1MN3A

Cue domain of yeast vps9p
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
54
structure length
54
Chain Sequence
b'SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAKKSRIEPCVDALLSLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein VPS9
publication title Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 19
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1mn3A00
1NV9A 2MGWA 2MJ5B 1UFZA 2JY8A 4DBGB 1TTEA 2HAKA 2LBCA 1WIVA 1A5TA 2JNHA 2K0BX 4G3OA 1E94E 2DAEA 2QSFX 2ZTCA 2DHYA 2L4FA 3GLHE 1QZEA 1CUKA 2EJSA 1R4GA 2LVPC 1WGLA 2BWEA 1IXSA 4WP2A 1YLAA 2MROB 1VQ1A 1C7YA 2EKKA 1JR3E 4R71A 1OTRA 1OAIA 2EKFA 2G3QA 1SG9A 1VEGA 1AIPC 1G3IA 2JZ1A 3MMPA 3FRHA 1XXHE 2HWJA 2DENA 5JI2E 1HQYE 1WJ7A 1XB2B 4Q7JA 2JY6B 1G4AE 3K9OA 2KNAA 2K9DA 2DAMA 1DV0A 2JZ0A 2DAIA 1ZMVA 4GEWA 3LCVB 2H5XA 2L2DA 2CWBA 3GLIE 4UN2B 1VEJA 2WZJA 4HEOA 2CP8A 1GO5A 2BWBA 1VEKA 1ZV1A 2DAKA 2KNZA 3K9PA 2DKLA 3E21A 2JUJA 1Q02A 1EFUB 2LVNC 1T43A 2OO9A 2LVOC 1IFYA 2RRUA 1Y8GA 1ZMWA 1BVSA 2B3TA 1IM2A 2LTUA 1WGNA 1OQYA 2DAGA 3FRIA 3IHPA 3BBZA 2R0IA 2QHOB 1HT2E 3GLFE 2KHHA 3H4JA 1V92A 2JY7A 1OKSA 1DO2A 2OOAA 2L4EA 4F2LA 1VG5A 3FE3A 4F1IA 1PGYA 2JY5A 2DI0A 3IECA 2DNAA 1HJPA 2OOBA 1WR1B 3F92A 3T6PA 1DO0A 5DFLA 2JP7A 1ZMUA 2QNJA 1F4IA 1G41A 1TR8A 3GLGE 2ZTDA 1WHCA 2LVQD 3E46A 2LVAA 1MN3A 2MR9A 1NV8A 1T6OA 2O25A 3B89A 3LCUA 2DZLA 1HT1E 1VDLA 1KYIA 1P3QQ 2KNVA
chains in the Genus database with same CATH superfamily
1NV9A 1R5LA 2MGWA 3AOGA 1L2BA 3SHFA 3HWSA 2X49A 1XMQM 1D2NA 1V34A 1Z5AA 2LBCA 4B3RM 5ITXA 4RNAA 2Z4RA 3FTEA 1E94E 2DAEA 4I81A 3GQ3A 2DHYA 3AV0A 4B7GA 3SC3A 1IN8A 2F5QA 4NSOB 3CTWB 1L2CA 1QQWA 1R4GA 2QENA 4WP2A 1K3WA 1YLAA 4P17A 2C5RA 4QNRA 2O5RA 3GPXA 4G4OA 5IWAM 4LRSA 5ITYA 3GPUA 1C7YA 4I8OA 2DWMA 4DV3M 4B3MM 5EXXA 3UK6A 2HCBA 2V6ZM 4NSRA 1K82A 3HHZA 3LVWA 2WSCF 1OTRA 2EKFA 1T3TA 1JR3D 1SXJE 2G3QA 4XK8F 1VDDA 2K47A 4DV1M 2N35A 2WSFF 3TWMA 2C98A 4XBOA 3WHKA 1XXHE 4LJ8A 3K92A 3K2LA 2HKJA 4B3SM 5KQ8A 2EUCA 2R44A 3LQRA 3T1YM 4WW0A 3U6QA 1G4AE 3KP0E 4YY3M 3K9OA 2KNAA 1ZAEA 3LMMA 1SXJB 2LHCA 3FYDA 2JZ0A 1WXQA 3GPPA 4L4UA 2H5XA 3PNYA 2L2DA 3C3DA 4AW4A 3QYBA 3KFUG 1VEJA 3KXEC 2J7NA 3VFDA 3KDSE 3U61B 4YHHM 2CP8A 1QAMA 1GO5A 2BWBA 1ZV1A 2DAKA 5DYIA 2Q2EB 3GLFB 3E21A 2JUJA 2L09A 2CEAA 1JQJC 3U6DA 1SXJD 3J81S 2CV1A 2DHRA 3SBJA 3FYCA 4GH9A 4II7A 4GKKM 2B3TA 1WGNA 4KODA 3DA1A 2VDBB 1HNXM 1QYRA 2XEPA 2QHOB 3K8ZA 4IBDA 3VKGA 1Z5CA 4FWHA 4HL4A 3ZCBB 2DVWB 4AKHA 3U60B 4REZA 3K1JA 3U6SA 1L8QA 1DGHA 1EE8A 3HHWA 4F2LA 3RE8A 3T1HM 1NJFA 2BNKA 3FE3A 4F1IA 4MM3B 4JI8M 2L7IA 2DI0A 1IXZA 2GNOA 2H1RA 2DNAA 5DNYA 4M9XA 2BJWA 4LGYA 4IBCA 3HHYA 3U5ZB 