1MMXA

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-fucose
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 99
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mmxA00
3J7HA 3MV11 1NSMA 3DYMA 1NS7A 1RWHA 2JKPA 1NSXA 3VDCA 1N7OA 2E24A 1RWCA 1NSVA 3OB8A 3DCDA 2CISA 2BRWA 1N7NA 1RWAA 3NJXA 4TTGA 2WW0A 3T08A 3VD3A 1YGAA 1OJOA 3E1F1 3I3DA 2BRVX 3VDAA 2HTBA 1I8QA 1NKGA 1PX3A 1JOVA 1NS2A 1JZ7A 1NS0A 1MMYA 3T0BA 1NS8A 1W3YA 2WVZA 1NS4A 1Z45A 3IAQA 1F1SA 1HMWA 1HM2A 1NSZA 2WW2A 3I3BA 3SEPA 1JZ5A 3ECQA 3DYPA 1HN1A 1HM3A 1LXKA 1HMUA 1JZ3A 3T09A 1JYXA 1RWFA 2WCOA 1NSSA 1OJNA 3OBAA 1LURA 1C82A 1N7PA 1J0MA 5A1AA 1TXKA 3DYOA 4BZEA 2WVXA 1RWGA 3T2PA 1JZ6A 1L7KA 4RNLA 1L7JA 4DUWA 3IAPA 1F4HA 3MV01 4BZFA 2ZXQA 1JZ2A 2X03A 1PX4A 1CB8A 4DUXA 1DP0A 1K1WA 4DUVA 4BZGA 3IMHA 2XSGA 1OJPA 1JYNA 3WFAA 1EGUA 1NSUA 1RW9A 1UG9A 1YQ2A 1JZ8A 1LXMA 1J0NA 2ZQ0A 3OS7A 3VD4A 1NSRA 3NJVA 3K25A 2HTAA 2Q1FA 2WVXB 3T2OA 1JYVA 1X1JA 2WVYA 2E22A 3MUZ1 3VDBA 3VD5A 1MN0A 3Q1NA 3T2QA 4AQ0A 2WZSA 1X1IA 2BRPA 1MMXA 1LF9A 1OJMA 1N7QA 3NREA 2CIQA 1MMZA 4BZHA 1SO0A 3I3EA 3T0DA 3MUY1 3VD9A 1K1YA 2XHNA 2WW1A 1K1XA 3MWXA 1F9GA 3CZJA 1LF6A 1LOHA 1SNZA 1F4AA 3A24A 3BGAA 1ULVA 1X1HA 3VD7A 2WW3A 2D73A 1JZ4A 1HN0A 3DECA 2CIRA 1N7RA 2JKAA 2JKEA 1JYWA 2WDAA 5E1QA 1MMUA 3T0AA
chains in the Genus database with same CATH superfamily
3J7HA 1NSMA 1WMOA 1NS7A 2D1WA 3W7XA 2E24A 3DCDA 2F1BA 2BRWA 1RWAA 4FNPA 2Y74A 3QG0A 2EABA 2Y73A 2HTBA 1I8QA 1NKGA 1IVUA 3S4DA 2XN2A 3X40A 3ALAA 1HWWA 3D51A 3W7SA 4KFEA 1AVKA 1Z45A 2E2UA 3BLBA 1HM2A 3SEPA 3BVUA 1EKMA 3EJUA 3SXXA 1TQVA 1JZ3A 1NSSA 3W7WA 1LURA 4FNRA 1TXKA 2F7PA 3NBJA 1RWGA 5CA3A 1JZ6A 2F1AA 3BUPA 3IAPA 1R33A 1IVVA 3WIRA 3HIGA 1QALA 2XSGA 1OJPA 1JYNA 3D4ZA 2CWVA 1RKYA 1UG9A 1YQ2A 2CFKA 1J0NA 2CFWA 2ZQ0A 1TQSA 1NSRA 1D6YA 2HTAA 2WVXB 5JMFA 1X1JA 3X3ZA 3MUZ1 