3EGVB 2FNAA 2WY7Q 4UVAA 3DPTA 4I98B 1B9MA 3WODF 2BE5F 3G1MA 2V9PA 3J80K 5D5WB 3WTWC 3FMQA 1HCRA 1SC7A 1IV6A 3CMYA 1IZ1A 2ID6A 2QGUA 3GBGA 3DKYA 3QYFA 2MD5A 5LRRA 3I59A 4RMNA 5LHHA 3IRQA 1V54H 3S17J 2W24A 2D1HA 4M9ZA 2DA5A 1W7PD 3BLYA 4CSWA 5HS9A 5ICEA 2K85A 5J6XA 4PJLA 1FTTA 3H92A 3M8JA 2JN6A 5FFXA 3K10A 1MMNA 2HPMA 5D6EA 5J4VA 1WVRA 1G4DA 2WWYA 1D3YA 2FF4A 1MZBA 3RPQA 2XDVA 1I6HJ 4BNCA 3H36A 2H09A 4G8XA 2WB1A 4FT8A 5K5QA 4CGZA 1HSTA 1Z6TA 3LAJA 4KISA 4EGZA 1X1BA 3DLAA 1UB9A 4IL6C 2ISYA 3KLNA 5B1AH 5LRSA 5GAEJ 1A6IA 1SD7A 2K4BA 4AYBN 2OAZA 1TWCJ 4L9JA 1UHMA 2YSRA 2LY9A 4PJJA 4RLQA 3PL8A 3TDUC 4G6QA 1K6YA 1S7AA 2K9SA 1BI1A 1LQ1A 5EJCA 3GTGJ 3WE3A 3MVPA 2HWVA 3H35A 3EPZA 2DFIA 2DK8A 1ZR4A 2DOFA 2DQLA 1AOYA 1ZKGA 4I6ZA 3WTVC 3K9TA 2F4OB 3QPSA 2CV2A 2YS9A 4IHTA 3GYHX 5C4XJ 3WTXC 3BJAA 2LFBA 3A02A 3RPUD 2PQ8A 2ICWG 2P81A 4DYCA 2HOSA 4A3CJ 2R7SA 1WKMA 4QPOA 3I54A 4YIRX 4EATA 4HPQA 4HDVA 1LFPA 4M3BA 4YFNF 5J47A 3JTHA 1YYVA 2O8XA 1QPMA 4IHYA 2X6OA 1RR7A 3GF2A 2X48A 3ELKA 4GGGA 1WJBA 2LREA 2VB6A 3RTRA 1AHDP 4KIBA 5E3NA 3ZP5A 2HI3A 3AG1H 1APLC 3VDXA 3M8EA 1MBKA 3GZ6A 1X1AA 4P96A 3DEEA 1FMVA 3FBNB 3O6BB 4Q47A 5LFAA 4DJAA 3R60A 3I55I 4Y17A 3CCQI 3OMYA 2EIKH 5K7FA 3K4JA 2CQNA 2E71A 3FXUA 3ZQHA 1JHHA 2MSYA 3CUOA 1LVKA 1SD5A 3M1CA 2RQQA 4CH7A 4FQGA 4M6XA 1QHGA 2JSPA 5HS8A 2PBIA 5AIPA 2R7VA 3OV8A 2GBYA 3GLLA 2KPMA 3KYDB 4ETSA 1B6AA 2V4JC 3CUQC 3M07A 2IGOA 1MBJA 4UXNA 5FD5A 5F1JA 1N25A 2E7XA 1FLIA 4L5EA 4OIQF 4PCQA 3IAS2 3K70C 4UB8C 3FXLA 3GTPJ 3BCBA 3NAUA 2HDCA 3OR1C 1K7AA 2LMDA 4MGRA 1WH7A 3BG7A 3ZQ7A 3WU0A 4I7HA 4PGGA 2WADA 3I3LA 2VQGA 3A0HC 1P2FA 3ZMVA 2YR2A 3ZQCA 2HZDA 1P4XA 3FK7A 3ERED 2EFNA 1XSDA 1HDDC 2P7VB 4KFCA 2B0LA 2PMHA 2B7EA 1ZRFA 2K4JA 4KT5C 1DQUA 2M4GA 4F3QA 1B1BA 2LC2A 2VQHA 1USSA 1VQOI 2Q2EA 1Z21A 4Z2YA 1JKQC 2VQLA 1U5TA 1J0RA 2YUSA 3ZQQA 2L02A 3I58A 2CMPA 3K0LA 4RDUA 3ZMZA 1O7FA 2O61A 3BP8A 2F6CA 1XMAA 3LSHA 1D0YA 1X3ZB 3BOQA 3SHFA 3F8MA 1EA3A 5CVIA 4ZZDA 4LK0F 1LE8A 4ZTJA 3VSLA 3FIWA 3MQ0A 1MBFA 4HW0A 2XB5A 5M5XJ 2G0EA 2VJJA 4NQWA 4OMZA 1BW6A 2IJLA 4N4NB 4ZJZA 2KL4A 2L7FP 5JI6A 5L3BA 3IC7A 1BI2A 4UHTA 4KUMA 5FKLA 1JXSA 5DUKA 1OJLA 1T6SA 1YTYA 1FYMA 4BE0A 4Q48A 1R5HA 2Z16A 3CF2A 1F43A 2FEZA 1KONA 2WV1A 4ZH4F 2YX7A 2WV0A 4I0BA 1VTNC 1OYYA 2L01A 4U7DA 4NNJA 3B6CA 2LF7A 3R4KA 4OOIA 2ESNA 3HOWJ 2M7BA 4D9JA 3PNYA 3P9CA 1BW5A 5ERIA 2Y9ZA 3HEFA 4CHUA 3LSRA 3PFIA 1IC8A 1S7EA 1XSVA 2FXAA 4ZYEA 2W4SA 3QPTA 4GO1A 2K9NA 4L5JA 4QTRA 2E1OA 4OIRF 3GXOA 2LY1A 1UAAA 2IAIA 2LY2A 4JQFA 1MKMA 1HC8A 3DWLE 3HDDA 2LH9A 2YU3A 1ZG5A 3T1BA 3AG3H 4K2EA 1YFHA 1RUOA 1Z7UA 2HVSA 2V1UA 1JI8A 2R7XA 5KVRA 2D5VA 3GCMA 2DFFA 4LOCA 3RIRA 2H27A 4ZYGA 4HDUA 3BR1A 3OYFA 2CH0A 3LFUA 3OS2A 5HLTA 2P8TA 1LJ9A 4YG2F 4I01A 1MSEC 4Q5SF 3WHCA 1SD4A 3K4CA 3JREA 3HRSA 3O2PE 1RKWA 4JX5A 4ZTFA 1IUYA 5FFZA 2GA2A 2IT0A 4FE4A 5EEGA 5K7ZA 3EETA 4RB2C 4HQMA 5IP7J 3K4BA 3KPHA 1FPQA 3E3VA 3FF5A 2DT7B 3SFZA 4DYQA 5B5EC 4BY1J 3CTAA 3RCOA 3M7GA 4W1UA 3B6AA 2B9SA 1BOAA 1VQLI 2HFHA 4CCNA 3PO3J 4BEHB 3VB2A 4U88A 4LIUA 2P6TA 1FEXA 1JTXA 2MG4A 2ECCA 4A5MA 4F55A 1IF1A 2CUZA 3RKWA 1ZRCA 1V5FA 3SXYA 1SANA 3H3UA 1FX7A 2OF7A 4UVCA 4BL0B 2E1NA 1WGXA 1KYZA 2DTZA 2OPTA 4ENJA 2ZB9A 2ISZA 2RC4A 3KP4A 5K5RA 1XPXA 2W25A 2DFHA 5E1XA 2CO5A 3S3MA 2NVTJ 2STTA 2OCEA 1Q1VA 5HLGA 2LG4A 1H9GA 1R00A 2L9NA 2GA1A 3N97A 1YS6A 3ZGKA 3HPGA 2QA4I 2VKVA 4LK1F 1KU2A 3KLOA 2X85A 4KICA 1ETQA 1N77A 5IYDJ 3BJ6A 1WZ2A 4P1WA 4CCOA 1BR2A 1TWFJ 3CJRB 5ILVA 1MH3A 3ABTA 2R7UA 4EQQA 2ZJPF 1T39A 3CC2I 3BT9A 2K3PA 4EM1A 2M8EA 4O6JA 2IA0A 2E60A 4PSWA 3JRBA 4IZZA 3OSGA 3M1EA 1GV2A 2KIMA 2ZNZA 4YRVA 1AKHB 4U0VA 4ENMA 3WTYC 3UR3C 1WPKA 3ZMTA 3QWLA 5IPAA 4DZJA 4OIPF 1XG1A 3ISPA 2KDZA 5E8IA 2K9QA 3HUGA 2PMUA 4M71A 1YRNA 3MMYB 1YIOA 1S9HA 3JW4A 4I76A 1J7KA 1T0FA 4PK4A 1OCPA 5FB2A 1XB4A 4M72A 3S1RJ 1W36D 2JMWA 4LLGF 2PJRA 4WXDA 5GTHC 5E1WA 3S1QJ 3O8GA 2HU9A 1G3WA 1Z0XA 2DMPA 5A2QK 3H3ZA 3TKYA 4C30A 3DF8A 4N4OB 4BQAA 1IDZA 3RQ4A 2A6TA 4HNVA 1R36A 3OYAA 3H3VK 3L9FA 3GW2A 5F0FA 5E8GA 2PJPA 2DA6A 4E6KG 2LP0A 4IQ4A 2IA2A 3CMMA 1ULYA 3ZMDA 4NBQA 4DNCA 3ASNH 5FKNA 4C3IJ 3L2QA 2F5DA 1IGNA 3L2VA 4MHGA 3BQZA 3K7AJ 3TBIA 5F04A 1JJ8C 3BC8A 4AD9A 3CO7C 1H89C 1KA8A 2MLKA 1IN6A 3DBHB 4HX4A 2L9RA 3I4PA 3QP6A 3HGGA 4KIFA 2CV0A 2DA1A 2R7QA 3Q0UA 1GHCA 2V7FA 2FD5A 3HJEA 4G6DA 1FTZA 5J8FA 1ZYRF 3QAHA 1GV5A 3KEQA 1I1SA 2X4HA 1O7LA 3DKWA 3Q9SA 3HGYA 4WCGA 3BTCA 1QPIA 1LVAA 2A6HF 2COMA 3SDBA 3ZN1A 5F08A 1Y8QB 2R0QC 1O3TA 2JA6J 4N9IA 2GIVA 4XKCA 3OL4A 4BUPA 2DI3A 2F4IA 4Y3OA 4BACA 4RB3C 1H9TA 2GOMA 4BYYA 5HLIA 2KZVA 4KDPA 2KKOA 3MAJA 3FDYA 3NQOA 4XK4A 4A0XA 3A4CA 4FX4A 2A6EF 2IRFG 4N9HA 2KRHA 4XBFA 2IGKA 4F92B 1HW1A 2A5WA 5DCMA 2VI6A 1R1UA 1BBYA 3L2CA 4A2UA 4ZYDA 2VBWA 2E2JJ 2HDWA 3S8PA 3CCMI 2M0MA 3WTUC 4C9YA 1V5EA 5EGOB 3FWEA 2QENA 4M3FA 3L09A 1JGSA 2VBZA 1GXPA 2O9LA 2WAQN 3ZXSA 2KRFA 2FBKA 1BM9A 1IAWA 1XMKA 2EBIA 3BQYA 4RBOA 2DJNA 2MABA 2ZFUA 3ZQFA 5HODA 2O6GE 5JFRA 2KIQA 2PG4A 4UUSA 1WJCA 2DODA 2O8KA 1W5SA 5F27A 4IOCF 2LSOA 5FO5A 1Y6IA 3PQJA 2GWRA 1YW9A 1O57A 1LDKB 1R7JA 4KMFA 3FXJA 2R7TA 2EPFA 3T8TA 2R7DA 2CW0F 1ERDA 4JYKA 5CQEA 2EFQA 2XGDA 3VYUB 2XB0X 1QVUA 3IHUA 4YEJA 1VZ0A 1TW3A 5F0HA 