1MMXA

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-fucose
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords Aldose 1-epimerase
total genus 99
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mmxA00
3OB8A 3VDCA 1LOHA 1PX4A 4TTGA 2BRWA 2XHNA 3NJXA 1L7JA 1NSMA 1NSSA 3T0BA 1NSUA 1TXKA 2CIQA 3VD5A 1K1WA 3WFAA 2WDAA 1LF6A 2HTBA 3I3BA 3VD3A 1YQ2A 3SEPA 1HN1A 3ECQA 1NSRA 1OJOA 1LXMA 2WVXA 2X03A 3CZJA 3T2PA 3T0DA 1F1SA 3T09A 1JZ4A 1JZ2A 4BZFA 1HMWA 4RNLA 4BZGA 1MMYA 1EGUA 2E24A 1MN0A 3IMHA 1PX3A 1F4HA 1SO0A 3E1F1 1SNZA 1HMUA 1NSVA 2CISA 1JZ3A 2D73A 3VD7A 1JZ6A 3OS7A 3DYOA 3IAPA 3NJVA 3T08A 4DUWA 3I3DA 1K1XA 1RWHA 2JKPA 2WVZA 1OJNA 2BRVX 2HTAA 3DCDA 1OJPA 1HM2A 1JZ8A 1MMZA 2WVXB 2WW3A 4AQ0A 1YGAA 2XSGA 4DUVA 3K25A 1X1HA 1NS0A 2Q1FA 1JOVA 1NS2A 3DYPA 1W3YA 3T2OA 1C82A 1X1JA 1LF9A 1RWGA 2WVYA 3DYMA 3MWXA 3DECA 3I3EA 3MUY1 1OJMA 1CB8A 1Z45A 3Q1NA 1NSXA 1ULVA 1N7QA 3VD9A 3MUZ1 1N7RA 3MV01 4DUXA 1NS4A 1JYXA 2WW2A 3J7HA 2E22A 1RWFA 1UG9A 1NKGA 1HM3A 3VDAA 1RW9A 1X1IA 2ZQ0A 5E1QA 3T2QA 2BRPA 4BZEA 1RWAA 2CIRA 2WCOA 1JYWA 1F4AA 1MMUA 2ZXQA 3T0AA 3VD4A 3IAQA 3MV11 2JKEA 2WZSA 1N7PA 1K1YA 5A1AA 1JZ5A 1J0NA 1LXKA 2WW0A 1J0MA 1RWCA 1F9GA 4BZHA 1NS7A 2JKAA 3BGAA 3NREA 3OBAA 1L7KA 1N7OA 2WW1A 1JZ7A 1NSZA 1I8QA 1JYNA 1NS8A 1N7NA 3A24A 1DP0A 1LURA 1JYVA 3VDBA 1MMXA 1HN0A
chains in the Genus database with same CATH superfamily
3DX1A 2OOVA 3VDCA 1WMPA 3WA3A 2BRWA 3DX3A 1IQYA 4K3AA 4OK2A 2BT3A 3QFZA 1LF6A 1IVXA 3DDGA 1HN1A 3ECQA 3EJUA 2WVXA 2X03A 3T09A 2F18A 4BTYA 1HMWA 4BZGA 2C10A 3X3ZA 3IMHA 1HXKA 1PX3A 2C11A 3W7SA 2E2TA 3NJVA 3BUPA 3WIRA 1RWHA 2CQTA 1OJNA 1SIHA 1PU4A 2HTAA 2E2UA 1A2VA 2YFOA 2WGQA 3D4ZA 1HM2A 3WIQA 3S4DA 2WW3A 4KFFA 2XSGA 4FNTA 4DUVA 1IVWA 3CZSA 1X1HA 3DYPA 3HIGA 1C82A 1X1JA 4UFCA 1LF9A 1RWGA 3DECA 3I3EA 4J5TA 1CB8A 1Z45A 2OW7A 4FNRA 1N7QA 2Y74A 