1MN3A

Cue domain of yeast vps9p
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
54
structure length
54
Chain Sequence
SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAKKSRIEPCVDALLSLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein VPS9
publication title Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 19
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1mn3A00
1MN3A 1WJ7A 2DNAA 1VDLA 2ZTDA 1P3QQ 1KYIA 1G4AE 2LBCA 4Q7JA 1WR1B 2BWBA 2OOAA 1C7YA 4DBGB 1ZMUA 2JZ0A 1TR8A 2DHYA 2OO9A 4F1IA 4GEWA 2DAGA 2L2DA 2LVQD 3FRIA 2EJSA 4R71A 1NV8A 1AIPC 4HEOA 1XB2B 1R4GA 5JI2E 2RRUA 1HJPA 2BWEA 2CWBA 1WIVA 2MR9A 2H5XA 1HQYE 1EFUB 4G3OA 1HT2E 1DO0A 1E94E 1VEJA 2LVNC 1YLAA 1HT1E 1DO2A 1WGNA 1Q02A 3GLFE 2DI0A 2JY8A 1V92A 3IHPA 1GO5A 1NV9A 2G3QA 2DZLA 1VQ1A 1IM2A 2MROB 1OAIA 3H4JA 3GLHE 1SG9A 2LTUA 1PGYA 1VEKA 3K9OA 3IECA 2QNJA 3E46A 3MMPA 3LCVB 2EKKA 1XXHE 3GLGE 3FE3A 1OQYA 2JNHA 1ZMVA 2JZ1A 1WGLA 2K9DA 2JY5A 1IXSA 1JR3E 3B89A 2KNAA 2EKFA 3T6PA 3BBZA 2JY7A 2JY6B 2LVAA 1T43A 2KNZA 1VEGA 1VG5A 1WHCA 2HAKA 2WZJA 3K9PA 1OTRA 2CP8A 2L4EA 2O25A 1T6OA 1BVSA 4WP2A 2DKLA 1F4IA 1ZV1A 2DAIA 2LVOC 2K0BX 1TTEA 3FRHA 1Y8GA 1IFYA 2LVPC 1CUKA 2R0IA 2DAMA 5DFLA 2QSFX 2KNVA 4UN2B 2MJ5B 2ZTCA 4F2LA 2B3TA 1G3IA 3F92A 2DAKA 2JUJA 1UFZA 2QHOB 2MGWA 1OKSA 2L4FA 3E21A 2JP7A 3GLIE 1A5TA 3LCUA 2DAEA 2OOBA 1G41A 1QZEA 1ZMWA 2HWJA 1DV0A 2DENA 2KHHA
chains in the Genus database with same CATH superfamily
2LNHC 5FTKA 3L27A 3I04M 3U5ZB 2CRUA 3KS4A 3V76A 2DNAA 3LQQA 3FTDA 4DR1M 4RKUF 4B3TM 3SC3A 1VDLA 3UK6A 4AW4A 2UXDM 5DYIA 1L1ZA 4AKIA 4LF9M 4HLQA 1IY2A 2R4EA 4JI7M 1HR0M 4AQYM 5E6JA 4HL4A 3HU3A 1N77A 1K3WA 1C7YA 3HJSA 2NQ8C 1L2DA 2Y21A 3D8LA 5FLXS 1DGFA 4CHTB 3KVWA 4WW0A 2XSZD 4LJ7A 2V6ZM 2XFSA 1IN6A 4I4LA 3KXEC 1QZMA 2R45A 3K1JA 4LF7M 3FD9A 4QOZC 1XB2B 3PNYA 3T1HM 1H6UA 2BWEA 3K92A 4G4NA 2MR9A 3B9PA 1PJQA 8CATA 1HQYE 2LH0A 1GABA 1EFUB 3ZQJA 2FNAA 1XC8A 1Z5AA 1DO0A 3FYDA 5L8RF 1TH3A 2UXCM 1XXHA 1WGNA 4GKJM 2R4JA 2DI0A 1V92A 2ZANA 4PT5A 2VF8A 4FD2A 3THGA 2G3QA 1JR3D 2G5GX 2J5YA 3DZDA 2UUAM 1ZQ9A 1IM2A 3GLHE 1JR3A 4PDIA 2X4AA 4IBEA 1PGYA 2C98A 2KXEA 1NJGA 2Q2EB 2M5ZA 1QAMA 1IN7A 1QUSA 1MJGM 5H37D 3HX3A 4NRVA 3R8FA 2C9CA 1LTMA 3FE3A 4LGMA 3U6SA 2K47A 2JNHA 3GLHA 1ZMVA 4B08A 3Q8GA 3D8BA 1QANA 3M7GA 1W5TA 2JY5A 1XXHB 3OTOM 3VDPA 1OJLA 3LVVA 3CF2A 5EXSA 2J7NA 3GP1A 3BBZA 2FH0A 5EP3A 3QYBA 3DA1A 3L28A 4DV7M 3QYEA 4LF4M 3HGIA 1NHGC 3WHKA 3U6QA 1T43A 2KNZA 2DHRA 3TQSA 3K9PA 3MK6A 4NSRA 4DV2M 1N33M 1T3TA 1NSFA 4AG5A 2R44A 1Q3BA 2HKJA 3FUTA 3K8ZA 4WURA 1L2CA 2F5NA 4JI4M 1HNWM 3GLHB 2DAIA 2LVOC 3I4YA 5ITTA 3GRRA 4IBDA 1XHBA 4MGIE 3VKGA 