3L28A 2XZUA 1G71A 3T6PA 1KSFX 1TGUA 2CV0A 2ZBKB 2XZFA 3HY5A 4L6V6 1ZMUA 2BJVA 4DUYM 1N36M 2F5OA 3FTFA 1G41A 2I7NA 3DZDA 1HQCA 3SATA 2XSZA 5JI3E 3B7NA 5ITTA 3J2PB 2CHGA 2VF8A 5E6JA 2C9CA 5LMNM 1NVMA 1WHCA 3E46A 3LW5F 4LFAM 1NSFA 3V76A 3SARA 3FTCA 3IG5A 2MR9A 3UMMA 4GHAA 1C1KA 1IY2A 4B08A 2YQZA 3LCUA 4W5WA 4JI1M 1I94M 1HT1E 3TWLA 1OJLA 4DBGB 2DWNA 2CV2A 2APLA 2QBYB 4IIWA 2OQ4A 4DV6M 2D7GA 1IBKM 2FS1A 4TUWA 4CGYB 5IZ7D 3PXGA 2QSFX 2ZTCA 1JB0F 1GL7A 3GLHE 4X65M 1GJSA 3KP1E 5GKNA 2HL7A 4ANRA 3SAWA 2EJSA 2P5TA 4RF1A 2LVPC 4K0KM 4KO8A 1IBMM 1WGLA 2BWEA 3SYLA 4X66M 1OIZA 2L7HA 1SXJA 1TDHA 5KPTA 1VQ1A 4IBBA 2KZSA 1Z59A 1XXHA 1Q3BA 2L6OA 4BLCA 4LF6M 3GLHB 4S12A 3Q8GA 2LWXA 4I4LA 4IBFA 2UU9M 2G5GX 1JR3E 4LF4M 1N33M 4R3DA 2V1UA 4HLQA 4PT5A 2R4EA 1SG9A 1VEGA 1D0LA 4CIZA 2D7EA 4M0WA 2VQFM 2CFOA 3FRHA 3B7ZA 1E9RA 2UUCM 4OVZA 3SYKA 3U6OA 1XNRM 4AI6A 4JI0M 4FCVA 1K3XA 1L2DA 1XB2B 4DR5M 3LVVA 3UJNA 1TH2A 4XGIA 1H6UA 4KT0F 4NXNM 5FTLA 1PJTA 3LQQA 3HJQA 1OIPA 4QOSA 1FJGM 1L1ZA 2K9DA 2DAMA 1DGFA 1QDTA 4WURA 2DAIA 3SFZA 3I4YA 1G59A 1DV0A 2JA2A 5FSWA 1ZMVA 4JI7M 1NO1A 2FNAA 4LG2A 2CWBA 3GLIE 4UN2B 2WZJA 3KW6A 1TH4A 3HU3A 3ZC7B 2KEBA 3A45A 4CJ6A 5BPVA 4DR3M 1HR0M 4BBAA 3KSXA 3BXWA 5LMUM 1XMOM 3HZJA 2QP9X 4DR1M 3L25A 2KNZA 1VEKA 3HJ8A 3PVSA 3SASA 4CHTB 5IREB 3A98B 4FWDA 2D7HA 2ERCA 2MH8A 2KRUA 4M9SA 3U6PA 4LF8M 2R18A 1Q02A 1EFUB 2C9OA 1GL6A 1NJGA 5FTNA 4X64M 3GP1A 3GLIB 4DV4M 2XFSA 5EJCA 4G4NA 3DFZA 4LF7M 2LVOC 1IFYA 1YE9A 1PJQA 1IM2A 1D0KA 3AOEC 2Y21A 2R46A 3FUTA 3I04M 3FRIA 2DXIA 3KS4A 3BBZA 3M0EA 2F5NA 3GLFE 2KHHA 5H37D 4MGIE 3D8BA 1V92A 3L26A 3FD9A 3HU2A 4Y28F 1OKSA 2DWLA 4KHPM 1PGYA 2Y0QA 3GPYA 3IECA 2XFTA 1HJPA 3UGJA 3CGWA 4D82A 1G8PA 3T15A 1OFHA 1QANA 3B9PA 2VIIA 4P16A 3RGSA 2C96A 5KO3A 1TF0B 2X8AA 3C9PA 2CE7A 2QNJA 3OTOM 1F4IA 2F4VM 1IN6A 4LGMA 3GRUA 3H4MA 4MGZE 1TDZA 2ZANA 3SAUA 4IBJA 3RGPA 2Y20A 4JN6A 3UZUA 2FE8A 1IN7A 1R7RA 2KXEA 3J7BA 1W5SA 2WSEF 5L8RF 3PNVA 4M0DA 4QOZC 3FTDA 1E32A 1IY0A 2DZLA 3T38A 1Z6TA 2KNVA 2Z4SA 4DV7M 2MJ5B 3MK6A 2JY8A 4PCZA 3GLGA 4CISA 2QQ8A 1S3SA 1WIVA 4JI4M 1A5TA 2X4AA 3MJ5A 4G3OA 2LNHC 1QUTA 1GVNA 2V1CA 4OW0A 5FTKA 3EIHA 5KQDA 4AZFA 1ZQ9A 2L4FA 4LF5M 1N75A 4DR6M 1PRBA 3NBXX 3TQSA 4GIPA 2HHHM 1JR3A 2A5YB 2RGHA 5FTMA 3FUWA 1HNZM 2JXNA 2MROB 1NNJA 3AKZA 3VLFB 1MU5A 3C58A 4L78A 3W0FA 4IBKA 3ZQJA 5BR8M 2C99A 2O01F 3FUVA 4JI3M 2GQFA 4DR4M 2UXDM 4DUZM 4DV2M 4LZJA 4R71A 1OFIA 3KOZE 5C1BA 4GRIA 3VK8A 1PJIA 1PJJA 1QAOA 1G3IA 2JZ1A 3I51A 4LJ6A 3MMPA 4NC6A 2OPFA 2AHMA 3GRYA 2DWZB 3GQ5A 1LV7A 2CUZA 3BOSA 5EP4A 4AKIA 2HWJA 2DENA 5ITRA 4AKGA 1IN5A 1HQYE 4FVMA 3SAVA 3HJSA 3TE6A 4NRWA 1FNNA 3JAMS 5KPRA 1N78A 