1MMSA

Crystal structure of the ribosomal protein l11-rna complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title A detailed view of a ribosomal active site: the structure of the L11-RNA complex.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Ribosome
total genus 32
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1mmsA02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 1mmsA01
3CJSB 1FOYA 5DM7F 2ZJPF 2H8WA 2K3FA 3I56I 5GADJ 4IOCF 3CC4I 3CCMI 4IOAF 1VQLI 3CD6I 1FOWA 3CCUI 3CC7I 5GAEJ 3CF5F 3DLLF 5DM6F 1Y39A 3J7ZI 3PIOF 3CJRB 3CCSI 3J7YJ 3I55I 2E36A 1VQ8I 1ACIA 1VQNI 1VQ5I 3CCEI 3G4SI 1YHQI 1VQ7I 3CCQI 1VQ6I 3CCLI 1YJWI 5GAGJ 2JQ7A 3PIPF 1QA6A 3CMEI 3EGVB 3CJTB 3CMAI 1VQPI 3CCRI 2FOWA 2QA4I 1VQ9I 2OTLI 3G6EI 1YIJI 4UY8I 1HC8A 1WIBA 3CC2I 5GAHJ 4V19K 2E35A 3G71I 1YITI 1VQMI 1YI2I 2QEXI 1VQOI 5JVGF 1VQ4I 2E34A 1YJNI 2ZJRF 1YJ9I 2ZJQF 3CCJI 3CCVI 4IO9F 2NXNB 1S72I 1VQKI 1FOXA 2OTJI 3CJQB 1MMSA
chains in the Genus database with same CATH superfamily
3H3UA 3R4KA 2W82A 1ZR2A 3PSIA 2A69F 4RAFA 3RZOJ 2D1VA 4XRSA 4A0XA 5TISC 2X6XA 1A04A 3F8NA 4KN4X 4IL6C 1G59A 1R36A 2P8TA 2EK5A 3J80K 1FLIA 2AO9A 1SANA 4QWQA 1FYKA 2F4MB 2VC0A 2F5FA 2DMUA 1E17A 2M30A 4G94A 2LFBA 1MMAA 5LHHA 3ABLH 3OYCA 2KQRA 2M87A 3FMRA 3CJNA 1K78A 2R7VA 3S2WA 1MBEA 2HFHA 2P4WA 1MZBA 2DODA 4XN3A 3PUFA 2XIGA 3CESA 1HF0A 3I5UA 1ORKA 2CFXA 1G3TA 3FWEA 4OMYA 3I4NJ 2V6CA 2GOXB 1BI2A 2O3FA 3V4GA 1K78B 4ENMA 4OMZA 1SVOA 3HUGA 3GVAA 4CYCB 2PJPA 5E8IA 1YQAA 3IKTA 2XGXA 2H09A 3HIFA 3W2AA 2KIMA 3PNYA 1C0WA 1T0FC 5F1RA 1B9NA 2HEOA 4XK4A 1BN5A 4EMSA 4TV7A 1R5ID 4Z2YA 2YR2A 3LSHA 4U7BA 2KIUA 3E97A 1XDSA 2ZB9A 2X4HA 3S8PA 2XAGA 5L3GA 3FHNA 1K61A 1Z7UA 3BCAA 4HAMA 1LJ9A 4P9FA 3MKZA 1FTZA 3MD2A 4A3MJ 2X6WA 5GTHC 1MNDA 2EB7A 4M3DA 2K4BA 4XMYA 3FXOA 3OS2A 3GTMJ 2CRGA 3CP2A 1T2KA 1BL0A 4L9NA 2OQRA 4ZDPA 1E3HA 5FRNA 4BXUA 3AG1H 2I10A 3K1NA 3HOZJ 2N8GA 2NYXA 5M3FJ 2O8KA 3DKWA 5L3BA 3ZP5A 4N4OB 3F8BA 1TC3C 1U8RA 3FXMA 3CJQB 2BE5F 2W48A 5LGNA 2Z16A 2FQ4A 3KP3A 3ABTA 4UVBA 5LHGA 2HPMA 4GO1A 1V55H 3CJSB 3L7WA 3FBIB 4JP0A 2DA6A 2W84A 3ZQCA 3K7AJ 2WAQA 2K3FA 2FMLA 1A36A 4A3GJ 1X3ZB 3P9CA 3GTKJ 2D2WA 2KZGA 3DTEA 5JLWA 1R49A 1ZHFA 4R1HA 2LP0A 3H9GA 3LSIA 3K4CA 1VQLI 2YU9J 2E5NA 2JRMA 3RYRA 2EA2A 1P7JA 3C3WA 3KEYA 1S7EA 5DUIA 2Y2ZA 5LGUA 4A6DA 1JJ6C 2Y30A 1QVUA 2R5YA 2E1OA 2BBYA 1R1UA 4RMNA 1ETWA 1VQ7I 2ELJA 5TGTA 1YJWI 2XAQA 1N25A 2QCOA 5FFXA 3BR6A 1V4RA 4G7HF 4LLLA 4FETA 1J7KA 4EVIA 4HSRA 1WJCA 4A3KJ 2I8DA 2WBMA 4KITB 1TZLA 1BR1A 5HNHA 3KZZA 2FMYA 1D1AA 4W97A 2KRCA 2VI6A 4B43A 2V4JC 5J8CA 1UZCA 3E7LA 1K6YA 3BG6A 3A01B 5K7FA 1VI0A 1FMVA 2ZSHB 1D8JA 5GAHJ 1QO0D 1SAUA 1WFXA 4BXXJ 1XGSA 2E7WA 3D1NI 5LRRA 3ERMA 3OL3A 3LA3A 1A31A 2WY7Q 5GP9A 4QTRA 2V9PA 3IAM2 2DMNA 3HOXJ 2BW3B 1HBXG 4A3LJ 4LJZF 1J59A 3PL8A 5H6QA 3FXRA 5F1JA 2X0LA 2W00A 2ZSIB 2G7UA 3I59B 4F7ZA 4LB5A 1RKTA 3VEPA 3BZ6A 4D7NA 2VJ4A 2R7ZJ 4BU2A 4UXNA 3MKYB 4IRGA 4OAYA 1FEXA 2DQRA 1D0ZA 1T56A 1B9MA 3ZOBA 3E0JB 2R4GA 4IO9F 1XPXA 5C44J 1ZG5A 3G1OA 1K6OA 2TRTA 3AL0C 2NXNB 3M3YJ 1PUFB 2LK2A 2ZNZA 5E3NA 1QGPA 3KZYA 4WF2A 5B1BH 3TO6A 4O6JA 3RCOA 4CZZA 5D4RA 4E7KA 4XM3A 5FGMA 3IP4B 4M3GA 3MZHA 5E3MA 1LDDA 2BHYA 1QHHD 1OLTA 1R6RA 2WTEA 5K5QA 1HKSA 1A6IA 2V6EA 5JFRA 3I0TA 6PAXA 4L9TA 1X19A 2OA4A 4PGGA 3CC4I 5EZGA 3TW6A 1HXDA 1BC8C 3ABKH 1W36C 1OCTC 1GHCA 3EETA 2FNAA 3TO9A 2HXOA 3ABMH 2X6YA 3EUKL 5C4XJ 3AL0B 4P1WA 2COMA 2WV0A 3J7ZI 1TT0A 3JRHA 3ONQA 1T8IA 4HSTA 3S3MA 2KL4A 3QYEA 2GXGA 1ACIA 1TBXA 4YFNF 1ULYA 3OYHA 4I02A 5DV5A 3S15J 1OYYA 3WU1B 2HDCA 1WZ2A 2P5KA 3CUQB 2QF7A 3BPXA 2PMHA 2QKLB 2XPVA 2VBXA 5AIPA 4XOTA 2Z2SB 2P6TA 3C18A 2ZFWA 2MA3A 3TKYA 1X1BA 1KQ8A 3I9V2 1FPQA 2ZO4A 3JAMK 2JVHA 4HX4A 5HDKA 1XCBA 3GTJJ 1R5HA 2OV7A 5F0CA 4UUSA 1TW3A 2H1LA 1HSTA 2EA4A 1NG7A 3EPZA 4B1RA 3V7RA 4NQWB 2LBFA 4E7ZA 2O6GE 2HDWA 1VQMI 3ZQIA 4KA4A 5CVIA 4CICA 1Z67A 4LMYA 2F4OB 1A5JA 2QKMB 1D0YA 4I6ZA 2EIMH 3K9TA 3ZMTA 4P5OA 2MSYA 5DCMA 3IRQA 2XROA 1BIBA 3GTPJ 4RAZA 3OYFA 2COBA 4CGZA 3M07A 1VZ0A 4KNYA 3COAC 1R9TJ 1HW5A 4ANJA 4HNTA 1WPKA 3BR2A 3CO7C 1JUSA 4IVNA 1X4PA 3SHFA 4HDVA 2A5WA 2K27A 5HLIA 4DGWB 2LTPA 1AKHA 4UUVA 4JX6A 1E2XA 4RB2C 1TWHJ 2PFBA 3OR1C 4XNFA 4I98B 3ECOA 1X58A 4MQ9F 3JSPA 4JK1X 3BJAA 3K4JA 4KMUX 3TW7A 3DPUA 3DEWA 2CS3A 2YUSA 4ZZDA 2E5ZA 1MKMA 1OCRH 4J01A 4G12A 4XQFA 1IJWC 5CVJA 4PJLA 3OYJA 4LIUA 5H20A 5K5RA 4ABZA 2HGCA 3GO5A 4RM2A 3HPGA 2GIZA 5DCFA 2NVUB 4BJ5C 2XB0X 1TL8A 1MH4A 2DTRA 4V2FA 4BHBA 5FB2A 2DJNA 3LSJA 1PP7U 4IOAF 5E20A 1NHAA 4I99C 1I6XA 2W25A 3MEXA 2X51A 1X2NA 2MH2A 3OMYA 3IV5A 3H3VK 4E7LA 2H8RA 4KICA 1JT6A 2LVSA 5DM6F 4MTDA 3I4MJ 3OYLA 4D7MA 3LA7A 4CCLA 2AQEA 4CCJA 2IP2A 4OWRB 2P6SA 5FKKA 1VFCA 1VQNI 3A03A 2V26A 1I39A 3BP8A 5IT9Z 1F9NA 3CDHA 1MMDA 2BY1A 4FE4A 5A2QZ 3MZYA 1UB9A 3PNTA 2W57A 1HW1A 2V1DA 1ETXA 3I54A 1I1GA 2GLOA 4IXAA 3ZGKA 2VKDA 2X1EA 1NK2P 1JT0A 4H4KC 4DYQA 3REOA 1XSXA 3BG3A 1V3FA 2F6CA 3ECHA 3G1MA 4I76A 4AIJA 1CQTA 1NK3P 3I64A 2CUEA 1I5ZA 2HXIA 4A5NA 1IN4A 2XC7A 1ETYA 2QQ9A 5CVRA 3S2HJ 1JJ8C 2QZ8A 3DTKA 4JX5A 2FRHA 2R7FA 3BTLA 2E35A 1J0RA 1Z7LA 2LY2A 1S3JA 1WVRA 1FP2A 3V8JA 1DP7P 1LFPA 4BXFA 5IT3A 5GTIC 1UELB 1W1WE 2XF5A 2LC2A 5JVGF 2LKPA 1Y1WJ 3HOSA 2OCEA 2OF7A 4DQ2A 1OJLA 1X3UA 5ICCA 2J5OA 1SD6A 3ZQLA 3ISPA 1A35A 1ZLJA 2CSOA 2M0MA 2HVQA 2BV6A 1TWCJ 4A3BJ 4PCQA 2CQXA 2EINH 4M6XA 4UHTA 4XONA 2VJ5A 4S0HB 5F64A 5B5EC 4Q5SF 2DA7A 3K4BA 4MQVA 2VUMJ 4E7JA 1BI3A 5JI6A 3WG9A 2PN6A 3QWLA 4WXHA 4RM3A 2BZTA 3FXUA 2IAIA 3WGIA 4YFXF 3BY6A 1WJFA 2DFFA 4IEJA 5JR3A 2FF4A 2VQGA 2X1CA 3DKXA 2EQRA 2HQAA 5DYMA 3OOPA 4O3MA 1OR7A 4YIRX 5ILUA 2EZKA 2L7FP 4JBAA 2ISYA 2KIFA 1V5GA 2KP6A 3GF2A 3KYDB 5IP7J 3K2ZA 1ZREA 2DDAA 1WJBA 3V7CA 3BR1A 3CCMI 3H5RA 3OY9A 4KIBA 4E7HA 2K9LA 1ETQA 1YS7A 4DZJA 4F52A 3L1PA 4ENNA 1E0EA 5CYVA 3Q0UA 4E70A 2VE9A 1DUXC 2BEOA 3HGGA 5JHFA 2P5LC 2I5UA 3CCSI 3JW4A 1MSFC 3G3ZA 1TLHB 1HA8A 3L2QA 4II2A 2BYVE 5FLXZ 1R7JA 4AIHA 2JQ7A 2M5WA 1IRGA 2F5EA 1HLVA 2DPUA 2XF7A 4ZH4F 2DO7A 3L9FA 2QQ8A 3KP4A 2NNNA 2E60A 1XN7A 5IY5H 2XGEA 2VXDA 2DK8A 3FM3A 2RVCA 4F55A 2JSCA 1XDUA 5JVTA 2DFHA 2JSPA 4ON0A 5E79C 1KYZA 2GAUA 2RV8A 3HBLA 2OTLI 2XHKA 3QP6A 3BJOA 3KCCA 3HZJA 3CC2I 2KJBA 4GYGA 4OIQF 4BGDA 2A05A 3K10A 1GVDA 1OQYA 3J81Z 4V19K 4CXFA 2DT5A 2L9NA 3IAS2 3GFIA 1LDJA 1MMGA 3S3NA 2CUFA 2L54A 1HOMA 2L7ZA 1ZG1A 5HLGA 2ZKZA 1VQOI 2E7XA 1USSA 2PEXA 