1MMXA

Crystal structure of galactose mutarotase from lactococcus lactis complexed with d-fucose
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose 1-epimerase
publication title Structural and kinetic studies of sugar binding to galactose mutarotase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 99
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1mmxA00
1X1HA 3T0AA 1OJNA 1JZ3A 2WVZA 5E1QA 1LF6A 3DECA 1NSMA 4DUWA 3NJVA 1PX4A 1NSVA 1MMUA 3T2OA 2JKEA 4TTGA 1EGUA 3VD5A 3VDBA 3J7HA 2CIRA 3OS7A 4BZFA 3ECQA 1NS8A 1JZ8A 3E1F1 3OBAA 3T2QA 1RWAA 1OJMA 1HMUA 2JKPA 1K1WA 1NSRA 2HTAA 3IAQA 2WW1A 2XSGA 1J0MA 3VDCA 3MV11 1JOVA 2D73A 1UG9A 4RNLA 1X1IA 4BZEA 1NS2A 1NS4A 1RW9A 1RWCA 1RWFA 2ZQ0A 3T09A 1C82A 2WVYA 3VD7A 2E22A 1JZ5A 1YQ2A 1JZ6A 1RWGA 1RWHA 2WDAA 2Q1FA 3VD9A 3BGAA 2WVXA 1YGAA 2CISA 3MUZ1 3VDAA 1F1SA 1JZ7A 2ZXQA 1JYNA 1K1YA 1NKGA 3T08A 4BZGA 2WVXB 1J0NA 1TXKA 3IMHA 1NSUA 5A1AA 2BRPA 1JZ2A 1NS0A 3OB8A 3T0BA 1L7KA 2XHNA 3I3EA 1K1XA 3VD4A 1I8QA 1N7OA 2BRVX 1PX3A 3DYMA 4DUVA 3I3BA 1DP0A 1F9GA 1NS7A 4DUXA 1N7QA 3CZJA 3NREA 1N7NA 2WCOA 1X1JA 1N7RA 1Z45A 2BRWA 2CIQA 3SEPA 1HMWA 3T0DA 1HM3A 1OJPA 1F4AA 1OJOA 2WW3A 1CB8A 2HTBA 2JKAA 1MN0A 1NSZA 1L7JA 3DCDA 1MMYA 1W3YA 2E24A 3MV01 3VD3A 1HN0A 1MMZA 3T2PA 1NSSA 3K25A 1MMXA 1NSXA 3A24A 2WZSA 3MWXA 4AQ0A 1JYWA 1ULVA 1LF9A 1JYVA 1LXKA 1F4HA 3WFAA 2WW0A 3IAPA 3NJXA 1JZ4A 1N7PA 1LOHA 3I3DA 1LXMA 2X03A 1SNZA 1HM2A 1JYXA 1SO0A 3Q1NA 2WW2A 3DYPA 3MUY1 1HN1A 1LURA 3DYOA 4BZHA
chains in the Genus database with same CATH superfamily
3T0AA 1OJNA 1JZ3A 1SIIA 2WVZA 5E1QA 3DECA 1IQXA 1W6GA 3E7JA 1R34A 1EGUA 3QFZA 3D4ZA 3X3XA 1SPUA 3BLBA 3OS7A 3BUDA 3ECQA 1NS8A 3AMOB 1JZ8A 3OBAA 1PS3A 3W7TA 3HIGA 4FNTA 1OJMA 2CWUA 2E2VA 3X41A 3S4BA 3BLCA 3EJPA 2EACA 4FNQA 4FNPA 3VDCA 1A2VA 2D73A 1UG9A 4FNVA 2CFWA 4BZEA 1NS2A 1RW9A 2CQSA 1RWFA 3BVWA 2WDAA 1QWUA 