2R62A 1IXSB 1D0MA 2EA0A 2XGNA 1RU3A 3JR5A 3KOYE 5F3WA 1HNWM 1EIJA 5FTJA 4IJFA 2F5PA 3LCVB 3IG8A 4IBEA 4B3TM 4FD2A 4HEOA 1J09A 1R2YA 3J27B 4RKUF 3I01M 3EIEA 3U61A 3K9PA 5ITUA 1GABA 2EO2A 2Z7JA 3KOXE 3Q8XA 1XNQM 4FWGA 7CATA 2LVNC 3GLFA 4GC9A 1T43A 3HGIA 3KOWE 4I5SA 3THGA 4JYAM 2LH0A 3B74A 2OO9A 2I7PA 4JXJA 5DYGA 3A46A 2UXBM 1Y8GA 1UM8A 3AJIB 3VK7A 1ZMWA 4LJAA 3R8FA 2LTUA 3E4RA 2UUBM 1OQYA 1Q39A 3FUUA 5EP1A 3IHPA 2R0IA 1HT2E 2KW0A 5ITQA 2RKOA 1DGHB 3H4JA 4L16A 4LFCM 3NBIA 2KZUA 4LJ5A 1DO2A 2OOAA 2L4EA 3U60A 1VG5A 1GLNA 3CF6E 3GRRA 1V33A 1XHBA 2JY5A 3MHVC 4M9ZA 4A3VB 2K6BA 3FKEA 3L29A 4LFBM 4AG5A 3F92A 4D80A 4LJ4A 4NXMM 3RFWA 3U5ZA 1N32M 3GRVA 4ZPXA 2JP7A 3C3EA 3KSJA 2M60A 2YFQA 2YNMD 4Z6YA 4PDGA 2W82A 2R4JA 4GITA 5EQTA 1ORYB 4FCWA 1X37A 2LVQD 4QHTA 2DZOB 4G6ZA 5FLXS 4DV5M 1NY6A 4GC5A 2RGOA 1T6OA 4NRVA 2VQEM 1QDRA 2O25A 3L27A 4LRTA 4MGKE 1L1TA 3R9XB 3B7QA 1KYIA 1QZMA 2E5LM 2XSZD 4X62M 2KA6B 3QAUA 1UFZA 1TTEA 2HAKA 2QBYA 2K0BX 2JNHA 4NOOB 4BB9A 4PDIA 3VKHA 2CRUA 1R2ZA 5KPZA 3DOAA 3HKPA 4EIWA 1Z5BA 4LJ9A 3WHLA 1KFVA 4B7FA 2FH0A 1PM5A 8CATA 1QZEA 3L2AA 1IY1A 1CUKA 4MB7A 2M5ZA 1IN4A 4MGHA 5ITXE 1IXSA 2QPAA 3FUXA 4G4QA 3CF2A 1W5TA 1XXHB 1XWIA 2EKKA 1YUBA 2XLJA 1MX0A 2CHQA 4FW9A 1NHGC 3SMPA 1IBLM 1QVRA 4DR2M 4GKJM 4OX9M 2FOIC 3J80S 1NHWC 2VF7A 3GLHA 4JI5M 4B7HA 1OAIA 2LXEA 1SXJC 5IT9S 2Z3XA 1AIPC 4AQYM 1OAOC 2J5YA 4DR7M 4OVZB 4LZZA 5EXSA 4LY6A 2NQ8C 4KLNA 1GJTA 5EXTA 2KRKA 3GQ4A 3I4VA 1N77A 5JI2E 1WJ7A 3HHXA 3W68A 3TPZA 2F5SA 4Q7JA 2Z8YM 3TL4X 2CHVA 2JY6B 3GO8A 1NY5A 2J7OA 4NL4H 3D8LA 2FFJA 4QHSA 5EP3A 4D81A 3SMSA 4R7GA 4GEWA 1I4WA 2UUAM 3M6AA 2YR0A 4LCBA 2R6FA 4IJEA 4PD2A 1DGBA 3KVWA 4GHLA 3AFHA 2QZ4A 3A42A 3AOEA 3M7GA 2DKLA 4JI2M 2DZNB 4JI6M 4JV5M 4G4RA 4ITQA 1R6BX 5E26A 3W67A 4GMQA 3HX3A 4Z8XA 3GLIA 1Q3CA 1TH3A 2RRUA 3W0LB 2JWSA 3KS8A 1BVSA 1PJSA 1NNUC 2DAGA 4RF0A 2ZM6M 3ILKA 2Y0TA 4L8RC 1J7KA 4QNMA 2ZAOA 3NWLA 1QAQA 2JY7A 2KDLA 1GKIA 4IBGA 3U6CA 1YSYA 1IXRC 4AG6A 3QWLA 1AUAA 2UXCM 3U6LA 2R65A 2ZAMA 2R45A 1MJGM 3U6EA 3PFIA 4IBIA 4LJ7A 1IQPA 2OOBA 1WR1B 1N34M 2QCUA 1DO0A 4MGYE 1LTMA 4LF9M 5DFLA 3HU1A 4L15A 2XH9A 4OU7A 3QYEA 3E9SA 3ZH9B 2G8LA 1TR8A 4MH0E 3GLGE 1XC8A 2ZTDA 3AL0C 3J7AS 2XF3A 3TWKA 2LVAA 3VDUA 1J5EM 1MN3A 5EXPA 3U6MA 1E9SA 1NV8A 5A2QS 3CF0A 3JR4A 2LHGA 4FCTA 3B89A 5EP2A 5C18A 1DGGA 1QUSA 1VDLA 4DV0M 3SHGB 3VDPA 1P3QQ 3GLGB
chains in the Genus database with same CATH topology