2FXAA 1FIPA 2KT0A 2XRNA 5LGTA 2JZYA 1UG0A 1O3QA 2DOAA 4IHVA 2NVTJ 4I0BA 1J5YA 1FC3A 2YS9A 3NARA 3VB2A 3ZQ7A 1MGTA 1NTCA 2STWA 4XLPF 3ZMVA 1S7AA 1SVLA 4MTEA 4IHWA 2QYOA 1W7PD 2ZBKA 3FM5A 3CO6C 1BR2A 2ZJQF 3QPTA 3IWZA 2KFDA 2LF8A 2EWNA 2FE3A 4D0PA 4QIWN 4LK0F 4O5VA 3H0DA 5ICGA 2VQCA 2CQKA 3RJPA 2UXXA 4BEHA 4XIDA 1G3WA 1XMAA 4M74A 4A2UA 4AIDA 1WSUA 1ZRFA 4C30A 2QSFX 1STZA 2EFOA 2KLOA 3E5QA 1F4KA 2DTZA 1AU7A 1W36D 2HI3A 3VFZA 1U5TA 1SMYF 5FLVA 1YX5A 4G9YA 2HS5A 3OIOA 2MD5A 4RGXA 1WI3A 2MH9A 3SZPA 1HDDC 3WTTC 2VB6A 2LSOA 2R7SA 4CYDA 3GXOA 3KE2A 3CD6I 4U7DA 1U5TB 4LFUA 4XSXF 3C7JA 1REPC 3CC7I 3AFHA 3PQJA 1YW9A 4KISA 3BG9A 1Y39A 2DW4A 3LQRA 3LAJA 3HKZA 5BNGA 1IN6A 2Q0OA 4MEXF 4GRIA 4WK8F 1VQ5I 2IW5A 3LMMA 1J2XA 4C2UA 1Z91A 3HG9A 1LKXA 2IT0A 4B8XA 2PJRB 2OPTA 4AD9A 2RQPA 4XR6A 1HCRA 5L3DA 2WWYA 2A5YB 4U0WA 3FBNB 4BKXA 3OYBA 1R00A 1WJEA 2CV0A 4XLAA 1K79A 5FKOA 3PO3J 2FOWA 2P5VA 1TQMA 4FASD 1I3AA 4XLCA 2WB1N 2VT2A 4CYCA 4EM2A 3E6MA 2ZXJA 1YIJI 4HOBA 1TTYA 3E1SA 4Q47A 3PFYA 3RPQA 3ESWB 2BOLA 2FNPA 4DOZA 1O3SA 4BHCA 3BG5A 1IF1A 2M0CA 3DBRB 2RC4A 3M8FA 3O8GA 3S2DJ 3A0HC 4ZTFA 4L5JA 2M9HA 3SXYA 4FTHA 2ID6A 2HDDA 2V9VA 3HM5A 1BJAA 1U2WA 4NC7A 1FIAA 1O7LA 2ME6A 1FYLA 2L9RA 2LMDA 1X2MA 2VQHA 3QYBA 4IHYA 2EJRA 4DYRA 2M3AA 4AM3A 1RUNA 3QODA 5CQEA 2ELKA 4HLXA 5HLHA 2DMTA 3DFGA 5HS8A 1GXQA 1ZGJA 1OKRA 3E3VA 4BACA 2HR3A 1IN7A 3GZ5A 4WX9A 1JE8A 3Q9SA 4RGSA 3WHBA 3JRIA 5IYDJ 2L9VA 1SVMA 1IG7A 3PJRA 1TNSA 1X1AA 4ASNA 4F92B 3CCYA 3OYMA 3IL2A 2A68F 2L4AA 4CZCA 4HBLA 4N4NB 1P6RA 1JI8A 1TWGJ 3MWMA 2DA2A 4ZYDA 1QNTA 2QGUA 3VYSB 1F1ZA 3JR9A 3V42A 1ZG3A 3SFIA 2JA6J 3A02A 3W6KB 4MIMA 2ZC2A 1I27A 3RIRA 5IP6A 4EJVA 5E3OA 3OYIA 3L2CA 1SC7A 3Q0VA 1JGGA 2F5VA 5IPAA 1TW2A 2K7LA 5D8LB 3HTSB 1G4DA 2K9NA 3U1DA 3FISA 2IRFG 5D6FA 1EA3A 4ZYAA 2E2HJ 1NG6A 5AONA 1JGSA 1LNWA 2XGCA 4L9JA 3PO2J 1MNEA 3I3LA 1VQ8I 4ZDLA 4DYCA 4XICA 1VQ6I 2GXAA 5EDNA 2H27A 3EDPA 2RN7A 3SEZA 4LG0B 2ZNYA 1I50J 4I09A 3TP0A 2O9LA 2D45A 2FBHA 3HHGA 1MSEC 1QA6A 1IUFA 3A0BC 3BG7A 1TQPA 5J40A 3HRUA 1H88C 1Z1DA 4AYBN 3J7AO 4G6DA 3RPUA 2W4SA 2PMUA 3WGGA 3HDDA 3OSFA 1FOKA 2F2EA 2HQ5A 1ETVA 4GXOA 4G8XA 1FJLA 3AG2H 4UY8I 1IN8A 1VTNC 3RYPA 3IH3A 1ZK8A 1BR4A 4PJMA 5TRDA 1YOVB 3L2RA 4P55A 2EZIA 2RQQA 5CVVA 5ILVA 1ZRDA 5BOXA 2QEXI 5LLQA 2R0QC 3L09A 3F21A 3A01A 1U3EM 2HU9A 2XUBA 2RAEA 1BI0A 3V7SA 1G2HA 1Y0NA 3I58A 5IOZA 3OIQA 1JUPA 1OCCH 4M9XA 2JUCA 1JKOC 3T8TA 1MNMC 4PGHA 2BW3A 3DLAA 3KP7A 1BA5A 4XLNF 1G3YA 3R0AA 2CU7A 2IJLA 4MEYF 5IYBJ 4A3DJ 4A3IJ 3I59A 2XB5A 5FFZA 2HNHA 4L5IA 3N05A 3BR3A 2CQQA 2K4JA 3AKZA 2ISZA 2DFIA 3F8FA 2CUZA 1Q1VA 1XD7A 5J4VA 2YU3A 2DK5A 4V2GA 2KDZA 2QM3A 3QOPA 3WTZA 1XSDA 1PUFA 4M9SA 4AVZA 4A3FJ 2WC2A 5DM7F 2L7KA 3CMMA 1WHUA 5HDGA 3PUBA 4EEFG 1SMTA 2MYSA 4HZFA 5AIQA 3CUOA 4HRIA 1SFXA 2NS0A 5K1YA 2V1UA 2MGQA 3UR3C 1S5LC 4LLNA 3W6JB 2EZLA 4HNUA 1IGNA 2Y0SN 3SEQA 3F0CA 3LSMA 5EEAA 4BDYA 3KP5A 2ZCWA 5K7ZA 2XKOA 2QVOA 2HOSA 5IT9K 3LOCA 1T08B 5HOOA 3GBGA 4EM0B 2ELHA 4Y33A 4C3JJ 1DGWY 3ZMZA 1RR7A 2LRDA 3BJ6A 4OIPF 1J09A 4ZC3A 2LR8A 2WB1A 1H8AC 2HVSA 1T95A 3BTJA 4IQ4A 2IS1A 2GXBA 2ZXHA 4XL9A 1JTXA 2LYCA 1FBUA 4ESFA 2AQFA 2L3DA 3CCLI 5GAGJ 3BT9A 4Y3OA 5HLTA 4P96A 2MABA 4BBSJ 1ZR4A 3WU2C 4IHTA 2M4KA 3WTVC 1G6NA 3W3CA 1JKQC 3FK6A 1ZELA 4DBRA 2LY9A 1S7OA 5FO5A 5D5XB 1RUOA 3M1CA 3P5JA 3DF8A 2HQRA 4PJNA 1H89C 2QA4I 3LL7A 3CUQA 5D8KB 1KU9A 1FBSA 1ONVA 5M5YJ 3FZVA 1BM9A 2CUJA 2MLKA 2XPWA 5IOYA 5EF6A 3GMEA 1H0MA 2WY8Q 9ANTA 3F23A 3DCFA 3GLLA 4IHSA 1FYMA 3Q9VA 4JOMA 4MO7A 1U9NA 5FLMJ 3RZDJ 1ON1A 3CLQA 2QQBA 4FHTA 1YO5C 2KISA 3ZQFA 3DBHB 1AHDP 2XAHA 3HOVJ 5K7HA 4NQWA 2E34A 3MKLA 4LIVA 5KK1A 3CP8A 4DZPA 3SJMA 3K6GA 4EJUA 3AG4H 3SZGA 3S1MJ 4OOIA 2XASA 2VLAA 2XKPA 1YJ9I 4RA2A 4AU7A 1SD5A 4HDUA 1QRYA 1RC9A 1U0JA 3CCVI 1ERDA 1ON2A 1BW6A 1GV2A 3TEDA 3V8KA 4FX4A 1U6GA 5J8FA 4CCKA 1S72I 2WV1A 3GTQJ 2HTSA 2OTJI 3JREA 1ZTRA 1OCOH 4M6YA 4HX8A 3RI4A 1D1BA 2HYGD 1IW7F 1CF7B 3BR5A 1IZ1A 3W2WA 1Y6IA 3MQ0A 1XSVA 5CPRB 4W1UA 1KGSA 1D5VA 4Y13A 2IA0A 1P2FA 2HPIA 1ZN2A 3EUAA 5M3MJ 4WCGA 2MLGA 3FKJA 5FD6A 4X6AJ 2PQ8A 4LG3A 1YLFA 3G2BA 3GFLA 2VOOA 4HNVA 4OIRF 2E2JJ 5FLXK 2LD5A 2DYRH 4E7IA 3ZPLA 4AC0A 4NBQA 3RKXA 5F0FA 3D5RC 1OYIA 1MDMB 3HXLA 3BOQA 3OL4A 2IS6A 2ICWG 4HX7A 4BE0A 3LSGA 3PIOF 1WH5A 3U2RA 1AA7A 2GA1A 1YE9A 4EQQA 3TDZC 2FBIA 5KAIC 2NNYA 3IH4A 3QU3A 4I2OA 4LLGF 3HHHA 3B6CA 1QZZA 2DT7B 3ZXSA 2VJJA 3BR0A 2VPLA 3MZ8A 3GYHX 1W0TA 2XF6A 3LA2A 2K9SA 1T33A 4NNJA 4CCMA 2ACJA 4LOCA 1F5TA 3CJTB 2A61A 3M7GA 2Z1DA 1YIOA 1X1CA 4OU0A 4X1EA 5LD2C 2JA7J 1XGOA 2EH3A 2Z33A 1ODDA 3R61A 3QAHA 4PK4A 3SZTA 2GWRA 4XKVA 2LDUA 2GBYA 4A3EJ 4A12A 1OCPA 3RDIA 1B8IB 2VXZA 5IYCJ 2UZKA 2HVRA 3BC8A 4S04A 3GZ6A 2YPRA 4RBOA 2BXYA 2HOAA 1O7FA 4JQFA 1TNTA 3OYNA 3ABUA 4ZYHA 4XKBA 5DEQA 3ZCOA 2JA2A 3M8JA 3BZCA 3TOAA 5D4SA 1JTYA 4Y7NJ 4H0EA 1RR8C 2EFQA 2ZXWH 3L00A 3QU6A 4M73A 3HPHA 1DU6A 5B66C 4BE2A 5L3FA 2NOGA 2JPBA 1Z21A 1SFUA 2DAOA 3F9KA 3W2VA 3JRBA 5D5VB 2Z5UA 2V1NA 2J5PA 5FKMA 1R5GA 4D1QA 4A0ZA 1O4XA 2G7HA 3EYIA 1FMWA 2ZMEC 1KU7A 2KHMA 3JRCA 4ZYGA 2DT6A 4LB6B 3QPHA 4RGUA 1D8KA 1F36A 1QPIA 2OZ6A 4GFBA 1P4WA 2DA1A 1RETA 5J1YA 2DFEA 3BQYA 1SD7A 2EBIA 4JYKA 4Y4RA 3SDGA 4IHXA 4U0VA 4B3XA 1T98A 2OU2A 3K1PA 1UFMA 1GVJA 1USTA 2M45A 2QUFA 1ITYA 5KVRA 2NVXJ 2ZJPF 4BY1J 1MJAA 2H8WA 3WE2A 5L3CA 3I56I 4L0ZB 2E2IJ 1EF4A 4U88A 2VOPA 1TQIA 3ZN1A 3KPHA 2R5ZB 1DP3A 4BYYA 1RNLA 1KONA 3KX2A 3QPSA 1WCMJ 2BXZA 4XOPA 4HV6A 3JRGA 4CCNA 4MFEA 4PJ0C 3QYFA 1DU0A 4UNOA 2AS5F 4BQQA 5GAEJ 3CF5F 2BVMA 2ZMEB 5BS6A 1VF9A 2ETHA 2XAUA 3H36A 4XKWA 5H2FC 2VBYA 4ZDOA 2BHZA 4BHPA 3I55I 3QRFF 1YTYA 3C2BA 4AUXA 3P7NA 4L9VA 3IUOA 5EG0B 2L0KA 4IRIA 1Z0XA 1YW7A 2X6OA 3KYCB 2R7XA 4E7SA 3GUDA 3OYGA 2P7VB 3JAMZ 4M71A 1HW2A 2LG4A 4KFCA 2VPRA 4AIKA 1DPUA 4EM1A 2Z9OA 4M6VA 3FXJA 2KZVA 4N9IA 3GTGJ 2E1MC 2OUMA 3B6AA 4II3A 3KFWX 4KT6A 2LREA 2LH9A 1VQPI 3CCRI 5E17F 4LK1F 1IV8A 3PM1A 4XLEA 3W6VA 4UB8C 1VQ9I 3EYYA 5ICFA 2DOEA 5EYRA 3ROUA 2LLKA 4HLYA 1Z05A 2FX0A 2ID3A 3EUHC 2EPFA 1Y8QB 1UHWA 1N75A 4BJTA 1N77A 2XDVA 2P7CB 4OAZA 1ZKGA 2Y9YA 2CO5A 4HEA2 3GEZA 4EV0A 1SFOJ 2IPQX 1UAAA 1S9HA 3LQQA 1W5SA 2RKHA 1EH6A 2Q2EB 3K0LA 2RGVA 1IXRC 1QBJA 2Y0MA 1U9OA 3HB9A 1ZARA 1O3RA 2XAFA 1OMIA 3PNVA 3Q5FA 2Q1ZB 2Y48A 2FD5A 5JLXA 2IA2A 3A1YA 2VBWA 3LSKA 4YEJA 2VONA 2HTJA 3K69A 4BL0B 3DEEA 3O6BB 2QBYB 4CH7A 4HQMA 4D5CA 2IGMA 1Y8RB 5DUKA 2LKXA 4IF4A 