1WQ2A 2ZMEA 3LAPA 5J1RA 3DEUA 4F52A 1KU3A 2G7UA 5JLXA 4BJTA 3GX4X 4J19A 4A3EJ 3A03A 3DFGA 2DN0A 4BS9A 2JJ7A 1DGRM 2GXBA 1JUMA 1HKSA 3ABKH 2DMNA 3BG9A 3F8BA 4BY7J 3TL4X 3J7AO 3KZZA 3CJNA 4EGYA 3ABUA 2IS2A 5LBQA 4QSHA 2EWNA 4KIGA 3HKZN 1VQ7I 1D8JA 1W4MA 3JRAA 2X1CA 5DTDA 1MBHA 3M4OJ 2L4MA 1QNTA 1TL8A 5E79C 2A3SA 2CUFA 4A3KJ 3RZOJ 1A6QA 3FZVA 5JHUA 1WWXA 2EZKA 2Z2SB 1LNWA 3TEDA 2ECBA 5LHIA 2HQAA 2P7CB 1RI7A 1XCBA 4LITA 3FXMA 1WRJA 1OFCX 1RC9A 4RM2A 4IHVA 1BC8C 1M1EB 2LBFB 2W84A 4NC8A 5BPIA 1IN8A 3OL3A 1MMGA 4Q4ZF 1VFCA 2BW3B 2R5YA 1W36C 3PO2J 3DTKA 2R5ZB 1HQCA 2XF5A 3FXOA 2HS5A 2OTJI 1T38A 1D0XA 1WH5A 3BG5A 2NYXA 2XAGA 3SZTA 5C44J 2Z99A 2PMZA 2FSWA 4EVIA 2HOTA 4IJAA 1K78A 1ZTRA 2Q8KA 4CYDA 4GCVA 2DBBA 3UKGA 3LQQA 3MD2A 2YPRA 4HNUA 1ZAOA 1E2XA 3HTSB 2W7NA 1G59A 3D5RC 4LG0A 4HX7A 2DFEA 3HRMA 3G71I 3F21A 3W6VA 4AIKA 2EFWA 1ODDA 1LFUP 3CCYA 1IW7F 2XAFA 3HOXJ 3QU3A 3IH4A 2H6CA 2XF6A 4V2FA 2EIMH 5FKKA 3CQZJ 3BROA 1PUFA 4LLNA 1XCVA 3LA7A 1K6OA 2P0WA 2Y48A 1R5GA 1USTA 4A0ZA 3DKXA 1JUSA 1B72A 4BH9A 4AIHA 3IUOA 2BHYA 1VQ9I 4S04A 4RB1A 4L9TA 3VPRA 2HVQA 2E34A 3LOCA 3M9AA 1GT0C 2VC0A 3E6BA 2E19A 1U3EM 2IEKA 1EJ9A 2Y9YA 2O7OA 3P9KA 1DPUA 4DIQA 4BDZA 3KETA 2FOKA 4EJWA 3OIQA 3Q9VA 2ELKA 3VFZA 1GLNA 2ELHA 1EKEA 1NH3A 3ZMSA 3K2ZA 4AC0A 2R7ZJ 4Y52J 3CJTB 5LD2C 3LQRA 5HNHA 1I50J 1WJFA 1PP7U 4KYWA 2Y0MA 3OYDA 1I3QJ 5GADJ 3KP2A 4MQ9F 2GM4A 3O8HA 4B47A 2KMUA 2EZHA 3F72A 1WJEA 1O3SA 2FE3A 4WXHA 3CUQA 4HV5A 4XLAA 4GYIA 3QOPA 1X2MA 5ED4A 1YJWI 3R61A 3OYBA 3CP2A 5EEHA 1V4RA 3PUFA 4FHTA 3C2GA 3BCAA 5E20A 1P92A 1MBEA 2DU9A 1HDPA 1E3HA 4S05A 3TP0A 4ZYHA 3IRRA 4DOZA 3TDZC 4AYBA 3G1LA 3A1YA 2XPVA 2QQ9A 2ZKZA 1ZARA 3F8NA 3HM5A 3D0SA 3HTUA 5F6FA 1T2KA 2ACJA 4PUSA 3V7RA 1JGGA 5TJJA 2JRMA 3FXKA 2P5VA 3KEYA 1XX5A 4Y33A 2FU4A 3B02A 4B48A 2QSFX 2JZYA 3ZQGA 3GLXA 2O5RA 3PJRA 1SFXA 4O3MA 4BHPA 1BI0A 3L1PA 4FE7A 3DV8A 4XLFA 4UY8I 3WGGA 2VE8A 5ICGA 4CA0A 1KQ9A 2DYSH 2CQQA 3C3WA 2EINH 3WGHA 1MDMB 1XSXA 3FKJA 5AIQA 3S1NJ 5H2FC 1UG2A 3H5AA 3U9GA 2DYRH 2HR3A 1FC3A 2CFOA 3W6KB 2F5CA 1RNLA 2VKHA 1LEAA 2QSGX 1MH4A 1XGOA 3L7WA 3PIPF 5GAHJ 2ZSHB 2RNGA 1FSEA 5M5YJ 2QQAA 2EV0A 5E17F 1N75A 4HLYA 2JA2A 1W7PA 2BBYA 1ETOA 2XF7A 1E3PA 5GP9A 2XSDC 2JSCA 4OAYA 1KZHA 1ORKA 2DT6A 1MJAA 4A0YA 4B4CA 2XC7A 1Y56A 1OCRH 3GO5A 3GWZA 3TO6A 2VN2A 3AKZA 2IS6A 1IXRC 2KJCA 4FETA 4CXFA 4Y13A 2X6YA 4HZFA 3E0JB 2OQGA 5EG0A 2CWEA 2VONA 1F5TA 2LK2A 2WY8Q 2FNPA 5L3FA 1FNNA 3DPLC 4HF2A 1QGPA 4IO9F 1ZRDA 1X1PA 3ECOA 4EEFG 1QA6A 3E7LA 1FY7A 1XGSA 3WTZA 1IXCA 2LKXA 3TW7A 4CDGA 5E3MA 4G12A 2I5UA 2OJED 3HOYJ 1CGPA 3A2KA 2P4WA 2X1EA 5J40A 4PGHA 3FXQA 2DQRA 5ILSA 4II3A 3D1NI 1RRJA 5DYMA 3PSIA 1P6RA 3N05A 3P7NA 1HOMA 2QCOA 1AA7A 5H6RA 5DCFA 2MFZA 2DAOA 1REPC 2BZTA 3RPUA 4BHCA 2FMLA 1T8IA 1JKOC 1CF7B 3SEZA 1O3QA 1RUNA 2VKEA 5J1UA 5D6FA 2LRDA 1ZELA 5CVRA 5TRDA 2LYCA 4UV8A 4PZJA 2M5WA 4E4HA 2QKMB 1UZCA 4A6DA 4RAZA 1T33A 1LUJB 3M8FA 2C6YA 3H0GJ 4WXCA 4ZYAA 2EV5A 1VF9A 3OR2C 4XMYA 3Q0VA 3SJMA 2QBYA 2FA5A 3U21A 4QPQA 2HXOA 3VYRB 3I4NJ 4IHWA 5E3OA 3E6CC 2KQRA 1X4OA 1HW5A 4C3HJ 3CF5F 5C3EJ 1FWZA 4RGXA 3FM3A 4C2MJ 2V9KA 4CO8A 1Z91A 3HRUA 2LR8A 4I99C 4RGUA 3OS1A 1GVDA 2BY2A 1S6LA 3I53A 4HF1A 3CD6I 2K5CA 1DU6A 2HNHA 1FP1D 1FOXA 1V3FA 2LLKA 1MD0A 2GXGA 3J81Z 3GTJJ 4HQEA 3H9JA 4E7IA 2XAHA 3T0YA 3OOPA 1ZR2A 3DBLB 1BJAA 3BR3A 1Y0UA 1MSFC 4JX6A 1IN5A 2RV8A 3AG2H 2TCTA 3DCFA 1RESA 2M9HA 1DDNA 5CJ9A 1ONVA 3K69A 4UV9A 3IH3A 5BQTA 1TT5B 1Z67A 2CUEA 1H0MA 3QYBA 3C18A 2VXZA 5A2QZ 3JRGA 3MN2A 1TWHJ 1G3YA 1U6GA 2NS7A 4IHSA 4BXUA 3P9IA 5J4YA 1I3AA 1KYWA 3CMAI 1K61A 1ENHA 2EZLA 2JRTA 2QWWA 4AWXB 3HHGA 2GXAA 1WJ5A 2YU9J 3LSTA 2RNJA 4ON0A 2HQ5A 4EV0A 5F1RA 1MJBA 2R4GA 2L2OA 5CYVA 1WJDA 1FMWA 1D1BA 3I71A 4XKVA 4E7SA 3RZDJ 1R4MB 2F5FA 2ESHA 1QVTA 4RM3A 3Q5FA 4PDKA 1B8IB 1WI9A 4AVZA 2CQXA 2O0YA 5HS7A 5J3LA 2KISA 3KCCA 3IAM2 4E7KA 4WWCA 2DJIA 4ZDOA 2OV7A 3RDIA 2KZGA 2A05A 4FX0A 2V6EA 5D8KB 3MEXA 3FBIB 5M3MJ 1FYLA 1H88C 3REOA 1KQ0A 4S0HB 1QO0D 3G2BA 3KYLA 4A3BJ 2CQ7A 3LA2A 2JQ7A 3OSFA 2DA4A 3BY6A 4BQOA 1VQ5I 4NC6A 2OZ6A 1BR1A 5CVVA 3GFMA 4DYRA 3JSOA 1ZGWA 1RPWA 3TO7A 1BJZA 3DQVC 3VOEA 2AS5F 5ICFA 2ZXHA 4BBSJ 2JPCA 2ZXWH 2HKOA 5FKOA 5ICCA 5HOOA 2ZSIB 3JTGA 4L9NA 2QQBA 1A04A 3BR6A 5KHDA 3CLOA 4GRIA 2AO9A 4G7ZF 3S14J 4MFEA 4P5OA 3HXLA 2K27A 2NVYJ 1FJLA 2LDUA 2XUBA 2DDAA 5CLSA 2OA4A 1ZLKA 4XSXF 4EM2A 2OD5A 2NVUB 3U1DA 4ENNA 3GTLJ 3D5LA 4OINF 2EFOA 3LSIA 4LMYA 2JUCA 3HOTA 3RI4A 5HDKA 3BG6A 2E1MB 5DD8A 1U9NA 3A01B 2GQQA 4E7HA 4A3IJ 5FLVA 1IO2A 2M0CA 1R1VA 5JHFA 2IA1A 3PFYA 4L0ZB 3CDIA 2DOEA 1U0JA 2WBMA 3ABLH 3P5JA 2AHQA 2RGVA 1FIAA 4N0BA 2XGXA 3CCUI 3KP7A 4LJZF 4X6AJ 1IXSB 4JX4A 3HZJA 4R79A 3VEPA 4A69C 1YW8A 1HXDA 1FOWA 2ZCWA 3BZCA 3FK6A 5HDGA 2XAJA 2Y0SN 2UWMA 3ZPLA 1ETVA 4UNOA 3MZ8A 3KP6A 1TTYA 2VOPA 2WAEA 2V6CA 2MC4A 4BQQA 4CCKA 2M7AA 2W00A 4NB5A 5DEQA 3NRVA 3K1MA 4AM3A 2QUFA 1POGA 1D1AA 5LEKA 2HVRA 4QLCU 3J81K 1MNMC 3V7SA 1W5CC 2UZKA 1BN5A 3KE2A 2RDPA 1Z6RA 5CVJA 4U7BA 1FYKA 1Y1VJ 3S15J 5BNGA 3LA3A 3KIOA 4OU0A 4E7ZA 3LNQA 3TMOA 1W1WE 4XN3A 4XLNF 1SFOJ 2MW8A 2XPWA 4A6EA 4QIWN 5LGNA 1TWAJ 3PIOF 1YJNI 3PQKA 3HOVJ 2JA7J 1WHUA 2F4MB 2R7RA 4HF0A 1VQMI 2OCCH 1NHAA 4LB6B 2VC1A 1JT0A 3VWBA 1R58A 4LLLA 1BI3A 2V1DA 2M8GX 3I4MJ 4JK1X 1ZREA 4ASNA 5B3SH 4FCYA 1LDDA 1I39A 2KJBA 4GDFA 3DTIA 1PP8F 1SAUA 2FQ3A 4L18B 4Y15A 2EA4A 2OC6A 1XN7A 4I0AA 4LFUA 3BTIA 2OZUA 4A5NA 4DBRA 4MQVA 4CYCB 1LKXA 1PDNC 4DW6A 3OYLA 5ILUA 1BL0A