3D50A 3BVVA 2WVXA 3T0UA 2F7OA 1D6YA 3HIIA 1NKGA 2CWTA 5A1AA 1RJOA 2BRPA 1JZ2A 2YFOA 1TU5A 3OB8A 1AVLA 3W7XA 1K1XA 1H54A 3CV5A 4MMHA 4DUXA 1D6ZA 3LVTA 2WCOA 1Z45A 1QX1A 2CIQA 2EADA 1OJPA 3D3IA 1TQTA 1CB8A 2HTBA 1IVWA 3BS6A 3SXXA 3MV01 1R33A 3T2PA 3K25A 1V7XA 3DX0A 3A24A 2WZSA 3MWXA 1W5ZA 4AQ0A 1JYWA 2C10A 3CZNA 3WFAA 1HTYA 2XN0A 3IAPA 3NJXA 4KFFA 3LOYA 3E80A 2X03A 1SNZA 2WW2A 3DYPA 3WIQA 1IQYA 4BZHA 4OJZA 1X1HA 4FNUA 2OOVC 2EABA 2CQTA 3NJVA 1PX4A 1NSVA 3BUIA 3NBJA 4TTGA 2CIRA 5GW7A 2OW7A 3BVXA 3DX3A 3T2QA 2JKPA 1W2ZA 2F7PA 2HTAA 3IAQA 3WA3A 1J0MA 3MV11 1IVUA 2ZQ0A 1NS4A 1C82A 2E22A 1JZ5A 1YQ2A 1JZ6A 2WYIA 3PGBA 3D4YA 3BGAA 3VDAA 1YGAA 2CISA 2PNCA 1V7WA 1UI7A 4BTWA 3W7WA 3A0OA 3IMHA 1NSUA 1W4NA 1NS0A 3T0BA 1L7KA 2YX9A 2XHNA 3VD4A 5JMDA 2BRVX 3CZSA 4KFDA 3I3BA 1F9GA 1N7QA 2CFGA 3DX2A 2XN1A 1W7CA 1HWWA 3CZJA 1N7NA 1QALA 3AFLA 3QFYA 3SEPA 2YFNA 2WW3A 2OQEA 1IVVA 1V7VA 3S4CA 2WYHA 1NSSA 1SIHA 2Y74A 1LF9A 1JYVA 1UI8A 2WW0A 3WIRA 1LOHA 3BVTA 1WMOA 1WMPA 1O7DD 1HN1A 1DYUA 3D52A 3RRSA 1OACA 1N9EA 1QAFA 3TY1A 4KFEA 1MMUA 2WOFA 2D1WA 3VDBA 1EKMA 2FUQA 2WO0A 2CFKA 3EJQA 2CG1A 2CG0A 4RNLA 3T09A 2WVYA 3VD7A 2RDYA 1D6UA 1RWGA 2F7QA 3ALAA 2Q1FA 3VD9A 3MUZ1 4UFCA 3SX1A 1JYNA 2FYVA 4K35A 2ZL8A 3AFJA 4BZGA 2WVXB 2OW6A 2E2TA 3X3ZA 1PX3A 3DYMA 4DUVA 1NS7A 2EAEA 1AVKA 4EV5A 3EJSA 3BUBA 3NREA 1N7RA 5CA3A 4K3AA 3VSNA 2BRWA 1F4AA 1OJOA 5JMFA 3ACSA 1MN0A 4J5TA 1NSZA 1L7JA 3DCDA 1W3YA 3DDGA 1LVNA 2E24A 3EJTA 4BTYA 1HN0A 2C11A 1NSXA 1ULVA 1WMNA 2WOHA 1LXKA 1F4HA 2E2UA 2CFLA 4EV2A 1N7PA 3I3DA 1HM2A 2CFDA 4KTRA 1LURA 3DYOA 3WVFA 4OK2A 3BVUA 1LF6A 4OK4A 4NEIA 3DDFA 1NSMA 4DUWA 3DX4A 3T2OA 2JKEA 3EJUA 3VD5A 3J7HA 3KIIA 4BZFA 3MI6A 2Y73A 3S4DA 3E1F1 1RWAA 3BUPA 2OQEC 1HMUA 3D51A 1K1WA 1NSRA 3QG0A 3RSYA 2WW1A 2XSGA 3X42A 1JOVA 2BT3A 1X1IA 1RWCA 4FNSA 3BUQA 1RWHA 3AMOA 2WGQA 1QAKA 1F1SA 1JZ7A 2ZXQA 1RKYA 1K1YA 2F18A 