3FMSA 1BI1A 4DIQA 3FIWA 4I0AA 2R7QA 2XGDA 3FHZA 2HZTA 1K7AA 2CJJA 2ZFUA 1UMQA 4M9ZA 1POGA 1R4NB 3HSRA 5FROA 2H1KA 2M4GA 5DD8A 1MD0A 4E6KG 1KA8A 4IJAA 2QSGX 3HJEA 3NWTA 5IP9J 2E1NA 2X48A 5L3EA 3E6CC 2CMPA 1OYWA 3K4MA 2JA5J 1B72B 3DWLE 4EGZA 3BTIA 3T8RA 1FWZA 5M5WJ 2HKXA 2LKSA 5J6XA 1R4MB 2KRFA 1JKRC 1IDYA 2MC4A 4HF2A 1LQ1A 4S05A 3FMQA 3M9AA 4YELA 2VKVA 4CSWA 2HOEA 1IO2A 1HDPA 2HYJA 1Z6TA 1G3SA 1I1SA 3LFKA 1D3YA 1AOYA 3CCEI 3S16J 2CYYA 2M34A 4F93B 4Q4ZF 1S8NA 4BE1A 3HSEA 1LEBA 3PIPF 3KZIC 3QPLA 1I3QJ 2DMQA 1JKPC 2L4MA 3HOYJ 2OJED 2CWEA 4NC8A 2W85A 5E8GA 2WADA 3CMYA 2DA3A 2VKEA 4L0YB 2R93J 4RS8A 4J00A 1LB2A 2M1BA 1UCRA 3TQNA 2A07F 1YW8A 2JMWA 1J75A 1B4AA 3H35A 2PJRA 1BW5A 2QWWA 3H5NA 2VT3A 5CVUA 4C3IJ 3G6EI 4F91B 3WTUC 1GV5A 4EJOA 1WIBA 1UJ8A 3CLOA 3T0YA 4EATA 3CF2A 2EILH 1U8BA 3R6SA 2M8EA 2NVQJ 2NOJB 3DU5A 3OOUA 3WODF 2BY0A 3MFKA 2HYFA 3DKYA 4BH9A 2GZWA 1DQUA 3JSOA 4JX4A 4ENKA 4HW0A 4RB1A 4M3BA 1EH7A 4C2MJ 2Y69H 3MCZA 2W7NA 1WJAA 2GM4A 2OQGA 5F6FA 2VJIA 1LVKA 1R22A 4UVAA 3RKWA 2ZJRF 4HQEA 1L0OC 1R1VA 2PI0A 3PQKA 2GOMA 2G9WA 2O61A 1NH3A 2QLZA 1O3TA 2PMZN 2FU4A 3GWZA 4PFPA 3BTCA 5B1AH 2H6CA 5EGOA 1GXPA 1KU2A 3JTHA 1R23A 2V79A 4NDLA 3DV8A 3MKWB 5H6RA 2KDOA 4RLQA 3RKQA 3MAJA 4XRMA 4B47A 2Y9ZA 1PJRA 1BC7C 3F3XA 1XGMA 3IWFA 5EGOB 1IRFA 2JT1A 2P0WA 3NQOA 4KN7X 5LEKA 1RIOH 3UNGC 4BS9A 2O8XA 2HKOA 1ETOA 1BOAA 1XMXA 3F8MA 3B02A 4QSHA 4B4CA 3BCBA 3TBIA 3IC7A 3I53A 4HYEA 2JRTA 4A5MA 3G73A 4IZZA 4KDPA 2ZXIA 1LFBA 3VSLA 1S6LA 3E5UA 3TMOA 3D0SA 2OBPA 3GLXA 3LWFA 4P9UA 4ZTJA 4UV9A 5J4YA 1WGXA 3CCUI 3WU0A 2P81A 1ZGWA 3HUGB 4KUMA 3K70C 3HC7A 1T0FA 2ECBA 1XS9A 3T1BA 3J7YJ 4FE7A 4NHJA 1HSJA 1IXSB 4NUBA 2HQNA 3G4SI 1FSHA 3C2HA 2XPUA 1J9IA 2R3SA 4M3EA 1FNNA 4LGWA 4RAGA 4RGRA 2E19A 4I01A 3WE3A 4QLCU 4BQAA 1S29A 2UWMA 4NC6A 5CKTA 2L2OA 3WTXC 3UKGA 2R7UA 1FTTA 5LFAA 3NRVA 3HOWJ 3EQLF 2JWTA 2V9KA 3K2AA 3ASNH 4EGYA 3VWBA 1IXCA 2YSRA 3HYIA 3EGVB 1GUUA 2CQNA 2IS2A 1IUYA 2H94A 1T38A 1P7IA 1T6SA 2CH0A 3CQZJ 4UV8A 4LG0A 3K1MA 2XSJC 2OC6A 2NVYJ 1HC8A 2F48A 4A93J 3SFZA 4MNUA 2BY3A 4GYIA 3D5SC 4FQGA 4XLHA 3M4OJ 2VN2A 1ZGAA 2PG4A 4PDKA 4PJJA 5BMZA 2EFWA 1SAXA 2M7AA 5KNLA 4RLFA 1Z77A 5LHIA 3JRAA 1H9TA 1MBJA 1KYWA 3A4CA 2M7BA 1OCZH 3ZMDA 4OIOF 4MLOA 2EIKH 3VYTB 1DPRA 4DBQA 4F3QA 1CGPA 3S1NJ 2QQAA 3JRFA 3GX4X 3OYKA 3L2UA 1QU3A 2KJCA 1IN5A 2TDXA 1OFCX 2OCCH 2HWVA 4BY7J 1Y1VJ 2CW0F 3HSFA 4IPAA 4U0YA 4YG2F 2W24A 3SYTA 3CCJI 4ZZLA 1HKQA 2O03A 3U9GA 1MMNA 3V8LA 3TL4X 2GQQA 2B63J 3IKVA 3DP7A 5GPCA 3OS0A 3X2QH 1SFKA 3OV8A 2M8GX 2IXSA 1V54H 3H0GJ 3K4KA 4BNCA 4IRHA 5HNFA 2DN0A 1OISA 3F22A 2VQLA 3HOTA 3E6BA 3OIPA 4B48A 2FJ1A 2JK3A 2AHQA 2OZUA 1YS6A 2B9SA 2IVMA 1X1PA 2KKOA 4L18B 1RRJA 3L2VA 1JHHA 5KCMA 4K2EA 3BWGA 2HOTA 4XBFA 4OINF 2MBFA 2R5YB 3KYLA 3ULQB 1Z3YA 4NB5A 2VBZA 4XN0A 1A6QA 3H9QA 2EZHA 5LEJA 3O2PE 3DBLB 1RPWA 3JRDA 3JTGA 4R79A 3CDIA 1YRNA 1XMKA 2KMUA 3GW2A 4BUPA 4BQOA 2K9MA 1LEAA 3CJRB 3S1QJ 5FRMA 2WAFA 4GCVA 4HF1A 1UG2A 4AWXB 3LSRA 1Z3XA 3J80Z 3ZMSA 1YHQI 4MFDA 3BROA 1MBGA 5TJJA 3CCQI 5ICEA 4KJZA 3N4MA 1YRNB 3H3ZA 3FXQA 1GDTA 1QZEA 1ENHA 5F27A 1YFHA 4DW6A 3M1EA 4FT8A 5FKNA 5D5UB 3H5AA 5KHDA 5A2QK 4YIIA 2IA1A 2L02A 1RKWA 3BDDA 4ETSA 2DQLA 1X4OA 2EFNA 3TGNA 2CG4A 2K9QA 2K02A 1KQ0A 1LE8A 3I71A 1HKTA 3F6VA 2Y31A 3HOUJ 1ZAOA 2PMZA 4Z6YA 3TO7A 2GIVA 1YITI 1MJBA 3TP3A 1EJ9A 2JN6A 3RQIA 3ERED 2IGOA 2FA5A 1LE8B 5HDNA 1X3WB 1V5EA 3TOBA 1WWXA 2V7FA 3LNQA 1I6HJ 4G7OF 1W5TA 1W7PA 1HQCA 2FOKA 3ZMUA 4FISA 2R7TA 2B0LA 2DOFA 3CUQC 3ZQHA 4BJ6C 4MHGA 3Q0WA 2STTA 3S32A 3FF5A 2M2EA 2DI3A 4LD5A 1D5YA 3S3OA 2YX4A 1BBYA 3WGHA 4ENJA 1W7PB 4BBRJ 3GFMA 3OYAA 3ZR8X 5E3LA 2DMPA 4EJWA 3M8EA 2FSWA 1N78A 3GTOJ 4QPQA 1MH3A 2VKHA 3PSFA 2CQ7A 2A6TA 3FXKA 4KMFA 1QZYA 4RAYA 3TDUC 2ESNA 3KLNA 5CQGA 1K4TA 3BQZA 4G6TB 2FEZA 1APLC 3H9JA 4PSWA 4KIFA 5J47A 3K4LA 2R7WA 2EV5A 2DXIA 1LUJB 2EV0A 1PDNC 4IOCF 3DEUA 1ETKA 1EV7A 4BDZA 5BQTA 1CF7A 4KT5C 2EIJH 2GA2A 1FSEA 2TCTA 2BY2A 3ML6A 4HV5A 2IGKA 2V1XA 3RSNA 3JCUC 3B73A 4CDGA 4WXDA 4RB0A 1K4SA 1XG1A 2MW8A 1FP1D 2FBKA 5E1ZB 4Y17A 5ED4A 1SEUA 1JHFA 3MVPA 4J19A 5ERIA 4D9JA 3OYDA 3L2WA 5FD5A 1P9QC 1XGNA 2F5DA 2L9SA 2DA4A 4DNCA 1OPCA 3KP6A 4XRFA 4YIFA 3ZQGA 1MDMA 1Q1HA 2UXNA 4XRSG 5D5WB 5C3EJ 5EJCA 4UUSB 1T39A 1JXSA 3HTUA 4L5EA 1R71A 1Y56A 3O8HA 3CMEI 2D5VA 1Z6RA 3MMYB 2LBFB 2K5CA 2L5QA 4R8HA 3CMAI 1MBHA 4MGRA 3E5XA 1B1BA 2A6EF 1QVTA 4AYBA 4HPQA 2ADUA 3KEOA 1RZ4A 1KZHA 3U21A 4U87A 1R58A 2VC1A 4XSZF 3OYEA 5DCMB 4ZJZA 4DJAA 3DXJF 2AXTC 5BPIA 3CDLA 5FJ8J 2JUGA 1TP4A 2YX7A 5DS9A 1P92A 2DCEA 4YFKF 2JJ7A 1IRZA 3J81K 3IRRA 4KYWA 3KLOA 1AKHB 1WRJA 1B8IA 2DLLA 1EH8A 3U1KA 4XORA 2W1OA 3GZNB 1Y0UA 2K86A 3OS1A 5C4JJ 3VODA 2VASA 5LBQA 1SD4A 2DU9A 5ILSA 5DD4A 1JUMA 3LSPA 2A6HF 2ZJ2A 2MFZA 5HVQC 1G8XA 3OR2C 1FBQA 4IX7A 2VE8A 2IS4A 1TT5B 4E4HA 1XTAA 2MG4A 2OD5A 2CV1A 1H9GA 1FOXA 1KU3A 2AXLA 2JTVA 5LRSA 3HL2A 3VOEA 2DJIA 2JVGA 5KAFC 1B59A 1D0XA 1FT9A 2RREA 2BVLA 2DBBA 4RB3C 2ECCA 1QQIA 2LNBA 5EEGA 4RDUA 2LOOA 1D1CA 2WAEA 1PYVA 4M3FA 5CLSA 3ZQQA 2IEKA 4AVPA 2X9DA 1ZLKA 1FZPB 3S17J 2R92J 3GCMA 2VODA 1YYVA 4UVCA 5J3LA 1TWFJ 2KIQA 3K70D 1AWCA 1XB4A 2DYSH 2CGPA 2Y0SA 5HODA 3C1DA 1Z9CA 3FXLA 3SQNA 1FOWA 2QENA 4Y15A 1MBKA 1B6AA 2CW8A 4QPOA 5K5OA 1ZQ3P 4C9YA 1ZH5A 2MC3A 2Y75A 3DLLF 2K85A 2R5ZA 1PVEA 2CFOA 1DGRM 3HKZN 3I4PA 1QPMA 3DQVC 4UUTA 5JHUA 3FDYA 5CJ9A 1DDNA 2F5CA 1MJ9A 1MW7A 4HG2A 4A0YA 4HA8A 5E1XA 2JA8J 2Z3YA 2ZMEA 4Q48A 3D5LA 4PUSA 2K3PA 4B44A 2XV4S 1RI7A 4LITA 1GLNA 4C3HJ 1XC5A 2RNJA 2C6YA 1F43A 5F08A 1SFEA 5EG0A 2XRLA 1FY7A 3RQ4A 2KPMA 1WJ5A 3R0JA 2PX9A 2Q8KA 5HS9A 1OR7C 3DPTA 3NEUA 1X1DA 4PSXA 1W0UA 4HF0A 4ITVA 3S14J 2NAZA 2PLYA 1M1EB 1W5CC 3RPUD 1P4XA 3QP5A 2DDBA 2RNGA 4KIGA 4ZYEA 2NS7A 3HRSA 1GT0C 2BGCA 2L7MP 5M5XJ 4B09A 3BPVA 1LVAA 3FX3A 3MN2A 1L3LA 4N9HA 1VNDA 3DPLC 2E1CA 3OWTA 3CZ6A 2L01A 3HRTA 1UHSA 1VQ4I 1U78A 1LFUP 4XKCA 3H92A 1YJNI 4XLFA 3VYUB 4A3JJ 1WI9A 4FCYA 3R60A 2Q2EA 3C2GA 5J1RA 4CA0A 3KIOA 4WXCA 1K83J 3LFUA 3BLYA 3DU6A 3HGYA 2LF7A 5E1WA 3WHCA 1FX7A 1LDKB 1IV6A 3IH2A 4CCOA 2QBYA 1MIJA 2XVCA 3ZN0A 1V5FA 3LSTA 2IGNA 4CHUA 2R7OA 4IQJA 1FOYA 4WWCA 2FQ3A 2WA0A 4BQNA 2R7RA 2G0EA 2OAZA 3OSGA 3GTLJ 5GADJ 1RESA 1O57A 3NWSA 5DTDA 1R1TA 2B7EA 2E1MB 2RDPA 3EUHA 3KP2A 1IC8A 2H6BA 4UB6C 3AAFA 2CV2A 3J7AY 2ESHA 3AG3H 1P4AA 2KRHA 2FUG2 4YRVA 3SDBA 1ZYRF 2XSDC 3S1RJ 2E71A 4N0BA 2EV6A 1TWAJ 2D1HA 5D6EA 2UV1A 3P9IA 2VL8A 2E36A 5EEHA 1B72A 1BJZA 2WAQN 3VYRB 2X1DA 1PUEE 4EJTA 3P9KA 1LPQA 2ME0A 2O7OA 2A3SA 3HRMA 1WKMA 3QOEA 4FX0A 1YG2A 1WH7A 3WTYC 3H1CA 5J1UA 1YX3A 4G7ZF 1XX5A 2LY1A 2F4IA 1UHMA 5HS7A 3F6OA 4D5FA 3RKYA 4A3CJ 2O5RA 4X0GA 1E3OC 1IRXA 3VPRA 2DPDA 4ESBA 3G1LA 2XAJA 3HEFA 4ESJA 1U5TC 3RTRA 1KQ9A 2IBDA 3PFIA 5FKLA 5EZHA 4PFOA 3WTSC 1E3PA 4I7HA 2NS8A 4A6EA 2QSHX 2Z99A 3CTAA 3LAPA 3FKIJ 3Q3SA 1PP8F 1EKEA 3ZRGA 3G71I 4C2TA 3BZKA 2R7DA 2NRAC 1ZRCA 3F72A 2X85A 5F0HA 2PBIA 3O3KA 1YI2I 2UUZA 3S93A 3NAUA 1BOBA 1WJDA 5GPAA 3VDXA 3VSKA 3WTWC 4PZJA 4CO8A 5DDGA 4GGGA 5BPDA 4Y52J 2DA5A 3GFJA 1MBFA 2O0YA 3KEQA 2CW7A 3T5XA 3QQAA 5E18F 3N97A 3FK7A 4B3AA 3ASOH 2MD0A 4G6QA 4BEHB 1IAWA 4A69C 2JPCA 3DTIA 4IKFA 4BAYA 4GDFA 3E6DA 3WG7H 4CUGA 3KETA 3ELKA 3IHUA 2HZDA 5F04A 1BIAA 1VQKI 3K4NA 1IDZA 3F8CA 5B3SH 1WQ2A 2K40A 1MMSA 1W4MA 1XCVA 3A2KA 2EFPA 2VIXA 1QHGA 4M72A
