1MN3A

Cue domain of yeast vps9p
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
54
structure length
54
Chain Sequence
SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAKKSRIEPCVDALLSLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein VPS9
publication title Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 19
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1mn3A00
3FRIA 2MR9A 2JY8A 1QZEA 1TR8A 3LCVB 3FRHA 1IXSA 4G3OA 5JI2E 4WP2A 4F1IA 1ZMWA 3GLFE 2KNVA 2QNJA 1VDLA 4UN2B 2JY5A 2KNZA 1VEJA 1VQ1A 2R0IA 4Q7JA 1MN3A 1SG9A 1G3IA 1E94E 1IFYA 1HT1E 1WJ7A 2DHYA 2EKFA 2DKLA 2RRUA 2EJSA 1OTRA 1HT2E 1NV8A 2LTUA 1DO0A 1BVSA 2OOBA 3GLIE 2KNAA 2CP8A 2DENA 2JP7A 1NV9A 2H5XA 4GEWA 2L4EA 2DAEA 2DAKA 2EKKA 3FE3A 2LVAA 1DO2A 2JY7A 2CWBA 2LVNC 1XXHE 1ZMVA 2KHHA 1C7YA 2QHOB 2B3TA 2WZJA 3F92A 1A5TA 1Q02A 3IECA 2JZ1A 2JUJA 2MGWA 3GLHE 1PGYA 2LVQD 3B89A 1JR3E 1P3QQ 1G41A 1OKSA 1WGNA 2DI0A 3K9PA 2DZLA 2ZTCA 2BWBA 1F4IA 1XB2B 2HWJA 1VEGA 1V92A 3E46A 3LCUA 2MROB 2OOAA 4DBGB 2LVPC 2K9DA 2O25A 2QSFX 2LBCA 2K0BX 3K9OA 2L4FA 1DV0A 3E21A 2LVOC 3BBZA 4R71A 1G4AE 1CUKA 1ZV1A 2BWEA 1T6OA 1YLAA 1ZMUA 2JY6B 2HAKA 1VG5A 2DAGA 1EFUB 2DAMA 1OAIA 1IM2A 1TTEA 1WIVA 3IHPA 2G3QA 1WHCA 1R4GA 2MJ5B 4HEOA 2OO9A 1WR1B 1OQYA 2JZ0A 1HJPA 2ZTDA 2DAIA 3H4JA 3T6PA 1T43A 1WGLA 1VEKA 1Y8GA 3GLGE 2JNHA 5DFLA 1UFZA 1HQYE 1AIPC 2DNAA 4F2LA 1KYIA 2L2DA 1GO5A 3MMPA
chains in the Genus database with same CATH superfamily
1IY0A 2CHGA 2JY8A 1G71A 2YNMD 3U6PA 4QNRA 1DGGA 1PJTA 1R7RA 2V1CA 3FRHA 4LZZA 5EXSA 1IBLM 2OQ4A 2JWSA 4KT0F 4IBIA 3AKZA 3AL0C 2DZOB 4JXJA 3ZQJA 2VQFM 2G5GX 1J09A 1JQJC 3GRUA 5ITTA 3FUXA 4I5SA 2L6OA 3HHWA 4L15A 2QCUA 2XSZA 2XGNA 2D7GA 2KNZA 2X8AA 3D8BA 4AG6A 1MN3A 1SG9A 2R4EA 3HKPA 4D80A 2ZAMA 3GLHA 4R3DA 5E6JA 2C99A 1GABA 2RRUA 2LWXA 3B9PA 2N35A 3W68A 4OW0A 4LF8M 3DOAA 4YY3M 4B3SM 1BVSA 2FOIC 4P17A 2OOBA 1HNWM 2KNAA 4MGIE 3GRVA 5GKNA 4DV0M 1NV9A 2L09A 3IG8A 4DR1M 4OVZB 2LNHC 3DFZA 4KLNA 3AV0A 3B7ZA 4BBAA 3UGJA 4DUYM 2V1UA 2DAEA 2JXNA 1NO1A 4S12A 3KOWE 3HU1A 1KSFX 4FCVA 3C58A 2KA6B 4LJ7A 5KPZA 1OFHA 2B3TA 1IN4A 2WZJA 5KPTA 2R18A 5A2QS 2E5LM 3ZC7B 4GHAA 5ITYA 2X4AA 3M0EA 2JA2A 4X64M 2MGWA 2XZFA 2G8LA 2LVQD 5EXXA 5FTNA 1JR3E 1P3QQ 4OU7A 1GJTA 3LQRA 1G41A 2WSFF 2C9OA 3RGPA 3PFIA 1HQCA 3I4VA 1L2CA 1R5LA 4CGYB 3FYDA 5ITXA 3SC3A 4MM3B 3SAUA 2L7IA 3U61B 1QYRA 4NOOB 3VFDA 2DXIA 4FWHA 3SATA 4LF5M 1D2NA 2OOAA 3KSJA 1LTMA 1J5EM 3FUUA 2GNOA 1J7KA 3TPZA 2K0BX 4KODA 4NSOB 4R7GA 4JI7M 3BBZA 1XHBA 2I7NA 3HGIA 3FYCA 3K2LA 4QHTA 1HNXM 3HX3A 4LFCM 1CUKA 3SYKA 3PNYA 4DV4M 4REZA 2QBYA 1IXZA 2JY6B 4LF9M 2HAKA 2UUAM 2KRKA 5EQTA 1VG5A 4OX9M 1C1KA 