3EJRA 3T08A 1KSIA 1J0NA 1TXKA 4MMIA 3X40A 3QDEA 3I3EA 3NBBA 1I8QA 1N7OA 3X3YA 1TQSA 3W7SA 3MPHA 1DP0A 2OOVA 1AV4A 2F1AA 2F1BA 3KN4A 1IU7A 1X1JA 4BTXA 1HXKA 2FUTA 1JRQA 1HMWA 3T0DA 1HM3A 3N9HA 1PU4A 1W6CA 2JKAA 4FNRA 3HI7A 1MMYA 1TQUA 2CWVA 2F7RA 3VD3A 1MMZA 3ACTA 3VSMA 1MMXA 1IVXA 3S4AA 3DX1A 1QWNA 1US1A 3K5TA 2XN2A 1JZ4A 1LXMA 2ALWA 1JYXA 1TQWA 1SO0A 3Q1NA 3WA2X 3MUY1 2W0QA 5KBPA 4KTPA 1TQVA 3W7UA
chains in the Genus database with same CATH topology
1X1HA 3T0AA 1OJNA 1JZ3A 2WVZA 5E1QA 4OK4A 3DECA 1LF6A 4NEIA 3E7JA 3TY1A 1NSMA 4DUWA 3NJVA 1PX4A 1NSVA 1MMUA 3T2OA 2JKEA 4TTGA 1EGUA 3VD5A 3VDBA 3J7HA 2CIRA 3OS7A 4BZFA 3ECQA 1NS8A 2FUQA 1JZ8A 3E1F1 3OBAA 3T2QA 1RWAA 1OJMA 1HMUA 2JKPA 1K1WA 1NSRA 3BLCA 2HTAA 3IAQA 2WW1A 2XSGA 1J0MA 3VDCA 3MV11 1JOVA 2D73A 1UG9A 4RNLA 4FNVA 1X1IA 4BZEA 1NS2A 1NS4A 1RW9A 1RWCA 1RWFA 2ZQ0A 3T09A 1C82A 2WVYA 3VD7A 2E22A 1JZ5A 1YQ2A 1JZ6A 1RWGA 1RWHA 2WDAA 2Q1FA 3VD9A 3BGAA 2WVXA 1YGAA 2CISA 3MUZ1 3VDAA 1F1SA 1JZ7A 2ZXQA 1JYNA 1K1YA 1NKGA 3T08A 4BZGA 3A0OA 2WVXB 1J0NA 1TXKA 3IMHA 4MMIA 1NSUA 5A1AA 2BRPA 1JZ2A 1NS0A 3OB8A 3T0BA 1L7KA 2XHNA 3I3EA 1K1XA 3VD4A 5JMDA 1I8QA 1N7OA 2BRVX 1PX3A 3DYMA 4DUVA 3I3BA 1DP0A 1F9GA 1NS7A 4MMHA 4DUXA 1N7QA 3CZJA 3NREA 1N7NA 2WCOA 1X1JA 1N7RA 3VSNA 1Z45A 2BRWA 2FUTA 2CIQA 3AFLA 3SEPA 1HMWA 3T0DA 1HM3A 1OJPA 1F4AA 1OJOA 2WW3A 1CB8A 5JMFA 2HTBA 2JKAA 1MN0A 3BS6A 4J5TA 1NSZA 1L7JA 3DCDA 1MMYA 1W3YA 2E24A 3MV01 3VD3A 1HN0A 1MMZA 3T2PA 1NSSA 3K25A 3VSMA 1MMXA 1NSXA 3A24A 2WZSA 3MWXA 4AQ0A 1JYWA 1ULVA 1LF9A 1JYVA 1LXKA 1F4HA 3WFAA 2WW0A 3IAPA 3NJXA 1JZ4A 1N7PA 1LOHA 3I3DA 1LXMA 3E80A 2X03A 1SNZA 1HM2A 1JYXA 1SO0A 3Q1NA 2WW2A 3DYPA 3MUY1 1HN1A 1LURA 3DYOA 3WVFA 4BZHA 4OK2A 4OJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1H A;  3T0A A;  1OJN A;  1JZ3 A;  2WVZ A;  5E1Q A;  1LF6 A;  3DEC A;  1NSM A;  4DUW A;  3NJV A;  1PX4 A;  