1TTEA 4B3MM 3L29A 2DWZB 3J80S 5C18A 5KO3A 4IBGA 4Z6YA 4OVZA 3PNVA 1IBMM 1G3IA 3F92A 3SHGB 2JUJA 3UJNA 2QHOB 1N34M 2KZSA 2LWXA 3BOSA 3L25A 1OKSA 3TPZA 5FTLA 2BJVA 4GC5A 1QYRA 2N35A 2ZAMA 1A5TA 2L6OA 4PD2A 3LCUA 1XNQM 1QAQA 3M0EA 4D81A 1QZEA 3KSXA 5FTMA 4AZFA 1DV0A 4LJ8A 4JI1M 5ITYA 1WJ7A 3GPUA 3VDUA 1TDZA 4YHHM 1R5LA 5FTNA 2R65A 3GPYA 4QNMA 4P17A 4MGHA 4JN6A 3J7BA 4LGYA 4CISA 4RF0A 1IY1A 2KW0A 1NNJA 1G4AE 3TWLA 4Q7JA 1WR1B 1L8QA 4LJ6A 2OOAA 3SMSA 4FW9A 1GJTA 2CHVA 5EXXA 2JZ0A 1TR8A 4L78A 2DZOB 4FWHA 1PJIA 3B7QA 4X64M 4L6V6 4I8OA 2Y0TA 3HKPA 4OU7A 2DAGA 5IZ7D 5LMUM 2EJSA 3HWSA 4R71A 2DXIA 2YFQA 4HEOA 4KO8A 5GKNA 4BLCA 4GITA 4K0KM 1EIJA 2ERCA 1R4GA 3B7ZA 1TF0B 2RRUA 1HJPA 1WIVA 3RGPA 5JI2E 3Q8XA 4GKKM 4CIZA 3TWKA 2H5XA 3M6AA 1R6BX 2K6BA 3FTEA 1SXJD 2APLA 4DR2M 3RE8A 4GIPA 4B3RM 5IREB 3QWLA 2UXBM 1DO2A 1OAOC 3AOGA 2OQ4A 2AHMA 4RNAA 4FCWA 1D0MA 2JY8A 3IHPA 3FUXA 1L2BA 3SFZA 1NV9A 2F4VM 2YNMD 3B74A 1VQ1A 3J2PB 4GH9A 4L15A 3GQ4A 2X8AA 3A98B 4DR3M 2UUCM 4ITQA 2LTUA 4TUWA 3GO8A 3SMPA 1JB0F 2XSZA 3MMPA 3GPXA 1YE9A 2EKKA 1XXHE 5KPTA 4JYAM 3GLGE 3SAWA 3IG8A 2QCUA 1DGBA 2JZ1A 3E9SA 4MH0E 2LXEA 3LMMA 4L4UA 3AV0A 2K9DA 1Z59A 3UGJA 2XH9A 2VIIA 2WSCF 4DR5M 2HL7A 3FUUA 1QAOA 1JR3E 2ZAOA 5LMNM 3B89A 2KNAA 4XBOA 4DR6M 1OIPA 2EKFA 2QP9X 5IT9S 3GLGA 2I7NA 3J27B 4JI0M 3L2AA 3U6EA 4NRWA 4AI6A 1HNXM 4I81A 4OX9M 2C99A 2JY6B 1GJSA 3MHVC 3ZH9B 4DV0M 4DV3M 2R62A 1TGUA 1FJGM 2WZJA 4OW0A 4QNRA 3U6DA 1G71A 1TH4A 2I7PA 1R2ZA 3AOEA 3SAUA 1XMOM 4AKGA 1T6OA 4NSOB 4FWDA 4ZPXA 1QQWA 4L16A 5EP1A 2C96A 1PM5A 1N75A 5EXTA 2DAMA 1NVMA 5DFLA 1WXQA 2JWSA 3U6OA 2MJ5B 4G4OA 3VLFB 4DV4M 5C1BA 3KOZE 4XK8F 3GLGB 1R2YA 2L09A 4KHPM 2MH8A 3TWMA 3RGSA 2L4FA 3U6PA 2CHGA 5BR8M 3E21A 2JP7A 4LRSA 4MGKE 3DOAA 2DAEA 2XZUA 1GVNA 3CGWA 4LY6A 1ZMWA 4IJFA 3U6LA 4X65M 2DENA 4JV5M 3WHLA 1MN3A 4EIWA 1PJSA 3GLIB 1N36M 2D7GA 2VDBB 3HHWA 3KP0E 4GHAA 5E26A 2VQFM 1QDTA 5JI3E 1OFHA 1D0LA 4D82A 3UMMA 3ZCBB 1MX0A 2ZTDA 4GHLA 1FNNA 2FOIC 1KYIA 2KA6B 2LHGA 3NBIA 5ITXA 3W0FA 2LBCA 3SHFA 3FKEA 3UZUA 2BWBA 3GRYA 1IQPA 4DBGB 2UU9M 3HY5A 2D7HA 1YUBA 4LJ4A 4CJ6A 5KQDA 2DHYA 2OO9A 2XGNA 1Z5CA 1MU5A 3AOEC 4F1IA 1XNRM 4AKHA 4NOOB 3NBXX 1VDDA 2DZNB 2L2DA 1D2NA 2LVQD 4RF1A 1IBLM 3I01M 1IY0A 3HHXA 4IBCA 1NV8A 2RGHA 4YY3M 5F3WA 4ANRA 3ILKA 3VKHA 5EP2A 4IBJA 1HQCA 3CF6E 3IG5A 4M9SA 3A45A 1DGHA 2CV2A 2R46A 3K2LA 1OFIA 2OPFA 1UM8A 4NXMM 3JAMS 1Q39A 1W5SA 3KS8A 4I5SA 1Q02A 1DGGA 3VK8A 1V34A 4Y28F 2R18A 1GO5A 2O5RA 2EUCA 4FWGA 5EJCA 3LW5F 2YQZA 5EQTA 4II7A 2CFOA 3ZC7B 1OAIA 3H4JA 3PFIA 4REZA 3W0LB 4X66M 1SG9A 3HJ8A 3C58A 5KQ8A 2FE8A 1XWIA 3SAVA 1VEKA 4XGIA 2QNJA 4QHTA 3E46A 2KEBA 3LCVB 2XLJA 4M9XA 1SXJE 