1MN6A

Thioesterase domain from picromycin polyketide synthase, ph 7.6
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
281
structure length
276
Chain Sequence
AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDRAEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into channel architecture and substrate specificity from crystal structures of two macrocycle-forming thioesterases of modular polyketide synthases
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Transferase
molecule keywords polyketide synthase IV
total genus 88
structure length 276
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2002-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mn6A00
1Y7HA 1QIHA 4C6HA 3V9AA 5ALVA 2OCKA 3G9ZA 1SOMA 2DQZA 4GECA 5ALUA 4BAUA 2IITA 4XJVA 4HTAA 3W2TA 1ODTC 4BP9A 1BU8A 3KXPA 1HKHA 3OG9A 2WIDA 4DM7A 5ALXA 4W1PA 2QTBA 1AMNA 3B5EA 4C89A 5AO9A 3FWHA 1UXOA 5E4TA 2B9VA 2C4HA 2WIFA 5AKIA 4FNMA 2PSHA 5SYMA 1XRPA 1WHTA 2GZSA 3H0CA 1ZJ5A 5CT6A 2H7YA 5D7BA 3F98A 3G9XA 4K5QA 2CB9A 2AJCA 2Z3WA 3PUIA 1AC5A 1F6WA 3T52A 1XQVA 4GBGA 5JAOA 3A2NA 5AI5A 5K3EA 5DYWA 2HFJA 3HLKA 1CUAA 1CQWA 3FBWA 4OB7A 4CI9A 5A6VA 5CBKA 1WHSA 1R3DA 4MXDA 1LPAB 4G8BA 4LXGA 1CEXA 2XUQA 2JGJA 2OCGA 2OCLA 1JJFA 4P92A 3U1TA 4QNNA 3QMVA 3WJ1A 3KDAA 4UHHA 3STUA 2RI6A 5JD5A 1MX9A 1JJBA 2WU3A 5BOVA 3RARA 1XLVA 4IO0A 3K6KA 2WFMA 3ANTA 1QIFA 4UFPA 4YPVA 3ESBA 1VXRA 5K5EA 2C0QA 4K6GA 4FDMA 1G4HA 1DWQA 1UKAA 3WWPA 4CFSA 4CIAA 3I1IA 3KSRA 1E5TA 3MUNA 5T4HA 3ZLVA 2CUTA 3VVMA 3AZOA 5HKAA 4HAIA 3GBSA 1GPNA 3LIPA 2LIPA 1XLWA 1ODCA 1GQRA 2CKMA 3G9TA 3BXPA 1N1MA 1P0IA 4Q3KA 1IUNA 2XUKA 1MNAA 1BN7A 5AIAA 3FLBA 4A5SA 3HEAA 4RGYA 1UWCA 3SWWA 4U2FA 4DYHA 3STVA 5C7YA 1CLEA 4Q3LA 4AO6A 2JBWA 3R0VA 1UKBA 2PSDA 2DSNA 4GI1A 1L7AA 3FVRA 4HXEB 1UK6A 1JU3A 4PSUA 3PICA 5EIAA 1TCAA 2EDAA 2H9YA 3HSSA 1RYYA 3D0KA 3OM8A 5CXUA 3VXKA 2WHRA 4CCYA 1C4XA 3WWOA 1WB4A 1QTRA 3AIKA 2J3QA 3F97A 3FSGD 3VVLA 1O6GA 2JIDA 3A70A 2ZYIA 5AK4A 2PVSA 3OC0A 4IQ4A 3C45A 5HK9A 1XQXA 5A62A 1YAHA 1M33A 1XZGA 1OCEA 1YSCA 5A7FA 4V2IA 5ALWA 1XLUA 1J2EA 1R4ZA 2GYWA 3FYUA 1PFQA 5CT4A 3DS8A 4BRZA 2WUDA 3CCCA 2G63A 1DT3A 4FFWA 4KYVA 2OPHA 1YR2A 3PDCA 4OYLA 1OXMA 2RHTA 5AI0A 2AJBA 5DNWA 3JWEA 4RE6A 1ZJ4A 4J7AA 5CXXA 3W9BA 2OCIA 3AIMA 3I28A 3C5VA 1VJ5A 3I6MA 3V1KA 1WB5A 4XX1A 3HZOA 4UHFA 4X7BA 4L72A 3BF8A 1ZD3A 1VA5A 2JGKA 1EX9A 4E46A 5FRDA 1GQSA 5ALGA 5H3HA 4EUSA 1AZWA 2VTVA 4FWBA 1QIMA 2QUBA 2BCEA 1W76A 5JALA 4AO7A 2XB6A 1SCQA 4RNCA 4AMYA 3E3AA 4BAGA 1CUUA 5JD6A 3DD5A 3R3XA 4OUKX 1FFAA 1I6WA 4DMFA 4BTLA 2O7VA 3IUNA 4BTVA 3BE8A 1CUEA 4Y2SA 4FBMA 2HA5A 5AOAA 3D5EA 4WDRA 4N8DA 2VA9A 3D4LA 1E8MA 2QRUA 3R41A 4BC1A 5AKJA 2QOEA 1EDDA 2HA7A 2XMQA 4J0GA 4JEIA 5JATA 3GUUA 2BAGA 4FMPA 2YH2A 3H2GA 1UK8A 3DL7A 4X3CA 1CUZA 1XZDA 3M3DA 3OURA 3VJMA 1J07A 2VF2A 3M83A 1E8DA 2BKLA 2O7RA 5DLPA 5DNUA 5JAUA 5EHXA 1UOOA 3C8HA 4Y2PA 1K63A 2I78A 3R3VA 5EIHA 2ZVDA 5ESRA 3PFBA 1H2ZA 5AKEA 4CG3A 1QIDA 2IIVA 3IA2A 1DWOA 3EQ7A 3QPAA 3ZLTA 3BDIA 3I2KA 3WZLA 3HC7A 3R40A 1K6EA 1K5PA 4PSDA 5K3DA 6YASA 4EY5A 1E3QA 4BP8A 4AXBA 4XWGA 5CRIA 4EY7A 3CXUA 4CG1A 1BS9A 5LZ4A 2ACEA 4DMKA 1ZD2P 4A23A 1XZFA 4OSEA 2V96A 3STTA 1HBJA 2Y6UA 3ESCA 1XZJA 4P08A 3ESDA 3SC2A 2HHAA 5AKXA 4KRYA 2XMSA 3M82A 3QPCA 4DSZA 3BIXA 1P0MA 1PV1A 2AJ8A 2ES4A 2XT0A 4NMWA 4J0DA 1R9MA 4DGQA 4N8EA 1BE0A 1ZICA 5ALRA 1CV2A 4WFJA 4C4XA 1K4YA 2OGSA 5AM4A 4BCBA 3WWEA 1UOPA 3KD2A 3RK4A 3OTQA 1WCYA 5DNVA 3ZV7A 2WFZA 4ITVA 4C88A 2Y6VA 4Q34A 4BYMA 4FHZA 4FLEA 5C8ZA 3I2IA 2XUJA 2QMQA 4ARAA 2EDCA 4M0EA 1XRMA 3WJ2A 5ALSA 2JGFA 3K2IA 3BWXA 5E2IA 1JT2A 4Y2UA 1NU6A 3O4HA 1AUOA 4LIPD 3N2ZB 3QM1A 1EK1A 4M0FA 1QLWA 4M0MA 3C6BA 5KBYA 1CUWA 4YX9A 3C6YA 2BUBA 4ROTA 2GBFA 1E89A 1ZOIA 1EHYA 4MEBA 3IUQA 2YXPX 5AKYA 3B12A 2HA2A 1CVLA 2QXUA 5ALHA 3E0XA 3H1AA 5IH7A 4I19A 3HI4A 5AM0A 5EHZA 1VXOA 1CFJA 4U2CA 1A88A 1QIJA 3ED1A 3M81A 3T4UA 2XLBA 4BE9A 4QA9A 3QMWA 1TIBA 5LLSA 5IVKA 3K9BA 1EK2A 3L1IA 4IH1A 3WQHA 1SCKA 4L0CA 1XFDA 3QPDA 1QO7A 2GYVA 2RAUA 1YAJA 4XVCA 4LXHA 4G1FA 3BL8A 3PUHA 1IUOA 1QE3A 3BDVA 3C8DA 1K8QA 2GYUA 2FJ0A 5AKKA 3GELA 4FTWA 5ALJA 1DT5A 4BDTA 5ISMA 3GZJA 1RWQA 1QOZA 4AN0A 2JGMA 1T2NA 2OAGA 4GWLA 4UPDA 4UBKA 4C4ZA 3TJMA 1EB8A 2WJ3A 5A7GA 4GDMA 2V9ZA 3WKDA 5CH3A 5HFAA 1BRTA 4JH0A 3LS2A 4YASA 3O4IA 2V97A 5AP9A 3AILA 3KWJA 5ALYA 1R1DA 5HF6A 1UK9A 4B0OA 2XMZA 1P0PA 1JJIA 1EDEA 1XZCA 5HZGA 4J0KA 2VJBA 4ZGBA 4G4IA 3G0GA 3AIOA 2WIKA 3E1GA 3BJRA 1LPBB 3H17A 1ISPA 3WLAA 4C4YA 5HK8A 1G42A 4KR0A 3ZPXA 1EI9A 4J03A 4FKBA 5AKLA 5DWDA 1EVEA 1X70A 1LBSA 5LKRA 1VOTA 3WZMA 1QO9A 4IH4A 5ALFA 2I03A 3IIIA 1CUIA 5AI8A 1E66A 2P8SA 2ZJFA 4G4GA 2HRQA 2DFPA 2G5PA 4OD0A 4FOLA 4WJLA 2J4FA 3FCYA 2WHPA 3IB3A 4W9RA 5AJHA 4CCWA 4UBNA 4X97A 2XMCA 1GXSA 2V98A 5JZBA 1LPMA 1XRNA 3QZUA 4OYYA 1F0NA 3TRDA 2QZPA 2O2IA 3FLAA 4S0XA 3VJLA 1VA4A 1CR6A 1VZ2A 1ODSA 2VT7A 1N8SA 3FNBA 4K6HA 1QIKA 3O9VA 3CCBA 2WTNA 5EHNA 2XMBA 5HKBA 4ZRDA 3ICVA 4H7JA 2C5FA 4P9NA 2PU5A 3NUZA 5DJ5A 1THGA 4BVJA 3I2HA 4H35A 2BGNA 4EBBA 1G5FA 2CJPA 2HADA 1XRRA 4FNGA 3R3UA 4MYSA 4UBOA 