1NV9A 2MGWA 2MJ5B 1UFZA 2JY8A 4DBGB 1TTEA 2HAKA 2LBCA 1WIVA 1A5TA 2JNHA 2K0BX 4G3OA 1E94E 2DAEA 2QSFX 2ZTCA 2DHYA 2L4FA 3GLHE 1QZEA 1CUKA 2EJSA 1R4GA 2LVPC 1WGLA 2BWEA 1IXSA 4WP2A 1YLAA 2MROB 1VQ1A 1C7YA 2EKKA 1JR3E 4R71A 1OTRA 1OAIA 2EKFA 2G3QA 1SG9A 1VEGA 1AIPC 1G3IA 2JZ1A 3MMPA 3FRHA 1XXHE 2HWJA 2DENA 5JI2E 1HQYE 1WJ7A 1XB2B 4Q7JA 2JY6B 1G4AE 3K9OA 2KNAA 2K9DA 2DAMA 1DV0A 2JZ0A 2DAIA 1ZMVA 4GEWA 3LCVB 2H5XA 2L2DA 2CWBA 3GLIE 4UN2B 1VEJA 2WZJA 4HEOA 2CP8A 1GO5A 2BWBA 1VEKA 1ZV1A 2DAKA 2KNZA 3K9PA 2DKLA 3E21A 2JUJA 1Q02A 1EFUB 2LVNC 1T43A 2OO9A 2LVOC 1IFYA 2RRUA 1Y8GA 1ZMWA 1BVSA 2B3TA 1IM2A 2LTUA 1WGNA 1OQYA 2DAGA 3FRIA 3IHPA 3BBZA 2R0IA 2QHOB 1HT2E 3GLFE 2KHHA 3H4JA 1V92A 2JY7A 1OKSA 1DO2A 2OOAA 2L4EA 4F2LA 1VG5A 3FE3A 4F1IA 1PGYA 2JY5A 2DI0A 3IECA 2DNAA 1HJPA 2OOBA 1WR1B 3F92A 3T6PA 1DO0A 5DFLA 2JP7A 1ZMUA 2QNJA 1F4IA 1G41A 1TR8A 3GLGE 2ZTDA 1WHCA 2LVQD 3E46A 2LVAA 1MN3A 2MR9A 1NV8A 1T6OA 2O25A 3B89A 3LCUA 2DZLA 1HT1E 1VDLA 1KYIA 1P3QQ 2KNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV9 A;  2MGW A;  2MJ5 B;  1UFZ A;  2JY8 A;  4DBG B;  1TTE A;  2HAK A;  2LBC A;  1WIV A;  1A5T A;  2JNH A;  2K0B X;  4G3O A;  1E94 E;  2DAE A;  2QSF X;  2ZTC A;  2DHY A;  2L4F A;  3GLH E;  1QZE A;  1CUK A;  2EJS A;  1R4G A;  2LVP C;  1WGL A;  2BWE A;  1IXS A;  4WP2 A;  1YLA A;  2MRO B;  1VQ1 A;  1C7Y A;  2EKK A;  1JR3 E;  4R71 A;  1OTR A;  1OAI A;  2EKF A;  2G3Q A;  1SG9 A;  1VEG A;  1AIP C;  1G3I A;  2JZ1 A;  3MMP A;  3FRH A;  1XXH E;  2HWJ A;  2DEN A;  5JI2 E;  1HQY E;  1WJ7 A;  1XB2 B;  4Q7J A;  2JY6 B;  1G4A E;  3K9O A;  2KNA A;  2K9D A;  2DAM A;  1DV0 A;  2JZ0 A;  2DAI A;  1ZMV A;  4GEW A;  3LCV B;  2H5X A;  2L2D A;  2CWB A;  3GLI E;  4UN2 B;  1VEJ A;  2WZJ A;  4HEO A;  2CP8 A;  1GO5 A;  2BWB A;  1VEK A;  1ZV1 A;  2DAK A;  2KNZ A;  3K9P A;  2DKL A;  3E21 A;  2JUJ A;  1Q02 A;  1EFU B;  2LVN C;  1T43 A;  2OO9 A;  2LVO C;  1IFY A;  2RRU A;  1Y8G A;  1ZMW A;  1BVS A;  2B3T A;  1IM2 A;  2LTU A;  1WGN A;  1OQY A;  2DAG A;  3FRI A;  3IHP A;  3BBZ A;  2R0I A;  2QHO B;  1HT2 E;  3GLF E;  2KHH A;  3H4J A;  1V92 A;  2JY7 A;  1OKS A;  1DO2 A;  2OOA A;  2L4E A;  4F2L A;  1VG5 A;  3FE3 A;  4F1I A;  1PGY A;  2JY5 A;  2DI0 A;  3IEC A;  2DNA A;  1HJP A;  2OOB A;  1WR1 B;  3F92 A;  3T6P A;  1DO0 A;  5DFL A;  2JP7 A;  1ZMU A;  2QNJ A;  1F4I A;  1G41 A;  1TR8 A;  3GLG E;  2ZTD A;  1WHC A;  2LVQ D;  3E46 A;  2LVA A;  1MN3 A;  2MR9 A;  1NV8 A;  1T6O A;  2O25 A;  3B89 A;  3LCU A;  2DZL A;  1HT1 E;  1VDL A;  1KYI A;  1P3Q Q;  2KNV A; 
#chains in the Genus database with same CATH topology