3BVWA 2F1BA 3N9HA 1H54A 3W7WA 2EABA 1RWFA 2E22A 1D6YA 4NEIA 4EV5A 1X1IA 4KTPA 2CWUA 3T2QA 2BRPA 2XN2A 1RWAA 2WCOA 3EJTA 4BTWA 3BUDA 2F7OA 2EADA 3BS6A 1W7CA 1JZ5A 1LXKA 3AFJA 1N9EA 2WW0A 1O7DD 1NS7A 1L7KA 2D1WA 2F7QA 3SX1A 1JYNA 1TQUA 2WO0A 3OB8A 2WOFA 1W6GA 4TTGA 1OACA 1L7JA 1NSMA 1WMOA 1NSSA 1RKYA 1NSUA 1D6ZA 1QWUA 1K1WA 3QDEA 4FNVA 2HTBA 3I3BA 3X3XA 3NBJA 1V7XA 1YQ2A 3E80A 1LXMA 3CV5A 3T2PA 3T0DA 3QFYA 4OK4A 3LOYA 3X40A 1SNZA 1NSVA 3VD7A 1W4NA 4BTXA 4EV2A 4OJZA 2CQSA 1V7VA 3T08A 3HIIA 3I3DA 3DX4A 2BRVX 3BLCA 3DCDA 1TQVA 1JZ8A 1MMZA 2RDYA 3CZNA 3VSNA 3A0OA 4MMIA 1NS0A 1JOVA 1IVUA 1PS3A 3RRSA 3PGBA 2CFDA 3WA2X 2WVYA 3DYMA 3BVTA 2OW6A 3D51A 3Q1NA 1NSXA 1ULVA 3S4AA 1N7RA 1NS4A 1AV4A 1IU7A 1D6UA 3J7HA 1UG9A 2CWVA 1SIIA 2CIRA 2ALWA 2FYVA 3DX0A 1JYWA 3W7XA 3X42A 1F4AA 3LVTA 2ZXQA 3T0AA 3VD4A 3K5TA 3IAQA 1K1YA 2WYIA 3DDFA 1TU5A 2OOVC 2FUTA 1J0MA 3BUQA 2YX9A 3TY1A 3NREA 1N7OA 3RSYA 3S4BA 1JYVA 3VDBA 1MMXA 3X3YA 2XN1A 1LOHA 1PX4A 1W2ZA 1JRQA 2XHNA 4FNQA 1SPUA 3NJXA 4KFDA 3D4YA 3W7UA 1LVNA 1DYUA 2F1AA 5JMDA 2WDAA 2ZL8A 1AVKA 1US1A 5KBPA 1NSRA 1OJOA 2CFWA 3SXXA 3CZJA 3EJQA 2EAEA 3EJSA 2WOHA 1MMYA 2E24A 3BUBA 1TQSA 1MN0A 1F4HA 1SO0A 1HMUA 2D73A 3X41A 1JZ6A 3DYOA 5JMFA 4DUWA 1K1XA 1TQWA 2WVZA 2OQEA 3T0UA 3BVVA 1AVLA 1YGAA 3AFLA 1NS2A 1W3YA 3AMOA 3MUY1 3W7TA 2F7PA 1UI8A 3MV01 1JYXA 1NKGA 1HM3A 3VDAA 1RW9A 4FNPA 4BZEA 3HI7A 1KSIA 3AMOB 3BVUA 2WZSA 1N7PA 5A1AA 3ACSA 1WMNA 3VSMA 2EACA 3E7JA 1W6CA 3BGAA 3EJPA 3OBAA 2WW1A 1JZ7A 1NSZA 5GW7A 1NS8A 1N7NA 3A24A 1LURA 4FNSA 2Y73A 3BVXA 1RJOA 1HN0A 3KN4A 1QALA 3ACTA 4K35A 2CFLA 3DX2A 3T0BA 1TXKA 2CIQA 2W0QA 3VD5A 3WFAA 3EJRA 3VD3A 3SEPA 1HTYA 1R34A 2OQEC 3BLBA 2PNCA 2YFNA 1QAKA 1F1SA 1QAFA 1JZ2A 1JZ4A 4BZFA 1V7WA 4RNLA 5CA3A 1EGUA 2CG1A 1HWWA 3E1F1 3NBBA 2CISA 1JZ3A 4KTRA 3OS7A 3IAPA 2JKPA 3MPHA 3D3IA 1OJPA 3S4CA 2WVXB 4AQ0A 4KFEA 