1CUDA 4BVKA 3R3ZA 3WWDA 2WG0A 1ACLA 5AICA 3AZPA 2HA4A 4X91A 1GKLA 1YS2X 5T4BA 4WY5A 1N5MA 2OXEA 2VT6A 1MX5A 4YK7A 4IH9A 3LIIA 2XMDA 2WUEA 3O9MA 2HU5A 4UBLA 5FPQA 4UHCA 2C58A 5AK5A 5D6OA 4EY6A 5DYTA 4QDUA 2OQVA 3ANSA 1XROA 1P0QA 1CUSA 3ZLUA 4WY8A 1YA4A 3VDXA 4I4CA 4X94A 2XUAA 1TCCA 1ZGBA 3WL6A 1QZ3A 4BZZA 5CH5A 1JFRA 5EI5A 4Y7DA 2J3DA 4DLNA 4N5IX 1PJAA 3IURA 1VKHA 1H22A 3FCXA 3YASA 2OGTA 4NZZA 4A16A 2VATA 2XQIA 2ZYHA 1L7QA 1U2EA 2XI4A 1ACJA 2PM8A 1R50A 4KE9A 2JGIA 3ILSA 4BCCA 2EEPA 2R8BA 1EA5A 5AM1A 5FKJA 1MT3A 2XUGA 1ZI6A 1CIJA 4J0HA 5D3KA 3QBJA 2XUPA 1MAHA 4Q82A 2I3DA 3BF7A 2FUKA 1MTZA 2Y2UA 5JAPA 5KWJA 2PBLA 2X8BA 4N5HX 3WIOA 2G4LA 2QVBA 4WFKA 1HLGA 3A2MA 5E4YA 4PO3X 1FJ2A 1B41A 5AM2A 2HA6A 5FP0A 4ZI5A 4G8DA 4PW0A 3PF9A 3WWCA 2B4KA 4F21A 2Z3ZA 1EDBA 1EINA 3SX4A 1HDEA 2QUAA 4JUIA 5DYYA 4H77A 5AM3A 1CUFA 2XQFA 2C0PA 1QFMA 1F0PA 3H1BA 2CEKA 5T4FA 2OAEA 1GKKA 3N0TA 5ALQA 3DLTA 1YA8A 4EA6A 2ZJ6A 5A7HA 2XUFA 1WPRA 4B80A 5FV4A 2WG1A 2HM7A 1TRHA 3WK5A 1UKCA 2WU4A 5D3ZA 5BWCA 1XZEA 4MQLA 2O2GA 5K3FA 3S8YA 3H2KA 4ZV7A 3WKEA 4AN1A 2HFKA 1NU8A 2AXEA 2FX5A 4X93A 3RLIA 1BEEA 1UT6A 1IZ8A 3EIOA 1A8UA 2ZSIA 2UZ0A 4TVKA 3IUMA 4WCVA 1SFRA 5FLKA 5HCUA 4GHWA 5JASA 2WIJA 4X6XA 2QS9A 5I9IA 5JZ9A 1ZIXA 4BCDA 5YASA 4I3FA 4KAAA 1TCBA 4PV7A 1DX6A 1H2WA 2BJHA 4FBLA 5CW2A 2YASA 4X6UA 3ZWQA 4FLMA 2VJAA 2WFLA 4MWSA 5LZ9A 3W9UA 2WFLB 1VE7A 1N5RA 1ZGCA 1LZKA 4QLOA 3HRHA 5AIBA 4H7DA 4FFVA 3WK7A 3WIBA 2G5TA 4PNZA 1ZD4A 3KOOA 4KE6A 2ACKA 5AK6A 1FFDA 3WKAA 1W75A 5KREA 2NW6A 1GPLA 1U8EA 2ONCA 1LNSA 4X90A 3IBTA 3VJKA 1BCRA 1GT6A 4G8CA 1X2EA 4U2DA 2ORYA 2VJCA 2ZSHA 2WJ4A 1W6RA 4U2GA 5ALKA 3SK0A 1QONA 4B83A 5FXMA 4DMHA 3G0BA 1CUXA 2Z5GA 4ARBA 4ETWA 3LP5A 2PUJA 3OOSA 4UFNA 3EBLA 4OPMA 3TGLA 2XQJA 4X95A 4MYDA 3D7RA 1W1IA 3DCNA 1ZD5A 3WK8A 2VSQA 2AJDA 1AURA 1R88A 1Y7IA 2AJLI 1QIEA 2JEZA 1ZI8A 1AQLA 3GROA 4OB8A 4QEKA 5ALIA 2OGZA 4L3WA 3FYTA 4E15A 4ZV9A 4XIIA 3HJUA 3WMRA 5AOCA 4JNCA 5T4EA 1JU4A 1U4NA 4BAZA 3QITA 2VJDA 2XDWA 4W1RA 2DHDA 4H7EA 1CQZA 4MWTA 1YB7A 1Z68A 5JARA 1AGYA 2WTMA 5LP1A 1CUYA 2XE4A 1JKMA 1EH5A 5HFNA 5AI4A 1HPLA 4Q05A 4DNPA 4WDQA 2B20A 1ZIYA 3UUEA 1UK7A 3IVMA 2XUIA 1L7RA 5HF5A 2WIGA 2WLSA 5K3CA 4B84A 3D2CA 5K3FB 5SYNA 4TGLA 2H7CA 3I2JA 5AH0A 4OCZA 4WFIA 1A8SA 5BV7A 4FLFA 4ZREA 1FFBA 1LBTA 1WM1A 4QDZA 2PSJA 4F0JA 3G0DA 3H2IA 3QYJA 3LLCA 4OU4A 4OB6A 3AINA 1KEZA 3G7NA 4QE3A 1DWPA 4F5ZA 3GA7A 5LZ7A 1CUCA 5C8XA 1E8NA 1XZKA 2H1IA 5HF8A 5FOQA 2WUGA 1LGYA 5ALTA 5CTAA 5EIEA 5AKZA 4B0PA 4PSCA 3G02A 1SCIA 3W04A 2VAVA 3QH4A 1RP1A 1VLQA 4AMZA 4X71A 2DHEA 4GW3A 3BJMA 4RPCA 1QJ4A 4HZGA 1SC9A 1YB6A 2XUHA 2PSEA 7YASA 4H7KA 1XRQA 1IUPA 2QJRA 4KJXA 3VKFA 4U2EA 4AQDA 4JYMA 5AOBA 5AM5A 5KWIA 3WL8A 3BIWA 4UFOA 4B85A 2PSFA 3W06A 1AKNA 4G9GA 4UHBA 5DTJA 4X92A 3WK4A 4NVRA 4KRXA 5HF9A 3H04A 2HIHA 4Q3OA 5EFZA 3F96A 1EB9A 3CN9A 4UHDA 1FFCA 4MQMA 2RGUA 1LPSA 1T4MA 1DTEA 3S2ZA 4C01A 3A2LA 3STWA 4OU5A 5EHQA 1JMKC 5JADA 1HL7A 2XMGA 2VEOA 5E4JA 3V1NA 1WPXA 3WYDA 5JD4A 2WJ6A 2J4CA 3V1LA 3CN7A 4UBIA 1QTIA 4CG2A 2WKWA 2XUDA 3LCRA 4H7IA 4KE7A 5ALLA 2D5LA 3Q0TA 2C7BA 5C8VA 1MN6A 3PFCA 4X00A 1LPPA 3A6ZA 1XRLA 4B81A 1GZ7A 1XZAA 1X2BA 1MJ5A 5C81A 4J0JA 4CCYB 3DOHA 3O95A 5AI9A 3MGAA 4HS9A 1C7IA 4Y9SA 1XZMA 1LPOA 1LPNA 3X3HA 2VAXA 3FSGA 3DKKA 3C87A 3NOXA 3STXA 2DR0A 1ORWA 4RE5A 5I8PA 4QWMA 4CIBA 2PKYX 1MO2A 4Y2TA 3I6ZA 5ALNA 4W1SA 4KAJA 4GLBA 1CPYA 2CBGA 2QR5A 4P93A 2ROQA 4QWWA 2RHWA 3JYHA 2Y1KA 1YS1X 2BUCA 1J06A 1B6GA 1Q83A 5K3BA 1QGED 2OLEA 1TKRA 3G8YA 1LZLA 2BFNA 4BRSA 4Z49A 2Y2VA 1UZAA 5CH8A 2JEYA 1XZBA 2XQGA 4B82A 1O6FA 4F60A 1J1IA 1WB6A 3V48A 2RIPA 4ZXFA 4UHEA 3R3WA 4W63A 1G66A 5AK3A 5A71A 4AB1A 3WA7A 3L1HA 2B61A 4PQEA 3G0CA 3WI7A 4EY4A 2DHCA 4EZIA 1KU0A 3H19A 1CUBA 4G4JA 4QDOA 5AKGA 4GEGA 1R9NA 2WSLA 1USWA 1XZHA 1MNQA 3DKRA 2QXTA 5LIPA 4QLAA 3I2GA 2BUAA 3ICWA 4DNQA 1JMYA 1A8QA 2CZQA 1TQHA 3WK6A 3R3YA 5LKAA 4L9AA 1YCDA 1IVYA 2GZRA 3RM3A 5CT5A 4J3JA 3ESAA 4AO8A 1BN6A 3RKSA 4X85A 1QIGA 3JW8A 1Q0RA 3WA6A 3IUJA 1CUHA 4AZ3A 1MX1A 2DQYA 2JGLA 5ALOA 3I2FA 3FYUC 3IDAA 1OILA 3WKCA 3O4GA 4HXFB 2PL5A 5CT9A 3DYIA 4H18A 4LKOA 1ETHA 5FPPA 3HACA 1UFOA 3E4DA 3AFIA 2Z8XA 1D07A 2X5XA 3D2BA 1XQYA 3IULA 2Q0XA 2XMRA 2HU7A 2HU8A 5JIBA 3GFFA 4QDXA 2HRRA 2WG2A 2XLCA 3WL7A 4D9JA 4AX4A 1XKTA 4HVTA 3FOBA 4BDSA 5LZ5A 2WQZA 4E11A 3B3QA 1QFSA 4X6YA 2HDWA 1YASA 4U2BA 5AHXA 5AI6A 4B9EA 1F8UA 4Y2XA 1MAAA 2HA0A 4DNOA 3EQ8A 1Q84A 1CRLA 2OQIA 2XQKA 2E3JA 4JYPA 3ZI7A 4UBMA 1XZLA 4QZVA 2PUHA 2IX9A 3FVTA 1CUVA 5HQ3B 2R11A 4BC0A 1TAHA 1XZIA 4H7FA 1BCSA 2PPLA 2QKYA 1XKLA 3C43A 1LLFA 4Y2VA 4B6GA 3DJYA 2HA3A 5IVHA 2JF0A 2Z8ZA 4KACA 4EY8A 2OG1A 4ZWNA 1XQWA 2XUOA 4Y2QA 2WHQA 1BROA 5CURA 3DEAA 3QVMA 1EXWA 3C6XA 3WK9A 2D0DA 2C5GA 5ALPA 3DYVA 1H2YA 3WYNA 3D2AA 4BATA 4BZWA 2JGEA 4HRXA 5IVDA 1VE6A 5LZ8A 2W6CX 1TK3A 4B7ZA 1JI3A 3DDUA 3VISA 1GGVA 2ZYRA 2ECFA 3TEJA 3HABA 2FJPA 2BGRA 3I1YA 4HXGA 3DQZA 4J0CA 4DSAA 3G9UA 5HQ3A 5LZ2A 2K2QB 3QMMA 1ORVA 4QDTA 3STYA 4N8SA 3NWOA 4HRYA 2YYSA 3AUKA 4C87A 3DOIA 3EQ9A 4GXNA 2W22A 3PF8A 4KAFA 2QM0A 1DQZA 4INZA 3C6ZA 