2K47A 3FUTA 5BR8M 2VF8A 1OAIA 1TTEA 1WHCA 4XGIA 1SXJC 1X37A 3GLFA 4HEOA 2J5YA 2LXEA 3U60A 4LRSA 1PRBA 4LRTA 1WR1B 4LFBM 1T43A 3C3DA 3J7BA 3VLFB 3HHZA 1TDHA 3RGSA 1NY5A 1W5SA 1R6BX 2RKOA 3SHGB 1WXQA 4NRWA 1GKIA 2CV0A 3VKHA 4L8RC 1JB0F 1DGFA 3RE8A 1Q3CA 4ITQA 1RU3A 4G6ZA 2QQ8A 4NRVA 1E9SA 1SXJE 3MMPA 3AFHA 3GLIB 4II7A 1S3SA 1OIPA 1Z59A 3J81S 2XEPA 2P5TA 1IXSA 5JI2E 2W82A 4JI5M 4B7GA 4M0WA 2UXCM 2XSZD 2HL7A 4WP2A 2KDLA 1HR0M 3L2AA 1IBKM 4G4QA 1IN7A 2RGOA 2JY5A 3HHXA 3MJ5A 3KW6A 3WHKA 1TGUA 4LJ5A 2Z7JA 3FTFA 1WJ7A 3U6OA 3R9XB 3EIHA 3JAMS 3FTDA 2DKLA 3VK8A 2EJSA 3I4YA 4IBBA 1OTRA 1ZQ9A 2BJWA 4M9XA 5DYGA 3JR4A 1NHGC 3LVVA 1EE8A 2LTUA 2Y21A 2CP8A 2DENA 2JP7A 2FS1A 3QYEA 4L16A 4AQYM 2QENA 4LJ4A 3GQ5A 2L4EA 3KXEC 1D0LA 2UXBM 2EKKA 3FE3A 3T1HM 2BJVA 2LVAA 2QPAA 2CV2A 1GLNA 2CEAA 1QQWA 3B74A 5IREB 1XXHB 8CATA 3GO8A 2R65A 4DV1M 1IN5A 3CF6E 3VDPA 2DWZB 4G4RA 1K3XA 1GL7A 3KS4A 3U6SA 1Q39A 2VDBB 4I81A 3W67A 1N77A 1SXJA 2VF7A 2R4JA 4GRIA 3FTEA 2QZ4A 5E26A 5KPRA 5L8RF 3GLHB 4RNAA 1T3TA 5EP4A 1QVRA 1N33M 3I04M 1V33A 3A45A 4LY6A 3WHLA 3KFUG 2DZLA 2ZTCA 1GVNA 5FTKA 1I94M 3R8FA 1PJJA 4L78A 4AG5A 2Q2EB 1HNZM 1NJGA 3KVWA 3Q8GA 4GKJM 1XB2B 2FH0A 3U6MA 1IN6A 4X65M 3E46A 3TWKA 2L7HA 5BPVA 1QDTA 2O5RA 1FJGM 2LVPC 3GLGA 4JN6A 1L2BA 1Z5CA 4NL4H 4BB9A 1XWIA 3L26A 5C18A 4DUZM 3K9OA 4K0KM 2L4FA 4NC6A 5EXPA 1LV7A 2LVOC 2CFOA 4LF6M 4NXMM 3FD9A 2X49A 2R46A 2DWLA 4P16A 2LH0A 1T6OA 4JI6M 4M9SA 2YR0A 3L28A 1QAQA 7CATA 4CHTB 2FFJA 3VKGA 2DAGA 4DR4M 1DGBA 3DZDA 4LFAM 4IBFA 2DAMA 3SASA 1EIJA 1XMQM 3GPYA 5H37D 1G8PA 2XZUA 4WURA 2O01F 4DV3M 3U6CA 3J2PB 4FW9A 2J7NA 2QP9X 1N34M 2UUBM 2KXEA 1NVMA 3GPPA 1OQYA 4LJ8A 3AOEA 3E4RA 4BLCA 3UK6A 4CIZA 4EIWA 1PM5A 2C98A 3LMMA 2UUCM 3I01M 4LCBA 1K3WA 1YSYA 4RF1A 1Y8GA 4GC9A 4QHSA 3SFZA 3KOZE 3E9SA 3KSXA 5DFLA 3GRRA 4MGZE 1AIPC 2I7PA 2DWNA 1GJSA 4DR7M 4D81A 3GQ4A 1QDRA 1KYIA 3C3EA 3SMSA 3BXWA 1V34A 3W0LB 5EJCA 2QBYB 1TR8A 1NNUC 2OPFA 3U61A 1FNNA 3T1YM 1L1TA 4LGYA 3A46A 3FTCA 4I4LA 3MK6A 2UXDM 2C5RA 1ZMWA 3W0FA 3SAVA 3GLFB 4M0DA 1XNQM 2KNVA 4MGYE 3U60B 2QNJA 4LJ6A 1XC8A 2A5YB 1E32A 4UN2B 2D7HA 3HHYA 1VEJA 1VQ1A 2R0IA 2KZUA 4Q7JA 2DHRA 2KZSA 3UMMA 1G3IA 3JR5A 3L27A 1GL6A 2DHYA 1DGHA 3T38A 1JR3A 3B7NA 2KRUA 4B7HA 1NV8A 4JV5M 3QAUA 1E9RA 4AW4A 3GP1A 4LG2A 2H5XA 1MU5A 4IIWA 2Y0TA 3KOXE 2GQFA 4LF7M 1QZMA 1IXSB 1MJGM 3FKEA 2Z4RA 1NHWC 2LHGA 2EUCA 1DO2A 4Z8XA 1IN8A 3NBIA 3NWLA 2LVNC 1XXHE 1ZMVA 2KHHA 1C7YA 2QHOB 4FCTA 4PD2A 2F4VM 1YUBA 1IY1A 3K8ZA 1Q02A 3GPXA 3U5ZA 4QOSA 1ORYB 4LF4M 2ERCA 2R44A 4RF0A 2JUJA 4QOZC 3QYBA 3VDUA 2DWMA 3GLHE 1PGYA 3H4MA 5IZ7D 4DR3M 3CF0A 1TH2A 2FE8A 3D8LA 5JI3E 3OTOM 3SARA 1NSFA 1WGNA 2DI0A 3K9PA 