1NSV A;  1MMU A;  3T2O A;  2JKE A;  4TTG A;  1EGU A;  3VD5 A;  3VDB A;  3J7H A;  2CIR A;  3OS7 A;  4BZF A;  3ECQ A;  1NS8 A;  1JZ8 A;  3E1F 1;  3OBA A;  3T2Q A;  1RWA A;  1OJM A;  1HMU A;  2JKP A;  1K1W A;  1NSR A;  2HTA A;  3IAQ A;  2WW1 A;  2XSG A;  1J0M A;  3VDC A;  3MV1 1;  1JOV A;  2D73 A;  1UG9 A;  4RNL A;  1X1I A;  4BZE A;  1NS2 A;  1NS4 A;  1RW9 A;  1RWC A;  1RWF A;  2ZQ0 A;  3T09 A;  1C82 A;  2WVY A;  3VD7 A;  2E22 A;  1JZ5 A;  1YQ2 A;  1JZ6 A;  1RWG A;  1RWH A;  2WDA A;  2Q1F A;  3VD9 A;  3BGA A;  2WVX A;  1YGA A;  2CIS A;  3MUZ 1;  3VDA A;  1F1S A;  1JZ7 A;  2ZXQ A;  1JYN A;  1K1Y A;  1NKG A;  3T08 A;  4BZG A;  2WVX B;  1J0N A;  1TXK A;  3IMH A;  1NSU A;  5A1A A;  2BRP A;  1JZ2 A;  1NS0 A;  3OB8 A;  3T0B A;  1L7K A;  2XHN A;  3I3E A;  1K1X A;  3VD4 A;  1I8Q A;  1N7O A;  2BRV X;  1PX3 A;  3DYM A;  4DUV A;  3I3B A;  1DP0 A;  1F9G A;  1NS7 A;  4DUX A;  1N7Q A;  3CZJ A;  3NRE A;  1N7N A;  2WCO A;  1X1J A;  1N7R A;  1Z45 A;  2BRW A;  2CIQ A;  3SEP A;  1HMW A;  3T0D A;  1HM3 A;  1OJP A;  1F4A A;  1OJO A;  2WW3 A;  1CB8 A;  2HTB A;  2JKA A;  1MN0 A;  1NSZ A;  1L7J A;  3DCD A;  1MMY A;  1W3Y A;  2E24 A;  3MV0 1;  3VD3 A;  1HN0 A;  1MMZ A;  3T2P A;  1NSS A;  3K25 A;  1MMX A;  1NSX A;  3A24 A;  2WZS A;  3MWX A;  4AQ0 A;  1JYW A;  1ULV A;  1LF9 A;  1JYV A;  1LXK A;  1F4H A;  3WFA A;  2WW0 A;  3IAP A;  3NJX A;  1JZ4 A;  1N7P A;  1LOH A;  3I3D A;  1LXM A;  2X03 A;  1SNZ A;  1HM2 A;  1JYX A;  1SO0 A;  3Q1N A;  2WW2 A;  3DYP A;  3MUY 1;  1HN1 A;  1LUR A;  3DYO A;  4BZH A; 
#chains in the Genus database with same CATH topology