 1NV9 A;  1R5L A;  2MGW A;  3AOG A;  1L2B A;  3SHF A;  3HWS A;  2X49 A;  1XMQ M;  1D2N A;  1V34 A;  1Z5A A;  2LBC A;  4B3R M;  5ITX A;  4RNA A;  2Z4R A;  3FTE A;  1E94 E;  2DAE A;  4I81 A;  3GQ3 A;  2DHY A;  3AV0 A;  4B7G A;  3SC3 A;  1IN8 A;  2F5Q A;  4NSO B;  3CTW B;  1L2C A;  1QQW A;  1R4G A;  2QEN A;  4WP2 A;  1K3W A;  1YLA A;  4P17 A;  2C5R A;  4QNR A;  2O5R A;  3GPX A;  4G4O A;  5IWA M;  4LRS A;  5ITY A;  3GPU A;  1C7Y A;  4I8O A;  2DWM A;  4DV3 M;  4B3M M;  5EXX A;  3UK6 A;  2HCB A;  2V6Z M;  4NSR A;  1K82 A;  3HHZ A;  3LVW A;  2WSC F;  1OTR A;  2EKF A;  1T3T A;  1JR3 D;  1SXJ E;  2G3Q A;  4XK8 F;  1VDD A;  2K47 A;  4DV1 M;  2N35 A;  2WSF F;  3TWM A;  2C98 A;  4XBO A;  3WHK A;  1XXH E;  4LJ8 A;  3K92 A;  3K2L A;  2HKJ A;  4B3S M;  5KQ8 A;  2EUC A;  2R44 A;  3LQR A;  3T1Y M;  4WW0 A;  3U6Q A;  1G4A E;  3KP0 E;  4YY3 M;  3K9O A;  2KNA A;  1ZAE A;  3LMM A;  1SXJ B;  2LHC A;  3FYD A;  2JZ0 A;  1WXQ A;  3GPP A;  4L4U A;  2H5X A;  3PNY A;  2L2D A;  3C3D A;  4AW4 A;  3QYB A;  3KFU G;  1VEJ A;  3KXE C;  2J7N A;  3VFD A;  3KDS E;  3U61 B;  4YHH M;  2CP8 A;  1QAM A;  1GO5 A;  2BWB A;  1ZV1 A;  2DAK A;  5DYI A;  2Q2E B;  3GLF B;  3E21 A;  2JUJ A;  2L09 A;  2CEA A;  1JQJ C;  3U6D A;  1SXJ D;  3J81 S;  2CV1 A;  2DHR A;  3SBJ A;  3FYC A;  4GH9 A;  4II7 A;  4GKK M;  2B3T A;  1WGN A;  4KOD A;  3DA1 A;  2VDB B;  1HNX M;  1QYR A;  2XEP A;  2QHO B;  3K8Z A;  4IBD A;  3VKG A;  1Z5C A;  4FWH A;  4HL4 A;  3ZCB B;  2DVW B;  4AKH A;  3U60 B;  4REZ A;  3K1J A;  3U6S A;  1L8Q A;  1DGH A;  1EE8 A;  3HHW A;  4F2L A;  3RE8 A;  3T1H M;  1NJF A;  2BNK A;  3FE3 A;  4F1I A;  4MM3 B;  4JI8 M;  2L7I A;  2DI0 A;  1IXZ A;  2GNO A;  2H1R A;  2DNA A;  5DNY A;  4M9X A;  2BJW A;  4LGY A;  4IBC A;  3HHY A;  3U5Z B;  3L28 A;  2XZU A;  1G71 A;  3T6P A;  1KSF X;  1TGU A;  2CV0 A;  2ZBK B;  2XZF A;  3HY5 A;  4L6V 6;  1ZMU A;  2BJV A;  4DUY M;  1N36 M;  2F5O A;  3FTF A;  1G41 A;  2I7N A;  3DZD A;  1HQC A;  3SAT A;  2XSZ A;  5JI3 E;  3B7N A;  5ITT A;  3J2P B;  2CHG A;  2VF8 A;  5E6J A;  2C9C A;  5LMN M;  1NVM A;  1WHC A;  3E46 A;  3LW5 F;  4LFA M;  1NSF A;  3V76 A;  3SAR A;  3FTC A;  3IG5 A;  2MR9 A;  3UMM A;  4GHA A;  1C1K A;  1IY2 A;  4B08 A;  2YQZ A;  3LCU A;  4W5W A;  4JI1 M;  1I94 M;  1HT1 E;  3TWL A;  1OJL A;  4DBG B;  2DWN A;  2CV2 A;  2APL A;  2QBY B;  4IIW A;  2OQ4 A;  4DV6 M;  2D7G A;  1IBK M;  2FS1 A;  4TUW A;  4CGY B;  5IZ7 D;  3PXG A;  2QSF X;  2ZTC A;  1JB0 F;  1GL7 A;  3GLH E;  4X65 M;  1GJS A;  3KP1 E;  5GKN A;  2HL7 A;  4ANR A;  3SAW A;  2EJS A;  2P5T A;  4RF1 A;  2LVP C;  4K0K M;  4KO8 A;  1IBM M;  1WGL A;  2BWE A;  3SYL A;  4X66 M;  1OIZ A;  2L7H A;  1SXJ A;  1TDH A;  5KPT A;  1VQ1 A;  4IBB A;  2KZS A;  1Z59 A;  1XXH A;  1Q3B A;  2L6O A;  4BLC A;  4LF6 M;  3GLH B;  4S12 A;  3Q8G A;  2LWX A;  4I4L A;  4IBF A;  2UU9 M;  2G5G X;  1JR3 E;  4LF4 M;  1N33 M;  4R3D A;  2V1U A;  4HLQ A;  4PT5 A;  2R4E A;  1SG9 