2CFLA 3K5TA 1IVXA 1IVWA 4BTXA 3AMOB 1MMZA 4BZHA 2E2VA 3MUY1 2XHNA 2BT3A 1HXKA 3W7UA 1W5ZA 3BUQA 3BUBA 1JZ4A 3S4CA 3DECA 1D6UA 3LOYA 3T0AA 1TQUA 3EJSA 2XN0A 5GW7A 3VSMA 3MV11 2CG0A 1HTYA 1PU4A 1RWCA 3S4BA 1OACA 1N7NA 3CV5A 2OW7A 4TTGA 1QWNA 3QFZA 2F18A 3T08A 1KSIA 2RDYA 2BRVX 1PX3A 2E2TA 3PGBA 3D4YA 1MMYA 3T0BA 1NS8A 2WVZA 1NS4A 3BVVA 1RJOA 3IAQA 1F1SA 1O7DD 2WW2A 1W4NA 3ECQA 3DYPA 1HM3A 1HMUA 1IQXA 1J0MA 3DYOA 1W6GA 2FYVA 3T0UA 1US1A 1F4HA 3QDEA 1K1WA 1W6CA 3IMHA 3X3YA 1RW9A 2OW6A 1LXMA 5JMDA 2OQEA 2CFGA 4BTWA 3NJVA 1JYVA 2E22A 3BUDA 3VDBA 3HI7A 1MN0A 3Q1NA 2CWTA 1QWUA 2WGQA 3RRSA 2YFNA 1LF9A 1SO0A 3T0DA 2OOVA 2PNCA 3VD9A 1K1YA 3RSYA 1F9GA 1AVLA 2EAEA 3HIIA 3DX4A 2W0QA 3A0OA 3LVTA 1LF6A 1F4AA 3A24A 3BGAA 3D50A 2D73A 3SX1A 2JKEA 1JYWA 5E1QA 3DYMA 2JKPA 3VDCA 1N7OA 3AFJA 4OK4A 3ACSA 1W2ZA 3MI6A 2WOFA 3VD3A 1YGAA 1OJOA 3E1F1 3I3DA 2C10A 1NS0A 1W3YA 4FNUA 2XN1A 3BVXA 3X41A 1HMWA 1N9EA 5KBPA 1NSZA 1SIIA 3I3BA 1JZ5A 1TQWA 1QAFA 1HN1A 1LXKA 3T09A 1JYXA 2FUQA 2WCOA 1OJNA 3BVTA 3OBAA 1C82A 1N7PA 4BZEA 2WVXA 3T2PA 3KN4A 1IQYA 2ZL8A 1L7KA 3EJRA 3MV01 4BZFA 3AMOA 2YFOA 2X03A 1UI8A 1V7VA 1SIHA 4FNTA 4DUXA 1DP0A 3EJTA 3E7JA 1D6ZA 3D52A 3ACTA 1DYUA 3WFAA 3MPHA 1NSUA 2F7QA 2F7OA 3VD4A 3S4AA 2Q1FA 1UI7A 2YX9A 3E80A 3VD5A 1TQTA 3T2QA 3VSNA 1MMXA 1OJMA 1N7QA 3NREA 2CIQA 3I3EA 2WOHA 1K1XA 3DX1A 3MWXA 3X42A 3CZJA 4FNVA 3EJQA 4KFFA 4EV2A 3BS6A 2CG1A 1V7WA 4EV5A 1SNZA 2EACA 1A2VA 3WIQA 3VD7A 1HN0A 2CIRA 1N7RA 2CQTA 1PS3A 3KIIA 3D3IA 2WYIA 1WMPA 4FNSA 1IU7A 1RWHA 1NSXA 2EADA 1NSVA 2F7RA 3OB8A 2CISA 3BVWA 3BLCA 4K35A 4KTPA 4KFDA 4OK2A 3NJXA 1QX1A 2WO0A 4KTRA 4K3AA 2WW0A 3DX0A 1R34A 1V7XA 2CQSA 3VDAA 3TY1A 1JOVA 1W7CA 1JRQA 3DX3A 1NS2A 1JZ7A 2CWUA 2ALWA 1H54A 3W7TA 2CFDA 1TU5A 4J5TA 1RWFA 1LVNA 5A1AA 3NBBA 3X3XA 4RNLA 2OQEC 1L7JA 4DUWA 3DX2A 2ZXQA 1JZ2A 3BUIA 1PX4A 1CB8A 3CZNA 4DUVA 4BZGA 2WYHA 3DDFA 4OJZA 3WA3A 1SPUA 1EGUA 4NEIA 1JZ8A 3QFYA 2OOVC 3OS7A 4UFCA 3K25A 3T2OA 2WVYA 4FNQA 4AQ0A 2WZSA 1X1IA 2BRPA 2FUTA 2WW1A 1WMNA 4BTYA 3WVFA 1LOHA 3DDGA 3N9HA 3EJPA 4MMIA 1QAKA 1ULVA 3WA2X 1X1HA 2C11A 2WW3A 3CZSA 4MMHA 2JKAA 2WDAA 1MMUA 1AV4A 3AFLA
