1MN3A

Cue domain of yeast vps9p
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
54
structure length
54
Chain Sequence
SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAKKSRIEPCVDALLSLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein VPS9
total genus 19
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1mn3A00
1PGYA 1ZV1A 3K9OA 1XXHE 1GO5A 1OKSA 2BWEA 2DZLA 3IHPA 2KNVA 2ZTDA 3E21A 1UFZA 2H5XA 2G3QA 2LVNC 2JY7A 3GLHE 2MR9A 2DAEA 2LVOC 2HWJA 4UN2B 2CWBA 2OO9A 3BBZA 1XB2B 5DFLA 1AIPC 2DNAA 2EKFA 2ZTCA 3E46A 3IECA 1HT1E 2K0BX 2O25A 1DO0A 1QZEA 2R0IA 2MGWA 1T6OA 1VDLA 1Y8GA 2QHOB 1A5TA 3FRIA 3GLIE 1WGLA 1HJPA 1G4AE 1E94E 1EFUB 1TTEA 1YLAA 2RRUA 1VG5A 1NV8A 2DHYA 2JZ1A 3B89A 3H4JA 4R71A 1IFYA 1Q02A 2QSFX 2L4FA 1IM2A 2KHHA 1DO2A 2DAMA 1ZMWA 2JY5A 1VQ1A 2DAIA 1WR1B 3GLGE 3F92A 1G41A 2EKKA 4F2LA 2LVPC 1VEJA 2JY6B 2OOAA 2KNZA 2DAKA 2WZJA 1JR3E 1V92A 3FE3A 1WIVA 2KNAA 4DBGB 3GLFE 2MJ5B 1VEKA 4HEOA 1WHCA 2LBCA 2LVAA 3LCVB 5JI2E 4GEWA 2QNJA 4Q7JA 2JNHA 2B3TA 1HQYE 1NV9A 2HAKA 1CUKA 1OTRA 1T43A 1ZMVA 2DAGA 3LCUA 4F1IA 2JP7A 2L2DA 3MMPA 1MN3A 2DKLA 2LTUA 2OOBA 2MROB 1OQYA 1WJ7A 1ZMUA 2DENA 1G3IA 3FRHA 2K9DA 2CP8A 4WP2A 1KYIA 4G3OA 1F4IA 1C7YA 1OAIA 2DI0A 1IXSA 1R4GA 2EJSA 2BWBA 2L4EA 1P3QQ 3T6PA 2JUJA 1TR8A 2JZ0A 1DV0A 1VEGA 3K9PA 1HT2E 1SG9A 2JY8A 1BVSA 1WGNA 2LVQD
chains in the Genus database with same CATH superfamily
4OVZB 1PGYA 2XEPA 3TQSA 4DV5M 1L2CA 4IBGA 4NL4H 1GO5A 4IBIA 2KRKA 4GHLA 1T3TA 2BWEA 5IT9S 2AHMA 2DZLA 4LG2A 2F4VM 3J7BA 4TUWA 3E21A 4CGYB 4OVZA 1JR3D 3GLHE 1IY1A 4L4UA 4AG5A 4DR5M 2HWJA 4UN2B 4B08A 2CWBA 5DFLA 1DGFA 3KP1E 1C1KA 4DR6M 3IECA 3J81S 3T38A 4LZJA 3GLHB 1N32M 1GABA 3HHWA 4X66M 3EIHA 4BLCA 1XXHA 2QHOB 1Y8GA 3B7NA 3R8FA 3KP0E 3I01M 1W5SA 3QAUA 3U6OA 4LJ7A 5BPVA 4LF9M 2NQ8C 3RE8A 3UK6A 4IJEA 1HJPA 1K3WA 1E94E 1TTEA 3Q8GA 2CV0A 2XZFA 1R6BX 2M5ZA 2QBYB 4CISA 3UZUA 2N35A 1QDRA 3KS4A 1VDDA 1W5TA 2EUCA 3GRYA 4LCBA 4R71A 2C5RA 2VF8A 1IFYA 3HU3A 1IQPA 3U61B 2Q2EB 5C18A 2E5LM 1MU5A 1PRBA 1HQCA 1XHBA 1ZMWA 3E4RA 3LVWA 3U60B 3SYLA 2DAIA 3T1HM 1IN8A 3QYEA 3J80S 3FTCA 3J2PB 2VDBB 4G4OA 2EKKA 5EXSA 1Q39A 3H4MA 2XLJA 4JI1M 2Y0TA 3HWSA 4F2LA 5KO3A 3T1YM 4G6ZA 2JY6B 4RKUF 4LF8M 3FTFA 3GRUA 1IBMM 2KZUA 3NBIA 4LGMA 5H37D 3UGJA 1L2DA 2X49A 2X8AA 3KVWA 3VKHA 2FS1A 3FE3A 4FCWA 3U5ZA 1HR0M 3M6AA 2D7HA 4PT5A 5IZ7D 2OQ4A 4ZPXA 3L27A 4DBGB 5KPRA 1PJTA 1IN4A 1TDHA 3K1JA 3TE6A 3MJ5A 4LFBM 4YY3M 2LH0A 1VEKA 1KFVA 3DFZA 1I94M 4Y28F 4HEOA 3ZQJA 1WHCA 1N75A 2YR0A 1IY0A 3L2AA 3JR5A 1PJQA 1NNJA 4JI8M 2QNJA 4K0KM 2B3TA 1SXJE 3LCUA 1OTRA 1R7RA 4L8RC 3C9PA 4X65M 2QP9X 2RGOA 1TH2A 3A46A 5FTNA 4B3TM 2JP7A 