1S8OA 2X76A 2QT9A 3FYUB 2CMFA 2H7XA 3PE6A 4PF1A 1IMJA 4EHBA 1CUGA 3HXKA 4Y2JA 2HL6A 5IVIA 3D3NA 4W1QA 3H2HA 1A7UA 4Q1VA 3PI6A 1DX4A 3C70A 4TPKA 3DL4A 4UUQA 1BEZA 4DTCA 4NS4A 5JZSA 5IKXA 3O4JA 1NX9A 3W05A 4G5XA 1H2XA 3MUOA 5ALEA 4H7HA 4K6KA 4Y2YA 4LXIA 1KU6A 5F4ZA 4KEAA 1ZI9A 3NGMA 3O0DA 4O08A 1HQDA 4Y2RA 1EVQA 1H23A 2ZYSA 4BE4A 4K2AA 1AX9A 3FLEA 1Q0ZA 2WUFA 5K3AA 4UBJA 1IZ7A 1DU4A 1MU0A 2GBGA 5JYCA 4BB0A 4DNFA 1VZ3A 3UUFA 4DIUA 4G9EA 3WKBA 2VQ6A 3KWFA 5ALZA 3EF3A 1GPKA 3V1MA 5J3JA 1THTA 5CT8A 3F8SA 3HYSA 5AKHA 5DTIA 1FFEA 2GBCA 4LYDA 2QJWA 1FSSA 4MJ3A 1WOMA 3OPMA 3U0VA 3P2MA 4E14A 5I7UA 3MVEA 2RONA 3DNMA 3C5WP 5JAHA 4KE8A 3AJAA 3FAKA 1UOQA 4LYEA 2PX6A 5ALDA 4B9AA 2GBIA 1W4LA 5CMLA 4BVLA 2I3ZA 3I6YA 3F9CA 4IHAA 4EB0A 3H18A 2O2HA 4AZ0A 4LHEA 3AZQA 2PU7A 2ZJ7A 3WL5A 5ALMA 5FDFA 3UMJA 5FUMA 3F67A 1CUJA 1C7JA 3L1JA 1DINA 2WHPB 5A2GA 3G0IA 4H0CA 4DMCA 4BBZA 3H2JA 5EGNA 4J0IA 1Y37A 1MPXA 1W52X 2DCMA 1QIIA 4MEAA 3Q8WA 1U65A 5BWBA 2WM2A 1DQYA 5LYYA 3D59A 2WILA 5JANA
chains in the Genus database with same CATH superfamily
4HNSA 1OI2A 2C2WA 5IK2A 1Y9ZA 1E99A 3TB4A 1Z7BA 5EL0A 3JR3A 3SEAA 2J0EA 3Q88A 2F9LA 4B7AA 3OX3A 1QFZA 1P61B 2OCKA 3AUAA 4ZJPA 3VR5D 4GECA 5C1BA 3LL4A 3JAWA 3W2EA 4XJVA 5EERA 3ZYZA 4XCQA 3KKZA 3MT9A 4K81B 4WESA 5FBKA 2J6CA 4AYWA 2GXSA 2P27A 4JP8A 1NHGA 5GADl 2P75A 3VPBA 4TL6A 2ILTA 4HDSB 4Q6BA 3KV1A 4QM6A 2I6SA 4QG3A 3KDPA 1UFQA 3L8ZA 2X5JO 3GOHA 4HWRA 1OFTA 5CVDA 4IQFA 4QGSA 3WIEA 5IABA 3LPAA 2BH2A 3LV8A 5L95A 2WIDA 5FYQA 4DM7A 3G1TA 1BS2A 1J5XA 2DUUA 1V6CA 4JWKA 3W6OA 2QTBA 2XV1A 3CNQS 2IYOA 1HNZB 3CNNA 1TMGE 3FOWA 3QELA 4NLLA 4YCAA 4PX3A 4MULA 5AO9A 5CHYA 3C8ZA 1DXQA 5E4TA 2B9VA 3QLVA 3LMKA 2JKYA 1YMQA 2C4HA 4TWAA 1Q1NA 1RFGE 2FH5B 4X63A 4KO1S 1YOVB 3NHFA 3P2EA 4OBBA 4Y2HA 1U0LA 1WSBA 2BR5A 4JX8A 4ZCSA 3L2OB 4P33A 1XRPA 1A71A 4FZVA 3OAAD 5EWLA 1NBIA 4CHTA 3BK1A 3ELYA 1P0CA 2P90A 2H7YA 3BWMA 3DC7A 2R87A 4ZEWA 3T1NA 3CUVA 3FSJX 3ECCA 4JSTA 4FFLA 4OXKA 1M0WA 4HMOA 3PDWA 4EO7A 2QLBA 2R66A 1E2JA 3CU5A 1PJLA 2Z3WA 2AJCA 4TKZA 5F73A 5EYPA 1XJWA 4QGGA 4D02A 4O4JA 1BXRB 1F6WA 2FK7A 3P2KA 1A9RA 1TCVA 1XAJA 1H2AS 4GBGA 4K8OA 3QOYA 1KJQA 1CJUC 4RM3A 4ZZ0A 2QRVB 2NLOA 3EEYA 1QYVA 3NC0C 1MVOA 4JJKA 3EULA 4HADA 4BGDA 1CUAA 2IYZA 2CBZA 3VAAA 5EMJA 1D2NA 1N2EA 1X74A 3A6HA 4QBTA 3P9QA 5IJ9B 3GVCA 4CI9A 2PS0A 3BQMB 3DEYX 3KEFA 2R6HA 4Q7KA 1S2GA 2OD2A 4R8VA 3UAZA 2VH5R 3MLEA 4R5MA 3UH1A 3GLUA 3RADC 5FWXA 4HGQA 3M34A 4LC1A 2X0IA 4CM9A 4WTOA 1V7CA 5CYFA 2O23A 4X5OA 1R3DA 1S7GA 5BSTA 4YCNA 1XZ8A 1E3MA 1CEXA 1LSOA 3C1OA 2EFGA 2F8TA 1TM1E 3HDQA 2QDKA 4REQB 4UD6A 4EA7A 3UMBA 1BXKA 5E9AA 2C7OA 1JJFA 4I50A 3EQ2A 4PBRA 1FSZA 4G36A 1FTSA 5EJ8A 2O2YA 4UAJA 1QFJA 1ZNZA 1ZK3A 4A2QA 5DT2A 4EFLA 3C74A 1KO4A 3JQGA 1K4MA 4IHKA 4QPZA 4UZEA 5E1BA 4ZKDA 4G0MA 4W5RA 3TSAA 4O5OA 3STUA 5ICSA 1D6NA 1M1ZA 3OPQA 4H08A 4NOMA 1GCUA 1MX9A 3EVBA 5SYAA 3TD9A 5CFZA 3CLRC 3G8BA 2B99A 4HNAA 2VJNA 3BPSA 4D9KA 1ZMXA 1U0TA 3LQ1A 4L6AA 2IE8A 3JWGA 4ZJYA 4N6OA 4R2LA 1P1JA 1D6JA 4G0QA 2CNWA 2ODWA 5ETJA 2I71A 5IPFA 3FPAA 2AOUA 4C0SA 3ZJ5A 1FFGA 2FEMA 1YRLA 1I3KA 2NV0A 4CIXA 1RQ7A 3C7DB 1Z4IA 4JY7A 3N2GB 1VMEA 4KDRA 5FCDA 4A03A 1DWQA 2CXUA 3HO1A 4OTZA 4AC9A 5H0IA 1H2RS 2WUVA 2Q1TA 1SBTA 3MOGA 1Y9DA 3JQ8A 3OQJA 5DNUA 2VRBA 4FZ3A 3MUNA 4L5CA 4MP6A 5T4HA 1WWKA 1UFVA 2QN2A 5JY6A 4HVAA 5JU6A 1A4IA 1LX7A 4BNMA 1DAHA 1XU7A 2D00A 2WMYA 6NULA 3G5TA 1IG3A 2ZZNA 4LHZA 1C9MA 4U39A 3A6JA 3VVMA 4HAIA 2FNAA 4IOMA 4WLOA 3QX8A 3BBPA 3U49A 2PMDA 1KWKA 3CVXA 4G1VA 4FSDA 2BL4A 2I99A 2LIPA 3FWKA 3RIMA 1FLDA 1SA0B 1XLWA 1ODCA 6GPBA 2B3TA 1RI5A 5H16A 2B0CA 4JA0A 4BFXA 3G9TA 3BXPA 3RYFA 2PGJA 4JBLA 3TX6A 1Y8RB 2WE7A 3A4TA 3GD7A 4Q3KA 4Q3EA 5A4MS 3N05A 3GJQA 3I83A 5IXYA 1BN7A 3HDVA 3OA0A 2IS1A 3BWVA 3W8FA 2KW5A 2H6EA 3K8ZA 5KTTA 3WB9A 1YRHA 3C3EA 4JOCA 4V3CA 3RVSA 4RA9A 1VMKA 4ZPXA 3QYPA 2WT9A 2RHJA 2MYUA 2PSDA 2W2XA 4ZU6X 4HXEB 4GKVA 4PE5B 4JBWA 5IKMA 5M04A 1JU3A 1DXYA 2VDWA 2ZQZA 5CIWA 3B2EA 3ZDXB 1CRZA 4I1PA 1QHIA 2XGJA 4YRIA 5EIAA 5JCOC 2H9YA 3HSSA 1NUQA 4YH1A 3KQPA 1VYTA 3B7WA 3EIWA 3N87A 1RYYA 4FGSA 4MK4A 2CMGA 5DEOA 1F9EA 4TRMA 2XODA 5L3ZA 5CXUA 1EUQA 3OJXA 4MR7A 3GN2A 5KIAA 2MOKA 3FGPA 3NUQA 4QFBA 3R76A 5L4LA 2E9SA 3WWOA 2M1XA 1K5HA 3FUXA 2JGNA 1ADGA 4WWHA 1JQKA 2X5KO 2NO9A 3VVLA 3TPFA 5FBHA 2WJWA 1K06A 2JIDA 3A70A 2ZYIA 3H65A 2GX6A 3OZIA 4MIOA 5FAXA 3QENA 1FW6A 1BFUA 1FQJA 1PJ8A 2WJVA 2FFQA 3GIDA 3HGTA 5JTUA 2XXAB 3JQEA 3AEYA 1QRRA 1AY0A 4RS4A 4PWZA 4A73A 1EM8A 3W5HA 3CR3C 1X0VA 2A6PA 4Z4QA 1YSCA 4ZJUA 2WILA 4GMDA 1M1XB 3PGLA 1UPUA 5AW7A 5JSQA 4LMPA 2QUZA 2X5NA 1EAYA 1WO8A 2LD4A 1QS0A 3JZIA 3P9IA 3ONWA 1ISHA 4YGXB 3CPHA 2OP0A 3BAZA 4IRMA 3PVZA 3N8GA 4LZJA 2GYWA 3W77A 3F6BX 2UUCB 4HP8A 1GUZA 1HYHA 1PFQA 1JEDA 2Q6OA 4LQ4A 5K4HA 2J7PA 3FBGA 3N6XA 5EZYA 2IVFA 4PAGA 4CKEB 1DKPA 4MV0A 4GGPA 4IF4A 1SKYE 3ROFA 4BPRA 5CHEA 3V55A 4EFKA 4FWTA 1ZU4A 1DARA 2TS1A 2WUDA 2J7PD 3T7RA 7REQA 2P4HX 3UG6A 3V7YA 4QVIA 3PHBE 3GCGA 4FFWA 2CXQA 1SXQA 5BORA 4PR0A 3DO5A 3CKYA 1KY3A 1XPJA 3PDCA 1OBVA 1OXMA 2PZBA 2XE6A 4IGIA 4UVDA 1L1FA 4DL9A 