chains in the Genus database with same CATH topology
1VQKI 4UY8I 1VQNI 3CJRB 2H8WA 2ZJPF 2OTLI 3CC2I 3CF5F 3DLLF 3I55I 3CCQI 5JVGF 1WIBA 3EGVB 3CCMI 3CD6I 3G6EI 3I56I 1YHQI 2E35A 3G71I 1HC8A 3CJQB 1FOYA 3PIPF 5GAHJ 1FOXA 1VQ6I 2FOWA 3CCUI 1YI2I 2E36A 5DM6F 4IOCF 1FOWA 1S72I 1VQ9I 3CJSB 1ACIA 1VQ8I 2E34A 3G4SI 3J7YJ 3CMAI 3CCSI 4IO9F 3CCEI 1YIJI 1QA6A 3CJTB 3CMEI 1Y39A 5GAEJ 5GADJ 1VQLI 2NXNB 1VQOI 2QEXI 1VQPI 5DM7F 3PIOF 1YJWI 1YJNI 1VQ4I 1VQ7I 3CCJI 1VQMI 1YJ9I 3CC7I 3CCVI 3CCLI 2JQ7A 1MMSA 5GAGJ 1VQ5I 3CCRI 2K3FA 1YITI 3J7ZI 3CC4I 4IOAF 4V19K 2ZJQF 2ZJRF 2QA4I 2OTJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK I;  4UY8 I;  1VQN I;  3CJR B;  2H8W A;  2ZJP F;  2OTL I;  3CC2 I;  3CF5 F;  3DLL F;  3I55 I;  3CCQ I;  5JVG F;  1WIB A;  3EGV B;  3CCM I;  3CD6 I;  3G6E I;  3I56 I;  1YHQ I;  2E35 A;  3G71 I;  1HC8 A;  3CJQ B;  1FOY A;  3PIP F;  5GAH J;  1FOX A;  1VQ6 I;  2FOW A;  3CCU I;  1YI2 I;  2E36 A;  5DM6 F;  4IOC F;  1FOW A;  1S72 I;  1VQ9 I;  3CJS B;  1ACI A;  1VQ8 I;  2E34 A;  3G4S I;  3J7Y J;  3CMA I;  3CCS I;  4IO9 F;  3CCE I;  1YIJ I;  1QA6 A;  3CJT B;  3CME I;  1Y39 A;  5GAE J;  5GAD J;  1VQL I;  2NXN B;  1VQO I;  2QEX I;  1VQP I;  5DM7 F;  3PIO F;  1YJW I;  1YJN I;  1VQ4 I;  1VQ7 I;  3CCJ I;  1VQM I;  1YJ9 I;  3CC7 I;  3CCV I;  3CCL I;  2JQ7 A;  1MMS A;  5GAG J;  1VQ5 I;  3CCR I;  2K3F A;  1YIT I;  3J7Z I;  3CC4 I;  4IOA F;  4V19 K;  2ZJQ F;  2ZJR F;  2QA4 I;  2OTJ I; 
#chains in the Genus database with same CATH topology
 2DPD A;  3K4M A;  2L3D A;  3C2H A;  1NG6 A;  2NNY A;  4J00 A;  2VBY A;  3H5N A;  3L2R A;  3DXJ F;  2JUG A;  2DPU A;  1R23 A;  3EYI A;  2PX9 A;  1P7J A;  5KAI C;  1PJR A;  4XLC A;  1EH6 A;  3CLQ A;  4HST A;  2OTL I;  3BTL A;  3W2A A;  5DV5 A;  3DLL F;  3HIF A;  2M2E A;  2LVS A;  1RZ4 A;  3S2D J;  3BR5 A;  1UCR A;  3K6G A;  3G3Z A;  1WIB A;  2CW7 A;  5JR3 A;  2J5P A;  3G6E I;  1Y8R B;  3I56 I;  1BC7 C;  2JVG A;  4YIF A;  4G9Y A;  1WSU A;  3OIO A;  2PLY A;  1A5J A;  4DGW B;  2XGE A;  1OR7 C;  4BE1 A;  2K86 A;  2M30 A;  3I59 B;  4MEX F;  4CCL A;  3JAM Z;  4HBL A;  4XSZ F;  3HG9 A;  4AVP A;  4A3D J;  5D4R A;  2L7Z A;  1D5Y A;  1A31 A;  2F2E A;  1I27 A;  4KNY A;  3SZP A;  2R7O A;  1FZP B;  1P9Q C;  4NDL A;  2KIF A;  2EJR A;  2L54 A;  3I5U A;  3OYM A;  1MW7 A;  4XR6 A;  1SFK A;  5H20 A;  2Z9O A;  2WAQ A;  5FKM A;  5IOZ A;  4BDY A;  4OWR B;  1Z7L A;  5EZG A;  1U9O A;  1B4A A;  5L3C A;  1Z9C A;  5FRN A;  4RAF A;  1TQM A;  2Y2Z A;  1XGN A;  4R8H A;  4XOP A;  1Z1D A;  2W48 A;  3RKQ A;  3NWT A;  3IP4 B;  3RYP A;  3CME I;  3V42 A;  3EUH A;  1O4X A;  4KT6 A;  2LD5 A;  4EJU A;  1QZY A;  2CU7 A;  5IT9 Z;  4XLH A;  4BEH A;  1U8R A;  4P9F A;  5HVQ C;  2L9S A;  3K4L A;  4LIV A;  4AUX A;  2G7H A;  3HOS A;  2KLO A;  4KN4 X;  1JKR C;  2M4K A;  3E5Q A;  3CCJ I;  1MMA A;  1YJ9 I;  1GXQ A;  1YG2 A;  1J5Y A;  2ADU A;  2E7W A;  2FMY A;  4DZP A;  4XRS A;  3BZK A;  2CGP A;  3HB9 A;  3GVA A;  3BTJ A;  2VUM J;  3E5U A;  2J5O A;  2VL8 A;  5D8L B;  4ESB A;  4M3D A;  3CCL I;  1MMS A;  3IL2 A;  4OIO F;  3QPL A;  2MLG A;  1RKT A;  1XS9 A;  1MBG A;  3ZRG A;  2VIX A;  4V2G A;  1KGS A;  4MLO A;  2K40 A;  5L3E A;  3WGI A;  3HKZ A;  3IWZ A;  2IVM A;  3EUA A;  5TGT A;  3OYJ A;  1JT6 A;  4CIC A;  2LNB A;  4M6V A;  2VT3 A;  5FLM J;  1G2H A;  3E97 A;  3OIP A;  2FJ1 A;  3ZQI A;  3CZ6 A;  1BA5 A;  2LOO A;  3Q3S A;  1Z05 A;  4ZZL A;  2CYY A;  4A3F J;  1X3U A;  4IF4 A;  4IQJ A;  3B73 A;  2F5V A;  2NRA C;  4XON A;  1O3R A;  1ZGJ A;  2DOA A;  2R7F A;  4E70 A;  3S93 A;  4BKX A;  1R49 A;  2PI0 A;  2KP6 A;  4WX9 A;  2XHK A;  2EB7 A;  4PJN A;  1FBQ A;  1RR8 C;  3DPU A;  1AKH A;  4W97 A;  2HTJ A;  3WE2 A;  5K7H A;  4UUV A;  2IGN A;  1QZE A;  2HYG D;  5F64 A;  3WG9 A;  1ETW A;  1HLV A;  3W2W A;  1P7I A;  3HOU J;  1OCC H;  1VI0 A;  2HGC A;  3C7J A;  3SQN A;  5FGM A;  2NS0 A;  3K1P A;  1U78 A;  4YFX F;  1A35 A;  2QVO A;  1PVE A;  2JK3 A;  2EH3 A;  2MGQ A;  3ESW B;  1ZLJ A;  1UMQ A;  4LD5 A;  3DU6 A;  3F22 A;  2CV1 A;  1L0O C;  3GTO J;  1F1Z A;  1IUF A;  3LSG A;  4BU2 A;  1OKR A;  3S1M J;  3F8F A;  1S72 I;  2R92 J;  1CQT A;  1K4T A;  3CJS B;  2ME0 A;  4CUG A;  5E1Z B;  4H0E A;  2BY0 A;  1IN4 A;  1G3S A;  2BVM A;  2RKH A;  4BJ6 C;  3JRC A;  4LG3 A;  1RIO H;  3ZR8 X;  2VOD A;  1XD7 A;  3C1D A;  4B09 A;  4OAZ A;  2UV1 A;  2FUG 2;  2WTE A;  1KU7 A;  3W2V A;  2IS1 A;  3CDL A;  3PNT A;  1UHW A;  4P55 A;  5DD4 A;  2QSH X;  3EUK L;  5CPR B;  2W57 A;  2QKL B;  1NK3 P;  2KRC A;  2ME6 A;  3VYS B;  4EMS A;  4C3J J;  1S29 A;  2XKP A;  5HLH A;  4B8X A;  3DEW A;  5H6Q A;  3JAM K;  1F4K A;  3I9V 2;  2EIL H;  2IPQ X;  1X19 A;  2Q2E B;  5KCM A;  4XKW A;  1U5T B;  5DDG A;  1KU9 A;  4HV6 A;  3HOZ J;  1Z3Y A;  3VOD A;  2EA2 A;  2M34 A;  1JUP A;  1Z77 A;  2BOL A;  1XGM A;  1LE8 B;  4BHB A;  2MC3 A;  3BJO A;  1R71 A;  2VPL A;  3FHN A;  3OYH A;  2R93 J;  4YII A;  3AL0 C;  2E1M