chains in the Genus database with same CATH topology
3CJSB 1FOYA 5DM7F 2ZJPF 2H8WA 2K3FA 3I56I 5GADJ 4IOCF 3CC4I 3CCMI 4IOAF 1VQLI 3CD6I 1FOWA 3CCUI 3CC7I 5GAEJ 3CF5F 3DLLF 5DM6F 1Y39A 3J7ZI 3PIOF 3CJRB 3CCSI 3J7YJ 3I55I 2E36A 1VQ8I 1ACIA 1VQNI 1VQ5I 3CCEI 3G4SI 1YHQI 1VQ7I 3CCQI 1VQ6I 3CCLI 1YJWI 5GAGJ 2JQ7A 3PIPF 1QA6A 3CMEI 3EGVB 3CJTB 3CMAI 1VQPI 3CCRI 2FOWA 2QA4I 1VQ9I 2OTLI 3G6EI 1YIJI 4UY8I 1HC8A 1WIBA 3CC2I 5GAHJ 4V19K 2E35A 3G71I 1YITI 1VQMI 1YI2I 2QEXI 1VQOI 5JVGF 1VQ4I 2E34A 1YJNI 2ZJRF 1YJ9I 2ZJQF 3CCJI 3CCVI 4IO9F 2NXNB 1S72I 1VQKI 1FOXA 2OTJI 3CJQB 1MMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJS B;  1FOY A;  5DM7 F;  2ZJP F;  2H8W A;  2K3F A;  3I56 I;  5GAD J;  4IOC F;  3CC4 I;  3CCM I;  4IOA F;  1VQL I;  3CD6 I;  1FOW A;  3CCU I;  3CC7 I;  5GAE J;  3CF5 F;  3DLL F;  5DM6 F;  1Y39 A;  3J7Z I;  3PIO F;  3CJR B;  3CCS I;  3J7Y J;  3I55 I;  2E36 A;  1VQ8 I;  1ACI A;  1VQN I;  1VQ5 I;  3CCE I;  3G4S I;  1YHQ I;  1VQ7 I;  3CCQ I;  1VQ6 I;  3CCL I;  1YJW I;  5GAG J;  2JQ7 A;  3PIP F;  1QA6 A;  3CME I;  3EGV B;  3CJT B;  3CMA I;  1VQP I;  3CCR I;  2FOW A;  2QA4 I;  1VQ9 I;  2OTL I;  3G6E I;  1YIJ I;  4UY8 I;  1HC8 A;  1WIB A;  3CC2 I;  5GAH J;  4V19 K;  2E35 A;  3G71 I;  1YIT I;  1VQM I;  1YI2 I;  2QEX I;  1VQO I;  5JVG F;  1VQ4 I;  2E34 A;  1YJN I;  2ZJR F;  1YJ9 I;  2ZJQ F;  3CCJ I;  3CCV I;  4IO9 F;  2NXN B;  1S72 I;  1VQK I;  1FOX A;  2OTJ I;  3CJQ B;  1MMS A; 
#chains in the Genus database with same CATH topology
 3H3U A;  3R4K A;  2W82 A;  1ZR2 A;  3PSI A;  2A69 F;  4RAF A;  3RZO J;  2D1V A;  4XRS A;  4A0X A;  5TIS C;  2X6X A;  1A04 A;  3F8N A;  4KN4 X;  4IL6 C;  1G59 A;  1R36 A;  2P8T A;  2EK5 A;  3J80 K;  1FLI A;  2AO9 A;  1SAN A;  4QWQ A;  1FYK A;  2F4M B;  2VC0 A;  2F5F A;  2DMU A;  1E17 A;  2M30 A;  4G94 A;  2LFB A;  1MMA A;  5LHH A;  3ABL H;  3OYC A;  2KQR A;  2M87 A;  3FMR A;  3CJN A;  1K78 A;  2R7V A;  3S2W A;  1MBE A;  2HFH A;  2P4W A;  1MZB A;  2DOD A;  4XN3 A;  3PUF A;  2XIG A;  3CES A;  1HF0 A;  3I5U A;  1ORK A;  2CFX A;  1G3T A;  3FWE A;  4OMY A;  3I4N J;  2V6C A;  2GOX B;  1BI2 A;  2O3F A;  3V4G A;  1K78 B;  4ENM A;  4OMZ A;  1SVO A;  3HUG A;  3GVA A;  4CYC B;  2PJP A;  5E8I A;  1YQA A;  3IKT A;  2XGX A;  2H09 A;  3HIF A;  3W2A A;  2KIM A;  3PNY A;  1C0W A;  1T0F C;  5F1R A;  1B9N A;  2HEO A;  4XK4 A;  1BN5 A;  4EMS A;  4TV7 A;  1R5I D;  4Z2Y A;  2YR2 A;  3LSH A;  4U7B A;  2KIU A;  3E97 A;  1XDS A;  2ZB9 A;  2X4H A;  3S8P A;  2XAG A;  5L3G A;  3FHN A;  1K61 A;  1Z7U A;  3BCA A;  4HAM A;  1LJ9 A;  4P9F A;  3MKZ A;  1FTZ A;  3MD2 A;  4A3M J;  2X6W A;  5GTH C;  1MND A;  2EB7 A;  4M3D A;  2K4B A;  4XMY A;  3FXO A;  3OS2 A;  3GTM J;  2CRG A;  3CP2 A;  1T2K A;  1BL0 A;  4L9N A;  2OQR A;  4ZDP A;  1E3H A;  5FRN A;  4BXU A;  3AG1 H;  2I10 A;  3K1N A;  3HOZ J;  2N8G A;  2NYX A;  5M3F J;  2O8K A;  3DKW A;  5L3B A;  3ZP5 A;  4N4O B;  3F8B A;  1TC3 C;  1U8R A;  3FXM A;  3CJQ B;  2BE5 F;  2W48 A;  5LGN A;  2Z16 A;  2FQ4 A;  3KP3 A;  3ABT A;  4UVB A;  5LHG A;  2HPM A;  4GO1 A;  1V55 H;  3CJS B;  3L7W A;  3FBI B;  4JP0 A;  2DA6 A;  2W84 A;  3ZQC A;  3K7A J;  2WAQ A;  2K3F A;  2FML A;  1A36 A;  4A3G J;  1X3Z B;  3P9C A;  3GTK J;  2D2W A;  2KZG A;  3DTE A;  5JLW A;  1R49 A;  1ZHF A;  4R1H A;  2LP0 A;  3H9G A;  3LSI A;  3K4C A;  1VQL I;  2YU9 J;  2E5N A;  2JRM A;  3RYR A;  2EA2 A;  1P7J A;  3C3W A;  3KEY A;  1S7E A;  5DUI A;  2Y2Z A;  5LGU A;  4A6D A;  1JJ6 C;  2Y30 A;  1QVU A;  2R5Y A;  2E1O A;  2BBY A;  1R1U A;  4RMN A;  1ETW A;  1VQ7 I;  2ELJ A;  5TGT A;  1YJW I;  2XAQ A;  1N25 A;  2QCO A;  5FFX A;  3BR6 A;  1V4R A;  4G7H F;  4LLL A;  4FET A;  1J7K A;  4EVI A;  4HSR A;  1WJC A;  4A3K J;  2I8D A;  2WBM A;  4KIT B;  1TZL A;  1BR1 A;  5HNH A;  3KZZ A;  2FMY A;  1D1A A;  4W97 A;  2KRC A;  2VI6 A;  4B43 A;  2V4J C;  5J8C A;  1UZC A;  3E7L A;  1K6Y A;  3BG6 A;  3A01 B;  5K7F A;  1VI0 A;  1FMV A;  2ZSH B;  1D8J A;  5GAH J;  1QO0 D;  1SAU A;  1WFX A;  4BXX J;  1XGS A;  2E7W A;  3D1N I;  5LRR A;  3ERM A;  3OL3 A;  3LA3 A;  1A31 A;  2WY7 Q;  5GP9 A;  4QTR A;  2V9P A;  3IAM 2;  2DMN A;  3HOX J;  2BW3 B;  1HBX G;  4A3L J;  4LJZ F;  1J59 A;  3PL8 A;  5H6Q A;  3FXR A;  5F1J A;  2X0L A;  2W00 A;  2ZSI B;  2G7U A;  3I59 B;  4F7Z A;  4LB5 A;  1RKT A;  3VEP A;  3BZ6 A;  4D7N A;  2VJ4 A;  2R7Z J;  4BU2 A;  4UXN A;  3MKY B;  4IRG A;  4OAY A;  1FEX A;  2DQR A;  1D0Z A;  1T56 A;  1B9M A;  3ZOB A;  3E0J B;  2R4G A;  4IO9 F;  1XPX A;  5C44 J;  1ZG5 A;  3G1O A;  1K6O A;  2TRT A;  3AL0 C;  2NXN B;  3M3Y J;  1PUF B;  2LK2 A;  2ZNZ A;  5E3N A;  1QGP A;  3KZY A;  4WF2 A;  5B1B H;  3TO6 A;  4O6J A;  3RCO A;  4CZZ A;  5D4R A;  4E7K A;  4XM3 A;  5FGM A;  3IP4 B;  4M3G A;  3MZH A;  5E3M A;  1LDD A;  2BHY A;  1QHH D;  1OLT A;  1R6R A;  2WTE A;  5K5Q A;  1HKS A;  1A6I A;  2V6E A;  5JFR A;  3I0T A;  6PAX A;  4L9T A;  1X19 A;  2OA4 A;  4PGG A;  3CC4 I;  5EZG A;  3TW6 A;  1HXD A;  1BC8 C;  3ABK H;  1W36 C;  1OCT C;  1GHC A;  3EET A;  2FNA A;  3TO9 A;  2HXO A;  3ABM H;  2X6Y A;  3EUK L;  5C4X J;  3AL0 B;  4P1W A;  2COM A;  2WV0 A;  3J7Z I;  1TT0 A;  3JRH A;  3ONQ A;  1T8I A;  4HST A;  3S3M A;  2KL4 A;  3QYE A;  2GXG A;  1ACI A;  1TBX A;  4YFN F;  1ULY A;  3OYH A;  4I02 A;  5DV5 A;  3S15 J;  1OYY A;  3WU1 B;  2HDC A;  1WZ2 A;  2P5K A;  3CUQ B;  2QF7 A;  3BPX A;  2PMH A;  2QKL B;  2XPV A;  2VBX A;  5AIP A;  4XOT A;  2Z2S