A;  1VEG A;  1D0L A;  4CIZ A;  2D7E A;  4M0W A;  2VQF M;  2CFO A;  3FRH A;  3B7Z A;  1E9R A;  2UUC M;  4OVZ A;  3SYK A;  3U6O A;  1XNR M;  4AI6 A;  4JI0 M;  4FCV A;  1K3X A;  1L2D A;  1XB2 B;  4DR5 M;  3LVV A;  3UJN A;  1TH2 A;  4XGI A;  1H6U A;  4KT0 F;  4NXN M;  5FTL A;  1PJT A;  3LQQ A;  3HJQ A;  1OIP A;  4QOS A;  1FJG M;  1L1Z A;  2K9D A;  2DAM A;  1DGF A;  1QDT A;  4WUR A;  2DAI A;  3SFZ A;  3I4Y A;  1G59 A;  1DV0 A;  2JA2 A;  5FSW A;  1ZMV A;  4JI7 M;  1NO1 A;  2FNA A;  4LG2 A;  2CWB A;  3GLI E;  4UN2 B;  2WZJ A;  3KW6 A;  1TH4 A;  3HU3 A;  3ZC7 B;  2KEB A;  3A45 A;  4CJ6 A;  5BPV A;  4DR3 M;  1HR0 M;  4BBA A;  3KSX A;  3BXW A;  5LMU M;  1XMO M;  3HZJ A;  2QP9 X;  4DR1 M;  3L25 A;  2KNZ A;  1VEK A;  3HJ8 A;  3PVS A;  3SAS A;  4CHT B;  5IRE B;  3A98 B;  4FWD A;  2D7H A;  2ERC A;  2MH8 A;  2KRU A;  4M9S A;  3U6P A;  4LF8 M;  2R18 A;  1Q02 A;  1EFU B;  2C9O A;  1GL6 A;  1NJG A;  5FTN A;  4X64 M;  3GP1 A;  3GLI B;  4DV4 M;  2XFS A;  5EJC A;  4G4N A;  3DFZ A;  4LF7 M;  2LVO C;  1IFY A;  1YE9 A;  1PJQ A;  1IM2 A;  1D0K A;  3AOE C;  2Y21 A;  2R46 A;  3FUT A;  3I04 M;  3FRI A;  2DXI A;  3KS4 A;  3BBZ A;  3M0E A;  2F5N A;  3GLF E;  2KHH A;  5H37 D;  4MGI E;  3D8B A;  1V92 A;  3L26 A;  3FD9 A;  3HU2 A;  4Y28 F;  1OKS A;  2DWL A;  4KHP M;  1PGY A;  2Y0Q A;  3GPY A;  3IEC A;  2XFT A;  1HJP A;  3UGJ A;  3CGW A;  4D82 A;  1G8P A;  3T15 A;  1OFH A;  1QAN A;  3B9P A;  2VII A;  4P16 A;  3RGS A;  2C96 A;  5KO3 A;  1TF0 B;  2X8A A;  3C9P A;  2CE7 A;  2QNJ A;  3OTO M;  1F4I A;  2F4V M;  1IN6 A;  4LGM A;  3GRU A;  3H4M A;  4MGZ E;  1TDZ A;  2ZAN A;  3SAU A;  4IBJ A;  3RGP A;  2Y20 A;  4JN6 A;  3UZU A;  2FE8 A;  1IN7 A;  1R7R A;  2KXE A;  3J7B A;  1W5S A;  2WSE F;  5L8R F;  3PNV A;  4M0D A;  4QOZ C;  3FTD A;  1E32 A;  1IY0 A;  2DZL A;  3T38 A;  1Z6T A;  2KNV A;  2Z4S A;  4DV7 M;  2MJ5 B;  3MK6 A;  2JY8 A;  4PCZ A;  3GLG A;  4CIS A;  2QQ8 A;  1S3S A;  1WIV A;  4JI4 M;  1A5T A;  2X4A A;  3MJ5 A;  4G3O A;  2LNH C;  1QUT A;  1GVN A;  2V1C A;  4OW0 A;  5FTK A;  3EIH A;  5KQD A;  4AZF A;  1ZQ9 A;  2L4F A;  4LF5 M;  1N75 A;  4DR6 M;  1PRB A;  3NBX X;  3TQS A;  4GIP A;  2HHH M;  1JR3 A;  2A5Y B;  2RGH A;  5FTM A;  3FUW A;  1HNZ M;  2JXN A;  2MRO B;  1NNJ A;  3AKZ A;  3VLF B;  1MU5 A;  3C58 A;  4L78 A;  3W0F A;  4IBK A;  3ZQJ A;  5BR8 M;  2C99 A;  2O01 F;  3FUV A;  4JI3 M;  2GQF A;  4DR4 M;  2UXD M;  4DUZ M;  4DV2 M;  4LZJ A;  4R71 A;  1OFI A;  3KOZ E;  5C1B A;  4GRI A;  3VK8 A;  1PJI A;  1PJJ A;  1QAO A;  1G3I A;  2JZ1 A;  3I51 A;  4LJ6 A;  3MMP A;  4NC6 A;  2OPF A;  2AHM A;  3GRY A;  2DWZ B;  3GQ5 A;  1LV7 A;  2CUZ A;  3BOS A;  