1QQWA 2DVWB 2Z3XA 1K3XA 3VKGA 3PNYA 4JI6M 3KSJA 1IBKM 1ZQ9A 2L2DA 8CATA 3I04M 2LTUA 1JQJC 3B7QA 4ANRA 2MROB 3GLGB 3AV0A 4RNAA 4HL4A 4GC5A 3KDSE 1QDTA 3FRHA 3AL0C 4LJAA 1D0KA 2FH0A 4CJ6A 1KYIA 4DV1M 3B7ZA 3TWKA 4JN6A 3HJSA 3GQ5A 4DUYM 4DR3M 2DZOB 3AOEA 4R7GA 1D2NA 1OFHA 3FTDA 4AW4A 4QNRA 1RU3A 1TR8A 1X37A 3GRVA 4X64M 5EXTA 4DR2M 4JI4M 1ORYB 1Q3BA 4GH9A 3GQ3A 3SFZA 1IN6A 1VEGA 2CE7A 3D8LA 2JY8A 1WGNA 4LY6A 4AKIA 4IJFA 4FWHA 4OX9M 3GPUA 2ZAOA 5EXPA 2DXIA 2L6OA 5FTKA 3K9OA 1XXHE 3E9SA 2I7PA 3IHPA 1L1ZA 1GJTA 3T15A 3SASA 2X4AA 1EIJA 4LJ6A 3I51A 1NHWC 2XSZA 2CV2A 1FJGM 1XB2B 2DWLA 3DA1A 2QCUA 4M9XA 2EKFA 3C3EA 3W67A 3GPXA 3C58A 2ZTCA 4M0WA 1HT1E 3HHYA 3RGPA 4B3RM 2BNKA 2XFSA 2HL7A 2O25A 4NOOB 4XK8F 4M0DA 4BBAA 2HKJA 2R0IA 1AUAA 2CV1A 1T6OA 4ITQA 1VDLA 4MGHA 1J09A 5A2QS 3FYCA 3FYDA 3GLIE 1WGLA 2DZNB 2WSEF 4I8OA 3ZCBB 2F5PA 1XMOM 3Q8XA 5LMNM 4FWGA 4KODA 2MH8A 4KT0F 1VG5A 4FWDA 4FVMA 3R9XB 2YFQA 3ZC7B 1PJSA 4IBDA 3M0EA 4GC9A 2HCBA 2R44A 1GKIA 1Q02A 2QSFX 5EP3A 3GLFA 2ZBKB 3SC3A 2CUZA 4MB7A 4YHHM 2L4FA 3NWLA 4AZFA 3U6DA 1J5EM 2F5QA 3W0FA 2DAMA 1XWIA 1K82A 2F5NA 2WSFF 1WR1B 3LW5F 3VDPA 4KHPM 2VF7A 1E32A 5FTJA 3FUWA 3FUTA 5ITXE 3KFUG 2HHHM 4CIZA 4NSOB 2FNAA 4B7HA 3SAWA 4GITA 3L29A 1V92A 3JAMS 1NY5A 5KQDA 2DWMA 2RGHA 2FE8A 2R46A 4Z8XA 3HU1A 3EIEA 1OAOC 1QVRA 1Z5CA 2MJ5B 1QUSA 4GKKM 3L28A 3JR4A 1OIZA 1MX0A 4IBKA 3ZH9B 4LJ9A 4GEWA 4Q7JA 2C99A 4CHTB 5KPTA 2J5YA 1ZMVA 2C9CA 2DAGA 4M9ZA 1V34A 4F1IA 2JXNA 3I4VA 4QHTA 2KRUA 4IBJA 1JR3A 2LHCA 1QANA 5KPZA 3GLIB 3CF2A 2A5YB 1WJ7A 1ZMUA 3RGSA 1XNQM 3KXEC 2DENA 1QUTA 4FCTA 2H1RA 2KA6B 2CP8A 4R3DA 1LTMA 4PD2A 2UXDM 1OAIA 7CATA 2DI0A 1IXSA 2Y21A 3J27B 1R4GA 5E6JA 2L7IA 2Z7JA 3GRRA 1P3QQ 2ZANA 3GPYA 1N78A 1KSFX 4GKJM 4PDIA 2RKOA 2C96A 3CF0A 2EA0A 3KOWE 2I7NA 5FTLA 3J7AS 2V1CA 4LGYA 2QENA 3VLFB 4M9SA 4WURA 4D82A 4DR4M 1ZV1A 4NRVA 2UU9M 3U6LA 1E9RA 3W68A 3GQ4A 1XXHB 2JA2A 1QAMA 5ITUA 4LFCM 1R2ZA 4L15A 3AOGA 2KNVA 2ZAMA 2ZTDA 3HHXA 4MH0E 3GLHA 2YQZA 1HNZM 3MHVC 5FTMA 2JY7A 5ITTA 3LQQA 5ITQA 2MR9A 2CFOA 2KW0A 2P5TA 4LJ8A 4II7A 3K92A 3U6MA 2OO9A 3BBZA 3D8BA 2UUCM 5FLXS 1IN7A 3CGWA 2JWSA 5FSWA 2XF3A 2ZM6M 1YSYA 5E26A 2O01F 2K0BX 2Y0QA 2VIIA 3TWMA 3U6EA 1IXSB 2UXBM 2C9OA 4MGZE 4Z6YA 1GLNA 2GNOA 4JI2M 2QPAA 1A5TA 2APLA 2EO2A 2WSCF 4PCZA 4B7GA 2XZUA 1IXZA 1HNWM 3WHKA 1NO1A 1GL7A 3GLGA 1DGHB 4IIWA 4FCVA 4I4LA 1G4AE 1Z5BA 2QZ4A 5ITRA 1EFUB 1YLAA 3HGIA 2RRUA 3KOXE 1N77A 4REZA 1EE8A 2KZSA 4DR1M 3A45A 3K8ZA 2VQEM 2DHYA 1SXJB 3AOEC 4QOSA 1NY6A 1OIPA 1S3SA 3VK7A 2FOIC 4L6V6 2JZ1A 4XBOA 3B89A 3H4JA 2CRUA 1OJLA 3THGA 1N34M 5BR8M 5IWAM 2QQ8A 2YNMD 5GKNA 1PM5A 4AKGA 4LRSA 1TH4A 4MM3B 4RF0A 1I4WA 