 3T0A A;  1OJN A;  1JZ3 A;  1SII A;  2WVZ A;  5E1Q A;  3DEC A;  1IQX A;  1W6G A;  3E7J A;  1R34 A;  1EGU A;  3QFZ A;  3D4Z A;  3X3X A;  1SPU A;  3BLB A;  3OS7 A;  3BUD A;  3ECQ A;  1NS8 A;  3AMO B;  1JZ8 A;  3OBA A;  1PS3 A;  3W7T A;  3HIG A;  4FNT A;  1OJM A;  2CWU A;  2E2V A;  3X41 A;  3S4B A;  3BLC A;  3EJP A;  2EAC A;  4FNQ A;  4FNP A;  3VDC A;  1A2V A;  2D73 A;  1UG9 A;  4FNV A;  2CFW A;  4BZE A;  1NS2 A;  1RW9 A;  2CQS A;  1RWF A;  3BVW A;  2WDA A;  1QWU A;  3D50 A;  3BVV A;  2WVX A;  3T0U A;  2F7O A;  1D6Y A;  3HII A;  1NKG A;  2CWT A;  5A1A A;  1RJO A;  2BRP A;  1JZ2 A;  2YFO A;  1TU5 A;  3OB8 A;  1AVL A;  3W7X A;  1K1X A;  1H54 A;  3CV5 A;  4MMH A;  4DUX A;  1D6Z A;  3LVT A;  2WCO A;  1Z45 A;  1QX1 A;  2CIQ A;  2EAD A;  1OJP A;  3D3I A;  1TQT A;  1CB8 A;  2HTB A;  1IVW A;  3BS6 A;  3SXX A;  3MV0 1;  1R33 A;  3T2P A;  3K25 A;  1V7X A;  3DX0 A;  3A24 A;  2WZS A;  3MWX A;  1W5Z A;  4AQ0 A;  1JYW A;  2C10 A;  3CZN A;  3WFA A;  1HTY A;  2XN0 A;  3IAP A;  3NJX A;  4KFF A;  3LOY A;  3E80 A;  2X03 A;  1SNZ A;  2WW2 A;  3DYP A;  3WIQ A;  1IQY A;  4BZH A;  4OJZ A;  1X1H A;  4FNU A;  2OOV C;  2EAB A;  2CQT A;  3NJV A;  1PX4 A;  1NSV A;  3BUI A;  3NBJ A;  4TTG A;  2CIR A;  5GW7 A;  2OW7 A;  3BVX A;  3DX3 A;  3T2Q A;  2JKP A;  1W2Z A;  2F7P A;  2HTA A;  3IAQ A;  3WA3 A;  1J0M A;  3MV1 1;  1IVU A;  2ZQ0 A;  1NS4 A;  1C82 A;  2E22 A;  1JZ5 A;  1YQ2 A;  1JZ6 A;  2WYI A;  3PGB A;  3D4Y A;  3BGA A;  3VDA A;  1YGA A;  2CIS A;  2PNC A;  1V7W A;  1UI7 A;  4BTW A;  3W7W A;  3A0O A;  3IMH A;  1NSU A;  1W4N A;  1NS0 A;  3T0B A;  1L7K A;  2YX9 A;  2XHN A;  3VD4 A;  5JMD A;  2BRV X;  3CZS A;  4KFD A;  3I3B A;  1F9G A;  1N7Q A;  2CFG A;  3DX2 A;  2XN1 A;  1W7C A;  1HWW A;  3CZJ A;  1N7N A;  1QAL A;  3AFL A;  3QFY A;  3SEP A;  2YFN A;  2WW3 A;  2OQE A;  1IVV A;  1V7V A;  3S4C A;  2WYH A;  1NSS A;  1SIH A;  2Y74 A;  1LF9 A;  1JYV A;  1UI8 A;  2WW0 A;  3WIR A;  1LOH A;  3BVT A;  1WMO A;  1WMP A;  1O7D D;  1HN1 A;  1DYU A;  3D52 A;  3RRS A;  1OAC A;  1N9E A;  1QAF A;  3TY1 A;  4KFE A;  1MMU A;  2WOF A;  2D1W A;  3VDB A;  1EKM A;  2FUQ A;  2WO0 A;  2CFK A;  3EJQ A;  2CG1 A;  2CG0 A;  4RNL A;  3T09 A;  2WVY A;  3VD7 A;  2RDY A;  1D6U A;  1RWG A;  2F7Q A;  3ALA A;  2Q1F A;  3VD9 A;  3MUZ 1;  4UFC A;  3SX1 A;  1JYN A;  2FYV A;  4K35 A;  2ZL8 A;  3AFJ A;  4BZG A;  2WVX B;  2OW6 A;  2E2T A;  3X3Z A;  1PX3 A;  3DYM A;  4DUV A;  1NS7 A;  2EAE A;  1AVK A;  4EV5 A;  3EJS A;  3BUB A;  3NRE A;  1N7R A;  5CA3 A;  4K3A A;  3VSN A;  2BRW A;  1F4A A;  1OJO A;  5JMF A;  3ACS A;  1MN0 A;  4J5T A;  1NSZ A;  1L7J A;  3DCD A;  1W3Y A;  3DDG A;  1LVN A;  2E24 A;  3EJT A;  4BTY A;  1HN0 A;  2C11 A;  1NSX A;  1ULV A;  1WMN A;  2WOH A;  1LXK A;  1F4H A;  2E2U A;  2CFL A;  4EV2 A;  1N7P A;  3I3D A;  1HM2 A;  2CFD A;  4KTR A;  1LUR A;  3DYO A;  3WVF A;  4OK2 A;  3BVU A;  1LF6 A;  4OK4 A;  4NEI A;  3DDF A;  1NSM A;  4DUW A;  3DX4 A;  3T2O A;  2JKE A;  3EJU A;  3VD5 A;  3J7H A;  3KII A;  4BZF A;  3MI6 A;  2Y73 A;  3S4D A;  3E1F 1;  1RWA A;  3BUP A;  2OQE C;  1HMU A;  3D51 A;  1K1W A;  1NSR A;  3QG0 A;  3RSY A;  2WW1 A;  2XSG A;  3X42 A;  1JOV A;  2BT3 A;  1X1I A;  1RWC A;  4FNS A;  3BUQ A;  1RWH A;  3AMO A;  2WGQ A;  1QAK A;  1F1S A;  1JZ7 A;  2ZXQ A;  1RKY A;  1K1Y A;  2F18 A;  3EJR A;  3T08 A;  1KSI A;  1J0N A;  1TXK A;  4MMI A;  3X40 A;  3QDE A;  3I3E A;  3NBB A;  1I8Q A;  1N7O A;  3X3Y A;  1TQS A;  3W7S A;  3MPH A;  1DP0 A;  2OOV A;  1AV4 A;  2F1A A;  2F1B A;  3KN4 A;  1IU7 A;  1X1J A;  4BTX A;  1HXK A;  2FUT A;  1JRQ A;  1HMW A;  3T0D A;  1HM3 A;  3N9H A;  1PU4 A;  1W6C A;  2JKA A;  4FNR A;  3HI7 A;  1MMY A;  1TQU A;  2CWV A;  2F7R A;  3VD3 A;  1MMZ A;  3ACT A;  3VSM A;  1MMX A;  1IVX A;  3S4A A;  3DX1 A;  1QWN A;  1US1 A;  3K5T A;  2XN2 A;  1JZ4 A;  1LXM A;  2ALW A;  1JYX A;  1TQW A;  1SO0 A;  3Q1N A;  3WA2 X;  3MUY 1;  2W0Q A;  5KBP A;  4KTP A;  1TQV A;  3W7U A; 
#chains in the Genus database with same CATH homology