1P8JA 3AP1A 3VH2A 4DLLA 4RJ2A 2ZU0C 3NBFA 4DR1B 1VTKA 4IDDA 3RNOA 4XFJA 2F59A 4O2BB 3VKVA 1J2RA 5CXXA 5F3DA 3DV0A 1V4NA 4A0FA 1T1GA 2OCIA 3K4HA 5F7JA 3DMTC 4XPIA 1RPNA 3I28A 5IXSA 2IK8A 2P4QA 4AM8A 1GZ6A 1PWHA 3I6MA 3ITDA 1LJ8A 3C4VA 3BFJA 2C94A 5FPKA 2FW9A 4BO2A 1O3YA 2R5FA 1M6HA 3BERA 4A4DA 4HMQA 3T3MB 1CDZA 1Q7EA 2A9KA 3C1TA 4X7BA 3K70D 2YHIA 3IC5A 1Y3IA 1VA5A 1QTQA 1OXKB 2NTJA 1JTFA 4EO4A 2ZUEA 4M9CA 4EECA 5ALGA 4R68A 5H3HA 4XIYA 5CFNA 1Z28A 3VHQA 4ARZA 2C5LA 5DW3A 5CLLA 3KQHA 1AZWA 1JR4A 1K9VF 3CFYA 3VR6H 4D6YA 2D5BA 4FWBA 4NHEA 1FTGA 4GE0A 4ALKA 1WZIA 2QMYA 3CINA 1W76A 3H7AA 2GKGA 2WPDA 4YHBA 3AI2A 2B30A 2AX4A 2PWYA 2O8EA 1I7LA 1KQPA 4IM7A 4ZVKA 4AO7A 2XB6A 4MGKR 4KR9A 1U0FA 4EH1A 2YWJA 3AQIA 1PZEA 1SXGA 2VJYA 3GZNA 4G4SO 4XH9B 4YJDA 4YJFB 1Z0IA 3GLSA 4EUHA 4DLYA 5AXAA 1WHSB 2WAAA 4D1YA 4KUHA 1KYQA 4FT4A 3A04A 3ZZUA 4BLUA 3UJNA 5TMBA 1ZGJA 1CQXA 1HMPA 1YT5A 2VL7A 3U7JA 2AG1A 4YN3A 3QTTA 2NZ2A 4KIJA 3UZUA 3WMXA 4J1QA 5I7HA 2HMSA 1CZKA 3P9SA 1JAZA 4HO1X 3ISJA 4LOKA 1M2EA 1R6BX 3K09A 2CZGA 1H4QA 3K0FA 5C8DA 3ENWA 4FBMA 2HA5A 1T34A 2D0PB 2GAOA 2QYTA 3W6UA 1VL1A 4WCDA 3E5HA 5AOAA 4MJLA 3D5EA 2ZUFA 4JITA 3NIBA 1ECPA 1XVIA 1PR1A 1DAPA 5DCLA 3B2QA 3R41A 4JQCA 3Q3HA 1GG8A 4TTAA 3RAJA 2Q41A 3E2PA 5EA2A 3DBLA 2DPYA 3NEAA 4JUBA 1M34A 4LZNA 3IEMA 2A4KA 3JD2A 1Z2AA 4HB0A 4R1SA 4WIAA 4IDHA 1L5YA 3H2GA 1PWZA 1TZBA 1UK8A 2O7QA 1EJ0A 3FTQA 4J16A 4UXJA 4FDUA 3TBHA 1HDYA 3DL7A 5KNCD 3RYIB 1LVGA 1VIYA 3LSYA 2IXDA 5I7VA 5LBUA 1HYGA 3UAWA 1ZD1A 2YC2C 1XZDA 2B1GA 2BEKA 2V74B 3ORRA 3QEJA 4FFRA 3OURA 4EYSA 4DW8A 3WYEA 2QTGA 1MJGA 1W1UA 4L74A 5ERYA 3UOGA 1EFUA 2IZZA 1P3JA 4ARVA 5DNCA 3CH5A 5E6UB 1DO2A 1U0BB 2Q9UA 2EX1A 3PEWA 3FKSA 1FFXA 2RAVA 2RGEA 3C5EA 1MFPA 4JC8A 2J5KA 3BEOA 3ZE0B 5CXSA 3JY6A 3R3VA 2C7PA 2ZVDA 4BO7A 2GCIA 3MCUA 5ESRA 1V41E 2JIPA 3I6BA 3PFBA 5AKEA 2ETVA 1TNDA 2HWKA 4N01A 4CG3A 3PC8A 2J5XA 2A7XA 4Y7CA 1YE8A 3QE3A 3QJYA 3IA2A 1T2UA 1YHNA 5AVSA 4FINA 2GM3A 4YROA 2PMCA 2YBEA 3B6IA 4HDNB 3UHAA 2PSSA 2AFVA 5JRDS 1WVGA 1QP7A 4C30A 4PYIA 3T06B 3FYDA 3M0EA 4RHYA 4JZYA 4W5WA 1REQB 2Y93A 3E82A 2XKBA 5FV7A 3ZE1B 2YS7A 4ZKEA 4DXHA 2FLWA 2HBRA 1GT91 1UMDB 2IIBA 3KHTA 3L8EA 3KXIA 4YIHA 3QWHA 1L4EA 1NXQA 4O33A 2ZT7A 2XYGA 1EHCA 4BP8A 2DMRA 3EMKA 2YTZA 4TV9F 4AXBA 1NXPA 1ZKDA 3NTOA 5CRIA 1YQQA 1NURA 2AV6A 3E18A 1RJ9B 4MR7B 2RHRA 1LRLA 2XMPA 4CG1A 5LZ4A 2AFRA 4ZZ2A 4PYQA 2HXYA 3EGIA 1DHRA 1U8YA 2B0JA 1OX4B 4YT4A 1JA0A 5GINE 1JH8A 4A23A 3Q8LA 1QCDA 2BHTA 3F7NA 4MA4A 4OSEA 4RCVA 3LVRE 1I3OA 5J4VA 1PEYA 3Q7PA 3ESCA 2Y6UA 1RI2A 2YY7A 3STTA 5CCEA 1BX0A 3DQPA 1SBCA 3U13A 4P08A 1A1VA 2PYZA 4RF5A 1S6YA 3OWHA 1F60A 1KEEB 2HHAA 3DGEC 5EP1A 1Y5MA 3IMKA 4L7QA 1H0KA 3N1UA 3RQIA 3FPJA 1BXRA 2OWDA 2P69A 1MO6A 2WF7A 2ZRJA 4QC2A 4RZ2A 4QEZA 5KHAA 5KTOA 4WOKA 2B5OA 4X7RA 5FL3A 1XA3A 1BDJA 1FRZA 2Q3CA 2GK7A 3R5JA 1KP2A 1YH3A 1P0MA 3AR5A 3DLCA 4LUCA 3GAFA 5EJ6A 3UGJA 1PV1A 2HMWA 3VPCA 2GK6A 1Y80A 3DVQX 2ES4A 4WK0B 4X54A 4LYYA 4BUZA 4JLMA 2BFMA 2P9QA 4B6JA 4EM6A 1EWVA 4V1CA 2YS6A 2OKGA 1EBBA 2G4VA 4DV6B 5D7NA 3DB1A 5DNDA 3LC2O 1D8AA 3M3PA 3ID6C 1BJRE 1XVAA 2G0NA 3DOFA 5D85A 4YP5A 1YK0A 5BSMA 4HDNA 4MS1B 4DGQA 5HRCA 4Z7QB 2GDJA 2BC9A 4BMXA 5JAMA 2EZUA 3D8RA 4OBWA 2C2ZA 1BE0A 1H93A 1ZICA 3KAKA 2DWCA 3RGGA 3AEQA 5IZ4A 2OO7A 5AM4A 2QZ9A 4PHFA 3SVZA 3RH0A 1M6VB 1UOPA 3CLTD 2GM9A 3A9CA 4GC5A 5E8RA 5HHTA 3NPAA 4M83A 4ZAFA 1EFLA 3IOMA 5CDUA 3OTQA 2C54A 5DNVA 3ZV7A 4A8HA 1KMHB 1ZNYA 3HKDB 4KVAA 1QKKA 1K7SN 4AKIA 2CHVA 1Z4QA 1JE1A 2Y6VA 3FETA 1PN3A 5COQA 1FRVA 2CHFA 3JZFA 1IN4A 2E85A 4FGUA 4K40A 4OQLA 1WMSA 4UARA 5K51A 3W5IA 2GEUA 3L7OA 3S7TA 4ICIA 5IT0A 1CJBA 1PS0A 4FLEA 1AQ6A 4LVNA 3AFNA 4MW2A 2RMKA 3EF0A 2XUJA 1H6DA 1KYWA 1MH1A 4K9KA 3V8BA 4ZQCB 4ARAA 4M0EA 1NUTA 2X19A 4M0UA 1D2GA 1OXVA 3TIVA 1RPJA 1XDSA 1PLKA 3BWXA 2HK9A 4FFOA 1OLSA 3KAPA 5E2AA 4HAWA 1NU6A 4XWWA 3DZIA 2FPMA 3B1YA 1AUOA 3G2QA 3ETCA 3QKSB 4IFBA 4YI5A 4O4JF 3SPXA 3WLOA 2UYHA 2IEAA 3LTEA 4NCNA 4P22A 1HT3A 1C2YA 3REOA 3I9V1 4G5OA 4HLUC 1UT5A 3LFHA 2VHQA 2GEDA 4M0MA 3D8UA 3B9BA 4LJYA 4NAUA 4C0BA 2YCBA 3LVBA 4QQKA 1E6UA 5LXTB 3E9YA 4DA6A 4G5QA 2HCFA 4CDMA 1P2UA 1HGXA 2DLNA 4DA8A 2DJ5A 1AN0A 2RK6A 3JVVA 5EVCA 5JDIA 1ZW6A 3DUFA 3F6EX 2PL3A 5DWVA 1XRSB 2A9RA 1VC2A 2OO5C 2VJLA 5AKYA 5GOTA 3UMCA 3F7MA 3CW8X 3BSFA 4TOIA 3WISA 3GZ4A 1E63A 4TSFD 1WDMA 4OJMX 1X9GA 4ZAXA 5JMTA 3T7AA 1P5RA 5IH7A 1WJGA 4J43A 4RFLA 2VWQA 3CRMA 4CCSA 5HR5A 3T38A 4FQ7A 3ZGNA 4OY3A 4F56A 1Q0TA 3MWDB 1ZK4A 3BM5A 3E0QA 3F6RA 3MRVA 3Q7QA 3Q3VA 5C4GB 4BMPB 4CL3A 2JASA 1DBIA 2D6FA 4UVGA 5B58T 2KB0A 1AKYA 1TJ5A 1KPIA 3IJ5A 1PHRA 1ZLXA 2GGSA 1JIQA 2JLAA 2EARA 2XY4A 2ZRCA 4IICA 5CVEA 2NM0A 1MVLA 3ED1A 3K73O 3M81A 4PGFA 1OYVA 3NAQA 2GFQA 5A3SA 2OFFA 1TU0A 2I29A 2HLHA 2E2WA 2XLBA 2QMZA 4Q24A 3PC3A 4QA9A 2VP9A 3C3WA 5LLSA 3K9HA 4S1TA 3C4JA 1BNCA 1SXJB 3B6JA 1MG5A 5JHHB 1MAWA 3EDMA 1Z0DA 3ACCA 3PDIB 4M6WB 3F6SA 4EJMA 3OI7A 1EK2A 2QN1A 4EARA 3N7TA 4CLRB 3A4NA 1QO7A 1U2DC 1O97D 3W0LB 1K5DA 1EUDA 1GKIA 1MG0A 1XZNA 1YAJA 2JGDB 4LF8B 4JJAA 2G77B 2ZE8A 3TTXA 3ZIAA 3WJAA 2P2DA 