4B3SM 3H4MA 1IN8A 3KOXE 3U60B 1DGHB 2VF7A 4Z8XA 1GKIA 1N32M 1GL7A 3J81S 4JI6M 1AUAA 4LF8M 1WGLA 4A3VB 1IXRC 1NJFA 2Y0QA 1NNUC 3GQ5A 4LFBM 1QVRA 1YSYA 1SXJA 5EXPA 3HHYA 5KPRA 4X62M 2DWMA 1I4WA 5IWAM 1Z6TA 3SBJA 4IIWA 3SYLA 1VEGA 3KOYE 3A42A 1WHCA 1E32A 2HAKA 4GC9A 1EE8A 4DR4M 3SARA 1OTRA 2CP8A 2O25A 3KDSE 1NO1A 4CGYB 4DV5M 3U61A 1BVSA 4FVMA 4JI8M 1F4IA 2L7IA 1G59A 3I51A 4GMQA 4R7GA 3U6CA 4BBAA 3FRHA 1Y8GA 3SYKA 2F5QA 4LFCM 2R0IA 3T15A 2QSFX 3TE6A 1G8PA 4UN2B 3PXGA 3BXWA 1QDRA 4F2LA 3AL0C 1SXJB 5ITRA 3EIEA 2XF3A 2B3TA 4FCVA 3CTWB 4IBFA 4KLNA 2A5YB 2R6FA 4KT0F 4QHSA 3HHZA 1UFZA 2QQ8A 4IBBA 4JXJA 2M60A 1L1TA 1NHWC 2H1RA 3GRVA 5BPVA 1N78A 5FTJA 3T1YM 4M0WA 3GLIE 3TL4X 2J7OA 1IN4A 3C3DA 1JQJC 1V33A 2KRKA 4PCZA 1IBKM 3U61B 4LFAM 1E9RA 2CEAA 3C3EA 2RKOA 2KHHA 4P16A 1PRBA 1K3XA 3KFUG 3FTFA 4G4QA 3GLIA 1J09A 1SXJC 2FS1A 2X49A 3DFZA 3I4VA 4IJEA 4LF5M 2C9OA 3VFDA 4B7GA 1GL6A 3KP1E 1D0KA 1P3QQ 4B7HA 3GQ3A 5DNYA 2CUZA 2XEPA 3HU1A 2Z7JA 1PJTA 4LZJA 3MJ5A 3GPPA 1ZMUA 4DV1M 3A46A 4LRTA 4GRIA 3FUVA 1R7RA 2P5TA 4MGZE 3VK7A 4GEWA 2DWNA 2V1UA 3LQRA 1OIZA 3FTCA 3FRIA 2JXNA 5EP4A 4MGYE 4D80A 4PDGA 4JI2M 2UUBM 1AIPC 3J7AS 2G8LA 3AFHA 5ITXE 2CWBA 2Z3XA 4G4RA 2HCBA 3RFWA 1NY6A 1TH2A 2CHQA 3B7NA 4NC6A 4G3OA 1HT2E 4LZZA 4BB9A 4DUYM 1QUTA 2O01F 2QPAA 1HNZM 1E94E 1VEJA 2LVNC 2WSEF 1YLAA 2XFTA 3HZJA 1PJJA 1HT1E 4L8RC 2V1CA 3FYCA 4S12A 3GLFE 4LJ9A 2VQEM 2GNOA 1J7KA 4LJAA 3W67A 3KOWE 1NY5A 4NL4H 2KZUA 2DZLA 2QZ4A 1K82A 4LJ5A 2CV0A 3FUWA 4IBIA 2MROB 3EIHA 2QENA 4MM3B 5KPZA 2F5OA 4M9ZA 2D7EA 3W68A 2C5RA 2W82A 4QOSA 3K9OA 4JI3M 3GLFA 1X37A 3IECA 1E9SA 3T38A 4JI5M 3HU2A 4M0DA 4B7FA 2FFJA 3AJIB 1OQYA 2F5SA 3AKZA 3U60A 3CF0A 3L26A 2Z4RA 1KFVA 3SATA 2Y20A 2CV1A 1IN5A 3HJQA 4FCTA 1IXSA 3SASA 2CE7A 2KDLA 4AG6A 2WSFF 2QBYA 3T6PA 2JA2A 4LCBA 2EO2A 1J5EM 2JY7A 4LF6M 4R3DA 2LVAA 3JR5A 2BJWA 2F5PA 1VG5A 4MB7A 3GLFB 2LHCA 5ITQA 2ZM6M 2L4EA 3R9XB 4G6ZA 1I94M 3NWLA 3C9PA 3GRUA 2HHHM 1TDHA 4WP2A 2DKLA 2DVWB 1ZV1A 2GQFA 4IBKA 5A2QS 1LV7A 3U5ZA 1Q3CA 3PVSA 4KODA 2K0BX 2XZFA 3KSJA 1IFYA 2LVPC 1CUKA 4DR7M 2KRUA 4OVZB 1IXSB 5ITUA 4DV6M 2KNVA 1XMQM 2RGOA 3LVWA 2ZTCA 5DYGA 2QBYB 3U6MA 1C1KA 1ORYB 2Z8YM 2DAKA 3QAUA 2BNKA 1RU3A 2Z4SA 1S3SA 3JR4A 5FSWA 1Z5BA 1KSFX 1GLNA 2MGWA 3KW6A 2E5LM 2YR0A 4NXNM 7CATA 4DUZM 3E4RA 2DWLA 1ZAEA 4W5WA 2EA0A 2OOBA 1G41A 2ZBKB 4LG2A 2HWJA 1IXZA 2L7HA
chains in the Genus database with same CATH topology