4FWDA 3PNVA 4NSRA 3J27B 3RFWA 5LMNM 2CRUA 3PXGA 2BWBA 4AI6A 4B7FA 1H6UA 3B7QA 1VEGA 2NQ8C 3LCUA 2MROB 2CUZA 4DV2M 2EO2A 1IXRC 2VIIA 4DBGB 3SHFA 3ZH9B 5KO3A 3FUWA 3K92A 2DZNB 3TE6A 4FVMA 4HL4A 4XK8F 4PDGA 3KP1E 4DV7M 3THGA 2FNAA 2LBCA 4FD2A 1DV0A 4R71A 3A98B 4I8OA 4L4UA 3L25A 1G4AE 4B08A 1MX0A 2XFTA 2Y0QA 2XLJA 3T15A 1YLAA 1OIZA 1TH4A 4IBKA 2HHHM 3ZCBB 3TL4X 2YQZA 3KS8A 2K6BA 2Z8YM 4GIPA 5ITQA 1WIVA 1Z6TA 2C96A 1R4GA 2MJ5B 2YFQA 2APLA 1XXHA 4GKKM 5ITXE 1N78A 2JZ0A 2ZTDA 2DVWB 4KO8A 3T6PA 4D82A 2F5QA 5EXTA 2R45A 4LGMA 2F5PA 3GQ3A 3U6DA 3GLGB 2XF3A 3ILKA 3C9PA 4DR6M 4X62M 4JI0M 1UFZA 1HQYE 4A3VB 4CJ6A 4PCZA 5DYIA 4F2LA 2Y20A 1Z5BA 3FRIA 2MR9A 2H1RA 2WSCF 4GMQA 3SAWA 2VQEM 1QZEA 1VDDA 3LCVB 4IBEA 4OVZA 3SBJA 1QANA 2R6FA 1K82A 1TDZA 3HJSA 4MGKE 4AKHA 3GPUA 4G3OA 1R2ZA 1L2DA 4B3TM 3SMPA 4G4NA 3KDSE 3KOYE 1D0MA 3AOGA 2XH9A 3PVSA 3IG5A 1TH3A 4F1IA 3GLFE 2WSEF 4IBGA 3U6EA 1VDLA 2CHQA 1JR3D 1D0KA 4FCWA 1NY6A 3CF2A 1N36M 1AUAA 1E94E 1IBMM 1HT1E 2F5SA 1IFYA 2J7OA 3KP0E 2EKFA 5IWAM 2ZANA 4JI3M 2M5ZA 4XBOA 1HT2E 2D7EA 4GH9A 5EP3A 1DO0A 4PT5A 4AKIA 1IY2A 4GC5A 5C1BA 3GLIE 2CE7A 3LW5F 4LJAA 4DV5M 4CISA 4B3RM 5FLXS 2BNKA 1XMOM 4LJ9A 4LZJA 1QUSA 4GEWA 4B3MM 4YHHM 2ZM6M 2DAKA 4GITA 2R62A 2ZBKB 2JY7A 1OFIA 4L6V6 2CWBA 2F5OA 3CGWA 4JI1M 4PDIA 1QUTA 3GRYA 3M7GA 3A42A 3F92A 3SYLA 2Z3XA 5ITUA 1A5TA 4G4OA 3IECA 5IT9S 1YE9A 4ZPXA 1L1ZA 3J7AS 2CV1A 2JZ1A 3HY5A 2HCBA 3V76A 5EP2A 3BOSA 1QAMA 1UM8A 2LHCA 4JI8M 3B89A 5FTLA 1DGHB 1NJFA 3I51A 4W5WA 2M60A 2MH8A 1PJIA 5FTJA 1OKSA 5DNYA 3UJNA 4JYAM 4X66M 2UU9M 5EP1A 3VK7A 1PJSA 4IJFA 5F3WA 3J80S 1ZAEA 4IBDA 4QNMA 2F5NA 2KW0A 4JI4M 3FUVA 4TUWA 1F4IA 3HJQA 2AHMA 3CTWB 4ANRA 2HWJA 1QAOA 1V92A 3HU2A 3HWSA 1TF0B 3NBXX 2K9DA 2O25A 2V6ZM 3HJ8A 4MH0E 1SXJD 5KQDA 3AJIB 3LQQA 1OJLA 2QSFX 3TWMA 3TWLA 1I4WA 1XNRM 1N32M 3E21A 2CHVA 3HU3A 4MGHA 1ZV1A 4DR5M 3U5ZB 2BWEA 3TQSA 5LMUM 3U6QA 2KEBA 3GLIA 1ZMUA 2ZAOA 3UZUA 4IBJA 2HKJA 5FSWA 4KHPM 1EFUB 4FWGA 4M9ZA 1R2YA 1NNJA 2C9CA 2Z4SA 3HZJA 1IM2A 2XFSA 3IHPA 2RGHA 2G3QA 3Q8XA 4MB7A 1KFVA 3M6AA 5KQ8A 3DA1A 1IQPA 4AZFA 3MHVC 3QWLA 4GHLA 1Q3BA 2OO9A 5FTMA 1G59A 4DV6M 1HJPA 2DAIA 3H4JA 4JI2M 1WGLA 3EIEA 1VEKA 4RKUF 1PJQA 4WW0A 1W5TA 2EA0A 1L8QA 3GLGE 4IBCA 4AKGA 2JNHA 3U6LA 3L29A 3LVWA 4IJEA 3K1JA 1OAOC 4HLQA 1Z5AA 1N75A 4Z6YA 4DR2M 4Y28F 2DNAA 3AOEC 1SXJB 5ITRA 2L2DA 1GO5A 4NXNM
chains in the Genus database with same CATH topology