3QWLA 3U5ZB 4BB9A 3FUVA 3KOYE 4RF1A 4L78A 3F92A 1QAOA 1G8PA 4A3VB 1TF0B 4PDGA 4LF5M 5DYGA 1MJGM 2LVPC 1NVMA 1VEJA 4MGYE 2DAKA 2WZJA 2L7HA 4AKHA 2R62A 1N33M 2UUAM 1DGBA 4DUZM 1XNRM 1WIVA 2R65A 5KQ8A 4WW0A 3U60A 4LJ5A 1TDZA 3SARA 4MGKE 4D81A 1G59A 1NJFA 3HX3A 2LNHC 3U61A 3GLFB 3LCVB 5DYIA 3HKPA 1IN5A 3HY5A 1J7KA 4QHSA 2M60A 3SHGB 1IBLM 2JNHA 1ZAEA 1HQYE 3AJIB 3PFIA 1CUKA 1XC8A 1HNXM 4B3SM 1XMQM 3HJ8A 3B74A 3U6CA 1PJIA 2R4EA 4DV2M 3SAVA 4G4QA 3SATA 3MMPA 3FKEA 2DKLA 2R6FA 4P16A 3WHLA 1OQYA 4OW0A 5EP1A 2R18A 1GJSA 3TPZA 2KEBA 1NSFA 1Q3CA 2KXEA 4JYAM 3VFDA 1L2BA 2K9DA 5ITYA 2UUBM 4WP2A 5JI3E 2J7OA 1F4IA 1C7YA 3AFHA 3TWLA 2JUJA 1V33A 3W0LB 4DR7M 1QAQA 3KSXA 1FNNA 2DWNA 1DV0A 2G8LA 4L16A 3AKZA 1OFIA 1SXJD 1HT2E 3K9PA 4JXJA 3B9PA 1GVNA 4JI0M 4QNMA 5EXXA 3HJQA 3M7GA 3ILKA 2OPFA 2K6BA 1OKSA 1NHGC 3VK8A 4GMQA 4FW9A 2CHVA 1UFZA 1R5LA 2G3QA 2H5XA 2LVNC 3GO8A 3SMSA 4DV3M 2DAEA 5F3WA 2FFJA 2LVOC 2R45A 2J7NA 3IG8A 4X62M 1LV7A 3LVVA 4DV0M 4IBEA 1AIPC 1IXRC 2DNAA 5EQTA 3FTEA 3KS8A 3LMMA 3E46A 2LXEA 5LMUM 4IBBA 1QYRA 1DO0A 1QZEA 2C98A 1D0MA 1H6UA 4JV5M 2MGWA 4AI6A 3KW6A 3CTWB 1DGGA 5EJCA 1NJGA 5L8RF 3SMPA 3I4YA 2CHGA 3PVSA 3SBJA 1QZMA 3FRIA 4MGIE 2W82A 3K2LA 1TGUA 4LRTA 2DWZB 5ITXA 2BJVA 2Y20A 1NNUC 1NV8A 4HLQA 1SXJC 3KOZE 1YUBA 3NBXX 3UMMA 3SAUA 3BOSA 2GQFA 3MK6A 2CHQA 3L25A 4D80A 1IM2A 2Z8YM 2XFTA 2KHHA 1DO2A 2BJWA 2KDLA 4GHAA 1Z5AA 1UM8A 4JI5M 4W5WA 2JY5A 1VQ1A 3GLIA 2R4JA 1L8QA 1E9SA 3GLGE 3DZDA 3IG5A 1G41A 2V1UA 4IBCA 5IREB 3SYKA 2D7EA 3UJNA 4EIWA 4NRWA 2K47A 2OOAA 2KNZA 1D0LA 3BXWA 3HU2A 3V76A 1JR3E 4LF4M 4FD2A 1G71A 1Z59A 4G4NA 3CF6E 3QYBA 5EP4A 2KNAA 4JI3M 2DHRA 3GLFE 4AQYM 3PNVA 4GRIA 2UXCM 3C3DA 4I5SA 3DOAA 3A98B 3U6PA 3FUXA 1PJJA 2ERCA 3VDUA 2LBCA 2LVAA 5JI2E 5DNYA 4NSRA 4AG6A 4I81A 4NXNM 4LF7M 1TH3A 1NV9A 2L09A 2D7GA 2HAKA 1T43A 4DV7M 1Z6TA 2QBYA 3HZJA 1YE9A 3A42A 2V6ZM 2XGNA 3GP1A 3FD9A 2VQFM 2LHGA 4G4RA 1GL6A 1JB0F 1MN3A 4QOZC 2OOBA 4LFAM 4NC6A 1IY2A 4GIPA 5EP2A 2XH9A 2O5RA 3RFWA 3PXGA 5C1BA 1G3IA 3U6QA 3HHZA 4S12A 4B7FA 3OTOM 2XSZD 3FUUA 4G3OA 4B3MM 4KLNA 4NXMM 4XGIA 2CEAA 2EJSA 2BWBA 2L4EA 4LZZA 1SXJA 2LWXA 3LQRA 3T6PA 4DV6M 3TL4X 4P17A 2Z4RA 3L26A 3U6SA 2JZ0A 2F5OA 3SHFA 1WXQA 1N36M 2F5SA 4LF6M 4OU7A 2Z4SA 3GPPA 4LJ4A 4DV4M 4IBFA 1SG9A 4KO8A 1DGHA 1BVSA 2LVQD 1R2YA 2G5GX 1L1TA 4JI7M
chains in the Genus database with same CATH topology