C;  3I64 A;  4NQW B;  4I2O A;  2K3F A;  1Y1W J;  4A3M J;  4HRI A;  1KQ8 A;  3V8J A;  3TOB A;  2BYV E;  2NOJ B;  1Z3X A;  2BXZ A;  2VXD A;  2JWT A;  4HG2 A;  5KK1 A;  5L3D A;  3R6S A;  2V26 A;  2CW8 A;  1BIB A;  2XIG A;  4XID A;  1YQA A;  3GTK J;  5IT9 K;  2ZJR F;  2HQR A;  5IP6 A;  1EV7 A;  3AG4 H;  2E5N A;  4R1H A;  3VSK A;  4WF2 A;  3JR9 A;  4G7H F;  1TLH B;  2HKX A;  1R6R A;  1TT0 A;  5D5U B;  5M5W J;  3M3Y J;  2HZT A;  4HSR A;  4BXF A;  2GLO A;  4WK8 F;  2GAU A;  3TP3 A;  2RRE A;  2Y69 H;  2Q0O A;  2L7K A;  1NG7 A;  2DK5 A;  1AWC A;  2M3A A;  2ZNY A;  3V8L A;  5C4J J;  3V7C A;  2NVQ J;  4B43 A;  5HDN A;  1QZZ A;  4EM0 B;  3AFH A;  2F5E A;  4LGW A;  5EGO A;  3CJQ B;  4A3G J;  1FOY A;  3H1C A;  4L9V A;  1VQ6 I;  3J7A Y;  1GDT A;  1ZN2 A;  4KIT B;  3A0B C;  1V55 H;  3BZ6 A;  4AID A;  2WB1 N;  1F9N A;  1DU0 A;  2HOE A;  3NWS A;  1WFX A;  1WI3 A;  2FQ4 A;  4C2U A;  3WTS C;  2VAS A;  4XLE A;  5DM6 F;  1S5L C;  1K79 A;  1DUX C;  2ELJ A;  2EFP A;  2Y31 A;  1FBU A;  3U2R A;  2NVX J;  1VQ8 I;  3QQA A;  1SAX A;  1UJ8 A;  2DMQ A;  3DP7 A;  5LGT A;  2CUJ A;  3G4S I;  4NHJ A;  1FP2 A;  1SVO A;  1IDY A;  2NAZ A;  3TOA A;  1ITY A;  2CQK A;  3GZN B;  1TQP A;  3IWF A;  4XNF A;  1ON1 A;  2NNN A;  1HKT A;  1I6X A;  2ZXJ A;  3BDD A;  1IRX A;  3VYT B;  1FIP A;  4I02 A;  2RVC A;  1TNS A;  1Y39 A;  1QBJ A;  2ID3 A;  5M3F J;  2CJJ A;  2Z5U A;  4XN0 A;  3ULQ B;  4QWQ A;  1OYI A;  3ZOB A;  1OCT C;  3MKZ A;  2XRO A;  3WU2 C;  2BEO A;  2V9V A;  4EJT A;  4D5F A;  3OOU A;  2QF7 A;  3R0J A;  4KMU X;  2UUZ A;  4FAS D;  1SEU A;  1R22 A;  1P4W A;  3CCV I;  3AAF A;  4KN7 X;  3GFJ A;  3V4G A;  4IVN A;  3FHZ A;  2PEX A;  4XM3 A;  1DP3 A;  3K4K A;  1ETX A;  4HLX A;  3ZCO A;  2E2H J;  3TGN A;  4M73 A;  5GAG J;  2YX4 A;  3T5X A;  5FRO A;  4UVB A;  2L5Q A;  3WTT C;  3TO9 A;  2L0K A;  4CCJ A;  3WHB A;  2PN6 A;  2AQE A;  2QYO A;  2LTP A;  2HEO A;  2JPB A;  1HSJ A;  2LBF A;  2STW A;  5TIS C;  4HAM A;  4AIJ A;  2MYS A;  4V19 K;  2BW3 A;  1OYW A;  1SVL A;  1IV8 A;  2TRT A;  2Z1D A;  2R5Z A;  4D5C A;  9ANT A;  1STZ A;  3RSN A;  5GTI C;  5K5O A;  4PFO A;  3HSE A;  3MZH A;  2JVH A;  5EDN A;  1U8B A;  1ZQ3 P;  1LPQ A;  2A68 F;  4G7O F;  2OU2 A;  3LWF A;  3MWM A;  1SMT A;  1IRZ A;  1Y0N A;  2BY3 A;  1G3T A;  1D8K A;  2MH9 A;  3GTQ J;  2VLA A;  2OUM A;  4HNT A;  4BQN A;  1QHH D;  4MIM A;  1IRG A;  2OQR A;  3E1S A;  3DU5 A;  1RET A;  5E18 F;  3HUG B;  5CVU A;  5IT3 A;  3QRF F;  1YO5 C;  4HYE A;  1YRN B;  4XL9 A;  1E0E A;  1R4N B;  4YEL A;  3COA C;  2O3F A;  3OYN A;  4MTD A;  2W85 A;  2QZ8 A;  4FIS A;  1C0W A;  3KEO A;  2XKO A;  3ABM H;  3IKT A;  3C2B A;  2PJR B;  2VJ5 A;  5BMZ A;  4F93 B;  3CDH A;  1J59 A;  3RKY A;  3L2W A;  1TW2 A;  4EJV A;  4Y7N J;  1D5V A;  3H5R A;  2HPI A;  4GFB A;  4JOM A;  4CZZ A;  3N4M A;  4MO7 A;  3S2W A;  2V1X A;  1YS7 A;  5J8C A;  5D5V B;  1FT9 A;  2DMT A;  1ZG3 A;  3J7Y J;  3ONQ A;  2L9V A;  2X51 A;  4D0P A;  4ENK A;  3BG3 A;  4H4K C;  4I09 A;  1JTY A;  1EF4 A;  3RKX A;  5JLW A;  3LL7 A;  3OYK A;  1ON2 A;  1YE9 A;  3MKY B;  4EJO A;  2EQR A;  2W82 A;  4MNU A;  4M9S A;  3W3C A;  1OMI A;  2X9D A;  3LSM A;  3QYE A;  5DS9 A;  2XSJ C;  3JRH A;  4J01 A;  3TQN A;  2XRN A;  2BXY A;  1FBS A;  4DBQ A;  2JA5 J;  4RGR A;  1EH7 A;  4NC7 A;  1VQ4 I;  4LB5 A;  3FXR A;  3NAR A;  2KHM A;  1B9N A;  4ZC3 A;  1X3W B;  3CC7 I;  1WJA A;  2HDD A;  2IBD A;  2MH2 A;  2WAF A;  2A69 F;  4JBA A;  3MFK A;  3F9K A;  2QLZ A;  1OCO H;  2VQC A;  3FIS A;  3LMM A;  4ESJ A;  2DA7 A;  4F91 B;  3K2A A;  3CO6 C;  3ASO H;  2BY1 A;  3QP5 A;  1OIS A;  3BWG A;  2BGC A;  3PM1 A;  4RGS A;  3OS0 A;  2DTR A;  2RAE A;  2ZJQ F;  1X58 A;  4RS8 A;  1IRF A;  1X1D A;  2XAQ A;  2IGM A;  3S3O A;  3OYG A;  2E1C A;  4RAG A;  3HPH A;  1MIJ A;  3O3K A;  3SYT A;  2XRL A;  1TC3 C;  3ML6 A;  4UB6 C;  3JSP A;  2H94 A;  2DA2 A;  3FKI J;  4M3G A;  4U0W A;  5IOY A;  3D5S C;  4ZDP A;  3H9Q A;  4XIC A;  4BJ5 C;  1MDM A;  1QU3 A;  1YX3 A;  2MA3 A;  2GIZ A;  5DCM B;  4IPA A;  1A36 A;  3X2Q H;  3HSR A;  3JCU C;  1T98 A;  1HKQ A;  3DBR B;  4KA4 A;  1UEL B;  4ABZ A;  5D4S A;  4F7Z A;  1BOB A;  1XC5 A;  3H9G A;  1JJ6 C;  6PAX A;  1YHQ I;  1F36 A;  2TDX A;  4O5V A;  1SMY F;  5IP9 J;  1T95 A;  2KT0 A;  2FOW A;  1H8A C;  1OQY A;  2Z3Y A;  3Q0W A;  4HOB A;  1QQI A;  2X0L A;  1T56 A;  1MGT A;  1OCZ H;  1U5T C;  2JTV A;  3EDP A;  4XKB A;  1XDU A;  1AU7 A;  2FBH A;  3GME A;  2KDO A;  3GEZ A;  3CES A;  2VT2 A;  3F3X A;  4UUS B;  3FM5 A;  1YI2 I;  3ZMU A;  3MKW B;  2HQN A;  2F48 A;  1FOK A;  3E5X A;  1XDS A;  5BOX A;  1ACI A;  5AON A;  5IYB J;  1SVM A;  3HBL A;  3S2H J;  3I0T A;  4M9X A;  4IXA A;  5CKT A;  2LKP A;  3ECH A;  3AL0 B;  2MD0 A;  2ZXI A;  2VBX A;  3QOE A;  2IS4 A;  1IJW C;  4OMY A;  2ZME B;  2Q1Z B;  2KFD A;  4BAY A;  3JRD A;  2DXI A;  3CCS I;  1NK2 P;  1ETY A;  1BR4 A;  2G9W A;  2D1V A;  3HSF A;  2L4A A;  4G94 A;  3JRI A;  1R9T J;  2NOG A;  4IHX A;  2N8G A;  5F0C A;  1ETK A;  3F6V A;  3TW6 A;  2Y0S A;  1OR7 A;  5GPA A;  2PFB A;  2MBF A;  4IEJ A;  3H0D A;  2HTS A;  4DQ2 A;  2QEX I;  2XAU A;  2DO7 A;  4ESF A;  1DGW Y;  1S8N A;  3QOD A;  3RYR A;  3KYC