3FRIA 2MR9A 2JY8A 1QZEA 1TR8A 3LCVB 3FRHA 1IXSA 4G3OA 5JI2E 4WP2A 4F1IA 1ZMWA 3GLFE 2KNVA 2QNJA 1VDLA 4UN2B 2JY5A 2KNZA 1VEJA 1VQ1A 2R0IA 4Q7JA 1MN3A 1SG9A 1G3IA 1E94E 1IFYA 1HT1E 1WJ7A 2DHYA 2EKFA 2DKLA 2RRUA 2EJSA 1OTRA 1HT2E 1NV8A 2LTUA 1DO0A 1BVSA 2OOBA 3GLIE 2KNAA 2CP8A 2DENA 2JP7A 1NV9A 2H5XA 4GEWA 2L4EA 2DAEA 2DAKA 2EKKA 3FE3A 2LVAA 1DO2A 2JY7A 2CWBA 2LVNC 1XXHE 1ZMVA 2KHHA 1C7YA 2QHOB 2B3TA 2WZJA 3F92A 1A5TA 1Q02A 3IECA 2JZ1A 2JUJA 2MGWA 3GLHE 1PGYA 2LVQD 3B89A 1JR3E 1P3QQ 1G41A 1OKSA 1WGNA 2DI0A 3K9PA 2DZLA 2ZTCA 2BWBA 1F4IA 1XB2B 2HWJA 1VEGA 1V92A 3E46A 3LCUA 2MROB 2OOAA 4DBGB 2LVPC 2K9DA 2O25A 2QSFX 2LBCA 2K0BX 3K9OA 2L4FA 1DV0A 3E21A 2LVOC 3BBZA 4R71A 1G4AE 1CUKA 1ZV1A 2BWEA 1T6OA 1YLAA 1ZMUA 2JY6B 2HAKA 1VG5A 2DAGA 1EFUB 2DAMA 1OAIA 1IM2A 1TTEA 1WIVA 3IHPA 2G3QA 1WHCA 1R4GA 2MJ5B 4HEOA 2OO9A 1WR1B 1OQYA 2JZ0A 1HJPA 2ZTDA 2DAIA 3H4JA 3T6PA 1T43A 1WGLA 1VEKA 1Y8GA 3GLGE 2JNHA 5DFLA 1UFZA 1HQYE 1AIPC 2DNAA 4F2LA 1KYIA 2L2DA 1GO5A 3MMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FRI A;  2MR9 A;  2JY8 A;  1QZE A;  1TR8 A;  3LCV B;  3FRH A;  1IXS A;  4G3O A;  5JI2 E;  4WP2 A;  4F1I A;  1ZMW A;  3GLF E;  2KNV A;  2QNJ A;  1VDL A;  4UN2 B;  2JY5 A;  2KNZ A;  1VEJ A;  1VQ1 A;  2R0I A;  4Q7J A;  1MN3 A;  1SG9 A;  1G3I A;  1E94 E;  1IFY A;  1HT1 E;  1WJ7 A;  2DHY A;  2EKF A;  2DKL A;  2RRU A;  2EJS A;  1OTR A;  1HT2 E;  1NV8 A;  2LTU A;  1DO0 A;  1BVS A;  2OOB A;  3GLI E;  2KNA A;  2CP8 A;  2DEN A;  2JP7 A;  1NV9 A;  2H5X A;  4GEW A;  2L4E A;  2DAE A;  2DAK A;  2EKK A;  3FE3 A;  2LVA A;  1DO2 A;  2JY7 A;  2CWB A;  2LVN C;  1XXH E;  1ZMV A;  2KHH A;  1C7Y A;  2QHO B;  2B3T A;  2WZJ A;  3F92 A;  1A5T A;  1Q02 A;  3IEC A;  2JZ1 A;  2JUJ A;  2MGW A;  3GLH E;  1PGY A;  2LVQ D;  3B89 A;  1JR3 E;  1P3Q Q;  1G41 A;  1OKS A;  1WGN A;  2DI0 A;  3K9P A;  2DZL A;  2ZTC A;  2BWB A;  1F4I A;  1XB2 B;  2HWJ A;  1VEG A;  1V92 A;  3E46 A;  3LCU A;  2MRO B;  2OOA A;  4DBG B;  2LVP C;  2K9D A;  2O25 A;  2QSF X;  2LBC A;  2K0B X;  3K9O A;  2L4F A;  1DV0 A;  3E21 A;  2LVO C;  3BBZ A;  4R71 A;  1G4A E;  1CUK A;  1ZV1 A;  2BWE A;  1T6O A;  1YLA A;  1ZMU A;  2JY6 B;  2HAK A;  1VG5 A;  2DAG A;  1EFU B;  2DAM A;  1OAI A;  1IM2 A;  1TTE A;  1WIV A;  3IHP A;  2G3Q A;  1WHC A;  1R4G A;  2MJ5 B;  4HEO A;  2OO9 A;  1WR1 B;  1OQY A;  2JZ0 A;  1HJP A;  2ZTD A;  2DAI A;  3H4J A;  3T6P A;  1T43 A;  1WGL A;  1VEK A;  1Y8G A;  3GLG E;  2JNH A;  5DFL A;  1UFZ A;  1HQY E;  1AIP C;  2DNA A;  4F2L A;  1KYI A;  2L2D A;  1GO5 A;  3MMP A; 
#chains in the Genus database with same CATH topology