B;  2P6T A;  3C18 A;  2ZFW A;  2MA3 A;  3TKY A;  1X1B A;  1KQ8 A;  3I9V 2;  1FPQ A;  2ZO4 A;  3JAM K;  2JVH A;  4HX4 A;  5HDK A;  1XCB A;  3GTJ J;  1R5H A;  2OV7 A;  5F0C A;  4UUS A;  1TW3 A;  2H1L A;  1HST A;  2EA4 A;  1NG7 A;  3EPZ A;  4B1R A;  3V7R A;  4NQW B;  2LBF A;  4E7Z A;  2O6G E;  2HDW A;  1VQM I;  3ZQI A;  4KA4 A;  5CVI A;  4CIC A;  1Z67 A;  4LMY A;  2F4O B;  1A5J A;  2QKM B;  1D0Y A;  4I6Z A;  2EIM H;  3K9T A;  3ZMT A;  4P5O A;  2MSY A;  5DCM A;  3IRQ A;  2XRO A;  1BIB A;  3GTP J;  4RAZ A;  3OYF A;  2COB A;  4CGZ A;  3M07 A;  1VZ0 A;  4KNY A;  3COA C;  1R9T J;  1HW5 A;  4ANJ A;  4HNT A;  1WPK A;  3BR2 A;  3CO7 C;  1JUS A;  4IVN A;  1X4P A;  3SHF A;  4HDV A;  2A5W A;  2K27 A;  5HLI A;  4DGW B;  2LTP A;  1AKH A;  4UUV A;  4JX6 A;  1E2X A;  4RB2 C;  1TWH J;  2PFB A;  3OR1 C;  4XNF A;  4I98 B;  3ECO A;  1X58 A;  4MQ9 F;  3JSP A;  4JK1 X;  3BJA A;  3K4J A;  4KMU X;  3TW7 A;  3DPU A;  3DEW A;  2CS3 A;  2YUS A;  4ZZD A;  2E5Z A;  1MKM A;  1OCR H;  4J01 A;  4G12 A;  4XQF A;  1IJW C;  5CVJ A;  4PJL A;  3OYJ A;  4LIU A;  5H20 A;  5K5R A;  4ABZ A;  2HGC A;  3GO5 A;  4RM2 A;  3HPG A;  2GIZ A;  5DCF A;  2NVU B;  4BJ5 C;  2XB0 X;  1TL8 A;  1MH4 A;  2DTR A;  4V2F A;  4BHB A;  5FB2 A;  2DJN A;  3LSJ A;  1PP7 U;  4IOA F;  5E20 A;  1NHA A;  4I99 C;  1I6X A;  2W25 A;  3MEX A;  2X51 A;  1X2N A;  2MH2 A;  3OMY A;  3IV5 A;  3H3V K;  4E7L A;  2H8R A;  4KIC A;  1JT6 A;  2LVS A;  5DM6 F;  4MTD A;  3I4M J;  3OYL A;  4D7M A;  3LA7 A;  4CCL A;  2AQE A;  4CCJ A;  2IP2 A;  4OWR B;  2P6S A;  5FKK A;  1VFC A;  1VQN I;  3A03 A;  2V26 A;  1I39 A;  3BP8 A;  5IT9 Z;  1F9N A;  3CDH A;  1MMD A;  2BY1 A;  4FE4 A;  5A2Q Z;  3MZY A;  1UB9 A;  3PNT A;  2W57 A;  1HW1 A;  2V1D A;  1ETX A;  3I54 A;  1I1G A;  2GLO A;  4IXA A;  3ZGK A;  2VKD A;  2X1E A;  1NK2 P;  1JT0 A;  4H4K C;  4DYQ A;  3REO A;  1XSX A;  3BG3 A;  1V3F A;  2F6C A;  3ECH A;  3G1M A;  4I76 A;  4AIJ A;  1CQT A;  1NK3 P;  3I64 A;  2CUE A;  1I5Z A;  2HXI A;  4A5N A;  1IN4 A;  2XC7 A;  1ETY A;  2QQ9 A;  5CVR A;  3S2H J;  1JJ8 C;  2QZ8 A;  3DTK A;  4JX5 A;  2FRH A;  2R7F A;  3BTL A;  2E35 A;  1J0R A;  1Z7L A;  2LY2 A;  1S3J A;  1WVR A;  1FP2 A;  3V8J A;  1DP7 P;  1LFP A;  4BXF A;  5IT3 A;  5GTI C;  1UEL B;  1W1W E;  2XF5 A;  2LC2 A;  5JVG F;  2LKP A;  1Y1W J;  3HOS A;  2OCE A;  2OF7 A;  4DQ2 A;  1OJL A;  1X3U A;  5ICC A;  2J5O A;  1SD6 A;  3ZQL A;  3ISP A;  1A35 A;  1ZLJ A;  2CSO A;  2M0M A;  2HVQ A;  2BV6 A;  1TWC J;  4A3B J;  4PCQ A;  2CQX A;  2EIN H;  4M6X A;  4UHT A;  4XON A;  2VJ5 A;  4S0H B;  5F64 A;  5B5E C;  4Q5S F;  2DA7 A;  3K4B A;  4MQV A;  2VUM J;  4E7J A;  1BI3 A;  5JI6 A;  3WG9 A;  2PN6 A;  3QWL A;  4WXH A;  4RM3 A;  2BZT A;  3FXU A;  2IAI A;  3WGI A;  4YFX F;  3BY6 A;  1WJF A;  2DFF A;  4IEJ A;  5JR3 A;  2FF4 A;  2VQG A;  2X1C A;  3DKX A;  2EQR A;  2HQA A;  5DYM A;  3OOP A;  4O3M A;  1OR7 A;  4YIR X;  5ILU A;  2EZK A;  2L7F P;  4JBA A;  2ISY A;  2KIF A;  1V5G A;  2KP6 A;  3GF2 A;  3KYD B;  5IP7 J;  3K2Z A;  1ZRE A;  2DDA A;  1WJB A;  3V7C A;  3BR1 A;  3CCM I;  3H5R A;  3OY9 A;  4KIB A;  4E7H A;  2K9L A;  1ETQ A;  1YS7 A;  4DZJ A;  4F52 A;  3L1P A;  4ENN A;  1E0E A;  5CYV A;  3Q0U A;  4E70 A;  2VE9 A;  1DUX C;  2BEO A;  3HGG A;  5JHF A;  2P5L C;  2I5U A;  3CCS I;  3JW4 A;  1MSF C;  3G3Z A;  1TLH B;  1HA8 A;  3L2Q A;  4II2 A;  2BYV E;  5FLX Z;  1R7J A;  4AIH A;  2JQ7 A;  2M5W A;  1IRG A;  2F5E A;  1HLV A;  2DPU A;  2XF7 A;  4ZH4 F;  2DO7 A;  3L9F A;  2QQ8 A;  3KP4 A;  2NNN A;  2E60 A;  1XN7 A;  5IY5 H;  2XGE A;  2VXD A;  2DK8 A;  3FM3 A;  2RVC A;  4F55 A;  2JSC A;  1XDU A;  5JVT A;  2DFH A;  2JSP A;  4ON0 A;  5E79 C;  1KYZ A;  2GAU A;  2RV8 A;  3HBL A;  2OTL I;  2XHK A;  3QP6 A;  3BJO A;  3KCC A;  3HZJ A;  3CC2 I;  2KJB A;  4GYG A;  4OIQ F;  4BGD A;  2A05 A;  3K10 A;  1GVD A;  1OQY A;  3J81 Z;  4V19 K;  4CXF A;  2DT5 A;  2L9N A;  3IAS 2;  3GFI A;  1LDJ A;  1MMG A;  3S3N A;  2CUF A;  2L54 A;  1HOM A;  2L7Z A;  1ZG1 A;  5HLG A;  2ZKZ A;  1VQO I;  2E7X A;  1USS A;  2PEX A;  2FXA A;  1FIP A;  2KT0 A;  2XRN A;  5LGT A;  2JZY A;  1UG0 A;  1O3Q A;  2DOA A;  4IHV A;  2NVT J;  4I0B A;  1J5Y A;  1FC3 A;  2YS9 A;  3NAR A;  3VB2 A;  3ZQ7 A;  1MGT A;  1NTC A;  2STW A;  4XLP F;  3ZMV A;  1S7A A;  1SVL A;  4MTE A;  4IHW A;  2QYO A;  1W7P D;  2ZBK A;  3FM5 A;  3CO6 C;  1BR2 A;  2ZJQ F;  3QPT A;  3IWZ A;  2KFD A;  2LF8 A;  2EWN A;  2FE3 A;  4D0P A;  4QIW N;  4LK0 F;  4O5V A;  3H0D A;  5ICG A;  2VQC A;  2CQK A;  3RJP A;  2UXX A;  4BEH A;  4XID A;  1G3W A;  1XMA A;  4M74 A;  4A2U A;  4AID A;  1WSU A;  1ZRF A;  4C30 A;  2QSF X;  1STZ A;  2EFO A;  2KLO A;  3E5Q A;  1F4K A;  2DTZ A;  1AU7 A;  1W36 D;  2HI3 A;  3VFZ A;  1U5T A;  1SMY F;  5FLV A;  1YX5 A;  4G9Y A;  2HS5 A;  3OIO A;  2MD5 A;  4RGX A;  1WI3 A;  2MH9 A;  3SZP A;  1HDD C;  3WTT C;  2VB6 A;  2LSO A;  2R7S A;  4CYD A;  3GXO A;  3KE2 A;  3CD6 I;  4U7D A;  1U5T B;  4LFU A;  4XSX F;  3C7J A;  1REP C;  3CC7 I;  3AFH A;  3PQJ A;  1YW9 A;  4KIS A;  3BG9 A;  1Y39 A;  2DW4 A;  3LQR A;  3LAJ A;  3HKZ A;  5BNG A;  1IN6 A;  2Q0O A;  4MEX F;  4GRI A;  4WK8 F;  1VQ5 I;  2IW5 A;  3LMM A;  1J2X A;  4C2U A;  1Z91 A;  3HG9 A;  1LKX A;  2IT0 A;  4B8X A;  2PJR B;  2OPT A;  4AD9 A;  2RQP A;  4XR6 A;  1HCR A;  5L3D A;  2WWY A;  2A5Y B;  4U0W A;  3FBN B;  4BKX A;  3OYB A;  1R00 A;  1WJE A;  2CV0 A;  4XLA A;  1K79 A;  5FKO A;  3PO3 J;  2FOW A;  2P5V A;  1TQM A;  4FAS D;  1I3A A;  4XLC A;  2WB1 N;  2VT2 A;  4CYC A;  4EM2 A;  3E6M A;  2ZXJ A;  1YIJ I;  4HOB A;  1TTY A;  3E1S A;  4Q47 A;  3PFY A;  3RPQ A;  3ESW B;  2BOL A;  2FNP A;  4DOZ A;  1O3S A;  4BHC A;  3BG5 A;  1IF1 A;  2M0C A;  3DBR B;  2RC4 A;  3M8F A;  3O8G A;  3S2D J;  3A0H C;  4ZTF A;  4L5J A;  2M9H A;  3SXY A;  4FTH A;  2ID6 A;  2HDD A;  2V9V A;  3HM5 A;  1BJA A;  1U2W A;  4NC7 A;  1FIA A;  1O7L A;  2ME6 A;  1FYL A;  2L9R A;  2LMD A;  1X2M A;  2VQH A;  3QYB A;  4IHY A;  2EJR A;  4DYR A;  2M3A A;  4AM3 A;  1RUN A;  3QOD A;  5CQE A;  2ELK A;  4HLX A;  5HLH A;  2DMT A;  3DFG A;  5HS8 A;  1GXQ A;  1ZGJ A;  1OKR A;  3E3V A;  4BAC A;  2HR3 A;  1IN7 A;  3GZ5 A;  4WX9 A;  1JE8 A;  3Q9S A;  4RGS A;  3WHB A;  3JRI A;  5IYD J;  2L9V A;  1SVM A;  1IG7 A;  3PJR A;  1TNS A;  1X1A A;  4ASN A;  4F92 B;  3CCY A;  3OYM A;  3IL2 A;  2A68 F;  2L4A A;  4CZC