1MN3A 1WJ7A 2DNAA 1VDLA 2ZTDA 1P3QQ 1KYIA 1G4AE 2LBCA 4Q7JA 1WR1B 2BWBA 2OOAA 1C7YA 4DBGB 1ZMUA 2JZ0A 1TR8A 2DHYA 2OO9A 4F1IA 4GEWA 2DAGA 2L2DA 2LVQD 3FRIA 2EJSA 4R71A 1NV8A 1AIPC 4HEOA 1XB2B 1R4GA 5JI2E 2RRUA 1HJPA 2BWEA 2CWBA 1WIVA 2MR9A 2H5XA 1HQYE 1EFUB 4G3OA 1HT2E 1DO0A 1E94E 1VEJA 2LVNC 1YLAA 1HT1E 1DO2A 1WGNA 1Q02A 3GLFE 2DI0A 2JY8A 1V92A 3IHPA 1GO5A 1NV9A 2G3QA 2DZLA 1VQ1A 1IM2A 2MROB 1OAIA 3H4JA 3GLHE 1SG9A 2LTUA 1PGYA 1VEKA 3K9OA 3IECA 2QNJA 3E46A 3MMPA 3LCVB 2EKKA 1XXHE 3GLGE 3FE3A 1OQYA 2JNHA 1ZMVA 2JZ1A 1WGLA 2K9DA 2JY5A 1IXSA 1JR3E 3B89A 2KNAA 2EKFA 3T6PA 3BBZA 2JY7A 2JY6B 2LVAA 1T43A 2KNZA 1VEGA 1VG5A 1WHCA 2HAKA 2WZJA 3K9PA 1OTRA 2CP8A 2L4EA 2O25A 1T6OA 1BVSA 4WP2A 2DKLA 1F4IA 1ZV1A 2DAIA 2LVOC 2K0BX 1TTEA 3FRHA 1Y8GA 1IFYA 2LVPC 1CUKA 2R0IA 2DAMA 5DFLA 2QSFX 2KNVA 4UN2B 2MJ5B 2ZTCA 4F2LA 2B3TA 1G3IA 3F92A 2DAKA 2JUJA 1UFZA 2QHOB 2MGWA 1OKSA 2L4FA 3E21A 2JP7A 3GLIE 1A5TA 3LCUA 2DAEA 2OOBA 1G41A 1QZEA 1ZMWA 2HWJA 1DV0A 2DENA 2KHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MN3 A;  1WJ7 A;  2DNA A;  1VDL A;  2ZTD A;  1P3Q Q;  1KYI A;  1G4A E;  2LBC A;  4Q7J A;  1WR1 B;  2BWB A;  2OOA A;  1C7Y A;  4DBG B;  1ZMU A;  2JZ0 A;  1TR8 A;  2DHY A;  2OO9 A;  4F1I A;  4GEW A;  2DAG A;  2L2D A;  2LVQ D;  3FRI A;  2EJS A;  4R71 A;  1NV8 A;  1AIP C;  4HEO A;  1XB2 B;  1R4G A;  5JI2 E;  2RRU A;  1HJP A;  2BWE A;  2CWB A;  1WIV A;  2MR9 A;  2H5X A;  1HQY E;  1EFU B;  4G3O A;  1HT2 E;  1DO0 A;  1E94 E;  1VEJ A;  2LVN C;  1YLA A;  1HT1 E;  1DO2 A;  1WGN A;  1Q02 A;  3GLF E;  2DI0 A;  2JY8 A;  1V92 A;  3IHP A;  1GO5 A;  1NV9 A;  2G3Q A;  2DZL A;  1VQ1 A;  1IM2 A;  2MRO B;  1OAI A;  3H4J A;  3GLH E;  1SG9 A;  2LTU A;  1PGY A;  1VEK A;  3K9O A;  3IEC A;  2QNJ A;  3E46 A;  3MMP A;  3LCV B;  2EKK A;  1XXH E;  3GLG E;  3FE3 A;  1OQY A;  2JNH A;  1ZMV A;  2JZ1 A;  1WGL A;  2K9D A;  2JY5 A;  1IXS A;  1JR3 E;  3B89 A;  2KNA A;  2EKF A;  3T6P A;  3BBZ A;  2JY7 A;  2JY6 B;  2LVA A;  1T43 A;  2KNZ A;  1VEG A;  1VG5 A;  1WHC A;  2HAK A;  2WZJ A;  3K9P A;  1OTR A;  2CP8 A;  2L4E A;  2O25 A;  1T6O A;  1BVS A;  4WP2 A;  2DKL A;  1F4I A;  1ZV1 A;  2DAI A;  2LVO C;  2K0B X;  1TTE A;  3FRH A;  1Y8G A;  1IFY A;  2LVP C;  1CUK A;  2R0I A;  2DAM A;  5DFL A;  2QSF X;  2KNV A;  4UN2 B;  2MJ5 B;  2ZTC A;  4F2L A;  2B3T A;  1G3I A;  3F92 A;  2DAK A;  2JUJ A;  1UFZ A;  2QHO B;  2MGW A;  1OKS A;  2L4F A;  3E21 A;  2JP7 A;  3GLI E;  1A5T A;  3LCU A;  2DAE A;  2OOB A;  1G41 A;  1QZE A;  1ZMW A;  2HWJ A;  1DV0 A;  2DEN A;  2KHH A; 
#chains in the Genus database with same CATH topology