 1IY0 A;  2CHG A;  2JY8 A;  1G71 A;  2YNM D;  3U6P A;  4QNR A;  1DGG A;  1PJT A;  1R7R A;  2V1C A;  3FRH A;  4LZZ A;  5EXS A;  1IBL M;  2OQ4 A;  2JWS A;  4KT0 F;  4IBI A;  3AKZ A;  3AL0 C;  2DZO B;  4JXJ A;  3ZQJ A;  2VQF M;  2G5G X;  1J09 A;  1JQJ C;  3GRU A;  5ITT A;  3FUX A;  4I5S A;  2L6O A;  3HHW A;  4L15 A;  2QCU A;  2XSZ A;  2XGN A;  2D7G A;  2KNZ A;  2X8A A;  3D8B A;  4AG6 A;  1MN3 A;  1SG9 A;  2R4E A;  3HKP A;  4D80 A;  2ZAM A;  3GLH A;  4R3D A;  5E6J A;  2C99 A;  1GAB A;  2RRU A;  2LWX A;  3B9P A;  2N35 A;  3W68 A;  4OW0 A;  4LF8 M;  3DOA A;  4YY3 M;  4B3S M;  1BVS A;  2FOI C;  4P17 A;  2OOB A;  1HNW M;  2KNA A;  4MGI E;  3GRV A;  5GKN A;  4DV0 M;  1NV9 A;  2L09 A;  3IG8 A;  4DR1 M;  4OVZ B;  2LNH C;  3DFZ A;  4KLN A;  3AV0 A;  3B7Z A;  4BBA A;  3UGJ A;  4DUY M;  2V1U A;  2DAE A;  2JXN A;  1NO1 A;  4S12 A;  3KOW E;  3HU1 A;  1KSF X;  4FCV A;  3C58 A;  2KA6 B;  4LJ7 A;  5KPZ A;  1OFH A;  2B3T A;  1IN4 A;  2WZJ A;  5KPT A;  2R18 A;  5A2Q S;  2E5L M;  3ZC7 B;  4GHA A;  5ITY A;  2X4A A;  3M0E A;  2JA2 A;  4X64 M;  2MGW A;  2XZF A;  2G8L A;  2LVQ D;  5EXX A;  5FTN A;  1JR3 E;  1P3Q Q;  4OU7 A;  1GJT A;  3LQR A;  1G41 A;  2WSF F;  2C9O A;  3RGP A;  3PFI A;  1HQC A;  3I4V A;  1L2C A;  1R5L A;  4CGY B;  3FYD A;  5ITX A;  3SC3 A;  4MM3 B;  3SAU A;  2L7I A;  3U61 B;  1QYR A;  4NOO B;  3VFD A;  2DXI A;  4FWH A;  3SAT A;  4LF5 M;  1D2N A;  2OOA A;  3KSJ A;  1LTM A;  1J5E M;  3FUU A;  2GNO A;  1J7K A;  3TPZ A;  2K0B X;  4KOD A;  4NSO B;  4R7G A;  4JI7 M;  3BBZ A;  1XHB A;  2I7N A;  3HGI A;  3FYC A;  3K2L A;  4QHT A;  1HNX M;  3HX3 A;  4LFC M;  1CUK A;  3SYK A;  3PNY A;  4DV4 M;  4REZ A;  2QBY A;  1IXZ A;  2JY6 B;  4LF9 M;  2HAK A;  2UUA M;  2KRK A;  5EQT A;  1VG5 A;  4OX9 M;  1C1K A;  2K47 A;  3FUT A;  5BR8 M;  2VF8 A;  1OAI A;  1TTE A;  1WHC A;  4XGI A;  1SXJ C;  1X37 A;  3GLF A;  4HEO A;  2J5Y A;  2LXE A;  3U60 A;  4LRS A;  1PRB A;  4LRT A;  1WR1 B;  4LFB M;  1T43 A;  3C3D A;  3J7B A;  3VLF B;  3HHZ A;  1TDH A;  3RGS A;  1NY5 A;  1W5S A;  1R6B X;  2RKO A;  3SHG B;  1WXQ A;  4NRW A;  1GKI A;  2CV0 A;  3VKH A;  4L8R C;  1JB0 F;  1DGF A;  3RE8 A;  1Q3C A;  4ITQ A;  1RU3 A;  4G6Z A;  2QQ8 A;  4NRV A;  1E9S A;  1SXJ E;  3MMP A;  3AFH A;  3GLI B;  4II7 A;  1S3S A;  1OIP A;  1Z59 A;  3J81 S;  2XEP A;  2P5T A;  1IXS A;  5JI2 E;  2W82 A;  4JI5 M;  4B7G A;  4M0W A;  2UXC M;  2XSZ D;  2HL7 A;  4WP2 A;  2KDL A;  1HR0 M;  3L2A A;  1IBK M;  4G4Q A;  1IN7 A;  2RGO A;  2JY5 A;  3HHX A;  3MJ5 A;  3KW6 A;  3WHK A;  1TGU A;  4LJ5 A;  2Z7J A;  3FTF A;  1WJ7 A;  3U6O A;  3R9X B;  3EIH A;  3JAM S;  3FTD A;  2DKL A;  3VK8 A;  2EJS A;  3I4Y A;  4IBB A;  1OTR A;  1ZQ9 A;  2BJW A;  4M9X A;  5DYG A;  3JR4 A;  1NHG C;  3LVV A;  1EE8 A;  2LTU A;  2Y21 A;  2CP8 A;  2DEN A;  2JP7 A;  2FS1 A;  3QYE A;  4L16 A;  4AQY M;  2QEN A;  4LJ4 A;  3GQ5 A;  2L4E A;  3KXE C;  1D0L A;  2UXB M;  2EKK A;  3FE3 A;  3T1H M;  2BJV