2CFGA 3K25A 3QG0A 2Q1FA 1QX1A 2E2VA 3T2OA 2FUQA 1IVVA 3MWXA 1OJMA 2CG0A 3VD9A 3MUZ1 4DUXA 3D50A 2WW2A 2CFKA 2ZQ0A 2CWTA 4FNUA 5E1QA 1EKMA 3BUIA 2XN0A 3D52A 1R33A 1MMUA 3MV11 3MI6A 2JKEA 1IQXA 1UI7A 1J0NA 2WYHA 4MMHA 3KIIA 1RWCA 1F9GA 1TQTA 4BZHA 2JKAA 3ALAA 2F7RA 1W5ZA 3WVFA 1I8QA 1DP0A 1QWNA
chains in the Genus database with same CATH topology
3OB8A 3VDCA 1LOHA 1PX4A 4TTGA 2BRWA 2XHNA 3NJXA 1L7JA 1NSMA 1NSSA 3T0BA 1NSUA 1TXKA 2CIQA 4OK2A 3VD5A 1K1WA 3WFAA 2WDAA 5JMDA 1LF6A 2HTBA 3I3BA 4FNVA 3E80A 1YQ2A 3SEPA 3VD3A 1HN1A 3ECQA 1NSRA 1OJOA 1LXMA 2WVXA 2X03A 3CZJA 3T2PA 3T0DA 1F1SA 3T09A 1JZ4A 1JZ2A 4BZFA 1HMWA 4RNLA 4BZGA 1MMYA 1EGUA 2E24A 4OK4A 1MN0A 3IMHA 1PX3A 1F4HA 1SO0A 3E1F1 1SNZA 1HMUA 1NSVA 2CISA 1JZ3A 2D73A 3VD7A 1JZ6A 3OS7A 4OJZA 3DYOA 3IAPA 3NJVA 3T08A 5JMFA 4DUWA 3I3DA 1K1XA 1RWHA 2JKPA 2WVZA 1OJNA 2BRVX 3BLCA 2HTAA 3DCDA 1OJPA 1HM2A 1JZ8A 1MMZA 2WVXB 2WW3A 3VSNA 4AQ0A 3A0OA 1YGAA 2XSGA 4MMIA 4DUVA 3K25A 1X1HA 3AFLA 1NS0A 2Q1FA 1JOVA 1NS2A 3DYPA 1W3YA 3T2OA 2FUQA 1C82A 1X1JA 1LF9A 1RWGA 2WVYA 3DYMA 3MWXA 3DECA 3I3EA 3MUY1 1OJMA 1CB8A 1Z45A 4J5TA 3Q1NA 1NSXA 1ULVA 1N7QA 3VD9A 3MUZ1 1N7RA 3MV01 4DUXA 1NS4A 1JYXA 2WW2A 3J7HA 2E22A 1RWFA 1UG9A 1NKGA 4NEIA 1HM3A 3VDAA 1RW9A 1X1IA 2ZQ0A 5E1QA 3T2QA 2BRPA 4BZEA 1RWAA 2CIRA 2WCOA 1JYWA 1F4AA 1MMUA 2ZXQA 3T0AA 3VD4A 3IAQA 3MV11 2JKEA 2WZSA 1N7PA 1K1YA 5A1AA 3BS6A 1JZ5A 1J0NA 1LXKA 4MMHA 3VSMA 2FUTA 3E7JA 2WW0A 1J0MA 1RWCA 1F9GA 4BZHA 1NS7A 2JKAA 3TY1A 3BGAA 3NREA 3OBAA 1L7KA 1N7OA 2WW1A 1JZ7A 1NSZA 3WVFA 1I8QA 1JYNA 1NS8A 1N7NA 3A24A 1DP0A 1LURA 1JYVA 3VDBA 1MMXA 1HN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OB8 A;  3VDC A;  1LOH A;  1PX4 A;  4TTG A;  2BRW A;  2XHN A;  3NJX A;  1L7J A;  1NSM A;  1NSS A;  3T0B A;  1NSU A;  1TXK A;  2CIQ A;  3VD5 A;  1K1W A;  3WFA A;  2WDA A;  1LF6 A;  2HTB A;  3I3B A;  3VD3 A;  1YQ2 A;  3SEP A;  1HN1 A;  3ECQ A;  1NSR A;  1OJO A;  1LXM A;  2WVX A;  2X03 A;  3CZJ A;  3T2P A;  3T0D A;  1F1S A;  3T09 A;  1JZ4 A;  1JZ2 A;  4BZF A;  1HMW A;  4RNL A;  4BZG A;  1MMY A;  1EGU A;  2E24 A;  1MN0 A;  3IMH A;  1PX3 A;  1F4H A;  1SO0 A;  3E1F 1;  1SNZ A;  1HMU A;  1NSV A;  2CIS A;  1JZ3 A;  2D73 A;  3VD7 A;  1JZ6 A;  3OS7 A;  3DYO A;  3IAP A;  3NJV A;  3T08 A;  4DUW A;  3I3D A;  1K1X A;  1RWH A;  2JKP A;  2WVZ A;  1OJN A;  2BRV X;  2HTA A;  3DCD A;  1OJP A;  1HM2 A;  1JZ8 A;  1MMZ A;  2WVX B;  2WW3 A;  4AQ0 A;  1YGA A;  2XSG A;  4DUV A;  3K25 A;  1X1H A;  1NS0 A;  2Q1F A;  1JOV A;  1NS2 A;  3DYP A;  1W3Y A;  3T2O A;  1C82 A;  1X1J A;  1LF9 A;  1RWG A;  2WVY A;  3DYM A;  3MWX A;  3DEC A;  3I3E A;  3MUY 1;  1OJM A;  1CB8 A;  1Z45 A;  3Q1N A;  1NSX A;  1ULV A;  1N7Q A;  3VD9 A;  3MUZ 1;  1N7R A;  3MV0 1;  4DUX A;  1NS4 A;  1JYX A;  2WW2 A;  3J7H A;  2E22 A;  1RWF A;  1UG9 A;  1NKG A;  1HM3 A;  3VDA A;  1RW9 A;  1X1I A;  2ZQ0 A;  5E1Q A;  3T2Q A;  2BRP A;  4BZE A;  1RWA A;  2CIR A;  2WCO A;  1JYW A;  1F4A A;  1MMU A;  2ZXQ A;  3T0A A;  3VD4 A;  3IAQ A;  3MV1 1;  2JKE A;  2WZS A;  1N7P A;  1K1Y A;  5A1A A;  1JZ5 A;  1J0N A;  1LXK A;  2WW0 A;  1J0M A;  1RWC A;  1F9G A;  4BZH A;  1NS7 A;  2JKA A;  3BGA A;  3NRE A;  3OBA A;  1L7K A;  1N7O A;  2WW1 A;  1JZ7 A;  1NSZ A;  1I8Q A;  1JYN A;  1NS8 A;  1N7N A;  3A24 A;  1DP0 A;  1LUR A;  1JYV A;  3VDB A;  1MMX A;  1HN0 A; 
#chains in the Genus database with same CATH topology
 3DX1 A;  2OOV A;  3VDC A;  1WMP A;  3WA3 A;  2BRW A;  3DX3 A;  1IQY A;  4K3A A;  4OK2 A;  2BT3 A;  3QFZ A;  1LF6 A;  1IVX A;  3DDG A;  1HN1 A;  3ECQ A;  3EJU A;  2WVX A;  2X03 A;  3T09 A;  2F18 A;  4BTY A;  1HMW A;  4BZG A;  2C10 A;  3X3Z A;  3IMH A;  1HXK A;  1PX3 A;  2C11 A;  3W7S A;  2E2T A;  3NJV A;  3BUP A;  3WIR A;  1RWH