5EP4 A;  4AKI A;  2HWJ A;  2DEN A;  5ITR A;  4AKG A;  1IN5 A;  1HQY E;  4FVM A;  3SAV A;  3HJS A;  3TE6 A;  4NRW A;  1FNN A;  3JAM S;  5KPR A;  1N78 A;  2R62 A;  1IXS B;  1D0M A;  2EA0 A;  2XGN A;  1RU3 A;  3JR5 A;  3KOY E;  5F3W A;  1HNW M;  1EIJ A;  5FTJ A;  4IJF A;  2F5P A;  3LCV B;  3IG8 A;  4IBE A;  4B3T M;  4FD2 A;  4HEO A;  1J09 A;  1R2Y A;  3J27 B;  4RKU F;  3I01 M;  3EIE A;  3U61 A;  3K9P A;  5ITU A;  1GAB A;  2EO2 A;  2Z7J A;  3KOX E;  3Q8X A;  1XNQ M;  4FWG A;  7CAT A;  2LVN C;  3GLF A;  4GC9 A;  1T43 A;  3HGI A;  3KOW E;  4I5S A;  3THG A;  4JYA M;  2LH0 A;  3B74 A;  2OO9 A;  2I7P A;  4JXJ A;  5DYG A;  3A46 A;  2UXB M;  1Y8G A;  1UM8 A;  3AJI B;  3VK7 A;  1ZMW A;  4LJA A;  3R8F A;  2LTU A;  3E4R A;  2UUB M;  1OQY A;  1Q39 A;  3FUU A;  5EP1 A;  3IHP A;  2R0I A;  1HT2 E;  2KW0 A;  5ITQ A;  2RKO A;  1DGH B;  3H4J A;  4L16 A;  4LFC M;  3NBI A;  2KZU A;  4LJ5 A;  1DO2 A;  2OOA A;  2L4E A;  3U60 A;  1VG5 A;  1GLN A;  3CF6 E;  3GRR A;  1V33 A;  1XHB A;  2JY5 A;  3MHV C;  4M9Z A;  4A3V B;  2K6B A;  3FKE A;  3L29 A;  4LFB M;  4AG5 A;  3F92 A;  4D80 A;  4LJ4 A;  4NXM M;  3RFW A;  3U5Z A;  1N32 M;  3GRV A;  4ZPX A;  2JP7 A;  3C3E A;  3KSJ A;  2M60 A;  2YFQ A;  2YNM D;  4Z6Y A;  4PDG A;  2W82 A;  2R4J A;  4GIT A;  5EQT A;  1ORY B;  4FCW A;  1X37 A;  2LVQ D;  4QHT A;  2DZO B;  4G6Z A;  5FLX S;  4DV5 M;  1NY6 A;  4GC5 A;  2RGO A;  1T6O A;  4NRV A;  2VQE M;  1QDR A;  2O25 A;  3L27 A;  4LRT A;  4MGK E;  1L1T A;  3R9X B;  3B7Q A;  1KYI A;  1QZM A;  2E5L M;  2XSZ D;  4X62 M;  2KA6 B;  3QAU A;  1UFZ A;  1TTE A;  2HAK A;  2QBY A;  2K0B X;  2JNH A;  4NOO B;  4BB9 A;  4PDI A;  3VKH A;  2CRU A;  1R2Z A;  5KPZ A;  3DOA A;  3HKP A;  4EIW A;  1Z5B A;  4LJ9 A;  3WHL A;  1KFV A;  4B7F A;  2FH0 A;  1PM5 A;  8CAT A;  1QZE A;  3L2A A;  1IY1 A;  1CUK A;  4MB7 A;  2M5Z A;  1IN4 A;  4MGH A;  5ITX E;  1IXS A;  2QPA A;  3FUX A;  4G4Q A;  3CF2 A;  1W5T A;  1XXH B;  1XWI A;  2EKK A;  1YUB A;  2XLJ A;  1MX0 A;  2CHQ A;  4FW9 A;  1NHG C;  3SMP A;  1IBL M;  1QVR A;  4DR2 M;  4GKJ M;  4OX9 M;  2FOI C;  3J80 S;  1NHW C;  2VF7 A;  3GLH A;  4JI5 M;  4B7H A;  1OAI A;  2LXE A;  1SXJ C;  5IT9 S;  2Z3X A;  1AIP C;  4AQY M;  1OAO C;  2J5Y A;  4DR7 M;  4OVZ B;  4LZZ A;  5EXS A;  4LY6 A;  2NQ8 C;  4KLN A;  1GJT A;  5EXT A;  2KRK A;  3GQ4 A;  3I4V A;  1N77 A;  5JI2 E;  1WJ7 A;  3HHX A;  3W68 A;  3TPZ A;  2F5S A;  4Q7J A;  2Z8Y M;  3TL4 X;  2CHV A;  2JY6 B;  3GO8 A;  1NY5 A;  2J7O A;  4NL4 H;  3D8L A;  2FFJ A;  4QHS A;  5EP3 A;  4D81 A;  3SMS A;  4R7G A;  4GEW A;  1I4W A;  2UUA M;  3M6A A;  2YR0 A;  4LCB A;  2R6F A;  4IJE A;  4PD2 A;  1DGB A;  