1PGYA 1ZV1A 3K9OA 1XXHE 1GO5A 1OKSA 2BWEA 2DZLA 3IHPA 2KNVA 2ZTDA 3E21A 1UFZA 2H5XA 2G3QA 2LVNC 2JY7A 3GLHE 2MR9A 2DAEA 2LVOC 2HWJA 4UN2B 2CWBA 2OO9A 3BBZA 1XB2B 5DFLA 1AIPC 2DNAA 2EKFA 2ZTCA 3E46A 3IECA 1HT1E 2K0BX 2O25A 1DO0A 1QZEA 2R0IA 2MGWA 1T6OA 1VDLA 1Y8GA 2QHOB 1A5TA 3FRIA 3GLIE 1WGLA 1HJPA 1G4AE 1E94E 1EFUB 1TTEA 1YLAA 2RRUA 1VG5A 1NV8A 2DHYA 2JZ1A 3B89A 3H4JA 4R71A 1IFYA 1Q02A 2QSFX 2L4FA 1IM2A 2KHHA 1DO2A 2DAMA 1ZMWA 2JY5A 1VQ1A 2DAIA 1WR1B 3GLGE 3F92A 1G41A 2EKKA 4F2LA 2LVPC 1VEJA 2JY6B 2OOAA 2KNZA 2DAKA 2WZJA 1JR3E 1V92A 3FE3A 1WIVA 2KNAA 4DBGB 3GLFE 2MJ5B 1VEKA 4HEOA 1WHCA 2LBCA 2LVAA 3LCVB 5JI2E 4GEWA 2QNJA 4Q7JA 2JNHA 2B3TA 1HQYE 1NV9A 2HAKA 1CUKA 1OTRA 1T43A 1ZMVA 2DAGA 3LCUA 4F1IA 2JP7A 2L2DA 3MMPA 1MN3A 2DKLA 2LTUA 2OOBA 2MROB 1OQYA 1WJ7A 1ZMUA 2DENA 1G3IA 3FRHA 2K9DA 2CP8A 4WP2A 1KYIA 4G3OA 1F4IA 1C7YA 1OAIA 2DI0A 1IXSA 1R4GA 2EJSA 2BWBA 2L4EA 1P3QQ 3T6PA 2JUJA 1TR8A 2JZ0A 1DV0A 1VEGA 3K9PA 1HT2E 1SG9A 2JY8A 1BVSA 1WGNA 2LVQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGY A;  1ZV1 A;  3K9O A;  1XXH E;  1GO5 A;  1OKS A;  2BWE A;  2DZL A;  3IHP A;  2KNV A;  2ZTD A;  3E21 A;  1UFZ A;  2H5X A;  2G3Q A;  2LVN C;  2JY7 A;  3GLH E;  2MR9 A;  2DAE A;  2LVO C;  2HWJ A;  4UN2 B;  2CWB A;  2OO9 A;  3BBZ A;  1XB2 B;  5DFL A;  1AIP C;  2DNA A;  2EKF A;  2ZTC A;  3E46 A;  3IEC A;  1HT1 E;  2K0B X;  2O25 A;  1DO0 A;  1QZE A;  2R0I A;  2MGW A;  1T6O A;  1VDL A;  1Y8G A;  2QHO B;  1A5T A;  3FRI A;  3GLI E;  1WGL A;  1HJP A;  1G4A E;  1E94 E;  1EFU B;  1TTE A;  1YLA A;  2RRU A;  1VG5 A;  1NV8 A;  2DHY A;  2JZ1 A;  3B89 A;  3H4J A;  4R71 A;  1IFY A;  1Q02 A;  2QSF X;  2L4F A;  1IM2 A;  2KHH A;  1DO2 A;  2DAM A;  1ZMW A;  2JY5 A;  1VQ1 A;  2DAI A;  1WR1 B;  3GLG E;  3F92 A;  1G41 A;  2EKK A;  4F2L A;  2LVP C;  1VEJ A;  2JY6 B;  2OOA A;  2KNZ A;  2DAK A;  2WZJ A;  1JR3 E;  1V92 A;  3FE3 A;  1WIV A;  2KNA A;  4DBG B;  3GLF E;  2MJ5 B;  1VEK A;  4HEO A;  1WHC A;  2LBC A;  2LVA A;  3LCV B;  5JI2 E;  4GEW A;  2QNJ A;  4Q7J A;  2JNH A;  2B3T A;  1HQY E;  1NV9 A;  2HAK A;  1CUK A;  1OTR A;  1T43 A;  1ZMV A;  2DAG A;  3LCU A;  4F1I A;  2JP7 A;  2L2D A;  3MMP A;  1MN3 A;  2DKL A;  2LTU A;  2OOB A;  2MRO B;  1OQY A;  1WJ7 A;  1ZMU A;  2DEN A;  1G3I A;  3FRH A;  2K9D A;  2CP8 A;  4WP2 A;  1KYI A;  4G3O A;  1F4I A;  1C7Y A;  1OAI A;  2DI0 A;  1IXS A;  1R4G A;  2EJS A;  2BWB A;  2L4E A;  1P3Q Q;  3T6P A;  2JUJ A;  1TR8 A;  2JZ0 A;  1DV0 A;  1VEG A;  3K9P A;  1HT2 E;  1SG9 A;  2JY8 A;  1BVS A;  1WGN A;  2LVQ D; 
#chains in the Genus database with same CATH topology