A;  2CQT A;  1OJN A;  1SIH A;  1PU4 A;  2HTA A;  2E2U A;  1A2V A;  2YFO A;  2WGQ A;  3D4Z A;  1HM2 A;  3WIQ A;  3S4D A;  2WW3 A;  4KFF A;  2XSG A;  4FNT A;  4DUV A;  1IVW A;  3CZS A;  1X1H A;  3DYP A;  3HIG A;  1C82 A;  1X1J A;  4UFC A;  1LF9 A;  1RWG A;  3DEC A;  3I3E A;  4J5T A;  1CB8 A;  1Z45 A;  2OW7 A;  4FNR A;  1N7Q A;  2Y74 A;  3BVW A;  2F1B A;  3N9H A;  1H54 A;  3W7W A;  2EAB A;  1RWF A;  2E22 A;  1D6Y A;  4NEI A;  4EV5 A;  1X1I A;  4KTP A;  2CWU A;  3T2Q A;  2BRP A;  2XN2 A;  1RWA A;  2WCO A;  3EJT A;  4BTW A;  3BUD A;  2F7O A;  2EAD A;  3BS6 A;  1W7C A;  1JZ5 A;  1LXK A;  3AFJ A;  1N9E A;  2WW0 A;  1O7D D;  1NS7 A;  1L7K A;  2D1W A;  2F7Q A;  3SX1 A;  1JYN A;  1TQU A;  2WO0 A;  3OB8 A;  2WOF A;  1W6G A;  4TTG A;  1OAC A;  1L7J A;  1NSM A;  1WMO A;  1NSS A;  1RKY A;  1NSU A;  1D6Z A;  1QWU A;  1K1W A;  3QDE A;  4FNV A;  2HTB A;  3I3B A;  3X3X A;  3NBJ A;  1V7X A;  1YQ2 A;  3E80 A;  1LXM A;  3CV5 A;  3T2P A;  3T0D A;  3QFY A;  4OK4 A;  3LOY A;  3X40 A;  1SNZ A;  1NSV A;  3VD7 A;  1W4N A;  4BTX A;  4EV2 A;  4OJZ A;  2CQS A;  1V7V A;  3T08 A;  3HII A;  3I3D A;  3DX4 A;  2BRV X;  3BLC A;  3DCD A;  1TQV A;  1JZ8 A;  1MMZ A;  2RDY A;  3CZN A;  3VSN A;  3A0O A;  4MMI A;  1NS0 A;  1JOV A;  1IVU A;  1PS3 A;  3RRS A;  3PGB A;  2CFD A;  3WA2 X;  2WVY A;  3DYM A;  3BVT A;  2OW6 A;  3D51 A;  3Q1N A;  1NSX A;  1ULV A;  3S4A A;  1N7R A;  1NS4 A;  1AV4 A;  1IU7 A;  1D6U A;  3J7H A;  1UG9 A;  2CWV A;  1SII A;  2CIR A;  2ALW A;  2FYV A;  3DX0 A;  1JYW A;  3W7X A;  3X42 A;  1F4A A;  3LVT A;  2ZXQ A;  3T0A A;  3VD4 A;  3K5T A;  3IAQ A;  1K1Y A;  2WYI A;  3DDF A;  1TU5 A;  2OOV C;  2FUT A;  1J0M A;  3BUQ A;  2YX9 A;  3TY1 A;  3NRE A;  1N7O A;  3RSY A;  3S4B A;  1JYV A;  3VDB A;  1MMX A;  3X3Y A;  2XN1 A;  1LOH A;  1PX4 A;  1W2Z A;  1JRQ A;  2XHN A;  4FNQ A;  1SPU A;  