 2LNH C;  5FTK A;  3L27 A;  3I04 M;  3U5Z B;  2CRU A;  3KS4 A;  3V76 A;  2DNA A;  3LQQ A;  3FTD A;  4DR1 M;  4RKU F;  4B3T M;  3SC3 A;  1VDL A;  3UK6 A;  4AW4 A;  2UXD M;  5DYI A;  1L1Z A;  4AKI A;  4LF9 M;  4HLQ A;  1IY2 A;  2R4E A;  4JI7 M;  1HR0 M;  4AQY M;  5E6J A;  4HL4 A;  3HU3 A;  1N77 A;  1K3W A;  1C7Y A;  3HJS A;  2NQ8 C;  1L2D A;  2Y21 A;  3D8L A;  5FLX S;  1DGF A;  4CHT B;  3KVW A;  4WW0 A;  2XSZ D;  4LJ7 A;  2V6Z M;  2XFS A;  1IN6 A;  4I4L A;  3KXE C;  1QZM A;  2R45 A;  3K1J A;  4LF7 M;  3FD9 A;  4QOZ C;  1XB2 B;  3PNY A;  3T1H M;  1H6U A;  2BWE A;  3K92 A;  4G4N A;  2MR9 A;  3B9P A;  1PJQ A;  8CAT A;  1HQY E;  2LH0 A;  1GAB A;  1EFU B;  3ZQJ A;  2FNA A;  1XC8 A;  1Z5A A;  1DO0 A;  3FYD A;  5L8R F;  1TH3 A;  2UXC M;  1XXH A;  1WGN A;  4GKJ M;  2R4J A;  2DI0 A;  1V92 A;  2ZAN A;  4PT5 A;  2VF8 A;  4FD2 A;  3THG A;  2G3Q A;  1JR3 D;  2G5G X;  2J5Y A;  3DZD A;  2UUA M;  1ZQ9 A;  1IM2 A;  3GLH E;  1JR3 A;  4PDI A;  2X4A A;  4IBE A;  1PGY A;  2C98 A;  2KXE A;  1NJG A;  2Q2E B;  2M5Z A;  1QAM A;  1IN7 A;  1QUS A;  1MJG M;  5H37 D;  3HX3 A;  4NRV A;  3R8F A;  2C9C A;  1LTM A;  3FE3 A;  4LGM A;  3U6S A;  2K47 A;  2JNH A;  3GLH A;  1ZMV A;  4B08 A;  3Q8G A;  3D8B A;  1QAN A;  3M7G A;  1W5T A;  2JY5 A;  1XXH B;  3OTO M;  3VDP A;  1OJL A;  3LVV A;  3CF2 A;  5EXS A;  2J7N A;  3GP1 A;  3BBZ A;  2FH0 A;  5EP3 A;  3QYB A;  3DA1 A;  3L28 A;  4DV7 M;  3QYE A;  4LF4 M;  3HGI A;  1NHG C;  3WHK A;  3U6Q A;  1T43 A;  2KNZ A;  2DHR A;  3TQS A;  3K9P A;  3MK6 A;  4NSR A;  4DV2 M;  1N33 M;  1T3T A;  1NSF A;  4AG5 A;  2R44 A;  1Q3B A;  2HKJ A;  3FUT A;  3K8Z A;  4WUR A;  1L2C A;  2F5N A;  4JI4 M;  1HNW M;  3GLH B;  2DAI A;  2LVO C;  3I4Y A;  5ITT A;  3GRR A;  4IBD A;  1XHB A;  4MGI E;  3VKG A;  1TTE A;  4B3M M;  3L29 A;  2DWZ B;  3J80 S;  5C18 A;  5KO3 A;  4IBG A;  4Z6Y A;  4OVZ A;  3PNV A;  1IBM M;  1G3I A;  3F92 A;  3SHG B;  2JUJ A;  3UJN A;  2QHO B;  1N34 M;  2KZS A;  2LWX A;  3BOS A;  3L25 A;  1OKS A;  3TPZ A;  5FTL A;  2BJV A;  4GC5 A;  1QYR A;  2N35 A;  2ZAM A;  1A5T A;  2L6O A;  4PD2 A;  3LCU A;  1XNQ M;  1QAQ A;  3M0E A;  4D81 A;  1QZE A;  3KSX A;  5FTM A;  4AZF A;  1DV0 A;  4LJ8 A;  4JI1 M;  5ITY A;  1WJ7 A;  3GPU A;  3VDU A;  1TDZ A;  4YHH M;  1R5L A;  5FTN A;  2R65 A;  3GPY A;  4QNM A;  4P17 A;  4MGH A;  4JN6 A;  3J7B A;  4LGY A;  4CIS A;  4RF0 A;  1IY1 A;  2KW0 A;  1NNJ A;  1G4A E;  3TWL A;  4Q7J A;  1WR1 B;  1L8Q A;  4LJ6 A;  2OOA A;  3SMS A;  4FW9 A;  1GJT A;  2CHV A;  5EXX A;  2JZ0 A;  1TR8 A;  4L78 A;  2DZO B;  4FWH A;  1PJI A;  3B7Q A;  4X64 M;  4L6V 6;  4I8O A;  2Y0T A;  3HKP A;  4OU7 A;  2DAG A;  5IZ7 D;  5LMU M;  2EJS A;  3HWS A;  4R71 A;  2DXI A;  2YFQ A;  4HEO A;  4KO8 A;  5GKN A;  4BLC A;  4GIT A;  4K0K M;  1EIJ A;  2ERC A;  1R4G A;  3B7Z A;  1TF0 B;  2RRU A;  1HJP A;  1WIV A;  3RGP A;  5JI2 E;  3Q8X A;  4GKK M;  4CIZ A;  3TWK A;  2H5X A;  3M6A A;  1R6B X;  2K6B A;  3FTE