chains in the Genus database with same CATH topology
3J7HA 3VSMA 3MV11 1NSMA 3DYMA 1NS7A 1RWHA 2JKPA 1NSXA 3VDCA 1N7OA 2E24A 4OK4A 1RWCA 1NSVA 3OB8A 3DCDA 2CISA 3BLCA 2BRWA 1N7NA 1RWAA 4OK2A 3NJXA 4TTGA 2WW0A 3T08A 3VD3A 1YGAA 1OJOA 3E1F1 3I3DA 2BRVX 3VDAA 2HTBA 1I8QA 1NKGA 1PX3A 3TY1A 1JOVA 1NS2A 1JZ7A 1NS0A 1MMYA 3T0BA 1NS8A 1W3YA 2WVZA 1NS4A 1Z45A 3IAQA 1F1SA 1HMWA 1HM2A 1NSZA 2WW2A 3I3BA 3SEPA 1JZ5A 3ECQA 3DYPA 1HN1A 1HM3A 1LXKA 1HMUA 4J5TA 3T09A 1JZ3A 1JYXA 1RWFA 2FUQA 2WCOA 1NSSA 1OJNA 3OBAA 1LURA 1C82A 1N7PA 1J0MA 5A1AA 1TXKA 3DYOA 4BZEA 2WVXA 1RWGA 3T2PA 1JZ6A 1L7KA 4RNLA 1L7JA 4DUWA 3IAPA 1F4HA 3MV01 4BZFA 2ZXQA 1JZ2A 2X03A 1PX4A 1CB8A 4DUXA 1DP0A 1K1WA 3E7JA 4DUVA 4BZGA 3IMHA 2XSGA 1OJPA 1JYNA 4OJZA 3WFAA 1EGUA 4NEIA 1NSUA 1RW9A 1UG9A 1YQ2A 1JZ8A 1LXMA 5JMDA 1J0NA 2ZQ0A 3OS7A 3VD4A 1NSRA 3NJVA 3K25A 2HTAA 2Q1FA 2WVXB 3T2OA 5JMFA 1X1JA 1JYVA 2WVYA 2E22A 3MUZ1 3VDBA 3E80A 3VD5A 1MN0A 3Q1NA 3T2QA 4AQ0A 2WZSA 3VSNA 1X1IA 2BRPA 1MMXA 1LF9A 1OJMA 1N7QA 2FUTA 3NREA 2CIQA 1MMZA 4BZHA 1SO0A 3I3EA 3T0DA 3MUY1 3VD9A 1K1YA 2XHNA 2WW1A 1K1XA 3MWXA 1F9GA 3CZJA 3A0OA 4FNVA 3BS6A 3WVFA 1LF6A 1LOHA 1SNZA 1F4AA 3A24A 4MMIA 3BGAA 1ULVA 1X1HA 3VD7A 2WW3A 2D73A 1JZ4A 1HN0A 3DECA 4MMHA 2CIRA 1N7RA 2JKAA 2JKEA 1JYWA 2WDAA 5E1QA 1MMUA 3AFLA 3T0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7H A;  3MV1 1;  1NSM A;  3DYM A;  1NS7 A;  1RWH A;  2JKP A;  1NSX A;  3VDC A;  1N7O A;  2E24 A;  1RWC A;  1NSV A;  3OB8 A;  3DCD A;  2CIS A;  2BRW A;  1N7N A;  1RWA A;  3NJX A;  4TTG A;  2WW0 A;  3T08 A;  3VD3 A;  