3NJX A;  4KFD A;  3D4Y A;  3W7U A;  1LVN A;  1DYU A;  2F1A A;  5JMD A;  2WDA A;  2ZL8 A;  1AVK A;  1US1 A;  5KBP A;  1NSR A;  1OJO A;  2CFW A;  3SXX A;  3CZJ A;  3EJQ A;  2EAE A;  3EJS A;  2WOH A;  1MMY A;  2E24 A;  3BUB A;  1TQS A;  1MN0 A;  1F4H A;  1SO0 A;  1HMU A;  2D73 A;  3X41 A;  1JZ6 A;  3DYO A;  5JMF A;  4DUW A;  1K1X A;  1TQW A;  2WVZ A;  2OQE A;  3T0U A;  3BVV A;  1AVL A;  1YGA A;  3AFL A;  1NS2 A;  1W3Y A;  3AMO A;  3MUY 1;  3W7T A;  2F7P A;  1UI8 A;  3MV0 1;  1JYX A;  1NKG A;  1HM3 A;  3VDA A;  1RW9 A;  4FNP A;  4BZE A;  3HI7 A;  1KSI A;  3AMO B;  3BVU A;  2WZS A;  1N7P A;  5A1A A;  3ACS A;  1WMN A;  3VSM A;  2EAC A;  3E7J A;  1W6C A;  3BGA A;  3EJP A;  3OBA A;  2WW1 A;  1JZ7 A;  1NSZ A;  5GW7 A;  1NS8 A;  1N7N A;  3A24 A;  1LUR A;  4FNS A;  2Y73 A;  3BVX A;  1RJO A;  1HN0 A;  3KN4 A;  1QAL A;  3ACT A;  4K35 A;  2CFL A;  3DX2 A;  3T0B A;  1TXK A;  2CIQ A;  2W0Q A;  3VD5 A;  3WFA A;  3EJR A;  3VD3 A;  3SEP A;  1HTY A;  1R34 A;  2OQE C;  3BLB A;  2PNC A;  2YFN A;  1QAK A;  1F1S A;  1QAF A;  1JZ2 A;  1JZ4 A;  4BZF A;  1V7W A;  4RNL A;  5CA3 A;  1EGU A;  2CG1 A;  1HWW A;  3E1F 1;  3NBB A;  2CIS A;  1JZ3 A;  4KTR A;  3OS7 A;  3IAP A;  2JKP A;  3MPH A;  3D3I A;  1OJP A;  3S4C A;  2WVX B;  4AQ0 A;  4KFE A;  2CFG A;  3K25 A;  3QG0 A;  2Q1F A;  1QX1 A;  2E2V A;  3T2O A;  2FUQ A;  1IVV A;  3MWX A;  1OJM A;  2CG0 A;  3VD9 A;  3MUZ 1;  4DUX A;  3D50 A;  2WW2 A;  2CFK A;  2ZQ0 A;  2CWT A;  4FNU A;  5E1Q A;  1EKM A;  3BUI A;  2XN0 A;  3D52 A;  1R33 A;  1MMU A;  3MV1 1;  3MI6 A;  2JKE A;  1IQX A;  1UI7 A;  1J0N A;  2WYH A;  4MMH A;  3KII A;  1RWC A;  1F9G A;  1TQT A;  4BZH A;  2JKA A;  3ALA A;  2F7R A;  1W5Z A;  3WVF A;  1I8Q A;  1DP0 A;  1QWN A; 
#chains in the Genus database with same CATH homology