A;  1SXJ D;  2APL A;  4DR2 M;  3RE8 A;  4GIP A;  4B3R M;  5IRE B;  3QWL A;  2UXB M;  1DO2 A;  1OAO C;  3AOG A;  2OQ4 A;  2AHM A;  4RNA A;  4FCW A;  1D0M A;  2JY8 A;  3IHP A;  3FUX A;  1L2B A;  3SFZ A;  1NV9 A;  2F4V M;  2YNM D;  3B74 A;  1VQ1 A;  3J2P B;  4GH9 A;  4L15 A;  3GQ4 A;  2X8A A;  3A98 B;  4DR3 M;  2UUC M;  4ITQ A;  2LTU A;  4TUW A;  3GO8 A;  3SMP A;  1JB0 F;  2XSZ A;  3MMP A;  3GPX A;  1YE9 A;  2EKK A;  1XXH E;  5KPT A;  4JYA M;  3GLG E;  3SAW A;  3IG8 A;  2QCU A;  1DGB A;  2JZ1 A;  3E9S A;  4MH0 E;  2LXE A;  3LMM A;  4L4U A;  3AV0 A;  2K9D A;  1Z59 A;  3UGJ A;  2XH9 A;  2VII A;  2WSC F;  4DR5 M;  2HL7 A;  3FUU A;  1QAO A;  1JR3 E;  2ZAO A;  5LMN M;  3B89 A;  2KNA A;  4XBO A;  4DR6 M;  1OIP A;  2EKF A;  2QP9 X;  5IT9 S;  3GLG A;  2I7N A;  3J27 B;  4JI0 M;  3L2A A;  3U6E A;  4NRW A;  4AI6 A;  1HNX M;  4I81 A;  4OX9 M;  2C99 A;  2JY6 B;  1GJS A;  3MHV C;  3ZH9 B;  4DV0 M;  4DV3 M;  2R62 A;  1TGU A;  1FJG M;  2WZJ A;  4OW0 A;  4QNR A;  3U6D A;  1G71 A;  1TH4 A;  2I7P A;  1R2Z A;  3AOE A;  3SAU A;  1XMO M;  4AKG A;  1T6O A;  4NSO B;  4FWD A;  4ZPX A;  1QQW A;  4L16 A;  5EP1 A;  2C96 A;  1PM5 A;  1N75 A;  5EXT A;  2DAM A;  1NVM A;  5DFL A;  1WXQ A;  2JWS A;  3U6O A;  2MJ5 B;  4G4O A;  3VLF B;  4DV4 M;  5C1B A;  3KOZ E;  4XK8 F;  3GLG B;  1R2Y A;  2L09 A;  4KHP M;  2MH8 A;  3TWM A;  3RGS A;  2L4F A;  3U6P A;  2CHG A;  5BR8 M;  3E21 A;  2JP7 A;  4LRS A;  4MGK E;  3DOA A;  2DAE A;  2XZU A;  1GVN A;  3CGW A;  4LY6 A;  1ZMW A;  4IJF A;  3U6L A;  4X65 M;  2DEN A;  4JV5 M;  3WHL A;  1MN3 A;  4EIW A;  1PJS A;  3GLI B;  1N36 M;  2D7G A;  2VDB B;  3HHW A;  3KP0 E;  4GHA A;  5E26 A;  2VQF M;  1QDT A;  5JI3 E;  1OFH A;  1D0L A;  4D82 A;  3UMM A;  3ZCB B;  1MX0 A;  2ZTD A;  4GHL A;  1FNN A;  2FOI C;  1KYI A;  2KA6 B;  2LHG A;  3NBI A;  5ITX A;  3W0F A;  2LBC A;  3SHF A;  3FKE A;  3UZU A;  2BWB A;  3GRY A;  1IQP A;  4DBG B;  2UU9 M;  3HY5 A;  2D7H A;  1YUB A;  4LJ4 A;  4CJ6 A;  5KQD A;  2DHY A;  2OO9 A;  2XGN A;  1Z5C A;  1MU5 A;  3AOE C;  4F1I A;  1XNR M;  4AKH A;  4NOO B;  3NBX X;  1VDD A;  2DZN B;  2L2D A;  1D2N A;  2LVQ D;  4RF1 A;  1IBL M;  3I01 M;  1IY0 A;  3HHX A;  4IBC A;  1NV8 A;  2RGH A;  4YY3 M;  5F3W A;  4ANR A;  3ILK A;  3VKH A;  5EP2 A;  4IBJ A;  1HQC A;  3CF6 E;  3IG5 A;  4M9S A;  3A45 A;  1DGH A;  2CV2 A;  2R46 A;  3K2L A;  1OFI A;  2OPF A;  1UM8 A;  4NXM M;  3JAM S;  1Q39 A;  1W5S A;  3KS8 A;  4I5S A;  1Q02 A;  1DGG A;  3VK8 A;  1V34 A;  4Y28 F;  2R18 A;  1GO5 A;  2O5R A;  2EUC A;  4FWG A;  5EJC A;  3LW5 F;  2YQZ A;  5EQT A;  4II7 A;  2CFO A;  3ZC7 B;  1OAI A;  3H4J A;  3PFI A;  4REZ A;  3W0L B;  