 4OVZ B;  1PGY A;  2XEP A;  3TQS A;  4DV5 M;  1L2C A;  4IBG A;  4NL4 H;  1GO5 A;  4IBI A;  2KRK A;  4GHL A;  1T3T A;  2BWE A;  5IT9 S;  2AHM A;  2DZL A;  4LG2 A;  2F4V M;  3J7B A;  4TUW A;  3E21 A;  4CGY B;  4OVZ A;  1JR3 D;  3GLH E;  1IY1 A;  4L4U A;  4AG5 A;  4DR5 M;  2HWJ A;  4UN2 B;  4B08 A;  2CWB A;  5DFL A;  1DGF A;  3KP1 E;  1C1K A;  4DR6 M;  3IEC A;  3J81 S;  3T38 A;  4LZJ A;  3GLH B;  1N32 M;  1GAB A;  3HHW A;  4X66 M;  3EIH A;  4BLC A;  1XXH A;  2QHO B;  1Y8G A;  3B7N A;  3R8F A;  3KP0 E;  3I01 M;  1W5S A;  3QAU A;  3U6O A;  4LJ7 A;  5BPV A;  4LF9 M;  2NQ8 C;  3RE8 A;  3UK6 A;  4IJE A;  1HJP A;  1K3W A;  1E94 E;  1TTE A;  3Q8G A;  2CV0 A;  2XZF A;  1R6B X;  2M5Z A;  2QBY B;  4CIS A;  3UZU A;  2N35 A;  1QDR A;  3KS4 A;  1VDD A;  1W5T A;  2EUC A;  3GRY A;  4LCB A;  4R71 A;  2C5R A;  2VF8 A;  1IFY A;  3HU3 A;  1IQP A;  3U61 B;  2Q2E B;  5C18 A;  2E5L M;  1MU5 A;  1PRB A;  1HQC A;  1XHB A;  1ZMW A;  3E4R A;  3LVW A;  3U60 B;  3SYL A;  2DAI A;  3T1H M;  1IN8 A;  3QYE A;  3J80 S;  3FTC A;  3J2P B;  2VDB B;  4G4O A;  2EKK A;  5EXS A;  1Q39 A;  3H4M A;  2XLJ A;  4JI1 M;  2Y0T A;  3HWS A;  4F2L A;  5KO3 A;  3T1Y M;  4G6Z A;  2JY6 B;  4RKU F;  4LF8 M;  3FTF A;  3GRU A;  1IBM M;  2KZU A;  3NBI A;  4LGM A;  5H37 D;  3UGJ A;  1L2D A;  2X49 A;  2X8A A;  3KVW A;  3VKH A;  2FS1 A;  3FE3 A;  4FCW A;  3U5Z A;  1HR0 M;  3M6A A;  2D7H A;  4PT5 A;  5IZ7 D;  2OQ4 A;  4ZPX A;  3L27 A;  4DBG B;  5KPR A;  1PJT A;  1IN4 A;  1TDH A;  3K1J A;  3TE6 A;  3MJ5 A;  4LFB M;  4YY3 M;  2LH0 A;  1VEK A;  1KFV A;  3DFZ A;  1I94 M;  4Y28 F;  4HEO A;  3ZQJ A;  1WHC A;  1N75 A;  2YR0 A;  1IY0 A;  3L2A A;  3JR5 A;  1PJQ A;  1NNJ A;  4JI8 M;  2QNJ A;  4K0K M;  2B3T A;  1SXJ E;  3LCU A;  1OTR A;  1R7R A;  4L8R C;  3C9P A;  4X65 M;  2QP9 X;  2RGO A;  1TH2 A;  3A46 A;  5FTN A;  4B3T M;  2JP7 A;  1QQW A;  2DVW B;  2Z3X A;  1K3X A;  3VKG A;  3PNY A;  4JI6 M;  3KSJ A;  1IBK M;  1ZQ9 A;  2L2D A;  8CAT A;  3I04 M;  2LTU A;  1JQJ C;  3B7Q A;  4ANR A;  2MRO B;  3GLG B;  3AV0 A;  4RNA A;  4HL4 A;  4GC5 A;  3KDS E;  1QDT A;  3FRH A;  3AL0 C;  4LJA A;  1D0K A;  2FH0 A;  4CJ6 A;  1KYI A;  4DV1 M;  3B7Z A;  3TWK A;  4JN6 A;  3HJS A;  3GQ5 A;  4DUY M;  4DR3 M;  2DZO B;  3AOE A;  4R7G A;  1D2N A;  1OFH A;  3FTD A;  4AW4 A;  4QNR A;  1RU3 A;  1TR8 A;  1X37 A;  3GRV A;  4X64 M;  5EXT A;  4DR2 M;  4JI4 M;  1ORY B;  1Q3B A;  4GH9 A;  3GQ3 A;  3SFZ A;  1IN6 A;  1VEG A;  2CE7 A;  3D8L A;  2JY8 A;  1WGN A;  4LY6 A;  4AKI A;  4IJF A;  4FWH A;  4OX9 M;  3GPU A;  2ZAO A;  5EXP A;  2DXI A;  2L6O A;  5FTK A;  3K9O A;  1XXH E;  3E9S A;  2I7P A;  3IHP A;  1L1Z A;  1GJT A;  3T15 A;  3SAS A;  2X4A A;  1EIJ A;  4LJ6 A;  3I51 A;  1NHW C;  2XSZ A;  2CV2 A;  1FJG M;  1XB2 B;  2DWL A;  3DA1 A;  2QCU A;  4M9X A;  2EKF A;  3C3E A;  3W67 A;  3GPX A;  3C58 A;  2ZTC A;  4M0W A;  1HT1 E;  3HHY A;  3RGP A;  4B3R M;  2BNK A;  2XFS A;  2HL7 A;  2O25 A;  4NOO B;  4XK8 F;  4M0D A;  