 3OB8 A;  3VDC A;  1LOH A;  1PX4 A;  4TTG A;  2BRW A;  2XHN A;  3NJX A;  1L7J A;  1NSM A;  1NSS A;  3T0B A;  1NSU A;  1TXK A;  2CIQ A;  4OK2 A;  3VD5 A;  1K1W A;  3WFA A;  2WDA A;  5JMD A;  1LF6 A;  2HTB A;  3I3B A;  4FNV A;  3E80 A;  1YQ2 A;  3SEP A;  3VD3 A;  1HN1 A;  3ECQ A;  1NSR A;  1OJO A;  1LXM A;  2WVX A;  2X03 A;  3CZJ A;  3T2P A;  3T0D A;  1F1S A;  3T09 A;  1JZ4 A;  1JZ2 A;  4BZF A;  1HMW A;  4RNL A;  4BZG A;  1MMY A;  1EGU A;  2E24 A;  4OK4 A;  1MN0 A;  3IMH A;  1PX3 A;  1F4H A;  1SO0 A;  3E1F 1;  1SNZ A;  1HMU A;  1NSV A;  2CIS A;  1JZ3 A;  2D73 A;  3VD7 A;  1JZ6 A;  3OS7 A;  4OJZ A;  3DYO A;  3IAP A;  3NJV A;  3T08 A;  5JMF A;  4DUW A;  3I3D A;  1K1X A;  1RWH A;  2JKP A;  2WVZ A;  1OJN A;  2BRV X;  3BLC A;  2HTA A;  3DCD A;  1OJP A;  1HM2 A;  1JZ8 A;  1MMZ A;  2WVX B;  2WW3 A;  3VSN A;  4AQ0 A;  3A0O A;  1YGA A;  2XSG A;  4MMI A;  4DUV A;  3K25 A;  1X1H A;  3AFL A;  1NS0 A;  2Q1F A;  1JOV A;  1NS2 A;  3DYP A;  1W3Y A;  3T2O A;  2FUQ A;  1C82 A;  1X1J A;  1LF9 A;  1RWG A;  2WVY A;  3DYM A;  3MWX A;  3DEC A;  3I3E A;  3MUY 1;  1OJM A;  1CB8 A;  1Z45 A;  4J5T A;  3Q1N A;  1NSX A;  1ULV A;  1N7Q A;  3VD9 A;  3MUZ 1;  1N7R A;  3MV0 1;  4DUX A;  1NS4 A;  1JYX A;  2WW2 A;  3J7H A;  2E22 A;  1RWF A;  1UG9 A;  1NKG A;  4NEI A;  1HM3 A;  3VDA A;  1RW9 A;  1X1I A;  2ZQ0 A;  5E1Q A;  3T2Q A;  2BRP A;  4BZE A;  1RWA A;  2CIR A;  2WCO A;  1JYW A;  1F4A A;  1MMU A;  2ZXQ A;  3T0A A;  3VD4 A;  3IAQ A;  3MV1 1;  2JKE A;  2WZS A;  1N7P A;  1K1Y A;  5A1A A;  3BS6 A;  1JZ5 A;  1J0N A;  1LXK A;  4MMH A;  3VSM A;  2FUT A;  3E7J A;  2WW0 A;  1J0M A;  1RWC A;  1F9G A;  4BZH A;  1NS7 A;  2JKA A;  3TY1 A;  3BGA A;  3NRE A;  3OBA A;  1L7K A;  1N7O A;  2WW1 A;  1JZ7 A;  1NSZ A;  3WVF A;  1I8Q A;  1JYN A;  1NS8 A;  1N7N A;  3A24 A;  1DP0 A;  1LUR A;  1JYV A;  3VDB A;  1MMX A;  1HN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...