1YGA A;  1OJO A;  3E1F 1;  3I3D A;  2BRV X;  3VDA A;  2HTB A;  1I8Q A;  1NKG A;  1PX3 A;  1JOV A;  1NS2 A;  1JZ7 A;  1NS0 A;  1MMY A;  3T0B A;  1NS8 A;  1W3Y A;  2WVZ A;  1NS4 A;  1Z45 A;  3IAQ A;  1F1S A;  1HMW A;  1HM2 A;  1NSZ A;  2WW2 A;  3I3B A;  3SEP A;  1JZ5 A;  3ECQ A;  3DYP A;  1HN1 A;  1HM3 A;  1LXK A;  1HMU A;  1JZ3 A;  3T09 A;  1JYX A;  1RWF A;  2WCO A;  1NSS A;  1OJN A;  3OBA A;  1LUR A;  1C82 A;  1N7P A;  1J0M A;  5A1A A;  1TXK A;  3DYO A;  4BZE A;  2WVX A;  1RWG A;  3T2P A;  1JZ6 A;  1L7K A;  4RNL A;  1L7J A;  4DUW A;  3IAP A;  1F4H A;  3MV0 1;  4BZF A;  2ZXQ A;  1JZ2 A;  2X03 A;  1PX4 A;  1CB8 A;  4DUX A;  1DP0 A;  1K1W A;  4DUV A;  4BZG A;  3IMH A;  2XSG A;  1OJP A;  1JYN A;  3WFA A;  1EGU A;  1NSU A;  1RW9 A;  1UG9 A;  1YQ2 A;  1JZ8 A;  1LXM A;  1J0N A;  2ZQ0 A;  3OS7 A;  3VD4 A;  1NSR A;  3NJV A;  3K25 A;  2HTA A;  2Q1F A;  2WVX B;  3T2O A;  1JYV A;  1X1J A;  2WVY A;  2E22 A;  3MUZ 1;  3VDB A;  3VD5 A;  1MN0 A;  3Q1N A;  3T2Q A;  4AQ0 A;  2WZS A;  1X1I A;  2BRP A;  1MMX A;  1LF9 A;  1OJM A;  1N7Q A;  3NRE A;  2CIQ A;  1MMZ A;  4BZH A;  1SO0 A;  3I3E A;  3T0D A;  3MUY 1;  3VD9 A;  1K1Y A;  2XHN A;  2WW1 A;  1K1X A;  3MWX A;  1F9G A;  3CZJ A;  1LF6 A;  1LOH A;  1SNZ A;  1F4A A;  3A24 A;  3BGA A;  1ULV A;  1X1H A;  3VD7 A;  2WW3 A;  2D73 A;  1JZ4 A;  1HN0 A;  3DEC A;  2CIR A;  1N7R A;  2JKA A;  2JKE A;  1JYW A;  2WDA A;  5E1Q A;  1MMU A;  3T0A A; 
#chains in the Genus database with same CATH topology
 3J7H A;  1NSM A;  1WMO A;  1NS7 A;  2D1W A;  3W7X A;  2E24 A;  3DCD A;  2F1B A;  2BRW A;  1RWA A;  4FNP A;  2Y74 A;  3QG0 A;  2EAB A;  2Y73 A;  2HTB A;  1I8Q A;  1NKG A;  1IVU A;  3S4D A;  2XN2 A;  3X40 A;  3ALA A;  1HWW A;  3D51 A;  3W7S A;  4KFE A;  1AVK A;  1Z45 A;  2E2U A;  3BLB A;  1HM2 A;  3SEP A;  3BVU A;  1EKM A;  3EJU A;  3SXX A;  