4BBA A;  2HKJ A;  2R0I A;  1AUA A;  2CV1 A;  1T6O A;  4ITQ A;  1VDL A;  4MGH A;  1J09 A;  5A2Q S;  3FYC A;  3FYD A;  3GLI E;  1WGL A;  2DZN B;  2WSE F;  4I8O A;  3ZCB B;  2F5P A;  1XMO M;  3Q8X A;  5LMN M;  4FWG A;  4KOD A;  2MH8 A;  4KT0 F;  1VG5 A;  4FWD A;  4FVM A;  3R9X B;  2YFQ A;  3ZC7 B;  1PJS A;  4IBD A;  3M0E A;  4GC9 A;  2HCB A;  2R44 A;  1GKI A;  1Q02 A;  2QSF X;  5EP3 A;  3GLF A;  2ZBK B;  3SC3 A;  2CUZ A;  4MB7 A;  4YHH M;  2L4F A;  3NWL A;  4AZF A;  3U6D A;  1J5E M;  2F5Q A;  3W0F A;  2DAM A;  1XWI A;  1K82 A;  2F5N A;  2WSF F;  1WR1 B;  3LW5 F;  3VDP A;  4KHP M;  2VF7 A;  1E32 A;  5FTJ A;  3FUW A;  3FUT A;  5ITX E;  3KFU G;  2HHH M;  4CIZ A;  4NSO B;  2FNA A;  4B7H A;  3SAW A;  4GIT A;  3L29 A;  1V92 A;  3JAM S;  1NY5 A;  5KQD A;  2DWM A;  2RGH A;  2FE8 A;  2R46 A;  4Z8X A;  3HU1 A;  3EIE A;  1OAO C;  1QVR A;  1Z5C A;  2MJ5 B;  1QUS A;  4GKK M;  3L28 A;  3JR4 A;  1OIZ A;  1MX0 A;  4IBK A;  3ZH9 B;  4LJ9 A;  4GEW A;  4Q7J A;  2C99 A;  4CHT B;  5KPT A;  2J5Y A;  1ZMV A;  2C9C A;  2DAG A;  4M9Z A;  1V34 A;  4F1I A;  2JXN A;  3I4V A;  4QHT A;  2KRU A;  4IBJ A;  1JR3 A;  2LHC A;  1QAN A;  5KPZ A;  3GLI B;  3CF2 A;  2A5Y B;  1WJ7 A;  1ZMU A;  3RGS A;  1XNQ M;  3KXE C;  2DEN A;  1QUT A;  4FCT A;  2H1R A;  2KA6 B;  2CP8 A;  4R3D A;  1LTM A;  4PD2 A;  2UXD M;  1OAI A;  7CAT A;  2DI0 A;  1IXS A;  2Y21 A;  3J27 B;  1R4G A;  5E6J A;  2L7I A;  2Z7J A;  3GRR A;  1P3Q Q;  2ZAN A;  3GPY A;  1N78 A;  1KSF X;  4GKJ M;  4PDI A;  2RKO A;  2C96 A;  3CF0 A;  2EA0 A;  3KOW E;  2I7N A;  5FTL A;  3J7A S;  2V1C A;  4LGY A;  2QEN A;  3VLF B;  4M9S A;  4WUR A;  4D82 A;  4DR4 M;  1ZV1 A;  4NRV A;  2UU9 M;  3U6L A;  1E9R A;  3W68 A;  3GQ4 A;  1XXH B;  2JA2 A;  1QAM A;  5ITU A;  4LFC M;  1R2Z A;  4L15 A;  3AOG A;  2KNV A;  2ZAM A;  2ZTD A;  3HHX A;  4MH0 E;  3GLH A;  2YQZ A;  1HNZ M;  3MHV C;  5FTM A;  2JY7 A;  5ITT A;  3LQQ A;  5ITQ A;  2MR9 A;  2CFO A;  2KW0 A;  2P5T A;  4LJ8 A;  4II7 A;  3K92 A;  3U6M A;  2OO9 A;  3BBZ A;  3D8B A;  2UUC M;  5FLX S;  1IN7 A;  3CGW A;  2JWS A;  5FSW A;  2XF3 A;  2ZM6 M;  1YSY A;  5E26 A;  2O01 F;  2K0B X;  2Y0Q A;  2VII A;  3TWM A;  3U6E A;  1IXS B;  2UXB M;  2C9O A;  4MGZ E;  4Z6Y A;  1GLN A;  2GNO A;  4JI2 M;  2QPA A;  1A5T A;  2APL A;  2EO2 A;  2WSC F;  4PCZ A;  4B7G A;  2XZU A;  1IXZ A;  1HNW M;  3WHK A;  1NO1 A;  1GL7 A;  3GLG A;  1DGH B;  4IIW A;  4FCV A;  4I4L A;  1G4A E;  1Z5B A;  2QZ4 A;  5ITR A;  1EFU B;  1YLA A;  3HGI A;  2RRU A;  3KOX E;  1N77 A;  4REZ A;  1EE8 A;  2KZS A;  4DR1 M;  3A45 A;  3K8Z A;  2VQE M;  2DHY A;  1SXJ B;  3AOE C;  4QOS A;  1NY6 A;  1OIP A;  1S3S