 1X1H A;  3T0A A;  1OJN A;  1JZ3 A;  2WVZ A;  5E1Q A;  4OK4 A;  3DEC A;  1LF6 A;  4NEI A;  3E7J A;  3TY1 A;  1NSM A;  4DUW A;  3NJV A;  1PX4 A;  1NSV A;  1MMU A;  3T2O A;  2JKE A;  4TTG A;  1EGU A;  3VD5 A;  3VDB A;  3J7H A;  2CIR A;  3OS7 A;  4BZF A;  3ECQ A;  1NS8 A;  2FUQ A;  1JZ8 A;  3E1F 1;  3OBA A;  3T2Q A;  1RWA A;  1OJM A;  1HMU A;  2JKP A;  1K1W A;  1NSR A;  3BLC A;  2HTA A;  3IAQ A;  2WW1 A;  2XSG A;  1J0M A;  3VDC A;  3MV1 1;  1JOV A;  2D73 A;  1UG9 A;  4RNL A;  4FNV A;  1X1I A;  4BZE A;  1NS2 A;  1NS4 A;  1RW9 A;  1RWC A;  1RWF A;  2ZQ0 A;  3T09 A;  1C82 A;  2WVY A;  3VD7 A;  2E22 A;  1JZ5 A;  1YQ2 A;  1JZ6 A;  1RWG A;  1RWH A;  2WDA A;  2Q1F A;  3VD9 A;  3BGA A;  2WVX A;  1YGA A;  2CIS A;  3MUZ 1;  3VDA A;  1F1S A;  1JZ7 A;  2ZXQ A;  1JYN A;  1K1Y A;  1NKG A;  3T08 A;  4BZG A;  3A0O A;  2WVX B;  1J0N A;  1TXK A;  3IMH A;  4MMI A;  1NSU A;  5A1A A;  2BRP A;  1JZ2 A;  1NS0 A;  3OB8 A;  3T0B A;  1L7K A;  2XHN A;  3I3E A;  1K1X A;  3VD4 A;  5JMD A;  1I8Q A;  1N7O A;  2BRV X;  1PX3 A;  3DYM A;  4DUV A;  3I3B A;  1DP0 A;  1F9G A;  1NS7 A;  4MMH A;  4DUX A;  1N7Q A;  3CZJ A;  3NRE A;  1N7N A;  2WCO A;  1X1J A;  1N7R A;  3VSN A;  1Z45 A;  2BRW A;  2FUT A;  2CIQ A;  3AFL A;  3SEP A;  1HMW A;  3T0D A;  1HM3 A;  1OJP A;  1F4A A;  1OJO A;  2WW3 A;  1CB8 A;  5JMF A;  2HTB A;  2JKA A;  1MN0 A;  3BS6 A;  4J5T A;  1NSZ A;  1L7J A;  3DCD A;  1MMY A;  1W3Y A;  2E24 A;  3MV0 1;  3VD3 A;  1HN0 A;  1MMZ A;  3T2P A;  1NSS A;  3K25 A;  3VSM A;  1MMX A;  1NSX A;  3A24 A;  2WZS A;  3MWX A;  4AQ0 A;  1JYW A;  1ULV A;  1LF9 A;  1JYV A;  1LXK A;  1F4H A;  3WFA A;  2WW0 A;  3IAP A;  3NJX A;  1JZ4 A;  1N7P A;  1LOH A;  3I3D A;  1LXM A;  3E80 A;  2X03 A;  1SNZ A;  1HM2 A;  1JYX A;  1SO0 A;  3Q1N A;  2WW2 A;  3DYP A;  3MUY 1;  1HN1 A;  1LUR A;  3DYO A;  3WVF A;  4BZH A;  4OK2 A;  4OJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...