1TQV A;  1JZ3 A;  1NSS A;  3W7W A;  1LUR A;  4FNR A;  1TXK A;  2F7P A;  3NBJ A;  1RWG A;  5CA3 A;  1JZ6 A;  2F1A A;  3BUP A;  3IAP A;  1R33 A;  1IVV A;  3WIR A;  3HIG A;  1QAL A;  2XSG A;  1OJP A;  1JYN A;  3D4Z A;  2CWV A;  1RKY A;  1UG9 A;  1YQ2 A;  2CFK A;  1J0N A;  2CFW A;  2ZQ0 A;  1TQS A;  1NSR A;  1D6Y A;  2HTA A;  2WVX B;  5JMF A;  1X1J A;  3X3Z A;  3MUZ 1;  2CFL A;  3K5T A;  1IVX A;  1IVW A;  4BTX A;  3AMO B;  1MMZ A;  4BZH A;  2E2V A;  3MUY 1;  2XHN A;  2BT3 A;  1HXK A;  3W7U A;  1W5Z A;  3BUQ A;  3BUB A;  1JZ4 A;  3S4C A;  3DEC A;  1D6U A;  3LOY A;  3T0A A;  1TQU A;  3EJS A;  2XN0 A;  5GW7 A;  3VSM A;  3MV1 1;  2CG0 A;  1HTY A;  1PU4 A;  1RWC A;  3S4B A;  1OAC A;  1N7N A;  3CV5 A;  2OW7 A;  4TTG A;  1QWN A;  3QFZ A;  2F18 A;  3T08 A;  1KSI A;  2RDY A;  2BRV X;  1PX3 A;  2E2T A;  3PGB A;  3D4Y A;  1MMY A;  3T0B A;  1NS8 A;  2WVZ A;  1NS4 A;  3BVV A;  1RJO A;  3IAQ A;  1F1S A;  1O7D D;  2WW2 A;  1W4N A;  3ECQ A;  3DYP A;  1HM3 A;  1HMU A;  1IQX A;  1J0M A;  3DYO A;  1W6G A;  2FYV A;  3T0U A;  1US1 A;  1F4H A;  3QDE A;  1K1W A;  1W6C A;  3IMH A;  3X3Y A;  1RW9 A;  2OW6 A;  1LXM A;  5JMD A;  2OQE A;  2CFG A;  4BTW A;  3NJV A;  1JYV A;  2E22 A;  3BUD A;  3VDB A;  3HI7 A;  1MN0 A;  3Q1N A;  2CWT A;  1QWU A;  2WGQ A;  3RRS A;  2YFN A;  1LF9 A;  1SO0 A;  3T0D A;  2OOV A;  2PNC A;  3VD9 A;  1K1Y A;  3RSY A;  1F9G A;  1AVL A;  2EAE A;  3HII A;  3DX4 A;  2W0Q A;  3A0O A;  3LVT A;  1LF6 A;  1F4A A;  3A24 A;  3BGA A;  3D50 A;  2D73 A;  3SX1 A;  2JKE A;  1JYW A;  5E1Q A;  3DYM A;  2JKP A;  3VDC A;  1N7O A;  3AFJ A;  4OK4 A;  3ACS A;  1W2Z A;  3MI6 A;  2WOF A;  3VD3 A;  1YGA A;  1OJO A;  3E1F 1;  3I3D A;  2C10 A;  1NS0 A;  1W3Y A;  4FNU A;  2XN1 A;  3BVX A;  3X41 A;  1HMW A;  1N9E A;  5KBP A;  1NSZ A;  1SII A;  3I3B A;  1JZ5 A;  1TQW A;  1QAF A;  1HN1 A;  