A;  3VK7 A;  2FOI C;  4L6V 6;  2JZ1 A;  4XBO A;  3B89 A;  3H4J A;  2CRU A;  1OJL A;  3THG A;  1N34 M;  5BR8 M;  5IWA M;  2QQ8 A;  2YNM D;  5GKN A;  1PM5 A;  4AKG A;  4LRS A;  1TH4 A;  4MM3 B;  4RF0 A;  1I4W A;  3QWL A;  3U5Z B;  4BB9 A;  3FUV A;  3KOY E;  4RF1 A;  4L78 A;  3F92 A;  1QAO A;  1G8P A;  4A3V B;  1TF0 B;  4PDG A;  4LF5 M;  5DYG A;  1MJG M;  2LVP C;  1NVM A;  1VEJ A;  4MGY E;  2DAK A;  2WZJ A;  2L7H A;  4AKH A;  2R62 A;  1N33 M;  2UUA M;  1DGB A;  4DUZ M;  1XNR M;  1WIV A;  2R65 A;  5KQ8 A;  4WW0 A;  3U60 A;  4LJ5 A;  1TDZ A;  3SAR A;  4MGK E;  4D81 A;  1G59 A;  1NJF A;  3HX3 A;  2LNH C;  3U61 A;  3GLF B;  3LCV B;  5DYI A;  3HKP A;  1IN5 A;  3HY5 A;  1J7K A;  4QHS A;  2M60 A;  3SHG B;  1IBL M;  2JNH A;  1ZAE A;  1HQY E;  3AJI B;  3PFI A;  1CUK A;  1XC8 A;  1HNX M;  4B3S M;  1XMQ M;  3HJ8 A;  3B74 A;  3U6C A;  1PJI A;  2R4E A;  4DV2 M;  3SAV A;  4G4Q A;  3SAT A;  3MMP A;  3FKE A;  2DKL A;  2R6F A;  4P16 A;  3WHL A;  1OQY A;  4OW0 A;  5EP1 A;  2R18 A;  1GJS A;  3TPZ A;  2KEB A;  1NSF A;  1Q3C A;  2KXE A;  4JYA M;  3VFD A;  1L2B A;  2K9D A;  5ITY A;  2UUB M;  4WP2 A;  5JI3 E;  2J7O A;  1F4I A;  1C7Y A;  3AFH A;  3TWL A;  2JUJ A;  1V33 A;  3W0L B;  4DR7 M;  1QAQ A;  3KSX A;  1FNN A;  2DWN A;  1DV0 A;  2G8L A;  4L16 A;  3AKZ A;  1OFI A;  1SXJ D;  1HT2 E;  3K9P A;  4JXJ A;  3B9P A;  1GVN A;  4JI0 M;  4QNM A;  5EXX A;  3HJQ A;  3M7G A;  3ILK A;  2OPF A;  2K6B A;  1OKS A;  1NHG C;  3VK8 A;  4GMQ A;  4FW9 A;  2CHV A;  1UFZ A;  1R5L A;  2G3Q A;  2H5X A;  2LVN C;  3GO8 A;  3SMS A;  4DV3 M;  2DAE A;  5F3W A;  2FFJ A;  2LVO C;  2R45 A;  2J7N A;  3IG8 A;  4X62 M;  1LV7 A;  3LVV A;  4DV0 M;  4IBE A;  1AIP C;  1IXR C;  2DNA A;  5EQT A;  3FTE A;  3KS8 A;  3LMM A;  3E46 A;  2LXE A;  5LMU M;  4IBB A;  1QYR A;  1DO0 A;  1QZE A;  2C98 A;  1D0M A;  1H6U A;  4JV5 M;  2MGW A;  4AI6 A;  3KW6 A;  3CTW B;  1DGG A;  5EJC A;  1NJG A;  5L8R F;  3SMP A;  3I4Y A;  2CHG A;  3PVS A;  3SBJ A;  1QZM A;  3FRI A;  4MGI E;  2W82 A;  3K2L A;  1TGU A;  4LRT A;  2DWZ B;  5ITX A;  2BJV A;  2Y20 A;  1NNU C;  1NV8 A;  4HLQ A;  1SXJ C;  3KOZ E;  1YUB A;  3NBX X;  3UMM A;  3SAU A;  3BOS A;  2GQF A;  3MK6 A;  2CHQ A;  3L25 A;  4D80 A;  1IM2 A;  2Z8Y M;  2XFT A;  2KHH A;  1DO2 A;  2BJW A;  2KDL A;  4GHA A;  1Z5A A;  1UM8 A;  4JI5 M;  4W5W A;  2JY5 A;  1VQ1 A;  3GLI A;  2R4J A;  1L8Q A;  1E9S A;  3GLG E;  3DZD A;  3IG5 A;  1G41 A;  2V1U A;  4IBC A;  5IRE B;  3SYK A;  2D7E A;  3UJN A;  4EIW A;  4NRW A;  2K47 A;  2OOA A;  2KNZ A;  1D0L A;  3BXW A;  3HU2 A;  3V76 A;  1JR3 E;  4LF4 M;  4FD2 A;  1G71 A;  1Z59 A;  4G4N A;  3CF6 E;  3QYB A;  