A;  4HBL A;  4N4N B;  1P6R A;  1JI8 A;  1TWG J;  3MWM A;  2DA2 A;  4ZYD A;  1QNT A;  2QGU A;  3VYS B;  1F1Z A;  3JR9 A;  3V42 A;  1ZG3 A;  3SFI A;  2JA6 J;  3A02 A;  3W6K B;  4MIM A;  2ZC2 A;  1I27 A;  3RIR A;  5IP6 A;  4EJV A;  5E3O A;  3OYI A;  3L2C A;  1SC7 A;  3Q0V A;  1JGG A;  2F5V A;  5IPA A;  1TW2 A;  2K7L A;  5D8L B;  3HTS B;  1G4D A;  2K9N A;  3U1D A;  3FIS A;  2IRF G;  5D6F A;  1EA3 A;  4ZYA A;  2E2H J;  1NG6 A;  5AON A;  1JGS A;  1LNW A;  2XGC A;  4L9J A;  3PO2 J;  1MNE A;  3I3L A;  1VQ8 I;  4ZDL A;  4DYC A;  4XIC A;  1VQ6 I;  2GXA A;  5EDN A;  2H27 A;  3EDP A;  2RN7 A;  3SEZ A;  4LG0 B;  2ZNY A;  1I50 J;  4I09 A;  3TP0 A;  2O9L A;  2D45 A;  2FBH A;  3HHG A;  1MSE C;  1QA6 A;  1IUF A;  3A0B C;  3BG7 A;  1TQP A;  5J40 A;  3HRU A;  1H88 C;  1Z1D A;  4AYB N;  3J7A O;  4G6D A;  3RPU A;  2W4S A;  2PMU A;  3WGG A;  3HDD A;  3OSF A;  1FOK A;  2F2E A;  2HQ5 A;  1ETV A;  4GXO A;  4G8X A;  1FJL A;  3AG2 H;  4UY8 I;  1IN8 A;  1VTN C;  3RYP A;  3IH3 A;  1ZK8 A;  1BR4 A;  4PJM A;  5TRD A;  1YOV B;  3L2R A;  4P55 A;  2EZI A;  2RQQ A;  5CVV A;  5ILV A;  1ZRD A;  5BOX A;  2QEX I;  5LLQ A;  2R0Q C;  3L09 A;  3F21 A;  3A01 A;  1U3E M;  2HU9 A;  2XUB A;  2RAE A;  1BI0 A;  3V7S A;  1G2H A;  1Y0N A;  3I58 A;  5IOZ A;  3OIQ A;  1JUP A;  1OCC H;  4M9X A;  2JUC A;  1JKO C;  3T8T A;  1MNM C;  4PGH A;  2BW3 A;  3DLA A;  3KP7 A;  1BA5 A;  4XLN F;  1G3Y A;  3R0A A;  2CU7 A;  2IJL A;  4MEY F;  5IYB J;  4A3D J;  4A3I J;  3I59 A;  2XB5 A;  5FFZ A;  2HNH A;  4L5I A;  3N05 A;  3BR3 A;  2CQQ A;  2K4J A;  3AKZ A;  2ISZ A;  2DFI A;  3F8F A;  2CUZ A;  1Q1V A;  1XD7 A;  5J4V A;  2YU3 A;  2DK5 A;  4V2G A;  2KDZ A;  2QM3 A;  3QOP A;  3WTZ A;  1XSD A;  1PUF A;  4M9S A;  4AVZ A;  4A3F J;  2WC2 A;  5DM7 F;  2L7K A;  3CMM A;  1WHU A;  5HDG A;  3PUB A;  4EEF G;  1SMT A;  2MYS A;  4HZF A;  5AIQ A;  3CUO A;  4HRI A;  1SFX A;  2NS0 A;  5K1Y A;  2V1U A;  2MGQ A;  3UR3 C;  1S5L C;  4LLN A;  3W6J B;  2EZL A;  4HNU A;  1IGN A;  2Y0S N;  3SEQ A;  3F0C A;  3LSM A;  5EEA A;  4BDY A;  3KP5 A;  2ZCW A;  5K7Z A;  2XKO A;  2QVO A;  2HOS A;  5IT9 K;  3LOC A;  1T08 B;  5HOO A;  3GBG A;  4EM0 B;  2ELH A;  4Y33 A;  4C3J J;  1DGW Y;  3ZMZ A;  1RR7 A;  2LRD A;  3BJ6 A;  4OIP F;  1J09 A;  4ZC3 A;  2LR8 A;  2WB1 A;  1H8A C;  2HVS A;  1T95 A;  3BTJ A;  4IQ4 A;  2IS1 A;  2GXB A;  2ZXH A;  4XL9 A;  1JTX A;  2LYC A;  1FBU A;  4ESF A;  2AQF A;  2L3D A;  3CCL I;  5GAG J;  3BT9 A;  4Y3O A;  5HLT A;  4P96 A;  2MAB A;  4BBS J;  1ZR4 A;  3WU2 C;  4IHT A;  2M4K A;  3WTV C;  1G6N A;  3W3C A;  1JKQ C;  3FK6 A;  1ZEL A;  4DBR A;  2LY9 A;  1S7O A;  5FO5 A;  5D5X B;  1RUO A;  3M1C A;  3P5J A;  3DF8 A;  2HQR A;  4PJN A;  1H89 C;  2QA4 I;  3LL7 A;  3CUQ A;  5D8K B;  1KU9 A;  1FBS A;  1ONV A;  5M5Y J;  3FZV A;  1BM9 A;  2CUJ A;  2MLK A;  2XPW A;  5IOY A;  5EF6 A;  3GME A;  1H0M A;  2WY8 Q;  9ANT A;  3F23 A;  3DCF A;  3GLL A;  4IHS A;  1FYM A;  3Q9V A;  4JOM A;  4MO7 A;  1U9N A;  5FLM J;  3RZD J;  1ON1 A;  3CLQ A;  2QQB A;  4FHT A;  1YO5 C;  2KIS A;  3ZQF A;  3DBH B;  1AHD P;  2XAH A;  3HOV J;  5K7H A;  4NQW A;  2E34 A;  3MKL A;  4LIV A;  5KK1 A;  3CP8 A;  4DZP A;  3SJM A;  3K6G A;  4EJU A;  3AG4 H;  3SZG A;  3S1M J;  4OOI A;  2XAS A;  2VLA A;  2XKP A;  1YJ9 I;  4RA2 A;  4AU7 A;  1SD5 A;  4HDU A;  1QRY A;  1RC9 A;  1U0J A;  3CCV I;  1ERD A;  1ON2 A;  1BW6 A;  1GV2 A;  3TED A;  3V8K A;  4FX4 A;  1U6G A;  5J8F A;  4CCK A;  1S72 I;  2WV1 A;  3GTQ J;  2HTS A;  2OTJ I;  3JRE A;  1ZTR A;  1OCO H;  4M6Y A;  4HX8 A;  3RI4 A;  1D1B A;  2HYG D;  1IW7 F;  1CF7 B;  3BR5 A;  1IZ1 A;  3W2W A;  1Y6I A;  3MQ0 A;  1XSV A;  5CPR B;  4W1U A;  1KGS A;  1D5V A;  4Y13 A;  2IA0 A;  1P2F A;  2HPI A;  1ZN2 A;  3EUA A;  5M3M J;  4WCG A;  2MLG A;  3FKJ A;  5FD6 A;  4X6A J;  2PQ8 A;  4LG3 A;  1YLF A;  3G2B A;  3GFL A;  2VOO A;  4HNV A;  4OIR F;  2E2J J;  5FLX K;  2LD5 A;  2DYR H;  4E7I A;  3ZPL A;  4AC0 A;  4NBQ A;  3RKX A;  5F0F A;  3D5R C;  1OYI A;  1MDM B;  3HXL A;  3BOQ A;  3OL4 A;  2IS6 A;  2ICW G;  4HX7 A;  4BE0 A;  3LSG A;  3PIO F;  1WH5 A;  3U2R A;  1AA7 A;  2GA1 A;  1YE9 A;  4EQQ A;  3TDZ C;  2FBI A;  5KAI C;  2NNY A;  3IH4 A;  3QU3 A;  4I2O A;  4LLG F;  3HHH A;  3B6C A;  1QZZ A;  2DT7 B;  3ZXS A;  2VJJ A;  3BR0 A;  2VPL A;  3MZ8 A;  3GYH X;  1W0T A;  2XF6 A;  3LA2 A;  2K9S A;  1T33 A;  4NNJ A;  4CCM A;  2ACJ A;  4LOC A;  1F5T A;  3CJT B;  2A61 A;  3M7G A;  2Z1D A;  1YIO A;  1X1C A;  4OU0 A;  4X1E A;  5LD2 C;  2JA7 J;  1XGO A;  2EH3 A;  2Z33 A;  1ODD A;  3R61 A;  3QAH A;  4PK4 A;  3SZT A;  2GWR A;  4XKV A;  2LDU A;  2GBY A;  4A3E J;  4A12 A;  1OCP A;  3RDI A;  1B8I B;  2VXZ A;  5IYC J;  2UZK A;  2HVR A;  3BC8 A;  4S04 A;  3GZ6 A;  2YPR A;  4RBO A;  2BXY A;  2HOA A;  1O7F A;  4JQF A;  1TNT A;  3OYN A;  3ABU A;  4ZYH A;  4XKB A;  5DEQ A;  3ZCO A;  2JA2 A;  3M8J A;  3BZC A;  3TOA A;  5D4S A;  1JTY A;  4Y7N J;  4H0E A;  1RR8 C;  2EFQ A;  2ZXW H;  3L00 A;  3QU6 A;  4M73 A;  3HPH A;  1DU6 A;  5B66 C;  4BE2 A;  5L3F A;  2NOG A;  2JPB A;  1Z21 A;  1SFU A;  2DAO A;  3F9K A;  3W2V A;  3JRB A;  5D5V B;  2Z5U A;  2V1N A;  2J5P A;  5FKM A;  1R5G A;  4D1Q A;  4A0Z A;  1O4X A;  2G7H A;  3EYI A;  1FMW A;  2ZME C;  1KU7 A;  2KHM A;  3JRC A;  4ZYG A;  2DT6 A;  4LB6 B;  3QPH A;  4RGU A;  1D8K A;  1F36 A;  1QPI A;  2OZ6 A;  4GFB A;  1P4W A;  2DA1 A;  1RET A;  5J1Y A;  2DFE A;  3BQY A;  1SD7 A;  2EBI A;  4JYK A;  4Y4R A;  3SDG A;  4IHX A;  4U0V A;  4B3X A;  1T98 A;  2OU2 A;  3K1P A;  1UFM A;  1GVJ A;  1UST A;  2M45 A;  2QUF A;  1ITY A;  5KVR A;  2NVX J;  2ZJP F;  4BY1 J;  1MJA A;  2H8W A;  3WE2 A;  5L3C A;  3I56 I;  4L0Z B;  2E2I J;  1EF4 A;  4U88 A;  2VOP A;  1TQI A;  3ZN1 A;  3KPH A;  2R5Z B;  1DP3 A;  4BYY A;  1RNL A;  1KON A;  3KX2 A;  3QPS A;  1WCM J;  2BXZ A;  4XOP A;  4HV6 A;  3JRG A;  4CCN A;  4MFE A;  4PJ0 C;  3QYF A;  1DU0 A;  4UNO A;  2AS5 F;  4BQQ A;  5GAE J;  3CF5 F;  2BVM A;  2ZME B;  5BS6 A;  1VF9 A;  2ETH A;  2XAU A;  3H36 A;  4XKW A;  5H2F C;  2VBY A;  4ZDO A;  2BHZ A;  4BHP A;  3I55 I;  3QRF F;  1YTY A;  3C2B A;  4AUX A;  3P7N A;  4L9V A;  3IUO A;  5EG0 B;  2L0K A;  4IRI A;  1Z0X A;  1YW7 A;  2X6O A;  3KYC B;  2R7X A;  4E7S A;  3GUD A;  3OYG A;  2P7V B;  3JAM Z;  4M71 A;  1HW2 A;  2LG4 A;  4KFC A;  2VPR A;  4AIK A;  1DPU A;  4EM1 A;  2Z9O A;  