3ZTYA 3SC2B 1GIAA 1ZHOA 4OGGA 3WB1A 3V1TC 2GFIA 1COZA 2CDNA 2WJAA 1BKYA 3SYKA 2J3LA 5HKKD 1U8CB 4R0NA 1YZUA 3O94A 2PMWB 4YP1A 1SKMA 5IULC 4PTLA 4QAQA 1H8EA 2ATVA 2IDJA 1YD7A 3PSHA 4Q21A 5IDYA 1R8JA 3VPDA 5AVQA 3ZDBA 2A1UB 2ZATA 4PGHA 4ER3A 5HJ2A 4EUFA 2OC9A 3MLBA 2ET6A 2Q5EA 4QJBA 1IPEA 3TLBA 1VHWA 5EMHA 2QL9A 4G23A 1A4RA 4UEKA 3WGNA 4DARA 5B7GA 3LP6A 2CW5A 5KINB 4XYEA 3DE3X 2BW0A 1O57A 3NTLA 3OHMA 5A3RA 1H1LB 4KN5A 3GELA 1PJ2A 3IEIA 3MTGA 4FTWA 4YS6A 4BDTA 3AUUA 1TB4A 4YRNA 3GZJA 1X1QA 5FNVA 2YN2A 3SKVA 4Q02A 1UUFA 1H1DA 3MA0A 4FN4A 3SSMA 3DV9A 1D6MA 3E7DA 1E0DA 3PXXA 2OXTA 4ZEMA 2SICE 5G0WA 1T5DX 2OAGA 4TZ6A 3W8EA 1K8RA 4OIFA 4TLCA 2D06A 4GLLA 1C4KA 2II6A 2YWXA 4NZ9A 1MF7A 1C3OA 2YIDA 3FVQA 1QUEA 1U1IA 2WJ3A 3NTVA 4WFQA 3ZGYA 3KYJB 4I1YA 4PPQA 3ROEA 1LCIA 5ARBA 1OTXA 5BRNA 5GIOE 4JH0A 3HUEA 1HV8A 1AU9A 1USUA 4R8SA 3BCUA 3IDSA 1XTRA 3AJRA 1QPBA 3K9CA 3QVWA 4L57A 4ZICA 3HUDA 5DYIA 3RUEA 2FA9A 2AFHE 1ZDMA 2CFOA 3L1VA 3NC1C 3KWJA 4L27A 2QM3A 2R6DA 4IGEA 3WNBA 5IBQA 3D8SA 1MC1A 1UK9A 4WGGA 1VHLA 2TMGA 2PJZA 4URZR 4ITUA 1KK1A 1P0PA 1P2GA 1XJQA 2VWHA 1HYQA 3HDHA 3FRIA 4I55F 5HZGA 4L78A 5JPIA 2CFIA 4CM4A 4EMSA 4PAQA 4XB2A 1G7CA 5DSTA 4BJ5A 1U2RA 1XMOB 2Y71A 3AIOA 2WIKA 3D4OA 1QP8A 4K26A 3I09A 1T9HA 2ACWA 2P6OA 1P6QA 1LPBB 3BJRA 3L9XA 3SBOA 5BUCA 1RBZA 3PI7A 1NUUA 1CEEA 1UJCA 1ISPA 3WLAA 2ZJBA 3ELDA 3DBIA 2FG5A 2KE5A 1MPTA 4L4SA 4YDHB 5HK8A 4OLAA 4G37A 2YJZA 2JJ1A 1T29A 3MRXA 3ZPXA 4DNXA 4QXMA 4FKBA 3MFYA 2CKDA 3OVMA 3WRYC 3QUSA 1T0JB 3REGA 2ZQYA 3R7NA 2FQQA 2GVZC 1X38A 2L0XA 1X70A 2X3FA 3KCNA 4UCXA 5LP6A 3T0FA 3KQLA 3RC8A 1VOTA 3WZMA 5ITWA 3A6FA 2PO7A 2H54A 5JC8A 4KPGA 4GO1A 5ALFA 5K0BA 4DCOA 1JB9A 3P0FA 4RY9A 5BXQC 3LX6A 1J9GA 3KYDA 5AI8A 4EUKA 5KSYA 1ZN8A 4NZOA 3KKQA 4JKYA 1EQAA 1L8LA 1NC1A 2PHZA 4MOWA 1ADCA 4U0KA 2P8SA 1C1DA 3JQBA 3IPRA 5I3CA 1ESNA 3QXHA 4REOA 4KOEC 3NHLA 1RLTA 3IIKA 4UM5A 4HUQA 3X1KA 2VPQA 2IV2X 1RQPA 1QMPA 2M6RA 2DFPA 3A26A 1WDKA 3I01A 4OD0A 2G25A 4FOLA 4OM8A 4B6PA 5LU8A 3EVTA 2VP6A 1CQJA 5JRZA 2J4FA 5AYVA 2NPOA 3V33A 4TN1A 4IY1A 2PN1A 3FNHA 1P5ZB 4HWKA 4UBNA 3HBNA 4ZZIA 1ICEA 1MZVA 4W4TA 1GXSA 1IY2A 1IMOA 2P91A 3CEAA 1IHXA 2Y1EA 1IM2A 1C8LA 3DE0X 4OXQA 4NWIA 1KH2A 3WGVA 3KBBA 3RODA 4EGSA 1Q1EA 4LRYA 3QZUA 4KQEA 3Q5GA 1Y5NA 2FZKA 1RYEA 3CE6A 3T1VA 1N9GB 2O2IA 1B16A 1FE8A 4GD3Q 4Q4AA 4HCJA 5JYDA 1M9NA 1VA4A 2R96A 3IH5A 4ES6A 4PTYA 1PV2A 2VT7A 1ODSA 3EA0A 3MAJA 4XUCA 2VQEB 3OY2A 3LQKA 2WA2A 3K32A 4EHFA 5FX2A 3WMGA 1QIKA 2NO0A 3U4QB 4G0NA 1GOTA 2REXB 4LQLA 3BX1A 1R6AA 3IJRA 4JLJA 1GQOA 2XMBA 5EHGA 5HKBA 2XNDA 2UZ3A 4RVFA 5FUXA 2AK2A 1ADYA 3PXCX 3MOIA 4H7JA 1ZLYA 2VYFA 4OXNA 4P9NA 4U7HA 4WOJA 3OSZA 3RKUA 4CR8A 4EMBA 1AQUA 5DOVA 2IS6A 1AK9A 3I1JA 1T8TA 5LA6B 1GRQA 3ZDDA 1GAQA 2VTDA 2AN9A 3PC4A 3CUUA 3K2BA 3Q2IA 2E87A 3MTAA 1SUCA 2W2TA 3PHGA 3QOXA 4FE7A 2Q9BA 1AZSC 1HYBA 3D5TA 3G2KA 3OPYI 1R0WA 4FNGA 3QE0A 4YIKA 5CJJA 1QH9A 3O5AA 4MWDA 4PZYA 2A94A 4FONA 1CUDA 1US8A 2Y1LA 3PZBA 3WWDA 2WG0A 2OZVA 1NKVA 4ZXPA 5TMEA 3RANA 3DE6X 1YZVA 3ML1A 3TNDA 1Z75A 1ZGAA 4KTVE 3USES 1FVXA 4L8LA 4TV9B 4QUKA 1TE2A 5IDWA 2GTIA 4L4RA 1N5MA 3GFPA 2VT6A 3HN2A 1MTOA 2AB0A 5J43A 4X20A 2C57A 4EGJA 1ZWKA 4MW0A 4PZCA 1U3WA 3H3JA 3PGKA 1FMTA 3EMVA 3ZV3A 5L4SA 1JKJB 3O9MA 4KZPA 2GVDC 1P1BA 5AUOB 4JVOA 4FHCA 3QRWA 4UZFA 5FPQA 4UHCA 1WF6A 1YQWA 3TIXB 1M34E 4E2YA 4TQUS 1L7VC 5BP7A 1INLA 1Y5IA 3LYHA 3BREA 3G68A 4N9QA 4QBGB 2JCBA 1NXWA 3UM9A 2ZYUX 5FOUA 5EN4A 3F4BA 2AI1A 3IQZA 3V97A 1OLUA 3ZW8A 1MHTA 2ZJ0A 2B7CA 4CUKA 1QGUB 2A0WA 1B8VA 1FUKA 4D8TA 4MYCA 5A9SB 3W1EA 4B47A 4BGUA 4IHJA 1NXVA 1ML3A 1PU2A 4MA0A 3O73A 2IXTA 4GEKA 5AXDA 3HDJA 4WY8A 1WRBA 2MIIA 2XUAA 4WESB 5CX4A 1EFVB 2C7VA 1RBMA 3IIMA 4FMBB 2XOEA 3VQTA 1P9LA 2ZM6B 3BFPA 1ENYA 3OO0A 2RH8A 4BZZA 1FJXA 2BFEB 2QTTA 3DUWA 2EJWA 3LGAA 5KDOA 3LHSA 2JFBA 3GRZA 3OJCA 3OM1A 3R0XA 2J3DA 5T8KC 4CJXA 4NF2A 3RFTA 4MVJG 3YASA 4O25A 3QV2A 4MCAA 1F8XA 3QWAA 4A16A 3SF8A 3TSZA 4DFDA 5LIRA 1ZR2A 4ZVPA 2XQIA 2ZYHA 4CMIB 4AS3A 1ND6A 1USKA 3SEQA 3UMVA 2QD5A 3QWFA 4PANA 2VAMA 1R50A 3GL9A 3I64A 3ORYA 2F3SA 1FVOA 1DV2A 2JGIA 3ESZA 3ILSA 4KE9A 4WUVA 1U8UA 2EEPA 2ZUTA 3S8EA 5EIFA 4FOSA 4U4AA 1IHPA 4Z0PA 4WEQA 5TVGA 3HBLA 1V71A 3L8CA 4JU9A 5AM1A 5TXGA 3VVBA 2BI7A 5B6PA 3FW1A 3GVHA 1MT3A 1XTVA 2JDIA 2Q21A 3EWAA 3HP4A 3HYTA 2GUWA 1UCFA 1PT5A 3H87A 4J0HA 2J5QA 1MAHA 4RAQA 1GPYA 4DQ0A 2HF8A 2RI0A 1A95A 1QO0A 1RRPA 1T2VA 2I3DA 2PLWA 4HDOB 3ABRB 1JG1A 3JYNA 4G0OA 4Y8VA 4JFRA 5EIBD 4TLDA 2CJWB 4HEA1 3FJOA 2UYCA 4L6IA 3MF4A 5FPTA 1WKBA 2ST1A 3TVDA 4EW6A 4NAVA 4D3SA 2R48A 4KIFA 1UPAA 4ZDKA 3SYLA 1Y7TA 1DBPA 4H1UA 2J9GA 3AP3A 1N2BA 2W93A 4IJVA 4RIIA 2G4LA 3ZGZA 2QVBA 4E33A 3NR2A 1FL9A 4ENTA 5ITZB 3L5OA 2OHIA 3GUVA 1XDZA 3RPEA 4KP7A 1R3UA 2D4HA 4MR9A 4S3MA 3L6CA 1Z5PA 2IHKA 2YN4A 4XVHA 4ND2A 1IY0A 1E9BA 2DH6A 2XQVA 1FJ2A 2XJ4A 3H75A 4TRJA 3USCS 4A26A 5AM2A 1I24A 1OVGA 4YUZA 1WXXA 4ZA2A 2CWWA 2RKBA 1IBMB 3T61A 4WBNF 4Y2GA 1BVYF 4P81A 3UPDA 5MFPA 4MV3A 3VAYA 1M6VA 1YKSA 4W9MC 3WNZA 3RI3A 3IL2A 1YFKA 2Q4TA 4WPGA 4KV9A 1ID1A 3WGOA 2OL4A 4QPCA 2X0KA 4EJ6A 