5EP4 A;  2KNA A;  4JI3 M;  2DHR A;  3GLF E;  4AQY M;  3PNV A;  4GRI A;  2UXC M;  3C3D A;  4I5S A;  3DOA A;  3A98 B;  3U6P A;  3FUX A;  1PJJ A;  2ERC A;  3VDU A;  2LBC A;  2LVA A;  5JI2 E;  5DNY A;  4NSR A;  4AG6 A;  4I81 A;  4NXN M;  4LF7 M;  1TH3 A;  1NV9 A;  2L09 A;  2D7G A;  2HAK A;  1T43 A;  4DV7 M;  1Z6T A;  2QBY A;  3HZJ A;  1YE9 A;  3A42 A;  2V6Z M;  2XGN A;  3GP1 A;  3FD9 A;  2VQF M;  2LHG A;  4G4R A;  1GL6 A;  1JB0 F;  1MN3 A;  4QOZ C;  2OOB A;  4LFA M;  4NC6 A;  1IY2 A;  4GIP A;  5EP2 A;  2XH9 A;  2O5R A;  3RFW A;  3PXG A;  5C1B A;  1G3I A;  3U6Q A;  3HHZ A;  4S12 A;  4B7F A;  3OTO M;  2XSZ D;  3FUU A;  4G3O A;  4B3M M;  4KLN A;  4NXM M;  4XGI A;  2CEA A;  2EJS A;  2BWB A;  2L4E A;  4LZZ A;  1SXJ A;  2LWX A;  3LQR A;  3T6P A;  4DV6 M;  3TL4 X;  4P17 A;  2Z4R A;  3L26 A;  3U6S A;  2JZ0 A;  2F5O A;  3SHF A;  1WXQ A;  1N36 M;  2F5S A;  4LF6 M;  4OU7 A;  2Z4S A;  3GPP A;  4LJ4 A;  4DV4 M;  4IBF A;  1SG9 A;  4KO8 A;  1DGH A;  1BVS A;  2LVQ D;  1R2Y A;  2G5G X;  1L1T A;  4JI7 M; 
#chains in the Genus database with same CATH homology
 1PGY A;  1ZV1 A;  3K9O A;  1XXH E;  1GO5 A;  1OKS A;  2BWE A;  2DZL A;  3IHP A;  2KNV A;  2ZTD A;  3E21 A;  1UFZ A;  2H5X A;  2G3Q A;  2LVN C;  2JY7 A;  3GLH E;  2MR9 A;  2DAE A;  2LVO C;  2HWJ A;  4UN2 B;  2CWB A;  2OO9 A;  3BBZ A;  1XB2 B;  5DFL A;  1AIP C;  2DNA A;  2EKF A;  2ZTC A;  3E46 A;  3IEC A;  1HT1 E;  2K0B X;  2O25 A;  1DO0 A;  1QZE A;  2R0I A;  2MGW A;  1T6O A;  1VDL A;  1Y8G A;  2QHO B;  1A5T A;  3FRI A;  3GLI E;  1WGL A;  1HJP A;  1G4A E;  1E94 E;  1EFU B;  1TTE A;  1YLA A;  2RRU A;  1VG5 A;  1NV8 A;  2DHY A;  2JZ1 A;  3B89 A;  3H4J A;  4R71 A;  1IFY A;  1Q02 A;  2QSF X;  2L4F A;  1IM2 A;  2KHH A;  1DO2 A;  2DAM A;  1ZMW A;  2JY5 A;  1VQ1 A;  2DAI A;  1WR1 B;  3GLG E;  3F92 A;  1G41 A;  2EKK A;  4F2L A;  2LVP C;  1VEJ A;  2JY6 B;  2OOA A;  2KNZ A;  2DAK A;  2WZJ A;  1JR3 E;  1V92 A;  3FE3 A;  1WIV A;  2KNA A;  4DBG B;  3GLF E;  2MJ5 B;  1VEK A;  4HEO A;  1WHC A;  2LBC A;  2LVA A;  3LCV B;  5JI2 E;  4GEW A;  2QNJ A;  4Q7J A;  2JNH A;  2B3T A;  1HQY E;  1NV9 A;  2HAK A;  1CUK A;  1OTR A;  1T43 A;  1ZMV A;  2DAG A;  3LCU A;  4F1I A;  2JP7 A;  2L2D A;  3MMP A;  1MN3 A;  2DKL A;  2LTU A;  2OOB A;  2MRO B;  1OQY A;  1WJ7 A;  1ZMU A;  2DEN A;  1G3I A;  3FRH A;  2K9D A;  2CP8 A;  4WP2 A;  1KYI A;  4G3O A;  1F4I A;  1C7Y A;  1OAI A;  2DI0 A;  1IXS A;  1R4G A;  2EJS A;  2BWB A;  2L4E A;  1P3Q Q;  3T6P A;  2JUJ A;  1TR8 A;  2JZ0 A;  1DV0 A;  1VEG A;  3K9P A;  1HT2 E;  1SG9 A;  2JY8 A;  1BVS A;  1WGN A;  2LVQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...