3KVW A;  4GHL A;  3AFH A;  2QZ4 A;  3A42 A;  3AOE A;  3M7G A;  2DKL A;  4JI2 M;  2DZN B;  4JI6 M;  4JV5 M;  4G4R A;  4ITQ A;  1R6B X;  5E26 A;  3W67 A;  4GMQ A;  3HX3 A;  4Z8X A;  3GLI A;  1Q3C A;  1TH3 A;  2RRU A;  3W0L B;  2JWS A;  3KS8 A;  1BVS A;  1PJS A;  1NNU C;  2DAG A;  4RF0 A;  2ZM6 M;  3ILK A;  2Y0T A;  4L8R C;  1J7K A;  4QNM A;  2ZAO A;  3NWL A;  1QAQ A;  2JY7 A;  2KDL A;  1GKI A;  4IBG A;  3U6C A;  1YSY A;  1IXR C;  4AG6 A;  3QWL A;  1AUA A;  2UXC M;  3U6L A;  2R65 A;  2ZAM A;  2R45 A;  1MJG M;  3U6E A;  3PFI A;  4IBI A;  4LJ7 A;  1IQP A;  2OOB A;  1WR1 B;  1N34 M;  2QCU A;  1DO0 A;  4MGY E;  1LTM A;  4LF9 M;  5DFL A;  3HU1 A;  4L15 A;  2XH9 A;  4OU7 A;  3QYE A;  3E9S A;  3ZH9 B;  2G8L A;  1TR8 A;  4MH0 E;  3GLG E;  1XC8 A;  2ZTD A;  3AL0 C;  3J7A S;  2XF3 A;  3TWK A;  2LVA A;  3VDU A;  1J5E M;  1MN3 A;  5EXP A;  3U6M A;  1E9S A;  1NV8 A;  5A2Q S;  3CF0 A;  3JR4 A;  2LHG A;  4FCT A;  3B89 A;  5EP2 A;  5C18 A;  1DGG A;  1QUS A;  1VDL A;  4DV0 M;  3SHG B;  3VDP A;  1P3Q Q;  3GLG B; 
#chains in the Genus database with same CATH homology
 1NV9 A;  2MGW A;  2MJ5 B;  1UFZ A;  2JY8 A;  4DBG B;  1TTE A;  2HAK A;  2LBC A;  1WIV A;  1A5T A;  2JNH A;  2K0B X;  4G3O A;  1E94 E;  2DAE A;  2QSF X;  2ZTC A;  2DHY A;  2L4F A;  3GLH E;  1QZE A;  1CUK A;  2EJS A;  1R4G A;  2LVP C;  1WGL A;  2BWE A;  1IXS A;  4WP2 A;  1YLA A;  2MRO B;  1VQ1 A;  1C7Y A;  2EKK A;  1JR3 E;  4R71 A;  1OTR A;  1OAI A;  2EKF A;  2G3Q A;  1SG9 A;  1VEG A;  1AIP C;  1G3I A;  2JZ1 A;  3MMP A;  3FRH A;  1XXH E;  2HWJ A;  2DEN A;  5JI2 E;  1HQY E;  1WJ7 A;  1XB2 B;  4Q7J A;  2JY6 B;  1G4A E;  3K9O A;  2KNA A;  2K9D A;  2DAM A;  1DV0 A;  2JZ0 A;  2DAI A;  1ZMV A;  4GEW A;  3LCV B;  2H5X A;  2L2D A;  2CWB A;  3GLI E;  4UN2 B;  1VEJ A;  2WZJ A;  4HEO A;  2CP8 A;  1GO5 A;  2BWB A;  1VEK A;  1ZV1 A;  2DAK A;  2KNZ A;  3K9P A;  2DKL A;  3E21 A;  2JUJ A;  1Q02 A;  1EFU B;  2LVN C;  1T43 A;  2OO9 A;  2LVO C;  1IFY A;  2RRU A;  1Y8G A;  1ZMW A;  1BVS A;  2B3T A;  1IM2 A;  2LTU A;  1WGN A;  1OQY A;  2DAG A;  3FRI A;  3IHP A;  3BBZ A;  2R0I A;  2QHO B;  1HT2 E;  3GLF E;  2KHH A;  3H4J A;  1V92 A;  2JY7 A;  1OKS A;  1DO2 A;  2OOA A;  2L4E A;  4F2L A;  1VG5 A;  3FE3 A;  4F1I A;  1PGY A;  2JY5 A;  2DI0 A;  3IEC A;  2DNA A;  1HJP A;  2OOB A;  1WR1 B;  3F92 A;  3T6P A;  1DO0 A;  5DFL A;  2JP7 A;  1ZMU A;  2QNJ A;  1F4I A;  1G41 A;  1TR8 A;  3GLG E;  2ZTD A;  1WHC A;  2LVQ D;  3E46 A;  2LVA A;  1MN3 A;  2MR9 A;  1NV8 A;  1T6O A;  2O25 A;  3B89 A;  3LCU A;  2DZL A;  1HT1 E;  1VDL A;  1KYI A;  1P3Q Q;  2KNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...