4ETIA 3ISTA 5BOSB 5EP4A 1YUNA 2P5SA 3KR9A 4U7DA 2C99A 2WJPA 5HPYB 4KITB 1DKRA 1EINA 4QOHA 2PUGA 3JARA 3SX4A 2Q5OA 3MJEA 2P40A 4UUBA 4CKCA 1CXZA 2NYVA 1HDEA 1ZAKA 2G7ZA 1PLLA 1IM8A 3HTXA 2BLLA 2C4UA 4H2DA 4H77A 5DYYA 3VR6A 1G4UR 3KZKA 4B76A 4DCCA 2WHYA 5K99A 1Y3BE 2I66A 2CV0A 1QFMA 3AR3A 5T4FA 5THKA 2OAEA 1GKKA 4HLQB 4XQ0A 3N0TA 3SJAA 1QK4A 4L02A 4AJPA 2GBPA 3BJZA 3N9IA 2IUEA 2JLSA 1E5VA 4EA6A 3TL3A 3L1UA 2FWIA 1OOEA 3QLEA 4JDPA 4YONB 2IPXA 4KRGA 5F5XA 2EFEB 2ZTVA 3D7MA 3TQHA 4UPEA 5CM9C 2AL7A 1KH1A 1U02A 3I32A 4QQFA 2XVXA 1KJNA 2HM7A 1N3IA 3KKMA 3LCMA 4IP0A 1TRHA 2I65A 1KDZA 1YRQA 4YAEA 4RGVA 4MO9A 1L4BA 3FFXA 1P29A 2C9YA 2CMHA 3JWIA 4R0MA 1KYZA 3K2EA 1LDYA 4BX2A 3O26A 4MQLA 3F2VA 5IUNC 2O52A 5JCPA 5JYBA 5MN4A 4ZCPA 1KJ9A 3MJRA 2W43A 2XTJA 3BH6A 1JA9A 1JEYA 3KJIA 3D3WA 4PZZA 2PX3A 4YRLA 2F62A 2EF0A 1URPA 1XCOA 3OTIA 4C43A 1PR9A 5JSKA 1ETUA 3LQRA 4S1WA 5L6MB 4ZI7A 3PUZA 1NMQA 3RSFA 2IH5A 4OHRA 3VX4A 3OZFA 2KMLA 4NPCA 2IQ5A 3OETA 1W5BA 2TRSB 1GGKA 3E9RA 3IAXA 3QYFA 1IZ8A 1OD6A 3EIOA 1K0UA 1P72A 2O3JA 3KJGA 1IQRA 3OY7A 4TVKA 3MHPA 4F45A 3S1LA 1O6ZA 3R77A 5JSZA 1IZZA 5HBGA 3RTCA 3ZHSA 3QOFA 1PTJC 4G01B 4KXUA 1KI9A 1P4JA 2EBWA 3UAYA 1H42A 1MH9A 3I05A 2WIJA 4P1ZA 3WICA 3OZWA 4DPKA 1LSSA 4MW5A 2QS9A 4PXSA 2XAAA 5ELXA 1JLLB 2FUNB 2JA1A 3M33A 4FFMA 2IXEA 1JH9A 3F78A 2DFNA 5C8YA 1N57A 4LDRA 4KAAA 2ZRLA 1KC1A 4W6ZA 2ZYTX 4QIHA 3WHIA 4MVJM 4BGVA 4EHLA 3SDBA 4MKIA 5LU9A 2PGIA 5G3ZA 3VBEA 4A6PA 1YCHA 4FBLA 4I4TA 1B1AA 4CV3A 4W9NC 1CKEA 2YVLA 3TRJA 1OBFO 4Y1RA 3DWIA 1ZH0A 4MTCA 5JQWA 2HT1A 3FG9A 3UHFA 4W82A 4EJFA 3HO8A 1D03A 4RKFA 5TJHA 3B9QA 3HEMA 4EJ0A 2E5LB 1OGYA 1N5RA 2QRZA 4MS4B 5B5SA 2RGYA 3EIQA 4J0EA 1HRDA 5A9SA 2CVHA 2TSYB 3NGXA 2JJ8A 5FHQA 1ZH8A 4R2XA 1OLXA 4K9MA 4YMWA 1PZMA 4Q7EA 1RBYA 3M2TA 4KXWA 3MTDA 4WKNA 1EK6A 1JKIA 2QI9F 2G5TA 3GFVA 4PM4A 3OTOB 3EFOB 4QFMA 3U7FB 3ORHA 2VAPA 2RC6A 4IUCS 5AK6A 4FUQA 3H2ZA 2H4YA 2C9ZA 3FCEA 3MWFA 4ZTUB 5BPFA 3W2HA 1TT5B 4NH4A 3WDSA 1HWYA 3ZE9A 4ZI7B 4D0LB 5KX5F 1EE9A 1VKRA 4UNRA 5L45A 1C4WA 3NT4A 1OKKD 1UBHS 4PYLA 5EJ9A 3BC1A 1FY2A 5HZHA 2C5AA 2ONCA 2OP1A 2PH7A 3JQCA 3VRHA 4X90A 3UTDA 3BQ9A 1WXIA 3KS9A 1DFIA 4OUDA 3VO8A 4F4UA 3V4LA 2GT1A 4GUDA 2AD1A 3LPCA 2D1QA 1K2WA 3LNCA 1KKLA 1Y1KE 4FZJA 4IGKA 3C8MA 4JROA 2I8LA 1MABB 3GH1A 4U2DA 2SBTA 2ODEA 2VJCA 4ZCQA 4S35A 4BB9A 2CDAA 1EA7A 2ZSHA 3AFGA 3ZHOA 2Y27A 1HE1C 1LI7A 3SR0A 4V0RA 4Q47A 1PR0A 3PIDA 2OHFA 2OBMA 4NE2A 4HBGA 4Q1AA 5ALKA 3RLFA 3SK0A 3SQOA 1QONA 3UWOA 5T7BA 1J0XO 5A04A 2ENWA 1O95D 2QBYA 3FPGA 2Z2XA 3I53A 2QRQA 4DMHA 3G0BA 3MMZA 1GCIA 1KAQA 4FYJA 4PPNA 4DQVA 3SR4A 5E3HA 5I7OA 4Y6SA 3R3HA 2PUJA 1OBOA 4LF7B 3CUSA 3OOSA 4DDHA 2CHGA 4EF6A 4CM7A 2QIPA 3L8YA 5T64A 2PTHA 3D3QA 4QOGA 2F3PA 1NW7A 1G6HA 3GPBA 4N5LA 3KLNA 4CNQA 4FW9A 2WJGA 2ATXA 3F8WA 3T1YB 1DJNA 2AN5A 1JKXA 1GSOA 2VSQA 3B20A 3D6TB 3G17A 3NHPA 2ZZKA 3Q6IA 4LNAA 3V8QA 3WBJA 5T3UA 4EKIA 2WZQA 4ESEA 2JG3A 3T3EA 1SVUA 2AJLI 4DSAA 1S2OA 3I4LA 3I73A 1NJSA 3COWA 4K1XA 1QIEA 4BZPA 1E7YA 1P9OA 1ULSA 3K2QA 4IEFB 3UYKA 2JH8A 1JG4A 1W6UA 4R9NA 4WLVA 1ZI8A 2FCRA 1AQLA 4MYHA 3EY4A 4TS1A 1MDBA 4NC9A 3N3BC 4B45A 3VOBA 1ENPA 1OROA 2Q3BA 3WYFA 5C5DA 1Y6ZA 5IX8A 1ZVVA 4QEKA 2ZIGA 3A1EA 3LUCA 4L0DA 5KAPA 4COKA 2BFAA 2VHTA 5ALIA 4UTNA 4RLHA 3O3OB 5GQSA 2ZDQA 4M0PA 3VHRA 3FYTA 3MWKA 4EIWA 2W2KA 4GOMD 3WBKA 4XIIA 4XM2A 2YQ5A 4RMGA 5HIKA 1H8ED 2W2KB 3ETHA 1IIRA 4R01A 2DCUA 1MV8A 3AR2A 4W9NA 3GGOA 3PQDA 3Q41A 4L5BA 4HF7A 5F9MA 1JU4A 3EPLA 3L5KA 3LT1A 4WY2A 3A14A 2X4LA 1S01A 3MXTA 4CKCB 4AFNA 4M55A 4NQZA 2I55A 3TLZA 4BAZA 1KFCB 4QGHA 4FHGA 3V46A 5KNBH 1PR4A 3SXPA 3W9SA 5BQFA 1J2TA 1I5EA 2RHMA 2XDWA 1Y4SA 1QZTA 3AETA 5DASA 5AR1A 3X2EA 4RK6A 4ND5A 3QGMA 4HYTA 4P7KA 4FVTA 1E1CB 1LI4A 1R0LA 1UEXC 3UUGA 3E84A 1Z68A 2W4MA 2GBLC 3OLYA 3ADDA 3TZQA 5LP1A 1CUYA 4K05A 2H1CA 4EKGA 4ZVUA 1WUIS 1EH5A 5JMPA 5HFNA 1RPZA 1FX0B 3HM9A 1GM5A 1HPLA 1HXHA 3VOTA 1L3BA 2OHVA 3SXUA 4Q05A 2IYNA 3CX6A 4Y0NA 4I9NA 4Y1EA 1XDDA 1T3TA 2WYOA 3LT0A 1NVMB 1KMQA 1N0IA 5BN5B 3FAZA 2HI0A 3AIIA 2ZAOA 4LWPA 3JX9A 1P18A 1ZIYA 3UUEA 4ETMA 4F8EA 2PPVA 5TPZD 3VKHA 1NP3A 3R2JA 3NFRA 2VH2A 2WAOA 1GFIA 1WNFA 3I92A 3LA6A 2VHYA 1I1QB 4LE1A 3G3EA 1GAXA 1E6EA 1NF2A 3HBJA 1FDWA 4E2ZA 2Q5HA 5EUMA 3ZWNA 2PD4A 3GJ8A 3ZWMA 4HH1A 1LEHA 3D2CA 4TXJA 2ECPA 1YRBA 2H7CA 5G02A 4JVLA 1G2PA 4KQKA 4RLSA 5CG1A 3HWX1 4E13A 3NV7A 4OCZA 1CZRA 2CLSA 3LCCA 4WFIA 3V42A 4AJEA 3A32A 3LQ4A 5DM2A 3AM5A 5AWFC 4DUZB 2IHBA 3MSXA 1YB1A 4M9ZA 3I23A 2YJ3A 3M1YA 1E9AA 4OL0A 4F0JA 1XTIA 3K71B 1WU7A 5H70A 1MC4A 4LY9A 2BT4A 2A9FA 4OB6A 1KSHA 5FI5A 1XMSA 2I1LA 2RGNA 3UUWA 2NACA 3H4MA 2MYPA 4EJ2A 4RMIA 3DAOA 9LDBA 5JFGA 1CUCA 2OBNA 3TCKA 1U9IC 1YJXA 5C8XA 3KETA 2AEFA 5FOQA 1WW8A 4R81A 2WUGA 3A9WA 4WKGA 1R00A 3H11A 5ALTA 5K03A 2XIJA 4LZAA 5CDGA 1CRQA 5AKZA 3SQLA 4B0PA 4PO9A 3D31A 1C1YA 2A1TS 4MV6A 4D4GA 2GA8A 3KHKA 2P77A 2QZJA 1U7DA 3W04A 1DCMA 5J9FA 3QH4A 2D7CA 4MQFB 2G09A 4LWQA 4E32A 1IXZA 3E03A 3OKCA 4AJIA 4GM4A 2Q6VA 1FDRA 3BJMA 4RPCA 4CU2A 3EFEA 3ND8A 4L95C 3NRCA 2YY6A 4UU1A 4IZHA 4OLJA 1NUPA 2FV8A 1GUYA 2J4DA 