4M6V A;  3FXJ A;  2KZV A;  4N9I A;  3GTG J;  2E1M C;  2OUM A;  3B6A A;  4II3 A;  3KFW X;  4KT6 A;  2LRE A;  2LH9 A;  1VQP I;  3CCR I;  5E17 F;  4LK1 F;  1IV8 A;  3PM1 A;  4XLE A;  3W6V A;  4UB8 C;  1VQ9 I;  3EYY A;  5ICF A;  2DOE A;  5EYR A;  3ROU A;  2LLK A;  4HLY A;  1Z05 A;  2FX0 A;  2ID3 A;  3EUH C;  2EPF A;  1Y8Q B;  1UHW A;  1N75 A;  4BJT A;  1N77 A;  2XDV A;  2P7C B;  4OAZ A;  1ZKG A;  2Y9Y A;  2CO5 A;  4HEA 2;  3GEZ A;  4EV0 A;  1SFO J;  2IPQ X;  1UAA A;  1S9H A;  3LQQ A;  1W5S A;  2RKH A;  1EH6 A;  2Q2E B;  3K0L A;  2RGV A;  1IXR C;  1QBJ A;  2Y0M A;  1U9O A;  3HB9 A;  1ZAR A;  1O3R A;  2XAF A;  1OMI A;  3PNV A;  3Q5F A;  2Q1Z B;  2Y48 A;  2FD5 A;  5JLX A;  2IA2 A;  3A1Y A;  2VBW A;  3LSK A;  4YEJ A;  2VON A;  2HTJ A;  3K69 A;  4BL0 B;  3DEE A;  3O6B B;  2QBY B;  4CH7 A;  4HQM A;  4D5C A;  2IGM A;  1Y8R B;  5DUK A;  2LKX A;  4IF4 A;  3FMS A;  1BI1 A;  4DIQ A;  3FIW A;  4I0A A;  2R7Q A;  2XGD A;  3FHZ A;  2HZT A;  1K7A A;  2CJJ A;  2ZFU A;  1UMQ A;  4M9Z A;  1POG A;  1R4N B;  3HSR A;  5FRO A;  2H1K A;  2M4G A;  5DD8 A;  1MD0 A;  4E6K G;  1KA8 A;  4IJA A;  2QSG X;  3HJE A;  3NWT A;  5IP9 J;  2E1N A;  2X48 A;  5L3E A;  3E6C C;  2CMP A;  1OYW A;  3K4M A;  2JA5 J;  1B72 B;  3DWL E;  4EGZ A;  3BTI A;  3T8R A;  1FWZ A;  5M5W J;  2HKX A;  2LKS A;  5J6X A;  1R4M B;  2KRF A;  1JKR C;  1IDY A;  2MC4 A;  4HF2 A;  1LQ1 A;  4S05 A;  3FMQ A;  3M9A A;  4YEL A;  2VKV A;  4CSW A;  2HOE A;  1IO2 A;  1HDP A;  2HYJ A;  1Z6T A;  1G3S A;  1I1S A;  3LFK A;  1D3Y A;  1AOY A;  3CCE I;  3S16 J;  2CYY A;  2M34 A;  4F93 B;  4Q4Z F;  1S8N A;  4BE1 A;  3HSE A;  1LEB A;  3PIP F;  3KZI C;  3QPL A;  1I3Q J;  2DMQ A;  1JKP C;  2L4M A;  3HOY J;  2OJE D;  2CWE A;  4NC8 A;  2W85 A;  5E8G A;  2WAD A;  3CMY A;  2DA3 A;  2VKE A;  4L0Y B;  2R93 J;  4RS8 A;  4J00 A;  1LB2 A;  2M1B A;  1UCR A;  3TQN A;  2A07 F;  1YW8 A;  2JMW A;  1J75 A;  1B4A A;  3H35 A;  2PJR A;  1BW5 A;  2QWW A;  3H5N A;  2VT3 A;  5CVU A;  4C3I J;  3G6E I;  4F91 B;  3WTU C;  1GV5 A;  4EJO A;  1WIB A;  1UJ8 A;  3CLO A;  3T0Y A;  4EAT A;  3CF2 A;  2EIL H;  1U8B A;  3R6S A;  2M8E A;  2NVQ J;  2NOJ B;  3DU5 A;  3OOU A;  3WOD F;  2BY0 A;  3MFK A;  2HYF A;  3DKY A;  4BH9 A;  2GZW A;  1DQU A;  3JSO A;  4JX4 A;  4ENK A;  4HW0 A;  4RB1 A;  4M3B A;  1EH7 A;  4C2M J;  2Y69 H;  3MCZ A;  2W7N A;  1WJA A;  2GM4 A;  2OQG A;  5F6F A;  2VJI A;  1LVK A;  1R22 A;  4UVA A;  3RKW A;  2ZJR F;  4HQE A;  1L0O C;  1R1V A;  2PI0 A;  3PQK A;  2GOM A;  2G9W A;  2O61 A;  1NH3 A;  2QLZ A;  1O3T A;  2PMZ N;  2FU4 A;  3GWZ A;  4PFP A;  3BTC A;  5B1A H;  2H6C A;  5EGO A;  1GXP A;  1KU2 A;  3JTH A;  1R23 A;  2V79 A;  4NDL A;  3DV8 A;  3MKW B;  5H6R A;  2KDO A;  4RLQ A;  3RKQ A;  3MAJ A;  4XRM A;  4B47 A;  2Y9Z A;  1PJR A;  1BC7 C;  3F3X A;  1XGM A;  3IWF A;  5EGO B;  1IRF A;  2JT1 A;  2P0W A;  3NQO A;  4KN7 X;  5LEK A;  1RIO H;  3UNG C;  4BS9 A;  2O8X A;  2HKO A;  1ETO A;  1BOA A;  1XMX A;  3F8M A;  3B02 A;  4QSH A;  4B4C A;  3BCB A;  3TBI A;  3IC7 A;  3I53 A;  4HYE A;  2JRT A;  4A5M A;  3G73 A;  4IZZ A;  4KDP A;  2ZXI A;  1LFB A;  3VSL A;  1S6L A;  3E5U A;  3TMO A;  3D0S A;  2OBP A;  3GLX A;  3LWF A;  4P9U A;  4ZTJ A;  4UV9 A;  5J4Y A;  1WGX A;  3CCU I;  3WU0 A;  2P81 A;  1ZGW A;  3HUG B;  4KUM A;  3K70 C;  3HC7 A;  1T0F A;  2ECB A;  1XS9 A;  3T1B A;  3J7Y J;  4FE7 A;  4NHJ A;  1HSJ A;  1IXS B;  4NUB A;  2HQN A;  3G4S I;  1FSH A;  3C2H A;  2XPU A;  1J9I A;  2R3S A;  4M3E A;  1FNN A;  4LGW A;  4RAG A;  4RGR A;  2E19 A;  4I01 A;  3WE3 A;  4QLC U;  4BQA A;  1S29 A;  2UWM A;  4NC6 A;  5CKT A;  2L2O A;  3WTX C;  3UKG A;  2R7U A;  1FTT A;  5LFA A;  3NRV A;  3HOW J;  3EQL F;  2JWT A;  2V9K A;  3K2A A;  3ASN H;  4EGY A;  3VWB A;  1IXC A;  2YSR A;  3HYI A;  3EGV B;  1GUU A;  2CQN A;  2IS2 A;  1IUY A;  2H94 A;  1T38 A;  1P7I A;  1T6S A;  2CH0 A;  3CQZ J;  4UV8 A;  4LG0 A;  3K1M A;  2XSJ C;  2OC6 A;  2NVY J;  1HC8 A;  2F48 A;  4A93 J;  3SFZ A;  4MNU A;  2BY3 A;  4GYI A;  3D5S C;  4FQG A;  4XLH A;  3M4O J;  2VN2 A;  1ZGA A;  2PG4 A;  4PDK A;  4PJJ A;  5BMZ A;  2EFW A;  1SAX A;  2M7A A;  5KNL A;  4RLF A;  1Z77 A;  5LHI A;  3JRA A;  1H9T A;  1MBJ A;  1KYW A;  3A4C A;  2M7B A;  1OCZ H;  3ZMD A;  4OIO F;  4MLO A;  2EIK H;  3VYT B;  1DPR A;  4DBQ A;  4F3Q A;  1CGP A;  3S1N J;  2QQA A;  3JRF A;  3GX4 X;  3OYK A;  3L2U A;  1QU3 A;  2KJC A;  1IN5 A;  2TDX A;  1OFC X;  2OCC H;  2HWV A;  4BY7 J;  1Y1V J;  2CW0 F;  3HSF A;  4IPA A;  4U0Y A;  4YG2 F;  2W24 A;  3SYT A;  3CCJ I;  4ZZL A;  1HKQ A;  2O03 A;  3U9G A;  1MMN A;  3V8L A;  3TL4 X;  2GQQ A;  2B63 J;  3IKV A;  3DP7 A;  5GPC A;  3OS0 A;  3X2Q H;  1SFK A;  3OV8 A;  2M8G X;  2IXS A;  1V54 H;  3H0G J;  3K4K A;  4BNC A;  4IRH A;  5HNF A;  2DN0 A;  1OIS A;  3F22 A;  2VQL A;  3HOT A;  3E6B A;  3OIP A;  4B48 A;  2FJ1 A;  2JK3 A;  2AHQ A;  2OZU A;  1YS6 A;  2B9S A;  2IVM A;  1X1P A;  2KKO A;  4L18 B;  1RRJ A;  3L2V A;  1JHH A;  5KCM A;  4K2E A;  3BWG A;  2HOT A;  4XBF A;  4OIN F;  2MBF A;  2R5Y B;  3KYL A;  3ULQ B;  1Z3Y A;  4NB5 A;  2VBZ A;  4XN0 A;  1A6Q A;  3H9Q A;  2EZH A;  5LEJ A;  3O2P E;  3DBL B;  1RPW A;  3JRD A;  3JTG A;  4R79 A;  3CDI A;  1YRN A;  1XMK A;  2KMU A;  3GW2 A;  4BUP A;  4BQO A;  2K9M A;  1LEA A;  3CJR B;  3S1Q J;  5FRM A;  2WAF A;  4GCV A;  4HF1 A;  1UG2 A;  4AWX B;  3LSR A;  1Z3X A;  3J80 Z;  3ZMS A;  1YHQ I;  4MFD A;  3BRO A;  1MBG A;  5TJJ A;  3CCQ I;  5ICE A;  4KJZ A;  3N4M A;  1YRN B;  3H3Z A;  3FXQ A;  1GDT A;  1QZE A;  1ENH A;  5F27 A;  1YFH A;  4DW6 A;  3M1E A;  4FT8 A;  5FKN A;  5D5U B;  3H5A A;  5KHD A;  5A2Q K;  4YII A;  2IA1 A;  2L02 A;  1RKW A;  3BDD A;  4ETS A;  2DQL A;  1X4O A;  2EFN A;  3TGN A;  2CG4 A;  2K9Q A;  2K02 A;  1KQ0 A;  1LE8 A;  3I71 A;  1HKT A;  3F6V A;  2Y31 A;  3HOU J;  1ZAO A;  2PMZ A;  4Z6Y A;  3TO7 A;  2GIV A;  1YIT I;  1MJB A;  3TP3 A;  1EJ9 A;  2JN6 A;  3RQI A;  3ERE D;  2IGO A;  2FA5 A;  1LE8 B;  5HDN A;  1X3W B;  1V5E A;  3TOB A;  1WWX A;  2V7F A;  3LNQ A;  1I6H J;  4G7O F;  1W5T A;  1W7P A;  1HQC A;  2FOK A;  3ZMU A;  4FIS A;  2R7T A;  2B0L A;  2DOF A;  3CUQ C;  3ZQH A;  4BJ6 C;  4MHG A;  3Q0W A;  2STT A;  3S32 A;  3FF5 A;  2M2E A;  2DI3 A;  4LD5 A;  1D5Y A;  3S3O A;  2YX4 A;  1BBY A;  3WGH A;  4ENJ A;  1W7P B;  4BBR J;  3GFM A;  3OYA A;  3ZR8 X;  5E3L A;  2DMP A;  