A;  2LVA A;  2QPA A;  2CV2 A;  1GLN A;  2CEA A;  1QQW A;  3B74 A;  5IRE B;  1XXH B;  8CAT A;  3GO8 A;  2R65 A;  4DV1 M;  1IN5 A;  3CF6 E;  3VDP A;  2DWZ B;  4G4R A;  1K3X A;  1GL7 A;  3KS4 A;  3U6S A;  1Q39 A;  2VDB B;  4I81 A;  3W67 A;  1N77 A;  1SXJ A;  2VF7 A;  2R4J A;  4GRI A;  3FTE A;  2QZ4 A;  5E26 A;  5KPR A;  5L8R F;  3GLH B;  4RNA A;  1T3T A;  5EP4 A;  1QVR A;  1N33 M;  3I04 M;  1V33 A;  3A45 A;  4LY6 A;  3WHL A;  3KFU G;  2DZL A;  2ZTC A;  1GVN A;  5FTK A;  1I94 M;  3R8F A;  1PJJ A;  4L78 A;  4AG5 A;  2Q2E B;  1HNZ M;  1NJG A;  3KVW A;  3Q8G A;  4GKJ M;  1XB2 B;  2FH0 A;  3U6M A;  1IN6 A;  4X65 M;  3E46 A;  3TWK A;  2L7H A;  5BPV A;  1QDT A;  2O5R A;  1FJG M;  2LVP C;  3GLG A;  4JN6 A;  1L2B A;  1Z5C A;  4NL4 H;  4BB9 A;  1XWI A;  3L26 A;  5C18 A;  4DUZ M;  3K9O A;  4K0K M;  2L4F A;  4NC6 A;  5EXP A;  1LV7 A;  2LVO C;  2CFO A;  4LF6 M;  4NXM M;  3FD9 A;  2X49 A;  2R46 A;  2DWL A;  4P16 A;  2LH0 A;  1T6O A;  4JI6 M;  4M9S A;  2YR0 A;  3L28 A;  1QAQ A;  7CAT A;  4CHT B;  2FFJ A;  3VKG A;  2DAG A;  4DR4 M;  1DGB A;  3DZD A;  4LFA M;  4IBF A;  2DAM A;  3SAS A;  1EIJ A;  1XMQ M;  3GPY A;  5H37 D;  1G8P A;  2XZU A;  4WUR A;  2O01 F;  4DV3 M;  3U6C A;  3J2P B;  4FW9 A;  2J7N A;  2QP9 X;  1N34 M;  2UUB M;  2KXE A;  1NVM A;  3GPP A;  1OQY A;  4LJ8 A;  3AOE A;  3E4R A;  4BLC A;  3UK6 A;  4CIZ A;  4EIW A;  1PM5 A;  2C98 A;  3LMM A;  2UUC M;  3I01 M;  4LCB A;  1K3W A;  1YSY A;  4RF1 A;  1Y8G A;  4GC9 A;  4QHS A;  3SFZ A;  3KOZ E;  3E9S A;  3KSX A;  5DFL A;  3GRR A;  4MGZ E;  1AIP C;  2I7P A;  2DWN A;  1GJS A;  4DR7 M;  4D81 A;  3GQ4 A;  1QDR A;  1KYI A;  3C3E A;  3SMS A;  3BXW A;  1V34 A;  3W0L B;  5EJC A;  2QBY B;  1TR8 A;  1NNU C;  2OPF A;  3U61 A;  1FNN A;  3T1Y M;  1L1T A;  4LGY A;  3A46 A;  3FTC A;  4I4L A;  3MK6 A;  2UXD M;  2C5R A;  1ZMW A;  3W0F A;  3SAV A;  3GLF B;  4M0D A;  1XNQ M;  2KNV A;  4MGY E;  3U60 B;  2QNJ A;  4LJ6 A;  1XC8 A;  2A5Y B;  1E32 A;  4UN2 B;  2D7H A;  3HHY A;  1VEJ A;  1VQ1 A;  2R0I A;  2KZU A;  4Q7J A;  2DHR A;  2KZS A;  3UMM A;  1G3I A;  3JR5 A;  3L27 A;  1GL6 A;  2DHY A;  1DGH A;  3T38 A;  1JR3 A;  3B7N A;  2KRU A;  4B7H A;  1NV8 A;  4JV5 M;  3QAU A;  1E9R A;  4AW4 A;  3GP1 A;  4LG2 A;  2H5X A;  1MU5 A;  4IIW A;  2Y0T A;  3KOX E;  2GQF A;  4LF7 M;  1QZM A;  1IXS B;  1MJG M;  3FKE A;  2Z4R A;  1NHW C;  2LHG A;  2EUC A;  1DO2 A;  4Z8X A;  1IN8 A;  3NBI A;  3NWL A;  2LVN C;  1XXH E;  1ZMV A;  2KHH A;  1C7Y A;  2QHO B;  4FCT A;  4PD2 A;  2F4V M;  1YUB A;  1IY1 A;  3K8Z A;  1Q02 A;  3GPX A;  3U5Z A;  4QOS A;  1ORY B;  4LF4 M;  2ERC A;  2R44 A;  4RF0 A;  2JUJ A;  4QOZ C;  3QYB A;  