3UTCA 1DC4A 1IYZA 2Q8NA 4C0XA 4C9BA 4F4IA 3WB0A 3PGMA 5F7OA 1S3SA 4Y98A 3KLOA 1KAOA 5BNWA 4UEQA 5DGDA 1L3CA 1KH3A 1AKTA 2NZXA 3EISA 3H6GA 5EXSA 3RC1A 2W8BB 3HYRA 4MKZA 4RXUA 2IIPA 4BMDA 1X42A 2ZAGA 5T8KA 5G4LA 3HCBA 2WF9A 4I55B 1I14A 3WWYA 1TPYA 1NYTA 1FFWA 1WXQA 3BIWA 2JFPA 2R85A 3FDIA 5IUKC 3DE5X 2FW1A 5KU7A 4Z7NB 2MHCA 1GNSA 2UXDB 1KQOA 4WXRA 4G9GA 2CE2X 2HX1A 3GR6A 4X92A 4BO6A 1Z8DA 3WK4A 4RK4A 3AX6A 5DKFA 3RTAA 3QE4A 3GFQA 2O3QA 1JWLA 5AMXA 3CW9A 4TV8A 2JHGA 1OGIA 3U9SA 3KQSA 4ADSG 4I50B 4YAUA 4EJSA 3I9LA 3KB6A 3M6MD 3NIDB 4OSOA 3T95A 3PWTA 1NSFA 2ZYAA 3K0AA 5J4HA 1SXJE 3OZXA 1KTVA 3NKLA 4L4ZA 1A50B 1PFYA 3B13B 4YAJA 1SUPA 1YR8A 3K0CC 4NECA 4CMJA 5BSGA 1G98A 5JXGA 2AZDA 2VP5A 1VMAA 4NV0A 1A7AA 3AVOA 5D5HA 3MT7A 3IQDB 4LSGA 5F23A 2XTMA 5TS2A 3QQPA 2X6TA 5SZKB 4PLGA 1SWWA 4ZYYA 5K6RA 3KSMA 3WLEA 2B78A 2G8NA 1TOAA 3RTDA 2GCPA 2A5FA 4C01A 3GCWA 1Y9EA 3A2LA 3NORA 1UC5B 2GN4A 3IJPA 1NT2A 4OJQA 3J80A 1UDCA 1RLIA 4RNDB 2EAUA 2PBZA 4WNIA 3O7WA 4KN8A 2LW7A 2HWUA 2C31A 3TOCA 3AF5A 3H1EA 2PFGA 3EEBA 3ZGXA 2P5UA 1ZW1A 4FD3A 4XXHA 2GA9A 3KOUA 1TC1A 2WSSD 5FD8A 3QVKA 1E9FA 1E1YA 2A5GA 2RG1A 3M5CA 5DRTA 5E4JA 2BKVA 3GG2A 5JAZA 4MR8B 3B82A 3CRZA 2Q46A 3EVZA 5B1EA 5EFOA 1X1TA 4M54A 4IYJA 4I7EA 1LFAA 3BTVA 1A5BB 1SD5A 2YV3A 1ZWLA 2XSZD 1IEWA 3LDFA 4AD8A 2I2WA 4EKYA 3I5AA 4GP7A 1HMYA 3CN7A 5D2CA 5FL7D 2DBRA 4MQEA 4YY3B 5KTNA 4CM1A 1TFRA 1PS9A 1GSHA 1L0BA 1RAHA 5AW1A 2XUDA 4MV4A 2D1YA 2BMVA 2B92A 2WTEA 1CS0B 1WQ4A 4L07A 1YL5A 1W36D 1L8QA 2OHGA 3C39A 1R4AA 3WGQA 1FVHA 3Q0TA 5ILQA 4V0ME 1ZXBA 3ND9A 3DKPA 3V7WA 3WRXC 1C30B 2GYYA 2PS1A 4XGQA 3QEMB 3EXHC 4RA9B 1L4FA 1PL8A 2C7BA 1VPVA 2NQ2C 2YZ2A 5TGTA 2YXDA 2VWGA 1MB4A 4L4YA 4B3FX 4ED9A 4B3TB 2ZBFA 5D51S 1OWNA 1JDNA 3L43A 3OLCX 1EVYA 5C8VA 3OFNA 1XMIA 1MN6A 1BWRA 1VL0A 3OE7A 4X00A 3ZNQA 4J49A 4KDFA 2ZIUB 3DMGA 2FCAA 4CKYA 4WK4B 1DOZA 1TA9A 2BI8A 2OD9A 1NPDA 2O1EA 3E1KA 4LY3A 4MHOA 3SE7A 2VSYA 5A3VA 4M36A 3EXIB 4IZOA 3VDNB 5KQGA 3FF4A 3GVIA 3L8FA 2IH4A 3MN1A 1X2BA 5C81A 2EXXA 1F12A 1S4QA 4P4TA 1EX6A 4M88A 5JQGB 4KFUA 1I5OA 3ZDAA 4BX3A 3EAGA 2O54A 3PFGA 4HS9A 1C7IA 2E1PA 4QTYA 1D0VA 4Y9SA 1D2EA 4H1WA 4GZ6A 3OFND 1FLNA 4MAAA 4AJ9A 2AYXA 4DR4B 1LPOA 5AVXA 4F3CA 1LPNA 1BG6A 5TS3A 2XIQA 2YVAA 2G4CA 2WI8A 2WLTA 3ADKA 4ZVTA 3Q1KA 3GOQA 3NOXA 3FDXA 2BSXA 2QUIA 4GOOD 1X80A 2P9FA 2A3NA 2V3VA 2F1JA 1L7NA 4UTXA 5CA1F 3R6LA 3RSHA 2BZGA 1II8A 2WABA 1E3WA 3BSYA 4ZC8A 1ORWA 3PG5A 1KO8A 4XCVA 4BO1A 3U4QA 1W87A 4RPHA 3FTFA 3A1SA 4H59A 3ROMA 4XDYA 1FOEB 3NDJA 5LB4A 1AHHA 3I6ZA 3WLJA 4ZDIA 4HWPA 2XSZA 3GEMA 1KP3A 1GG5A 3OKAA 2FFRA 4GLBA 1CPYA 4U9UA 2I87A 3HDTA 1SUFA 2QN7A 3DEIA 1F20A 5CFRA 1PK9A 1JR6A 1YKFA 4LW8A 3EYWA 2BF4A 2QPTA 3C3DA 3I01M 3ZQKA 5BNTA 4I5GA 3CE9A 1IM5A 4DLAA 3JYHA 1ESZA 2BUCA 1TA4A 2OBFA 2NQTA 3CVJA 5FI1B 1Q83A 3TZEA 4JA2A 5I01A 3LT5A 2VT2A 3HQ4O 1KFEB 2V8OA 2W4QA 5JYEA 1A8IA 4RTKA 1AK1A 1U2GC 1N33B 1V35A 3PNBA 3GJ6A 4JGIA 2B94A 1QB7A 1JS1X 3M5PA 1IZYA 2R47A 4KXLA 4DLZA 2XW6A 4L5IA 4TN5A 5BSUA 2RAFA 3TZHA 3B7GA 1NTRA 1Q20A 4R8LA 3PL1A 2BFNA 4BASA 3VAZA 3GLIA 4JELA 2Y2VA 4ACAA 1UZAA 2BM9A 3VU0A 3T7DA 2QR3A 4O2BA 4I4TB 4J0QA 3F4LA 1L6IA 4ZVMA 5DE3A 4N03A 5KYVA 3E8MA 1LTQA 4HBZA 1O87A 4L85A 4BVHA 2BFOA 2JJ2A 4M0LA 3HXQA 1O6FA 3KLPX 1Y81A 2B2NA 1V4BA 4GKJB 2IPMA 1O95C 3U7QB 5CITA 4CKWA 2E4XA 1MQ9A 2DLDA 1EFRD 3JASB 4MS3B 4UHEA 2YNMA 2PUWA 4GPIB 4YQYA 1G66A 4D4KA 1FUUA 4YRCA 4BEJA 5JEDA 2PT9A 3D1VA 4AB1A 1F1BA 2YV5A 4NNJA 3PFNA 5CIYA 1R6UA 3OEED 4TWZA 5ICMA 3EWIA 1J90A 3R3JA 5ERGB 2B61A 4IGFA 4REMA 4N40A 1PYGA 4TQGA 3N0XA 1YL7A 3UFXA 3I62A 1QG4A 3CXRA 5AW2A 2YKGA 4F5WA 4JT4A 4FM9A 4TXNA 1WXFA 3OZVA 4GEGA 2YWEA 2CXSA 3L4KA 1JZSA 1W5SA 4BMCA 2IYSA 2J31A 2QYSA 4JB8A 1XZHA 5DTQA 3KQYA 2QXTA 1B14A 2EBFX 2N1MA 1SCUA 5AJUA 3BWBA 1T36B 4EELA 1CP2A 2J0UB 5G0SA 3UJ7A 3AU9A 4EGAA 2J0SA 2OENG 3IVAA 4TV8F 2CZQA 3T5MA 2JZNA 1POWA 1I0LA 5FOVA 4BLTA 3LLUA 4L9AA 1SIBE 2GILA 2R1UA 4Z2AA 4ZYTA 2QV0A 3U2QA 2CV1A 1R6VA 1SCNE 2WSYB 3CJQA 2ZIZA 3CTPA 5DM70 1SZDA 3ZHTA 1KC3A 2ORED 1FYDA 3W5JA 1H0SA 1W19A 1VGQA 4GOKA 2OOSA 2XYRA 3ZXXA 3IILA 2FWRA 3ESAA 4EB6B 3NG1A 4X7MA 1P4HA 1FDVA 1M10A 1TW2A 3SCZA 3GJZA 4YJKA 2JI7A 4H15A 4K6FA 4X8HA 4QRHA 3KEMA 5K8UA 4KNWA 3MELA 1QIGA 4DDVA 1Z62A 2VUTA 2FSSA 4GUAA 5DU2A 5FWYA 3TI9A 4B3SB 3B89A 1YJCA 4DC9A 4RD3A 4MUAA 4XTRA 3T9FA 3KVRA 3HCOA 2LPMA 3QUQA 4QUEA 3EEOA 3JVIA 1O0CA 4CEIA 3CUKA 5F12A 1NBAA 3ACBA 4UUMA 3ZWAA 3C3YA 4NOLA 4M1QA 4ND8B 5EJ4A 1WBBA 1SY7A 3AJDA 3BMQA 3L7LA 4AZ3A 4F2PA 4YBZA 4CQNA 1F5SA 5JVDB 5GV8A 2XR1A 2CD9A 4AZ3B 3FYUC 4KXXA 1F38A 3IDAA 2YNMD 1OILA 2GN6A 3HZRA 4FSXA 4JT8A 1C3VA 1EJ2A 1KAMA 1ZP6A 2PL5A 5EJAA 4MYRA 1IWOA 2LCQA 3DYIA 5KCZA 4EW2A 4DJDC 5KJCA 3NJ8A 2ZS8A 1YVDA 2QPAA 4H60A 4OQPA 4V24A 5KSPA 5C35A 2G71A 4LXQA 5FPPA 4JJ7A 5THQA 1NVWQ 1HNXB 4H6WA 1VHQA 3FRJA 2ZSAA 1GGHA 4LJ5A 3CEMA 3E4DA 3AFIA 3HSKA 4LX8A 4ZQBA 4D42A 2PCLA 5U9CA 2X5XA 4ALJA 4E09A 4YV0A 1XQYA 4EI2A 4J4HA 3GFFA 2HRRA 2ZBGA 4RENA 2PS3A 2XLCA 1OFIA 3ZWKA 4ALIA 4AUNA 4BNKA 4IHQA 4BJ1A 4FOPA 3HYNA 5FF9A 4YMGA 3ZZMA 