1LXK A;  3T09 A;  1JYX A;  2FUQ A;  2WCO A;  1OJN A;  3BVT A;  3OBA A;  1C82 A;  1N7P A;  4BZE A;  2WVX A;  3T2P A;  3KN4 A;  1IQY A;  2ZL8 A;  1L7K A;  3EJR A;  3MV0 1;  4BZF A;  3AMO A;  2YFO A;  2X03 A;  1UI8 A;  1V7V A;  1SIH A;  4FNT A;  4DUX A;  1DP0 A;  3EJT A;  3E7J A;  1D6Z A;  3D52 A;  3ACT A;  1DYU A;  3WFA A;  3MPH A;  1NSU A;  2F7Q A;  2F7O A;  3VD4 A;  3S4A A;  2Q1F A;  1UI7 A;  2YX9 A;  3E80 A;  3VD5 A;  1TQT A;  3T2Q A;  3VSN A;  1MMX A;  1OJM A;  1N7Q A;  3NRE A;  2CIQ A;  3I3E A;  2WOH A;  1K1X A;  3DX1 A;  3MWX A;  3X42 A;  3CZJ A;  4FNV A;  3EJQ A;  4KFF A;  4EV2 A;  3BS6 A;  2CG1 A;  1V7W A;  4EV5 A;  1SNZ A;  2EAC A;  1A2V A;  3WIQ A;  3VD7 A;  1HN0 A;  2CIR A;  1N7R A;  2CQT A;  1PS3 A;  3KII A;  3D3I A;  2WYI A;  1WMP A;  4FNS A;  1IU7 A;  1RWH A;  1NSX A;  2EAD A;  1NSV A;  2F7R A;  3OB8 A;  2CIS A;  3BVW A;  3BLC A;  4K35 A;  4KTP A;  4KFD A;  4OK2 A;  3NJX A;  1QX1 A;  2WO0 A;  4KTR A;  4K3A A;  2WW0 A;  3DX0 A;  1R34 A;  1V7X A;  2CQS A;  3VDA A;  3TY1 A;  1JOV A;  1W7C A;  1JRQ A;  3DX3 A;  1NS2 A;  1JZ7 A;  2CWU A;  2ALW A;  1H54 A;  3W7T A;  2CFD A;  1TU5 A;  4J5T A;  1RWF A;  1LVN A;  5A1A A;  3NBB A;  3X3X A;  4RNL A;  2OQE C;  1L7J A;  4DUW A;  3DX2 A;  2ZXQ A;  1JZ2 A;  3BUI A;  1PX4 A;  1CB8 A;  3CZN A;  4DUV A;  4BZG A;  2WYH A;  3DDF A;  4OJZ A;  3WA3 A;  1SPU A;  1EGU A;  4NEI A;  1JZ8 A;  3QFY A;  2OOV C;  3OS7 A;  4UFC A;  3K25 A;  3T2O A;  2WVY A;  4FNQ A;  4AQ0 A;  2WZS A;  1X1I A;  2BRP A;  2FUT A;  2WW1 A;  1WMN A;  4BTY A;  3WVF A;  1LOH A;  3DDG A;  3N9H A;  3EJP A;  4MMI A;  1QAK A;  1ULV A;  3WA2 X;  1X1H A;  2C11 A;  2WW3 A;  3CZS A;  4MMH A;  2JKA A;  2WDA A;  1MMU A;  1AV4 A;  3AFL A; 
#chains in the Genus database with same CATH homology