3VDU A;  2DWM A;  3GLH E;  1PGY A;  3H4M A;  5IZ7 D;  4DR3 M;  3CF0 A;  1TH2 A;  2FE8 A;  3D8L A;  5JI3 E;  3OTO M;  3SAR A;  1NSF A;  1WGN A;  2DI0 A;  3K9P A;  4FWD A;  3PNV A;  4NSR A;  3J27 B;  3RFW A;  5LMN M;  2CRU A;  3PXG A;  2BWB A;  4AI6 A;  4B7F A;  1H6U A;  3B7Q A;  1VEG A;  2NQ8 C;  3LCU A;  2MRO B;  2CUZ A;  4DV2 M;  2EO2 A;  1IXR C;  2VII A;  4DBG B;  3SHF A;  3ZH9 B;  5KO3 A;  3FUW A;  3K92 A;  2DZN B;  3TE6 A;  4FVM A;  4HL4 A;  4XK8 F;  4PDG A;  3KP1 E;  4DV7 M;  3THG A;  2FNA A;  2LBC A;  4FD2 A;  1DV0 A;  4R71 A;  3A98 B;  4I8O A;  4L4U A;  3L25 A;  1G4A E;  4B08 A;  1MX0 A;  2XFT A;  2Y0Q A;  2XLJ A;  3T15 A;  1YLA A;  1OIZ A;  1TH4 A;  4IBK A;  2HHH M;  3ZCB B;  3TL4 X;  2YQZ A;  3KS8 A;  2K6B A;  2Z8Y M;  4GIP A;  5ITQ A;  1WIV A;  1Z6T A;  2C96 A;  1R4G A;  2MJ5 B;  2YFQ A;  2APL A;  1XXH A;  4GKK M;  5ITX E;  1N78 A;  2JZ0 A;  2ZTD A;  2DVW B;  4KO8 A;  3T6P A;  4D82 A;  2F5Q A;  5EXT A;  2R45 A;  4LGM A;  2F5P A;  3GQ3 A;  3U6D A;  3GLG B;  2XF3 A;  3ILK A;  3C9P A;  4DR6 M;  4X62 M;  4JI0 M;  1UFZ A;  1HQY E;  4A3V B;  4CJ6 A;  4PCZ A;  5DYI A;  4F2L A;  2Y20 A;  1Z5B A;  3FRI A;  2MR9 A;  2H1R A;  2WSC F;  4GMQ A;  3SAW A;  2VQE M;  1QZE A;  1VDD A;  3LCV B;  4IBE A;  4OVZ A;  3SBJ A;  1QAN A;  2R6F A;  1K82 A;  1TDZ A;  3HJS A;  4MGK E;  4AKH A;  3GPU A;  4G3O A;  1R2Z A;  1L2D A;  4B3T M;  3SMP A;  4G4N A;  3KDS E;  3KOY E;  1D0M A;  3AOG A;  2XH9 A;  3PVS A;  3IG5 A;  1TH3 A;  4F1I A;  3GLF E;  2WSE F;  4IBG A;  3U6E A;  1VDL A;  2CHQ A;  1JR3 D;  1D0K A;  4FCW A;  1NY6 A;  3CF2 A;  1N36 M;  1AUA A;  1E94 E;  1IBM M;  1HT1 E;  2F5S A;  1IFY A;  2J7O A;  3KP0 E;  2EKF A;  5IWA M;  2ZAN A;  4JI3 M;  2M5Z A;  4XBO A;  1HT2 E;  2D7E A;  4GH9 A;  5EP3 A;  1DO0 A;  4PT5 A;  4AKI A;  1IY2 A;  4GC5 A;  5C1B A;  3GLI E;  2CE7 A;  3LW5 F;  4LJA A;  4DV5 M;  4CIS A;  4B3R M;  5FLX S;  2BNK A;  1XMO M;  4LJ9 A;  4LZJ A;  1QUS A;  4GEW A;  4B3M M;  4YHH M;  2ZM6 M;  2DAK A;  4GIT A;  2R62 A;  2ZBK B;  2JY7 A;  1OFI A;  4L6V 6;  2CWB A;  2F5O A;  3CGW A;  4JI1 M;  4PDI A;  1QUT A;  3GRY A;  3M7G A;  3A42 A;  3F92 A;  3SYL A;  2Z3X A;  5ITU A;  1A5T A;  4G4O A;  3IEC A;  5IT9 S;  1YE9 A;  4ZPX A;  1L1Z A;  3J7A S;  2CV1 A;  2JZ1 A;  3HY5 A;  2HCB A;  3V76 A;  5EP2 A;  3BOS A;  1QAM A;  1UM8 A;  2LHC A;  4JI8 M;  3B89 A;  5FTL A;  1DGH B;  1NJF A;  3I51 A;  4W5W A;  2M60 A;  2MH8 A;  1PJI A;  5FTJ A;  1OKS A;  5DNY A;  3UJN A;  4JYA M;  4X66 M;  2UU9 M;  5EP1 A;  3VK7 A;  1PJS A;  4IJF A;  5F3W A;  3J80 S;  1ZAE A;  4IBD A;  4QNM A;  2F5N A;  2KW0 A;  4JI4 M;  3FUV A;  4TUW A;  1F4I A;  