B;  1YX5 A;  1MJ9 A;  2HOA A;  4MTE A;  2P5L C;  1I5Z A;  1SD6 A;  4HX8 A;  2R3S A;  4HA8 A;  1TP4 A;  1LDJ A;  4BBR J;  5BS6 A;  5L3G A;  1XTA A;  1ZHF A;  4Y4R A;  4XRS G;  1U2W A;  3FMR A;  4JP0 A;  3EQL F;  1YLF A;  3CCR I;  1G6N A;  1CF7 A;  4XRM A;  2K9M A;  2M1B A;  1YIT I;  4L0Y B;  4U87 A;  4BE2 A;  2H6B A;  1B59 A;  2COB A;  2R5Y B;  4PSX A;  3OY9 A;  2IW5 A;  3IKV A;  4IRH A;  3OWT A;  3L2U A;  3KX2 A;  5EYR A;  4BGD A;  1NTC A;  1TNT A;  2W1O A;  4P9U A;  2FX0 A;  2X6W A;  2NS8 A;  1VQN I;  3HL2 A;  1K78 B;  3SDG A;  3IH2 A;  5J1Y A;  1BIA A;  2DW4 A;  4GYG A;  2LKS A;  5CQG A;  2VKD A;  1GVJ A;  1S7O A;  1G8X A;  4IX7 A;  2D2W A;  4M3E A;  2CFX A;  2UXX A;  1R5I D;  4LG0 B;  4D7N A;  4II2 A;  2RQP A;  1HBX G;  5FLX Z;  4G6T B;  1E3O C;  4D1Q A;  4IRG A;  1WCM J;  4GXO A;  4XLP F;  1MMD A;  1PUF B;  2IXS A;  2R7W A;  1HW2 A;  1OLT A;  2K02 A;  2WA0 A;  3W6J B;  5FD6 A;  5LLQ A;  1B72 B;  2VPR A;  2E36 A;  3LSJ A;  5DUI A;  1W5T A;  3GUD A;  3GFI A;  1L3L A;  2AXT C;  4B1R A;  3T8R A;  2D45 A;  4TV7 A;  2A61 A;  4YFK F;  1S3J A;  3K1N A;  2A07 F;  1TZL A;  2DMU A;  2M87 A;  2UXN A;  1YIJ I;  2Y75 A;  2IP2 A;  5B66 C;  2HYF A;  3E6D A;  3BPV A;  3WU1 B;  3ZQL A;  1UFM A;  4CCM A;  3FX3 A;  1TBX A;  5IYC J;  3DTE A;  3L00 A;  3MZY A;  1P4A A;  2Y30 A;  3HHH A;  3F0C A;  1B8I A;  2DLL A;  1UHS A;  2I10 A;  2ZC2 A;  5B1B H;  1GUU A;  5FRM A;  3ROU A;  5LHG A;  2E2I J;  5E3L A;  2LF8 A;  2V79 A;  3CUQ B;  2HXI A;  4PJ0 C;  2BV6 A;  3U1K A;  5GPC A;  5JVT A;  1HF0 A;  4ZDL A;  3OYC A;  4ANJ A;  2KIU A;  3CP8 A;  2GZW A;  2EIJ H;  1VND A;  3G1O A;  1W0U A;  2BVL A;  2ZJ2 A;  4RB0 A;  3MKL A;  5EZH A;  2X6X A;  2WC2 A;  4B44 A;  2EZI A;  4XQF A;  3BR0 A;  5IY5 H;  4IRI A;  1SFE A;  2VJ4 A;  3KZI C;  5K1Y A;  4MEY F;  4A12 A;  2ZFW A;  2QQ8 A;  3J7Z I;  3EYY A;  2P5K A;  3J80 Z;  3CC4 I;  3NEU A;  3HYI A;  2ZO4 A;  4RA2 A;  3LSP A;  3OYE A;  3R0A A;  1LFB A;  1D0Z A;  1T0F C;  3LFK A;  1LB2 A;  2XPU A;  4ITV A;  2O03 A;  2XGC A;  3WG7 H;  1X2N A;  1SFU A;  2B63 J;  1K4S A;  3PUB A;  4E7J A;  1DPR A;  3HC7 A;  3S16 J;  3JRF A;  4A3J J;  4AU7 A;  5LEJ A;  2H8R A;  4D7M A;  5HNF A;  3F23 A;  2JA8 J;  2I8D A;  3RQI A;  3HRT A;  5D5X B;  4IKF A;  4A3L J;  1J09 A;  2FRH A;  1ZG1 A;  4FTH A;  2CS3 A;  1J2X A;  1QRY A;  3LSK A;  1IN7 A;  2E35 A;  3GFL A;  2H1K A;  1UG0 A;  1XMX A;  3A01 A;  4BXX J;  1E17 A;  3S32 A;  3QU6 A;  3BR2 A;  4PJM A;  2GOX B;  1JKP C;  1EH8 A;  1W7P B;  5EEA A;  4U0Y A;  3FMS A;  1I1G A;  1R1T A;  2M45 A;  1PUE E;  2HYJ A;  4M6Y A;  3V8K A;  2VOO A;  3F8C A;  1YW7 A;  4M74 A;  2JT1 A;  2DT5 A;  2H1L A;  1DP7 P;  2E5Z A;  2K7L A;  4NUB A;  1OPC A;  2Z33 A;  1V5G A;  2P6S A;  1X1C A;  4CZC A;  4E7L A;  1J75 A;  5EG0 B;  4B3A A;  4PFP A;  3IV5 A;  4HEA 2;  5FLX K;  1N78 A;  2L7M P;  3S3N A;  3CCE I;  4A93 J;  2RN7 A;  4RLF A;  1X4P A;  3ZN0 A;  3BPX A;  4B3X A;  2AXL A;  3MCZ A;  2VJI A;  3SFI A;  1J9I A;  3PNV A;  2EV6 A;  2NXN B;  3QPH A;  1K83 J;  5LGU A;  1VQP I;  2EK5 A;  2K9L A;  5DM7 F;  2V1N A;  1JHF A;  3SEQ A;  2A5Y B;  3KP3 A;  1JE8 A;  4C2T A;  2OBP A;  2BHZ A;  3G73 A;  4XRF A;  1D1C A;  2CSO A;  3PSF A;  3KZY A;  5KAF C;  4X0G A;  3K70 D;  2PMZ N;  4MFD A;  1YOV B;  3KP5 A;  1FSH A;  2CRG A;  4RAY A;  3RJP A;  4L5I A;  4Z6Y A;  3ERM A;  2DCE A;  5FJ8 J;  3OYI A;  3K4N A;  4IOA F;  3GTM J;  1LEB A;  5BPD A;  2X1D A;  4XOR A;  3UNG C;  3EUH C;  3SZG A;  3E6M A;  3F6O A;  1ZK8 A;  4CYC A;  2CG4 A;  1PYV A;  4X1E A;  2ZBK A;  1MND A;  1Q1H A;  4KJZ A;  2QBY B;  1TQI A;  1ZGA A;  1VQK I;  1IG7 A;  1W0T A;  2XAS A;  2DA3 A;  4UUT A;  2XV4 S;  2H8W A;  1TWG J;  2DDB A;  1ZH5 A;  2AQF A;  2XVC A;  3GZ5 A;  2VE9 A;  1T08 B;  2FBI A;  3KFW X;  5KNL A;  1HA8 A;  2QM3 A;  4XOT A;  2ETH A;  5JVG F;  2ZME C;  5EF6 A;  1MNE A;  3EGV B;  2FNA A;  2WY7 Q;  4UVA A;  3DPT A;  4I98 B;  1B9M A;  3WOD F;  2BE5 F;  3G1M A;  2V9P A;  3J80 K;  5D5W B;  3WTW C;  3FMQ A;  1HCR A;  1SC7 A;  1IV6 A;  3CMY A;  1IZ1 A;  2ID6 A;  2QGU A;  3GBG A;  3DKY A;  3QYF A;  2MD5 A;  5LRR A;  3I59 A;  4RMN A;  5LHH A;  3IRQ A;  1V54 H;  3S17 J;  2W24 A;  2D1H A;  4M9Z A;  2DA5 A;  1W7P D;  3BLY A;  4CSW A;  5HS9 A;  5ICE A;  2K85 A;  5J6X A;  4PJL A;  1FTT A;  3H92 A;  3M8J A;  2JN6 A;  5FFX A;  3K10 A;  1MMN A;  2HPM A;  5D6E A;  5J4V A;  1WVR A;  1G4D A;  2WWY A;  1D3Y A;  2FF4 A;  1MZB A;  3RPQ A;  2XDV A;  1I6H J;  4BNC A;  3H36 A;  2H09 A;  4G8X A;  2WB1 A;  4FT8 A;  5K5Q A;  4CGZ A;  1HST A;  1Z6T A;  3LAJ A;  4KIS A;  4EGZ A;  1X1B A;  3DLA A;  1UB9 A;  4IL6 C;  2ISY A;  3KLN A;  5B1A H;  5LRS A;  5GAE J;  1A6I A;  1SD7 A;  2K4B A;  4AYB N;  2OAZ A;  1TWC J;  4L9J A;  1UHM A;  2YSR A;  2LY9 A;  4PJJ A;  4RLQ A;  3PL8 A;  3TDU C;  4G6Q A;  1K6Y A;  1S7A A;  2K9S A;  1BI1 A;  1LQ1 A;  5EJC A;  3GTG J;  3WE3 A;  3MVP A;  2HWV A;  3H35 A;  3EPZ A;  2DFI A;  2DK8 A;  1ZR4 A;  2DOF A;  2DQL A;  1AOY A;  1ZKG A;  4I6Z A;  3WTV C;  3K9T A;  2F4O B;  3QPS A;  2CV2 A;  2YS9 A;  4IHT A;  3GYH X;  5C4X J;  3WTX C;  3BJA A;  2LFB A;  3A02 A;  3RPU D;  2PQ8 A;  2ICW G;  2P81 