4EJW A;  3M8E A;  2FSW A;  1N78 A;  3GTO J;  4QPQ A;  1MH3 A;  2VKH A;  3PSF A;  2CQ7 A;  2A6T A;  3FXK A;  4KMF A;  1QZY A;  4RAY A;  3TDU C;  2ESN A;  3KLN A;  5CQG A;  1K4T A;  3BQZ A;  4G6T B;  2FEZ A;  1APL C;  3H9J A;  4PSW A;  4KIF A;  5J47 A;  3K4L A;  2R7W A;  2EV5 A;  2DXI A;  1LUJ B;  2EV0 A;  1PDN C;  4IOC F;  3DEU A;  1ETK A;  1EV7 A;  4BDZ A;  5BQT A;  1CF7 A;  4KT5 C;  2EIJ H;  2GA2 A;  1FSE A;  2TCT A;  2BY2 A;  3ML6 A;  4HV5 A;  2IGK A;  2V1X A;  3RSN A;  3JCU C;  3B73 A;  4CDG A;  4WXD A;  4RB0 A;  1K4S A;  1XG1 A;  2MW8 A;  1FP1 D;  2FBK A;  5E1Z B;  4Y17 A;  5ED4 A;  1SEU A;  1JHF A;  3MVP A;  4J19 A;  5ERI A;  4D9J A;  3OYD A;  3L2W A;  5FD5 A;  1P9Q C;  1XGN A;  2F5D A;  2L9S A;  2DA4 A;  4DNC A;  1OPC A;  3KP6 A;  4XRF A;  4YIF A;  3ZQG A;  1MDM A;  1Q1H A;  2UXN A;  4XRS G;  5D5W B;  5C3E J;  5EJC A;  4UUS B;  1T39 A;  1JXS A;  3HTU A;  4L5E A;  1R71 A;  1Y56 A;  3O8H A;  3CME I;  2D5V A;  1Z6R A;  3MMY B;  2LBF B;  2K5C A;  2L5Q A;  4R8H A;  3CMA I;  1MBH A;  4MGR A;  3E5X A;  1B1B A;  2A6E F;  1QVT A;  4AYB A;  4HPQ A;  2ADU A;  3KEO A;  1RZ4 A;  1KZH A;  3U21 A;  4U87 A;  1R58 A;  2VC1 A;  4XSZ F;  3OYE A;  5DCM B;  4ZJZ A;  4DJA A;  3DXJ F;  2AXT C;  5BPI A;  3CDL A;  5FJ8 J;  2JUG A;  1TP4 A;  2YX7 A;  5DS9 A;  1P92 A;  2DCE A;  4YFK F;  2JJ7 A;  1IRZ A;  3J81 K;  3IRR A;  4KYW A;  3KLO A;  1AKH B;  1WRJ A;  1B8I A;  2DLL A;  1EH8 A;  3U1K A;  4XOR A;  2W1O A;  3GZN B;  1Y0U A;  2K86 A;  3OS1 A;  5C4J J;  3VOD A;  2VAS A;  5LBQ A;  1SD4 A;  2DU9 A;  5ILS A;  5DD4 A;  1JUM A;  3LSP A;  2A6H F;  2ZJ2 A;  2MFZ A;  5HVQ C;  1G8X A;  3OR2 C;  1FBQ A;  4IX7 A;  2VE8 A;  2IS4 A;  1TT5 B;  4E4H A;  1XTA A;  2MG4 A;  2OD5 A;  2CV1 A;  1H9G A;  1FOX A;  1KU3 A;  2AXL A;  2JTV A;  5LRS A;  3HL2 A;  3VOE A;  2DJI A;  2JVG A;  5KAF C;  1B59 A;  1D0X A;  1FT9 A;  2RRE A;  2BVL A;  2DBB A;  4RB3 C;  2ECC A;  1QQI A;  2LNB A;  5EEG A;  4RDU A;  2LOO A;  1D1C A;  2WAE A;  1PYV A;  4M3F A;  5CLS A;  3ZQQ A;  2IEK A;  4AVP A;  2X9D A;  1ZLK A;  1FZP B;  3S17 J;  2R92 J;  3GCM A;  2VOD A;  1YYV A;  4UVC A;  5J3L A;  1TWF J;  2KIQ A;  3K70 D;  1AWC A;  1XB4 A;  2DYS H;  2CGP A;  2Y0S A;  5HOD A;  3C1D A;  1Z9C A;  3FXL A;  3SQN A;  1FOW A;  2QEN A;  4Y15 A;  1MBK A;  1B6A A;  2CW8 A;  4QPO A;  5K5O A;  1ZQ3 P;  4C9Y A;  1ZH5 A;  2MC3 A;  2Y75 A;  3DLL F;  2K85 A;  2R5Z A;  1PVE A;  2CFO A;  1DGR M;  3HKZ N;  3I4P A;  1QPM A;  3DQV C;  4UUT A;  5JHU A;  3FDY A;  5CJ9 A;  1DDN A;  2F5C A;  1MJ9 A;  1MW7 A;  4HG2 A;  4A0Y A;  4HA8 A;  5E1X A;  2JA8 J;  2Z3Y A;  2ZME A;  4Q48 A;  3D5L A;  4PUS A;  2K3P A;  4B44 A;  2XV4 S;  1RI7 A;  4LIT A;  1GLN A;  4C3H J;  1XC5 A;  2RNJ A;  2C6Y A;  1F43 A;  5F08 A;  1SFE A;  5EG0 A;  2XRL A;  1FY7 A;  3RQ4 A;  2KPM A;  1WJ5 A;  3R0J A;  2PX9 A;  2Q8K A;  5HS9 A;  1OR7 C;  3DPT A;  3NEU A;  1X1D A;  4PSX A;  1W0U A;  4HF0 A;  4ITV A;  3S14 J;  2NAZ A;  2PLY A;  1M1E B;  1W5C C;  3RPU D;  1P4X A;  3QP5 A;  2DDB A;  2RNG A;  4KIG A;  4ZYE A;  2NS7 A;  3HRS A;  1GT0 C;  2BGC A;  2L7M P;  5M5X J;  4B09 A;  3BPV A;  1LVA A;  3FX3 A;  3MN2 A;  1L3L A;  4N9H A;  1VND A;  3DPL C;  2E1C A;  3OWT A;  3CZ6 A;  2L01 A;  3HRT A;  1UHS A;  1VQ4 I;  1U78 A;  1LFU P;  4XKC A;  3H92 A;  1YJN I;  4XLF A;  3VYU B;  4A3J J;  1WI9 A;  4FCY A;  3R60 A;  2Q2E A;  3C2G A;  5J1R A;  4CA0 A;  3KIO A;  4WXC A;  1K83 J;  3LFU A;  3BLY A;  3DU6 A;  3HGY A;  2LF7 A;  5E1W A;  3WHC A;  1FX7 A;  1LDK B;  1IV6 A;  3IH2 A;  4CCO A;  2QBY A;  1MIJ A;  2XVC A;  3ZN0 A;  1V5F A;  3LST A;  2IGN A;  4CHU A;  2R7O A;  4IQJ A;  1FOY A;  4WWC A;  2FQ3 A;  2WA0 A;  4BQN A;  2R7R A;  2G0E A;  2OAZ A;  3OSG A;  3GTL J;  5GAD J;  1RES A;  1O57 A;  3NWS A;  5DTD A;  1R1T A;  2B7E A;  2E1M B;  2RDP A;  3EUH A;  3KP2 A;  1IC8 A;  2H6B A;  4UB6 C;  3AAF A;  2CV2 A;  3J7A Y;  2ESH A;  3AG3 H;  1P4A A;  2KRH A;  2FUG 2;  4YRV A;  3SDB A;  1ZYR F;  2XSD C;  3S1R J;  2E71 A;  4N0B A;  2EV6 A;  1TWA J;  2D1H A;  5D6E A;  2UV1 A;  3P9I A;  2VL8 A;  2E36 A;  5EEH A;  1B72 A;  1BJZ A;  2WAQ N;  3VYR B;  2X1D A;  1PUE E;  4EJT A;  3P9K A;  1LPQ A;  2ME0 A;  2O7O A;  2A3S A;  3HRM A;  1WKM A;  3QOE A;  4FX0 A;  1YG2 A;  1WH7 A;  3WTY C;  3H1C A;  5J1U A;  1YX3 A;  4G7Z F;  1XX5 A;  2LY1 A;  2F4I A;  1UHM A;  5HS7 A;  3F6O A;  4D5F A;  3RKY A;  4A3C J;  2O5R A;  4X0G A;  1E3O C;  1IRX A;  3VPR A;  2DPD A;  4ESB A;  3G1L A;  2XAJ A;  3HEF A;  4ESJ A;  1U5T C;  3RTR A;  1KQ9 A;  2IBD A;  3PFI A;  5FKL A;  5EZH A;  4PFO A;  3WTS C;  1E3P A;  4I7H A;  2NS8 A;  4A6E A;  2QSH X;  2Z99 A;  3CTA A;  3LAP A;  3FKI J;  3Q3S A;  1PP8 F;  1EKE A;  3ZRG A;  3G71 I;  4C2T A;  3BZK A;  2R7D A;  2NRA C;  1ZRC A;  3F72 A;  2X85 A;  5F0H A;  2PBI A;  3O3K A;  1YI2 I;  2UUZ A;  3S93 A;  3NAU A;  1BOB A;  1WJD A;  5GPA A;  3VDX A;  3VSK A;  3WTW C;  4PZJ A;  4CO8 A;  5DDG A;  4GGG A;  5BPD A;  4Y52 J;  2DA5 A;  3GFJ A;  1MBF A;  2O0Y A;  3KEQ A;  2CW7 A;  3T5X A;  3QQA A;  5E18 F;  3N97 A;  3FK7 A;  4B3A A;  3ASO H;  2MD0 A;  4G6Q A;  4BEH B;  1IAW A;  4A69 C;  2JPC A;  3DTI A;  4IKF A;  4BAY A;  4GDF A;  3E6D A;  3WG7 H;  4CUG A;  3KET A;  3ELK A;  3IHU A;  2HZD A;  5F04 A;  1BIA A;  1VQK I;  3K4N A;  1IDZ A;  3F8C A;  5B3S H;  1WQ2 A;  2K40 A;  1MMS A;  1W4M A;  1XCV A;  3A2K A;  2EFP A;  2VIX A;  1QHG A;  4M72 A; 
#chains in the Genus database with same CATH homology
 3CJS B;  1FOY A;  5DM7 F;  2ZJP F;  2H8W A;  2K3F A;  3I56 I;  5GAD J;  4IOC F;  3CC4 I;  3CCM I;  4IOA F;  1VQL I;  3CD6 I;  1FOW A;  3CCU I;  3CC7 I;  5GAE J;  3CF5 F;  3DLL F;  5DM6 F;  1Y39 A;  3J7Z I;  3PIO F;  3CJR B;  3CCS I;  3J7Y J;  3I55 I;  2E36 A;  1VQ8 I;  1ACI A;  1VQN I;  1VQ5 I;  3CCE I;  3G4S I;  1YHQ I;  1VQ7 I;  3CCQ I;  1VQ6 I;  3CCL I;  1YJW I;  5GAG J;  2JQ7 A;  3PIP F;  1QA6 A;  3CME I;  3EGV B;  3CJT B;  3CMA I;  1VQP I;  3CCR I;  2FOW A;  2QA4 I;  1VQ9 I;  2OTL I;  3G6E I;  1YIJ I;  4UY8 I;  1HC8 A;  1WIB A;  3CC2 I;  5GAH J;  4V19 K;  2E35 A;  3G71 I;  1YIT I;  1VQM I;  1YI2 I;  2QEX I;  1VQO I;  5JVG F;  1VQ4 I;  2E34 A;  1YJN I;  2ZJR F;  1YJ9 I;  2ZJQ F;  3CCJ I;  3CCV I;  4IO9 F;  2NXN B;  1S72 I;  1VQK I;  1FOX A;  2OTJ I;  3CJQ B;  1MMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...