3DW1X 4GOXA 4DR2B 1X7XB 2MSWA 4BE7B 3THXA 1SZJG 1RKUA 2G36A 3EUFA 1NYQA 1YVEI 3NWBA 4G84A 3JQ9A 2DFDA 2WKSA 4HVTA 4O1MA 2M6LA 3DJFA 4AROA 3B85A 4LEIA 5DYGA 5LZ5A 1YZFA 1G291 5DGCA 3GWGA 3H4VA 3CIOA 1KI2A 1QHNA 2ASEA 2NSYA 2Q62A 1XFAA 4K03A 3Q9UA 4TYWA 5JWHA 1CJSA 1QFSA 4QSMA 4Y6QA 4X6YA 4X6LA 2HDWA 5LQSA 3LZDA 1ZUNB 4ABYA 5JPDA 4U2BA 2P2LA 4OHYA 1QPGA 3IBCA 4YQZA 1N7GA 3R44A 3ZLBA 5IAAA 2R7NA 4B9EA 2DRIA 7MHTA 3KQVA 3TRKA 4Y2XA 5JJBA 2R7LA 5KYGA 2V54A 3TOXA 3CPEA 3N74A 5WRFA 2JL1A 1JKJA 1AKRA 4ZD6A 5M29A 3JR7A 1E0AA 1ZNXA 2QI9C 2QX4A 2XQKA 2VJKA 3TQIA 5DPMA 4LOIA 5TQ2B 4P0TA 3V8NA 4AX8A 2KX7A 5IK2D 2DT5A 3IBSA 5T41A 2XOKA 4Q4DA 4PR3A 3CISA 4P6VF 4UBMA 1XZLA 4EYKA 2O7SA 4JFAA 2EFHB 1JAXA 3K20A 5K6AA 3AHCA 4MVJD 5B1IA 1ZH6A 2AQKA 2IX9A 1SIOA 1KY4A 3I3SR 2A9QA 1ZSYA 2R11A 1TAHA 2IP2A 2ZB7A 4LRUA 1CLUA 3PHHA 1BCSA 5AHKA 2HWXA 5D1NA 4Q7MB 1EIWA 5LQUA 3DTVD 1OPRA 4AYXA 1JPJA 2WD7B 4Q15A 2ZWIA 2UXBB 2EBUA 3C43A 4IPTA 1GN8A 1Q2UA 1GA4A 1X7ZA 1VSQA 2H4XA 3DJYA 1XA4A 1RFLA 2Z9BA 3FH0A 5T6BA 5PNTA 1V9SA 3TLEA 4EUEA 4UTOA 5BWMA 1W25A 3RVQA 1KQFA 5IVHA 2C4KA 5AJWA 4QHSA 2PGOA 5DXFA 1E1NA 3EF1A 3GFOA 5JSHA 3IR5A 1BU5A 3DDSA 4KACA 1QU2A 1VPLA 1XQWA 2R62A 2VP3A 2W9XA 2W6ID 4L5YA 5A0FA 1UJ5A 1N1GA 3KM0A 3PHCA 4Y2QA 4MKXA 1Y48E 1C7QA 2WHQA 3JRNA 1WUTA 1BROA 1PGJA 1V11B 2D2XA 5I7FA 3C16C 2UZ1B 3AGQA 1KKUA 3RF6A 4YVFA 9LDTA 5LLDA 4LGVA 2PZFA 1W1WA 2PH3A 3C6XA 3CH4B 2J6BA 3FYHA 3O2NA 3I42A 5JJCA 3OTHA 3LFTA 3VTKA 2NVWA 5HTOA 4NK5A 3S0JA 1DFGA 3KVOA 1PBNA 1GDHA 3A9SA 3K5HA 3I52A 4ZI3A 4D0RA 3DMTA 3HXLA 3EFBA 5FUQA 4MI6A 1JI3A 4HTFB 5MN6A 1RC1A 3ZCUA 3DDUA 3COZA 4UTRA 3TEJA 1W94A 2Q4OA 4MGHA 2YIMA 3DVSX 4WZAE 4HXGA 4HDAA 4UQPA 3EZYA 4DCSA 1YACA 4KMSA 4QEDA 2RBGA 4P31A 5HQ3A 5I4BA 2P41A 4GT1A 1D3AA 2NO1A 4CM3A 3WNCA 3OEEA 5LYJB 4PQGA 2NUBA 3F5FA 2V7XA 2EKQA 3T7IA 4D3FA 1MKYA 4GMKA 4N8SA 4P4NA 3TNJA 2FYTA 2KM1A 2R00C 2F00A 2FUG6 2WD7A 1KZ9A 3NWOA 3AONB 1X13A 3MM4A 5K2MA 4ERNA 5C32A 1TJNA 1NG9A 4YB8A 2JCGA 4UVHA 2BE7A 3OEHD 2RBKA 1NBWB 3DOIA 1NBHA 2W22A 1C81A 3I04A 4KAFA 1TFUA 1XELA 2QM0A 5ADVA 1BXGB 1UBCA 3JATB 2YXNA 1DQZA 4MDHA 3HCAA 3VOAA 1E2UA 3TKYA 5K1ZA 3IKVA 3D6JA 3TLJA 4LRXA 2X76A 1NULA 5H5JA 1H2FA 2QTRA 3CSDA 3ABSB 3LXXA 4YJ3B 3K5PA 3HV0A 4F7WA 2VIIA 1LH0A 2ZWPA 4D4IA 4CFZA 2H7XA 2OV4A 4ZYZA 2DUMA 2VPIA 3QF4B 4XWYA 3CZ5A 4BQRA 1IMJA 4IIGA 1C0EA 4LMRA 2YUIA 3JAKA 4FOOA 3ZG6A 1S2DA 4D7AA 4EHBA 1SULA 4FGJA 2I80A 3CONA 2EV9A 3FDZA 2RHBA 3M4JA 1X9HA 4RMJA 3VR3A 3DBRA 5IVIA 2BR4A 3D3NA 4YP6A 1JDUA 5D6NA 5AESA 2GF0A 1PL6A 2LV8A 4AQ7A 4ZANA 2UVPA 1DAEA 1HFEL 3H2HA 4PGAA 4TS3A 5DIZA 4ZVLA 1UMBA 2X0NA 3PI6A 3AMVA 2X13A 4D9BA 1ORIA 3HWWA 2QGFA 1KE2A 4MYUA 3SHTA 4YAWA 1ZMOA 3EXFA 1EP9A 1EFDN 1JDVA 3IE2A 2Y77A 3NIFB 3SZLA 3TMKA 4I3HA 1K2VN 2JHAA 5LQRA 3LRTA 2TMDA 5EZ6B 1RR6A 3B6EA 1NONA 3AR8A 2WKPA 2V7QD 3QUBA 3PEUA 4MUKA 4NH0A 5I51A 5CP8A 1NX9A 3W05A 2QQ5A 4NYMQ 4G5XA 5IH3A 2B7BA 3MUOA 3N2LA 3ONFA 2XZLA 1AKUA 5ECGC 1T8SA 3F1KA 4GXTA 1NBEA 4M8KA 4NZPA 3C7CB 3KJZA 2HCBA 4U1RA 3IEXA 4Y2YA 4DR7B 1HRKA 3HJFA 1AKWA 4GFDA 2CLLB 5IW8A 5F4ZA 1ADBA 1O58A 2IEIA 3JD1A 3CRVA 2AX3A 2XHZA 3NGMA 5G53C 3QU2A 2V7WA 3CNOA 2C2YA 4RTJA 2RH4A 4M37A 1C2TA 2QK4A 3A58B 3QVGB 3RJMA 5IT5A 1H23A 1IVSA 3E2IA 3U7EB 1CD5A 2ERYA 1E7QA 4OP2A 4JWTA 3L6BA 1MO5A 3IJEB 1PD0A 3BS4A 3FOAA 3DOCA 1HNWB 2BISA 3L0ZA 1NW9B 3TLYA 5LQCA 1DU4A 3LK7A 3IKMB 1MU0A 3NDPA 5EHIA 2E7ZA 1OJLA 4N18A 5DM1A 4KXNA 2C78A 4GWGA 1D9XA 2Y1XA 3U3DA 3KDSE 1N5JA 1MBZA 3NW9A 1P81A 4ND3A 3AF6A 3DT9A 2QUJA 3SLRA 1KSGA 4WJKB 3T8YA 4HVCA 5K0SA 4M9QA 1ZONA 5ALZA 1J39A 4GI3A 4AJOA 2O48X 3RFUA 3GEEA 3JWHA 3ER9A 1PDOA 1YZGA 4WN3A 5DMXA 1GPKA 1Z2PX 1RRVA 5D3MB 4CF5A 1SEPA 1NVTA 5G4KA 4RLQA 4I50F 3DFIA 3WIVA 3U3XA 1Z4OA 4FMDF 3LWZA 4BZXA 2AZXA 4NOJA 2F1RA 4NBRA 1HI9A 3HYSA 3SMQA 4DSUA 3NKVA 1ISGA 1C5KA 3RU2A 1T2CA 4NCIA 3BG5A 1ZUHA 3FHCB 3IPLA 1Y1PA 3M6IA 3ZCXA 4IWXA 3ZE7A 4CEHB 4UAGA 4BWGA 2JBHA 2GBCA 3RSQA 4ZHQA 2GI4A 2X23A 2YFQA 3L7JA 4IZ6A 3RWMB 3QXGA 5TLSA 1S1CA 4V03A 3UT5B 4C1BA 1SVKA 4YAOA 2Q50A 2AHOA 4D9EA 4WK2B 1P5FA 3X1ZA 2QU7A 1LTHR 2VNKA 4ZOLA 1U5BA 4FR2A 3VU3A 5D86A 5H9WA 1VE9A 1EBFA 3LBYA 5ITVA 4C7MA 1L5LA 2RDMA 4E14A 2Q29A 5I7UA 3PQ7A 1HEUA 1RTKA 1JIIA 2MTBA 3MVEA 2WDZA 3FB1A 3LKBA 2JIRA 2NG1A 1QHFA 1Q2XA 1R16A 2OCXA 1AJEA 3DMPA 1RAEA 1RWNA 3V4FA 3CR7A 4UE3S 1PZGA 3K3PA 4KE8A 1PP4A 3L04A 3TS1A 4OBEA 2XBMA 3E35A 4H3HB 1U7PA 4AECA 2IGBA 4LYEA 1EVZA 1ZCBA 4Z1MA 2OORA 2PX6A 3H9UA 3SZGA 2CJYA 5DGHA 3UV7A 3EC7A 4CTOA 3G7UA 1VSTA 4QUDA 2JEOA 3P94A 3ZNPA 2OGUA 3M3HA 1RM3A 3CH6A 2FSGA 1CE8A 5CVVA 3INGA 2GBIA 4OO3A 5F7XA 5ERXA 1J6UA 1M2GA 2J7KA 3R3SA 2Y9PB 3R09A 4WT7A 4BVLA 1ZX1A 1PJQA 5KVQA 4EB0A 1VBNA 3REFA 1NQTA 1QYCA 4BLOA 4KYIB 2FZEA 1RJDA 1TD9A 2O2HA 1JFFB 5KOYA 2PXCA 4HAZA 2HUPA 4DV7B 5E3IA 1UXJA 3EA4A 1LDGA 1TCUA 1Y3HA 2HCJB 4IXMA 5JMOA 3F67A 5FBLB 4S2EA 1D0SA 1NN3A 1C7JA 3KQTA 4JX9A 5JR3A 2PCJA 1LQ2A 1XTJA 1GRVA 3BXEA 1JDZA 3LJKA 2WMDA 2F7SA 2X8JB 4RVUA 1GXSB 5AJXA 1G60A 2HQBA 1KSFX 4EG6A 3G0IA 4MUMA 3SX0A 4DMCA 3R0QA 3V3TA 5B2EA 1A82A</