A;  4DYC A;  2HOS A;  4A3C J;  2R7S A;  1WKM A;  4QPO A;  3I54 A;  4YIR X;  4EAT A;  4HPQ A;  4HDV A;  1LFP A;  4M3B A;  4YFN F;  5J47 A;  3JTH A;  1YYV A;  2O8X A;  1QPM A;  4IHY A;  2X6O A;  1RR7 A;  3GF2 A;  2X48 A;  3ELK A;  4GGG A;  1WJB A;  2LRE A;  2VB6 A;  3RTR A;  1AHD P;  4KIB A;  5E3N A;  3ZP5 A;  2HI3 A;  3AG1 H;  1APL C;  3VDX A;  3M8E A;  1MBK A;  3GZ6 A;  1X1A A;  4P96 A;  3DEE A;  1FMV A;  3FBN B;  3O6B B;  4Q47 A;  5LFA A;  4DJA A;  3R60 A;  3I55 I;  4Y17 A;  3CCQ I;  3OMY A;  2EIK H;  5K7F A;  3K4J A;  2CQN A;  2E71 A;  3FXU A;  3ZQH A;  1JHH A;  2MSY A;  3CUO A;  1LVK A;  1SD5 A;  3M1C A;  2RQQ A;  4CH7 A;  4FQG A;  4M6X A;  1QHG A;  2JSP A;  5HS8 A;  2PBI A;  5AIP A;  2R7V A;  3OV8 A;  2GBY A;  3GLL A;  2KPM A;  3KYD B;  4ETS A;  1B6A A;  2V4J C;  3CUQ C;  3M07 A;  2IGO A;  1MBJ A;  4UXN A;  5FD5 A;  5F1J A;  1N25 A;  2E7X A;  1FLI A;  4L5E A;  4OIQ F;  4PCQ A;  3IAS 2;  3K70 C;  4UB8 C;  3FXL A;  3GTP J;  3BCB A;  3NAU A;  2HDC A;  3OR1 C;  1K7A A;  2LMD A;  4MGR A;  1WH7 A;  3BG7 A;  3ZQ7 A;  3WU0 A;  4I7H A;  4PGG A;  2WAD A;  3I3L A;  2VQG A;  3A0H C;  1P2F A;  3ZMV A;  2YR2 A;  3ZQC A;  2HZD A;  1P4X A;  3FK7 A;  3ERE D;  2EFN A;  1XSD A;  1HDD C;  2P7V B;  4KFC A;  2B0L A;  2PMH A;  2B7E A;  1ZRF A;  2K4J A;  4KT5 C;  1DQU A;  2M4G A;  4F3Q A;  1B1B A;  2LC2 A;  2VQH A;  1USS A;  1VQO I;  2Q2E A;  1Z21 A;  4Z2Y A;  1JKQ C;  2VQL A;  1U5T A;  1J0R A;  2YUS A;  3ZQQ A;  2L02 A;  3I58 A;  2CMP A;  3K0L A;  4RDU A;  3ZMZ A;  1O7F A;  2O61 A;  3BP8 A;  2F6C A;  1XMA A;  3LSH A;  1D0Y A;  1X3Z B;  3BOQ A;  3SHF A;  3F8M A;  1EA3 A;  5CVI A;  4ZZD A;  4LK0 F;  1LE8 A;  4ZTJ A;  3VSL A;  3FIW A;  3MQ0 A;  1MBF A;  4HW0 A;  2XB5 A;  5M5X J;  2G0E A;  2VJJ A;  4NQW A;  4OMZ A;  1BW6 A;  2IJL A;  4N4N B;  4ZJZ A;  2KL4 A;  2L7F P;  5JI6 A;  5L3B A;  3IC7 A;  1BI2 A;  4UHT A;  4KUM A;  5FKL A;  1JXS A;  5DUK A;  1OJL A;  1T6S A;  1YTY A;  1FYM A;  4BE0 A;  4Q48 A;  1R5H A;  2Z16 A;  3CF2 A;  1F43 A;  2FEZ A;  1KON A;  2WV1 A;  4ZH4 F;  2YX7 A;  2WV0 A;  4I0B A;  1VTN C;  1OYY A;  2L01 A;  4U7D A;  4NNJ A;  3B6C A;  2LF7 A;  3R4K A;  4OOI A;  2ESN A;  3HOW J;  2M7B A;  4D9J A;  3PNY A;  3P9C A;  1BW5 A;  5ERI A;  2Y9Z A;  3HEF A;  4CHU A;  3LSR A;  3PFI A;  1IC8 A;  1S7E A;  1XSV A;  2FXA A;  4ZYE A;  2W4S A;  3QPT A;  4GO1 A;  2K9N A;  4L5J A;  4QTR A;  2E1O A;  4OIR F;  3GXO A;  2LY1 A;  1UAA A;  2IAI A;  2LY2 A;  4JQF A;  1MKM A;  1HC8 A;  3DWL E;  3HDD A;  2LH9 A;  2YU3 A;  1ZG5 A;  3T1B A;  3AG3 H;  4K2E A;  1YFH A;  1RUO A;  1Z7U A;  2HVS A;  2V1U A;  1JI8 A;  2R7X A;  5KVR A;  2D5V A;  3GCM A;  2DFF A;  4LOC A;  3RIR A;  2H27 A;  4ZYG A;  4HDU A;  3BR1 A;  3OYF A;  2CH0 A;  3LFU A;  3OS2 A;  5HLT A;  2P8T A;  1LJ9 A;  4YG2 F;  4I01 A;  1MSE C;  4Q5S F;  3WHC A;  1SD4 A;  3K4C A;  3JRE A;  3HRS A;  3O2P E;  1RKW A;  4JX5 A;  4ZTF A;  1IUY A;  5FFZ A;  2GA2 A;  2IT0 A;  4FE4 A;  5EEG A;  5K7Z A;  3EET A;  4RB2 C;  4HQM A;  5IP7 J;  3K4B A;  3KPH A;  1FPQ A;  3E3V A;  3FF5 A;  2DT7 B;  3SFZ A;  4DYQ A;  5B5E C;  4BY1 J;  3CTA A;  3RCO A;  3M7G A;  4W1U A;  3B6A A;  2B9S A;  1BOA A;  1VQL I;  2HFH A;  4CCN A;  3PO3 J;  4BEH B;  3VB2 A;  4U88 A;  4LIU A;  2P6T A;  1FEX A;  1JTX A;  2MG4 A;  2ECC A;  4A5M A;  4F55 A;  1IF1 A;  2CUZ A;  3RKW A;  1ZRC A;  1V5F A;  3SXY A;  1SAN A;  3H3U A;  1FX7 A;  2OF7 A;  4UVC A;  4BL0 B;  2E1N A;  1WGX A;  1KYZ A;  2DTZ A;  2OPT A;  4ENJ A;  2ZB9 A;  2ISZ A;  2RC4 A;  3KP4 A;  5K5R A;  1XPX A;  2W25 A;  2DFH A;  5E1X A;  2CO5 A;  3S3M A;  2NVT J;  2STT A;  2OCE A;  1Q1V A;  5HLG A;  2LG4 A;  1H9G A;  1R00 A;  2L9N A;  2GA1 A;  3N97 A;  1YS6 A;  3ZGK A;  3HPG A;  2QA4 I;  2VKV A;  4LK1 F;  1KU2 A;  3KLO A;  2X85 A;  4KIC A;  1ETQ A;  1N77 A;  5IYD J;  3BJ6 A;  1WZ2 A;  4P1W A;  4CCO A;  1BR2 A;  1TWF J;  3CJR B;  5ILV A;  1MH3 A;  3ABT A;  2R7U A;  4EQQ A;  2ZJP F;  1T39 A;  3CC2 I;  3BT9 A;  2K3P A;  4EM1 A;  2M8E A;  4O6J A;  2IA0 A;  2E60 A;  4PSW A;  3JRB A;  4IZZ A;  3OSG A;  3M1E A;  1GV2 A;  2KIM A;  2ZNZ A;  4YRV A;  1AKH B;  4U0V A;  4ENM A;  3WTY C;  3UR3 C;  1WPK A;  3ZMT A;  3QWL A;  5IPA A;  4DZJ A;  4OIP F;  1XG1 A;  3ISP A;  2KDZ A;  5E8I A;  2K9Q A;  3HUG A;  2PMU A;  4M71 A;  1YRN A;  3MMY B;  1YIO A;  1S9H A;  3JW4 A;  4I76 A;  1J7K A;  1T0F A;  4PK4 A;  1OCP A;  5FB2 A;  1XB4 A;  4M72 A;  3S1R J;  1W36 D;  2JMW A;  4LLG F;  2PJR A;  4WXD A;  5GTH C;  5E1W A;  3S1Q J;  3O8G A;  2HU9 A;  1G3W A;  1Z0X A;  2DMP A;  5A2Q K;  3H3Z A;  3TKY A;  4C30 A;  3DF8 A;  4N4O B;  4BQA A;  1IDZ A;  3RQ4 A;  2A6T A;  4HNV A;  1R36 A;  3OYA A;  3H3V K;  3L9F A;  3GW2 A;  5F0F A;  5E8G A;  2PJP A;  2DA6 A;  4E6K G;  2LP0 A;  4IQ4 A;  2IA2 A;  3CMM A;  1ULY A;  3ZMD A;  4NBQ A;  4DNC A;  3ASN H;  5FKN A;  4C3I J;  3L2Q A;  2F5D A;  1IGN A;  3L2V A;  4MHG A;  3BQZ A;  3K7A J;  3TBI A;  5F04 A;  1JJ8 C;  3BC8 A;  4AD9 A;  3CO7 C;  1H89 C;  1KA8 A;  2MLK A;  1IN6 A;  3DBH B;  4HX4 A;  2L9R A;  3I4P A;  3QP6 A;  3HGG A;  4KIF A;  2CV0 A;  2DA1 A;  2R7Q A;  3Q0U A;  1GHC A;  2V7F A;  2FD5 A;  3HJE A;  4G6D A;  