3HJQ A;  2AHM A;  3CTW B;  4ANR A;  2HWJ A;  1QAO A;  1V92 A;  3HU2 A;  3HWS A;  1TF0 B;  3NBX X;  2K9D A;  2O25 A;  2V6Z M;  3HJ8 A;  4MH0 E;  1SXJ D;  5KQD A;  3AJI B;  3LQQ A;  1OJL A;  2QSF X;  3TWM A;  3TWL A;  1I4W A;  1XNR M;  1N32 M;  3E21 A;  2CHV A;  3HU3 A;  4MGH A;  1ZV1 A;  4DR5 M;  3U5Z B;  2BWE A;  3TQS A;  5LMU M;  3U6Q A;  2KEB A;  3GLI A;  1ZMU A;  2ZAO A;  3UZU A;  4IBJ A;  2HKJ A;  5FSW A;  4KHP M;  1EFU B;  4FWG A;  4M9Z A;  1R2Y A;  1NNJ A;  2C9C A;  2Z4S A;  3HZJ A;  1IM2 A;  2XFS A;  3IHP A;  2RGH A;  2G3Q A;  3Q8X A;  4MB7 A;  1KFV A;  3M6A A;  5KQ8 A;  3DA1 A;  1IQP A;  4AZF A;  3MHV C;  3QWL A;  4GHL A;  1Q3B A;  2OO9 A;  5FTM A;  1G59 A;  4DV6 M;  1HJP A;  2DAI A;  3H4J A;  4JI2 M;  1WGL A;  3EIE A;  1VEK A;  4RKU F;  1PJQ A;  4WW0 A;  1W5T A;  2EA0 A;  1L8Q A;  3GLG E;  4IBC A;  4AKG A;  2JNH A;  3U6L A;  3L29 A;  3LVW A;  4IJE A;  3K1J A;  1OAO C;  4HLQ A;  1Z5A A;  1N75 A;  4Z6Y A;  4DR2 M;  4Y28 F;  2DNA A;  3AOE C;  1SXJ B;  5ITR A;  2L2D A;  1GO5 A;  4NXN M; 
#chains in the Genus database with same CATH homology
 3FRI A;  2MR9 A;  2JY8 A;  1QZE A;  1TR8 A;  3LCV B;  3FRH A;  1IXS A;  4G3O A;  5JI2 E;  4WP2 A;  4F1I A;  1ZMW A;  3GLF E;  2KNV A;  2QNJ A;  1VDL A;  4UN2 B;  2JY5 A;  2KNZ A;  1VEJ A;  1VQ1 A;  2R0I A;  4Q7J A;  1MN3 A;  1SG9 A;  1G3I A;  1E94 E;  1IFY A;  1HT1 E;  1WJ7 A;  2DHY A;  2EKF A;  2DKL A;  2RRU A;  2EJS A;  1OTR A;  1HT2 E;  1NV8 A;  2LTU A;  1DO0 A;  1BVS A;  2OOB A;  3GLI E;  2KNA A;  2CP8 A;  2DEN A;  2JP7 A;  1NV9 A;  2H5X A;  4GEW A;  2L4E A;  2DAE A;  2DAK A;  2EKK A;  3FE3 A;  2LVA A;  1DO2 A;  2JY7 A;  2CWB A;  2LVN C;  1XXH E;  1ZMV A;  2KHH A;  1C7Y A;  2QHO B;  2B3T A;  2WZJ A;  3F92 A;  1A5T A;  1Q02 A;  3IEC A;  2JZ1 A;  2JUJ A;  2MGW A;  3GLH E;  1PGY A;  2LVQ D;  3B89 A;  1JR3 E;  1P3Q Q;  1G41 A;  1OKS A;  1WGN A;  2DI0 A;  3K9P A;  2DZL A;  2ZTC A;  2BWB A;  1F4I A;  1XB2 B;  2HWJ A;  1VEG A;  1V92 A;  3E46 A;  3LCU A;  2MRO B;  2OOA A;  4DBG B;  2LVP C;  2K9D A;  2O25 A;  2QSF X;  2LBC A;  2K0B X;  3K9O A;  2L4F A;  1DV0 A;  3E21 A;  2LVO C;  3BBZ A;  4R71 A;  1G4A E;  1CUK A;  1ZV1 A;  2BWE A;  1T6O A;  1YLA A;  1ZMU A;  2JY6 B;  2HAK A;  1VG5 A;  2DAG A;  1EFU B;  2DAM A;  1OAI A;  1IM2 A;  1TTE A;  1WIV A;  3IHP A;  2G3Q A;  1WHC A;  1R4G A;  2MJ5 B;  4HEO A;  2OO9 A;  1WR1 B;  1OQY A;  2JZ0 A;  1HJP A;  2ZTD A;  2DAI A;  3H4J A;  3T6P A;  1T43 A;  1WGL A;  1VEK A;  1Y8G A;  3GLG E;  2JNH A;  5DFL A;  1UFZ A;  1HQY E;  1AIP C;  2DNA A;  4F2L A;  1KYI A;  2L2D A;  1GO5 A;  3MMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...