4X66 M;  1SG9 A;  3HJ8 A;  3C58 A;  5KQ8 A;  2FE8 A;  1XWI A;  3SAV A;  1VEK A;  4XGI A;  2QNJ A;  4QHT A;  3E46 A;  2KEB A;  3LCV B;  2XLJ A;  4M9X A;  1SXJ E;  4B3S M;  3H4M A;  1IN8 A;  3KOX E;  3U60 B;  1DGH B;  2VF7 A;  4Z8X A;  1GKI A;  1N32 M;  1GL7 A;  3J81 S;  4JI6 M;  1AUA A;  4LF8 M;  1WGL A;  4A3V B;  1IXR C;  1NJF A;  2Y0Q A;  1NNU C;  3GQ5 A;  4LFB M;  1QVR A;  1YSY A;  1SXJ A;  5EXP A;  3HHY A;  5KPR A;  4X62 M;  2DWM A;  1I4W A;  5IWA M;  1Z6T A;  3SBJ A;  4IIW A;  3SYL A;  1VEG A;  3KOY E;  3A42 A;  1WHC A;  1E32 A;  2HAK A;  4GC9 A;  1EE8 A;  4DR4 M;  3SAR A;  1OTR A;  2CP8 A;  2O25 A;  3KDS E;  1NO1 A;  4CGY B;  4DV5 M;  3U61 A;  1BVS A;  4FVM A;  4JI8 M;  1F4I A;  2L7I A;  1G59 A;  3I51 A;  4GMQ A;  4R7G A;  3U6C A;  4BBA A;  3FRH A;  1Y8G A;  3SYK A;  2F5Q A;  4LFC M;  2R0I A;  3T15 A;  2QSF X;  3TE6 A;  1G8P A;  4UN2 B;  3PXG A;  3BXW A;  1QDR A;  4F2L A;  3AL0 C;  1SXJ B;  5ITR A;  3EIE A;  2XF3 A;  2B3T A;  4FCV A;  3CTW B;  4IBF A;  4KLN A;  2A5Y B;  2R6F A;  4KT0 F;  4QHS A;  3HHZ A;  1UFZ A;  2QQ8 A;  4IBB A;  4JXJ A;  2M60 A;  1L1T A;  1NHW C;  2H1R A;  3GRV A;  5BPV A;  1N78 A;  5FTJ A;  3T1Y M;  4M0W A;  3GLI E;  3TL4 X;  2J7O A;  1IN4 A;  3C3D A;  1JQJ C;  1V33 A;  2KRK A;  4PCZ A;  1IBK M;  3U61 B;  4LFA M;  1E9R A;  2CEA A;  3C3E A;  2RKO A;  2KHH A;  4P16 A;  1PRB A;  1K3X A;  3KFU G;  3FTF A;  4G4Q A;  3GLI A;  1J09 A;  1SXJ C;  2FS1 A;  2X49 A;  3DFZ A;  3I4V A;  4IJE A;  4LF5 M;  2C9O A;  3VFD A;  4B7G A;  1GL6 A;  3KP1 E;  1D0K A;  1P3Q Q;  4B7H A;  3GQ3 A;  5DNY A;  2CUZ A;  2XEP A;  3HU1 A;  2Z7J A;  1PJT A;  4LZJ A;  3MJ5 A;  3GPP A;  1ZMU A;  4DV1 M;  3A46 A;  4LRT A;  4GRI A;  3FUV A;  1R7R A;  2P5T A;  4MGZ E;  3VK7 A;  4GEW A;  2DWN A;  2V1U A;  3LQR A;  1OIZ A;  3FTC A;  3FRI A;  2JXN A;  5EP4 A;  4MGY E;  4D80 A;  4PDG A;  4JI2 M;  2UUB M;  1AIP C;  3J7A S;  2G8L A;  3AFH A;  5ITX E;  2CWB A;  2Z3X A;  4G4R A;  2HCB A;  3RFW A;  1NY6 A;  1TH2 A;  2CHQ A;  3B7N A;  4NC6 A;  4G3O A;  1HT2 E;  4LZZ A;  4BB9 A;  4DUY M;  1QUT A;  2O01 F;  2QPA A;  1HNZ M;  1E94 E;  1VEJ A;  2LVN C;  2WSE F;  1YLA A;  2XFT A;  3HZJ A;  1PJJ A;  1HT1 E;  4L8R C;  2V1C A;  3FYC A;  4S12 A;  3GLF E;  4LJ9 A;  2VQE M;  2GNO A;  1J7K A;  4LJA A;  3W67 A;  3KOW E;  1NY5 A;  4NL4 H;  2KZU A;  2DZL A;  2QZ4 A;  1K82 A;  4LJ5 A;  2CV0 A;  3FUW A;  4IBI A;  2MRO B;  3EIH A;  2QEN A;  4MM3 B;  5KPZ A;  2F5O A;  4M9Z A;  2D7E A;  3W68 A;  2C5R A;  2W82 A;  4QOS A;  3K9O A;  4JI3 M;  3GLF A;  1X37 A;  3IEC A;  1E9S A;  3T38 A;  4JI5 M;  3HU2 A;  4M0D A;  4B7F A;  2FFJ A;  3AJI B;  1OQY A;  