1FTZ A;  5J8F A;  1ZYR F;  3QAH A;  1GV5 A;  3KEQ A;  1I1S A;  2X4H A;  1O7L A;  3DKW A;  3Q9S A;  3HGY A;  4WCG A;  3BTC A;  1QPI A;  1LVA A;  2A6H F;  2COM A;  3SDB A;  3ZN1 A;  5F08 A;  1Y8Q B;  2R0Q C;  1O3T A;  2JA6 J;  4N9I A;  2GIV A;  4XKC A;  3OL4 A;  4BUP A;  2DI3 A;  2F4I A;  4Y3O A;  4BAC A;  4RB3 C;  1H9T A;  2GOM A;  4BYY A;  5HLI A;  2KZV A;  4KDP A;  2KKO A;  3MAJ A;  3FDY A;  3NQO A;  4XK4 A;  4A0X A;  3A4C A;  4FX4 A;  2A6E F;  2IRF G;  4N9H A;  2KRH A;  4XBF A;  2IGK A;  4F92 B;  1HW1 A;  2A5W A;  5DCM A;  2VI6 A;  1R1U A;  1BBY A;  3L2C A;  4A2U A;  4ZYD A;  2VBW A;  2E2J J;  2HDW A;  3S8P A;  3CCM I;  2M0M A;  3WTU C;  4C9Y A;  1V5E A;  5EGO B;  3FWE A;  2QEN A;  4M3F A;  3L09 A;  1JGS A;  2VBZ A;  1GXP A;  2O9L A;  2WAQ N;  3ZXS A;  2KRF A;  2FBK A;  1BM9 A;  1IAW A;  1XMK A;  2EBI A;  3BQY A;  4RBO A;  2DJN A;  2MAB A;  2ZFU A;  3ZQF A;  5HOD A;  2O6G E;  5JFR A;  2KIQ A;  2PG4 A;  4UUS A;  1WJC A;  2DOD A;  2O8K A;  1W5S A;  5F27 A;  4IOC F;  2LSO A;  5FO5 A;  1Y6I A;  3PQJ A;  2GWR A;  1YW9 A;  1O57 A;  1LDK B;  1R7J A;  4KMF A;  3FXJ A;  2R7T A;  2EPF A;  3T8T A;  2R7D A;  2CW0 F;  1ERD A;  4JYK A;  5CQE A;  2EFQ A;  2XGD A;  3VYU B;  2XB0 X;  1QVU A;  3IHU A;  4YEJ A;  1VZ0 A;  1TW3 A;  5F0H A;  1WQ2 A;  2ZME A;  3LAP A;  5J1R A;  3DEU A;  4F52 A;  1KU3 A;  2G7U A;  5JLX A;  4BJT A;  3GX4 X;  4J19 A;  4A3E J;  3A03 A;  3DFG A;  2DN0 A;  4BS9 A;  2JJ7 A;  1DGR M;  2GXB A;  1JUM A;  1HKS A;  3ABK H;  2DMN A;  3BG9 A;  3F8B A;  4BY7 J;  3TL4 X;  3J7A O;  3KZZ A;  3CJN A;  4EGY A;  3ABU A;  2IS2 A;  5LBQ A;  4QSH A;  2EWN A;  4KIG A;  3HKZ N;  1VQ7 I;  1D8J A;  1W4M A;  3JRA A;  2X1C A;  5DTD A;  1MBH A;  3M4O J;  2L4M A;  1QNT A;  1TL8 A;  5E79 C;  2A3S A;  2CUF A;  4A3K J;  3RZO J;  1A6Q A;  3FZV A;  5JHU A;  1WWX A;  2EZK A;  2Z2S B;  1LNW A;  3TED A;  2ECB A;  5LHI A;  2HQA A;  2P7C B;  1RI7 A;  1XCB A;  4LIT A;  3FXM A;  1WRJ A;  1OFC X;  1RC9 A;  4RM2 A;  4IHV A;  1BC8 C;  1M1E B;  2LBF B;  2W84 A;  4NC8 A;  5BPI A;  1IN8 A;  3OL3 A;  1MMG A;  4Q4Z F;  1VFC A;  2BW3 B;  2R5Y A;  1W36 C;  3PO2 J;  3DTK A;  2R5Z B;  1HQC A;  2XF5 A;  3FXO A;  2HS5 A;  2OTJ I;  1T38 A;  1D0X A;  1WH5 A;  3BG5 A;  2NYX A;  2XAG A;  3SZT A;  5C44 J;  2Z99 A;  2PMZ A;  2FSW A;  4EVI A;  2HOT A;  4IJA A;  1K78 A;  1ZTR A;  2Q8K A;  4CYD A;  4GCV A;  2DBB A;  3UKG A;  3LQQ A;  3MD2 A;  2YPR A;  4HNU A;  1ZAO A;  1E2X A;  3HTS B;  2W7N A;  1G59 A;  3D5R C;  4LG0 A;  4HX7 A;  2DFE A;  3HRM A;  3G71 I;  3F21 A;  3W6V A;  4AIK A;  2EFW A;  1ODD A;  1LFU P;  3CCY A;  1IW7 F;  2XAF A;  3HOX J;  3QU3 A;  3IH4 A;  2H6C A;  2XF6 A;  4V2F A;  2EIM H;  5FKK A;  3CQZ J;  3BRO A;  1PUF A;  4LLN A;  1XCV A;  3LA7 A;  1K6O A;  2P0W A;  2Y48 A;  1R5G A;  1UST A;  4A0Z A;  3DKX A;  1JUS A;  1B72 A;  4BH9 A;  4AIH A;  3IUO A;  2BHY A;  1VQ9 I;  4S04 A;  4RB1 A;  4L9T A;  3VPR A;  2HVQ A;  2E34 A;  3LOC A;  3M9A A;  1GT0 C;  2VC0 A;  3E6B A;  2E19 A;  1U3E M;  2IEK A;  1EJ9 A;  2Y9Y A;  2O7O A;  3P9K A;  1DPU A;  4DIQ A;  4BDZ A;  3KET A;  2FOK A;  4EJW A;  3OIQ A;  3Q9V A;  2ELK A;  3VFZ A;  1GLN A;  2ELH A;  1EKE A;  1NH3 A;  3ZMS A;  3K2Z A;  4AC0 A;  2R7Z J;  4Y52 J;  3CJT B;  5LD2 C;  3LQR A;  5HNH A;  1I50 J;  1WJF A;  1PP7 U;  4KYW A;  2Y0M A;  3OYD A;  1I3Q J;  5GAD J;  3KP2 A;  4MQ9 F;  2GM4 A;  3O8H A;  4B47 A;  2KMU A;  2EZH A;  3F72 A;  1WJE A;  1O3S A;  2FE3 A;  4WXH A;  3CUQ A;  4HV5 A;  4XLA A;  4GYI A;  3QOP A;  1X2M A;  5ED4 A;  1YJW I;  3R61 A;  3OYB A;  3CP2 A;  5EEH A;  1V4R A;  3PUF A;  4FHT A;  3C2G A;  3BCA A;  5E20 A;  1P92 A;  1MBE A;  2DU9 A;  1HDP A;  1E3H A;  4S05 A;  3TP0 A;  4ZYH A;  3IRR A;  4DOZ A;  3TDZ C;  4AYB A;  3G1L A;  3A1Y A;  2XPV A;  2QQ9 A;  2ZKZ A;  1ZAR A;  3F8N A;  3HM5 A;  3D0S A;  3HTU A;  5F6F A;  1T2K A;  2ACJ A;  4PUS A;  3V7R A;  1JGG A;  5TJJ A;  2JRM A;  3FXK A;  2P5V A;  3KEY A;  1XX5 A;  4Y33 A;  2FU4 A;  3B02 A;  4B48 A;  2QSF X;  2JZY A;  3ZQG A;  3GLX A;  2O5R A;  3PJR A;  1SFX A;  4O3M A;  4BHP A;  1BI0 A;  3L1P A;  4FE7 A;  3DV8 A;  4XLF A;  4UY8 I;  3WGG A;  2VE8 A;  5ICG A;  4CA0 A;  1KQ9 A;  2DYS H;  2CQQ A;  3C3W A;  2EIN H;  3WGH A;  1MDM B;  1XSX A;  3FKJ A;  5AIQ A;  3S1N J;  5H2F C;  1UG2 A;  3H5A A;  3U9G A;  2DYR H;  2HR3 A;  1FC3 A;  2CFO A;  3W6K B;  2F5C A;  1RNL A;  2VKH A;  1LEA A;  2QSG X;  1MH4 A;  1XGO A;  3L7W A;  3PIP F;  5GAH J;  2ZSH B;  2RNG A;  1FSE A;  5M5Y J;  2QQA A;  2EV0 A;  5E17 F;  1N75 A;  4HLY A;  2JA2 A;  1W7P A;  2BBY A;  1ETO A;  2XF7 A;  1E3P A;  5GP9 A;  2XSD C;  2JSC A;  4OAY A;  1KZH A;  1ORK A;  2DT6 A;  1MJA A;  4A0Y A;  4B4C A;  2XC7 A;  1Y56 A;  1OCR H;  3GO5 A;  3GWZ A;  3TO6 A;  2VN2 A;  3AKZ A;  2IS6 A;  1IXR C;  2KJC A;  4FET A;  4CXF A;  4Y13 A;  2X6Y A;  4HZF A;  3E0J B;  2OQG A;  5EG0 A;  2CWE A;  2VON A;  1F5T A;  2LK2 A;  2WY8 Q;  2FNP A;  5L3F A;  1FNN A;  3DPL C;  4HF2 A;  1QGP A;  4IO9 F;  1ZRD A;  1X1P A;  3ECO A;  4EEF G;  1QA6 A;  3E7L A;  1FY7 A;  1XGS A;  3WTZ A;  1IXC A;  2LKX A;  3TW7 A;  4CDG A;  5E3M A;  4G12 A;  2I5U A;  2OJE D;  3HOY J;  1CGP A;  