 3J7H A;  3VSM A;  3MV1 1;  1NSM A;  3DYM A;  1NS7 A;  1RWH A;  2JKP A;  1NSX A;  3VDC A;  1N7O A;  2E24 A;  4OK4 A;  1RWC A;  1NSV A;  3OB8 A;  3DCD A;  2CIS A;  3BLC A;  2BRW A;  1N7N A;  1RWA A;  4OK2 A;  3NJX A;  4TTG A;  2WW0 A;  3T08 A;  3VD3 A;  1YGA A;  1OJO A;  3E1F 1;  3I3D A;  2BRV X;  3VDA A;  2HTB A;  1I8Q A;  1NKG A;  1PX3 A;  3TY1 A;  1JOV A;  1NS2 A;  1JZ7 A;  1NS0 A;  1MMY A;  3T0B A;  1NS8 A;  1W3Y A;  2WVZ A;  1NS4 A;  1Z45 A;  3IAQ A;  1F1S A;  1HMW A;  1HM2 A;  1NSZ A;  2WW2 A;  3I3B A;  3SEP A;  1JZ5 A;  3ECQ A;  3DYP A;  1HN1 A;  1HM3 A;  1LXK A;  1HMU A;  4J5T A;  3T09 A;  1JZ3 A;  1JYX A;  1RWF A;  2FUQ A;  2WCO A;  1NSS A;  1OJN A;  3OBA A;  1LUR A;  1C82 A;  1N7P A;  1J0M A;  5A1A A;  1TXK A;  3DYO A;  4BZE A;  2WVX A;  1RWG A;  3T2P A;  1JZ6 A;  1L7K A;  4RNL A;  1L7J A;  4DUW A;  3IAP A;  1F4H A;  3MV0 1;  4BZF A;  2ZXQ A;  1JZ2 A;  2X03 A;  1PX4 A;  1CB8 A;  4DUX A;  1DP0 A;  1K1W A;  3E7J A;  4DUV A;  4BZG A;  3IMH A;  2XSG A;  1OJP A;  1JYN A;  4OJZ A;  3WFA A;  1EGU A;  4NEI A;  1NSU A;  1RW9 A;  1UG9 A;  1YQ2 A;  1JZ8 A;  1LXM A;  5JMD A;  1J0N A;  2ZQ0 A;  3OS7 A;  3VD4 A;  1NSR A;  3NJV A;  3K25 A;  2HTA A;  2Q1F A;  2WVX B;  3T2O A;  5JMF A;  1X1J A;  1JYV A;  2WVY A;  2E22 A;  3MUZ 1;  3VDB A;  3E80 A;  3VD5 A;  1MN0 A;  3Q1N A;  3T2Q A;  4AQ0 A;  2WZS A;  3VSN A;  1X1I A;  2BRP A;  1MMX A;  1LF9 A;  1OJM A;  1N7Q A;  2FUT A;  3NRE A;  2CIQ A;  1MMZ A;  4BZH A;  1SO0 A;  3I3E A;  3T0D A;  3MUY 1;  3VD9 A;  1K1Y A;  2XHN A;  2WW1 A;  1K1X A;  3MWX A;  1F9G A;  3CZJ A;  3A0O A;  4FNV A;  3BS6 A;  3WVF A;  1LF6 A;  1LOH A;  1SNZ A;  1F4A A;  3A24 A;  4MMI A;  3BGA A;  1ULV A;  1X1H A;  3VD7 A;  2WW3 A;  2D73 A;  1JZ4 A;  1HN0 A;  3DEC A;  4MMH A;  2CIR A;  1N7R A;  2JKA A;  2JKE A;  1JYW A;  2WDA A;  5E1Q A;  1MMU A;  3AFL A;  3T0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...