2F5S A;  3AKZ A;  3U60 A;  3CF0 A;  3L26 A;  2Z4R A;  1KFV A;  3SAT A;  2Y20 A;  2CV1 A;  1IN5 A;  3HJQ A;  4FCT A;  1IXS A;  3SAS A;  2CE7 A;  2KDL A;  4AG6 A;  2WSF F;  2QBY A;  3T6P A;  2JA2 A;  4LCB A;  2EO2 A;  1J5E M;  2JY7 A;  4LF6 M;  4R3D A;  2LVA A;  3JR5 A;  2BJW A;  2F5P A;  1VG5 A;  4MB7 A;  3GLF B;  2LHC A;  5ITQ A;  2ZM6 M;  2L4E A;  3R9X B;  4G6Z A;  1I94 M;  3NWL A;  3C9P A;  3GRU A;  2HHH M;  1TDH A;  4WP2 A;  2DKL A;  2DVW B;  1ZV1 A;  2GQF A;  4IBK A;  5A2Q S;  1LV7 A;  3U5Z A;  1Q3C A;  3PVS A;  4KOD A;  2K0B X;  2XZF A;  3KSJ A;  1IFY A;  2LVP C;  1CUK A;  4DR7 M;  2KRU A;  4OVZ B;  1IXS B;  5ITU A;  4DV6 M;  2KNV A;  1XMQ M;  2RGO A;  3LVW A;  2ZTC A;  5DYG A;  2QBY B;  3U6M A;  1C1K A;  1ORY B;  2Z8Y M;  2DAK A;  3QAU A;  2BNK A;  1RU3 A;  2Z4S A;  1S3S A;  3JR4 A;  5FSW A;  1Z5B A;  1KSF X;  1GLN A;  2MGW A;  3KW6 A;  2E5L M;  2YR0 A;  4NXN M;  7CAT A;  4DUZ M;  3E4R A;  2DWL A;  1ZAE A;  4W5W A;  2EA0 A;  2OOB A;  1G41 A;  2ZBK B;  4LG2 A;  2HWJ A;  1IXZ A;  2L7H A; 
#chains in the Genus database with same CATH homology
 1MN3 A;  1WJ7 A;  2DNA A;  1VDL A;  2ZTD A;  1P3Q Q;  1KYI A;  1G4A E;  2LBC A;  4Q7J A;  1WR1 B;  2BWB A;  2OOA A;  1C7Y A;  4DBG B;  1ZMU A;  2JZ0 A;  1TR8 A;  2DHY A;  2OO9 A;  4F1I A;  4GEW A;  2DAG A;  2L2D A;  2LVQ D;  3FRI A;  2EJS A;  4R71 A;  1NV8 A;  1AIP C;  4HEO A;  1XB2 B;  1R4G A;  5JI2 E;  2RRU A;  1HJP A;  2BWE A;  2CWB A;  1WIV A;  2MR9 A;  2H5X A;  1HQY E;  1EFU B;  4G3O A;  1HT2 E;  1DO0 A;  1E94 E;  1VEJ A;  2LVN C;  1YLA A;  1HT1 E;  1DO2 A;  1WGN A;  1Q02 A;  3GLF E;  2DI0 A;  2JY8 A;  1V92 A;  3IHP A;  1GO5 A;  1NV9 A;  2G3Q A;  2DZL A;  1VQ1 A;  1IM2 A;  2MRO B;  1OAI A;  3H4J A;  3GLH E;  1SG9 A;  2LTU A;  1PGY A;  1VEK A;  3K9O A;  3IEC A;  2QNJ A;  3E46 A;  3MMP A;  3LCV B;  2EKK A;  1XXH E;  3GLG E;  3FE3 A;  1OQY A;  2JNH A;  1ZMV A;  2JZ1 A;  1WGL A;  2K9D A;  2JY5 A;  1IXS A;  1JR3 E;  3B89 A;  2KNA A;  2EKF A;  3T6P A;  3BBZ A;  2JY7 A;  2JY6 B;  2LVA A;  1T43 A;  2KNZ A;  1VEG A;  1VG5 A;  1WHC A;  2HAK A;  2WZJ A;  3K9P A;  1OTR A;  2CP8 A;  2L4E A;  2O25 A;  1T6O A;  1BVS A;  4WP2 A;  2DKL A;  1F4I A;  1ZV1 A;  2DAI A;  2LVO C;  2K0B X;  1TTE A;  3FRH A;  1Y8G A;  1IFY A;  2LVP C;  1CUK A;  2R0I A;  2DAM A;  5DFL A;  2QSF X;  2KNV A;  4UN2 B;  2MJ5 B;  2ZTC A;  4F2L A;  2B3T A;  1G3I A;  3F92 A;  2DAK A;  2JUJ A;  1UFZ A;  2QHO B;  2MGW A;  1OKS A;  2L4F A;  3E21 A;  2JP7 A;  3GLI E;  1A5T A;  3LCU A;  2DAE A;  2OOB A;  1G41 A;  1QZE A;  1ZMW A;  2HWJ A;  1DV0 A;  2DEN A;  2KHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...