3A2K A;  2P4W A;  2X1E A;  5J40 A;  4PGH A;  3FXQ A;  2DQR A;  5ILS A;  4II3 A;  3D1N I;  1RRJ A;  5DYM A;  3PSI A;  1P6R A;  3N05 A;  3P7N A;  1HOM A;  2QCO A;  1AA7 A;  5H6R A;  5DCF A;  2MFZ A;  2DAO A;  1REP C;  2BZT A;  3RPU A;  4BHC A;  2FML A;  1T8I A;  1JKO C;  1CF7 B;  3SEZ A;  1O3Q A;  1RUN A;  2VKE A;  5J1U A;  5D6F A;  2LRD A;  1ZEL A;  5CVR A;  5TRD A;  2LYC A;  4UV8 A;  4PZJ A;  2M5W A;  4E4H A;  2QKM B;  1UZC A;  4A6D A;  4RAZ A;  1T33 A;  1LUJ B;  3M8F A;  2C6Y A;  3H0G J;  4WXC A;  4ZYA A;  2EV5 A;  1VF9 A;  3OR2 C;  4XMY A;  3Q0V A;  3SJM A;  2QBY A;  2FA5 A;  3U21 A;  4QPQ A;  2HXO A;  3VYR B;  3I4N J;  4IHW A;  5E3O A;  3E6C C;  2KQR A;  1X4O A;  1HW5 A;  4C3H J;  3CF5 F;  5C3E J;  1FWZ A;  4RGX A;  3FM3 A;  4C2M J;  2V9K A;  4CO8 A;  1Z91 A;  3HRU A;  2LR8 A;  4I99 C;  4RGU A;  3OS1 A;  1GVD A;  2BY2 A;  1S6L A;  3I53 A;  4HF1 A;  3CD6 I;  2K5C A;  1DU6 A;  2HNH A;  1FP1 D;  1FOX A;  1V3F A;  2LLK A;  1MD0 A;  2GXG A;  3J81 Z;  3GTJ J;  4HQE A;  3H9J A;  4E7I A;  2XAH A;  3T0Y A;  3OOP A;  1ZR2 A;  3DBL B;  1BJA A;  3BR3 A;  1Y0U A;  1MSF C;  4JX6 A;  1IN5 A;  2RV8 A;  3AG2 H;  2TCT A;  3DCF A;  1RES A;  2M9H A;  1DDN A;  5CJ9 A;  1ONV A;  3K69 A;  4UV9 A;  3IH3 A;  5BQT A;  1TT5 B;  1Z67 A;  2CUE A;  1H0M A;  3QYB A;  3C18 A;  2VXZ A;  5A2Q Z;  3JRG A;  3MN2 A;  1TWH J;  1G3Y A;  1U6G A;  2NS7 A;  4IHS A;  4BXU A;  3P9I A;  5J4Y A;  1I3A A;  1KYW A;  3CMA I;  1K61 A;  1ENH A;  2EZL A;  2JRT A;  2QWW A;  4AWX B;  3HHG A;  2GXA A;  1WJ5 A;  2YU9 J;  3LST A;  2RNJ A;  4ON0 A;  2HQ5 A;  4EV0 A;  5F1R A;  1MJB A;  2R4G A;  2L2O A;  5CYV A;  1WJD A;  1FMW A;  1D1B A;  3I71 A;  4XKV A;  4E7S A;  3RZD J;  1R4M B;  2F5F A;  2ESH A;  1QVT A;  4RM3 A;  3Q5F A;  4PDK A;  1B8I B;  1WI9 A;  4AVZ A;  2CQX A;  2O0Y A;  5HS7 A;  5J3L A;  2KIS A;  3KCC A;  3IAM 2;  4E7K A;  4WWC A;  2DJI A;  4ZDO A;  2OV7 A;  3RDI A;  2KZG A;  2A05 A;  4FX0 A;  2V6E A;  5D8K B;  3MEX A;  3FBI B;  5M3M J;  1FYL A;  1H88 C;  3REO A;  1KQ0 A;  4S0H B;  1QO0 D;  3G2B A;  3KYL A;  4A3B J;  2CQ7 A;  3LA2 A;  2JQ7 A;  3OSF A;  2DA4 A;  3BY6 A;  4BQO A;  1VQ5 I;  4NC6 A;  2OZ6 A;  1BR1 A;  5CVV A;  3GFM A;  4DYR A;  3JSO A;  1ZGW A;  1RPW A;  3TO7 A;  1BJZ A;  3DQV C;  3VOE A;  2AS5 F;  5ICF A;  2ZXH A;  4BBS J;  2JPC A;  2ZXW H;  2HKO A;  5FKO A;  5ICC A;  5HOO A;  2ZSI B;  3JTG A;  4L9N A;  2QQB A;  1A04 A;  3BR6 A;  5KHD A;  3CLO A;  4GRI A;  2AO9 A;  4G7Z F;  3S14 J;  4MFE A;  4P5O A;  3HXL A;  2K27 A;  2NVY J;  1FJL A;  2LDU A;  2XUB A;  2DDA A;  5CLS A;  2OA4 A;  1ZLK A;  4XSX F;  4EM2 A;  2OD5 A;  2NVU B;  3U1D A;  4ENN A;  3GTL J;  3D5L A;  4OIN F;  2EFO A;  3LSI A;  4LMY A;  2JUC A;  3HOT A;  3RI4 A;  5HDK A;  3BG6 A;  2E1M B;  5DD8 A;  1U9N A;  3A01 B;  2GQQ A;  4E7H A;  4A3I J;  5FLV A;  1IO2 A;  2M0C A;  1R1V A;  5JHF A;  2IA1 A;  3PFY A;  4L0Z B;  3CDI A;  2DOE A;  1U0J A;  2WBM A;  3ABL H;  3P5J A;  2AHQ A;  2RGV A;  1FIA A;  4N0B A;  2XGX A;  3CCU I;  3KP7 A;  4LJZ F;  4X6A J;  1IXS B;  4JX4 A;  3HZJ A;  4R79 A;  3VEP A;  4A69 C;  1YW8 A;  1HXD A;  1FOW A;  2ZCW A;  3BZC A;  3FK6 A;  5HDG A;  2XAJ A;  2Y0S N;  2UWM A;  3ZPL A;  1ETV A;  4UNO A;  3MZ8 A;  3KP6 A;  1TTY A;  2VOP A;  2WAE A;  2V6C A;  2MC4 A;  4BQQ A;  4CCK A;  2M7A A;  2W00 A;  4NB5 A;  5DEQ A;  3NRV A;  3K1M A;  4AM3 A;  2QUF A;  1POG A;  1D1A A;  5LEK A;  2HVR A;  4QLC U;  3J81 K;  1MNM C;  3V7S A;  1W5C C;  2UZK A;  1BN5 A;  3KE2 A;  2RDP A;  1Z6R A;  5CVJ A;  4U7B A;  1FYK A;  1Y1V J;  3S15 J;  5BNG A;  3LA3 A;  3KIO A;  4OU0 A;  4E7Z A;  3LNQ A;  3TMO A;  1W1W E;  4XN3 A;  4XLN F;  1SFO J;  2MW8 A;  2XPW A;  4A6E A;  4QIW N;  5LGN A;  1TWA J;  3PIO F;  1YJN I;  3PQK A;  3HOV J;  2JA7 J;  1WHU A;  2F4M B;  2R7R A;  4HF0 A;  1VQM I;  2OCC H;  1NHA A;  4LB6 B;  2VC1 A;  1JT0 A;  3VWB A;  1R58 A;  4LLL A;  1BI3 A;  2V1D A;  2M8G X;  3I4M J;  4JK1 X;  1ZRE A;  4ASN A;  5B3S H;  4FCY A;  1LDD A;  1I39 A;  2KJB A;  4GDF A;  3DTI A;  1PP8 F;  1SAU A;  2FQ3 A;  4L18 B;  4Y15 A;  2EA4 A;  2OC6 A;  1XN7 A;  4I0A A;  4LFU A;  3BTI A;  2OZU A;  4A5N A;  4DBR A;  4MQV A;  4CYC B;  1LKX A;  1PDN C;  4DW6 A;  3OYL A;  5ILU A;  1BL0 A; 
#chains in the Genus database with same CATH homology
 1VQK I;  4UY8 I;  1VQN I;  3CJR B;  2H8W A;  2ZJP F;  2OTL I;  3CC2 I;  3CF5 F;  3DLL F;  3I55 I;  3CCQ I;  5JVG F;  1WIB A;  3EGV B;  3CCM I;  3CD6 I;  3G6E I;  3I56 I;  1YHQ I;  2E35 A;  3G71 I;  1HC8 A;  3CJQ B;  1FOY A;  3PIP F;  5GAH J;  1FOX A;  1VQ6 I;  2FOW A;  3CCU I;  1YI2 I;  2E36 A;  5DM6 F;  4IOC F;  1FOW A;  1S72 I;  1VQ9 I;  3CJS B;  1ACI A;  1VQ8 I;  2E34 A;  3G4S I;  3J7Y J;  3CMA I;  3CCS I;  4IO9 F;  3CCE I;  1YIJ I;  1QA6 A;  3CJT B;  3CME I;  1Y39 A;  5GAE J;  5GAD J;  1VQL I;  2NXN B;  1VQO I;  2QEX I;  1VQP I;  5DM7 F;  3PIO F;  1YJW I;  1YJN I;  1VQ4 I;  1VQ7 I;  3CCJ I;  1VQM I;  1YJ9 I;  3CC7 I;  3CCV I;  3CCL I;  2JQ7 A;  1MMS A;  5GAG J;  1VQ5 I;  3CCR I;  2K3F A;  1YIT I;  3J7Z I;  3CC4 I;  4IOA F;  4V19 K;  2ZJQ F;  2ZJR F;  2QA4 I;  2OTJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...