1MN9A

Ndp kinase mutant (h122g) complex with rtp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
150
Chain Sequence
b'VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NDP kinase
publication title Structural Analysis of the Activation of Ribavirin Analogs by NDP Kinase: Comparison with Other Ribavirin Targets
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 47
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2002-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1mn9A00
2AZ3A 3VGUA 3L7UA 4ANEA 1XIQA 5C7PA 1S57A 1KDNA 4CP5A 1NDLA 4ENOA 1JXVA 3DDIA 1HIYA 1NCLA 3ETMA 3WX8A 1F6TA 4DUTA 1U8WA 3VVUA 4HR2A 4UOFA 2ZUAA 3EVMA 4KPCA 3NGTA 4F36A 3FC9A 3EE3A 1NB2A 4F4AA 1F3FA 1S5ZA 3Q8YA 1NDPA 3EMTA 3ZTQA 3G2XA 2DY9A 1NUEA 2CWKA 1BE4A 3VGTA 3BBCA 1NHKL 3ZTOA 2BEFA 2DXEA 1S59A 3FCWA 3BBFA 1B99A 1K44A 3Q89A 4S0MA 1WKLA 1NDCA 2AZ1A 1NSPA 1NPKA 3EJMA 5CAAA 3FBCA 3NGRA 4UOHA 1LEOA 3BBBA 1LWXA 2DYAA 3NGUA 4DI6A 3ZTRA 4ANCA 3ZTSA 1NSQA 1HHQA 5IOLA 1WKKA 5CABA 3B54A 3EVWA 3R9LA 2NCKL 1WKJA 4W98A 4EK2A 1W7WA 3B6BA 3BH6B 1BUXA 2HVEA 3NGSA 3FCVA 3MPDA 3Q8UA 3VGSA 1PAEX 1NLKL 4UOGA 3Q83A 2VU5A 4ANDA 3BH7B 3GP9A 2HVDA 3ENAA 3ELHA 1HLWA 3EICA 3JS9A 3EVOA 3GPAA 5BXIA 1MN9A 2DXDA 1NDKA 1ZS6A 2BX6A 1NSKL 2B8QA 4DZ6A 3VVTA 4FKXA 1BHNA 2DXFA 1B4SA 2HURA 4O0NA 4WBFA 1PKUA 3FKBA 3Q8VA 1VYAA 3PJ9A 3EM1A 3FBFA 3FBEA 4C6AA 4FKYA 3DKDA 3Q86A 1UCNA 3ZTPA 3VGVA 2B8PA 1EHWA 3FBBA 1MN7A 1XQIA 3PRVA
chains in the Genus database with same CATH superfamily
4DWIA 1CLFA 3MUVP 3JSMB 3OVAA 1MW7A 5A0YA 1AUDA 3G82B 4F4AA 3K8WA 1S5ZA 4OYZA 4ZJOA 1U0HB 2DEJA 1S1TA 2V6AA 5IV4A 4LVOP 5KG0A 3D54A 1GNKA 3PYGA 4YQWA 2M88A 4LF6J 2DNOA 3GU0A 2ERRA 5K8PA 4R8UB 2X51A 4AE5A 4V19J 3M2VB 1PSDA 2PC6A 4EEYA 4CZCA 2HRUA 1VOMA 4PXCA 4IR9A 5C25B 4DR2J 4J90A 2AWZA 4C3LA 4LR9A 1FEEA 1U6ZA 3O44A 3OT9A 4P6QA 2Y1LB 2BE2A 3C6UB 2GMLA 4YUDA 3K0JA 4FBUA 4DQIA 2MZSA 4WYLA 4KYZA 3X3UA 3EICA 1YX2A 5A8RA 5D4PA 4DR6F 4YN3B 2RQMA 5IWAJ 1S9FA 1U48A 1OWXA 4DV0J 4G1PA 2ZKUA 4RKUC 4KHPJ 1PGZA 5BYQA 5LSRA 3F44A 2FVRA 4NMLA 3GV7B 4DPTA 2NSCA 2ROEA 2Y1IA 1KFSA 3OXGA 2HGNA 2J8SA 4JYAF 1NDLA 4YFUA 3HFVA 1OY8A 3M8PB 3CCLS 2MQLA 3UNYA 3L7OA 4U7UK 3MM6A 1TK5A 2N3LA 1SH3A 3DRRA 2FQQB 5HSPA 1WI8A 2DXEA 2R2SA 3S8SA 1FRXA 4N8NA 1KVKA 1F5BA 1GMWA 4JP8A 1WC6A 4ZDNA 1B7FA 4LF7J 3R5BA 2I38A 4BDPA 2ZWOA 2HIQA 4ZHRA 2O67A 2KRBA 3SBMA 5I42B 1EQ0A 4RW6B 1GK8A 2FYXA 1X5PA 3SI8A 3QGPA 3RBZA 5DG8A 3CULA 2GIFA 5KFHA 5LXYA 4DL2A 3OBIA 1NSKL 2IDEA 4PUOA 3A8EA 1JLAB 2DGQA 1A6LA 1R27B 3UNGC 1H6KX 3IWNC 2EC0A 3H2VE 1S1XB 2B5JA 3KDOA 3UCGA 3QFHA 4CLLA 5L8RC 3E01B 3EGNA 5GAHU 3ZFVA 4MK9A 3JB9k 1HQEB 2R7UA 1KONA 2Q66A 2VONA 5HJYA 3ZTQA 4ZJQA 4IFYA 1REGX 5AJ3F 3PW5A 2C1EB 2QMWA 2E5LJ 2CPFA 2V8VA 3AD9C 5EX3A 3LAMA 4QWAA 1RZMA 3TAMB 4FYDA 1WNEA 1SUQB 4QW8A 4K4TA 3GIMA 4NWBA 4QW9A 4PQUB 4NLWA 1RTHB 3OUYB 2HBYB 4DSIA 4DOZA 5J2QB 4XPCA 1PJ6A 2HRTA 4I2QA 1BD6A 2BQUA 2UXDF 2FZCB 3W9HA 1ZS6A 4ZPBA 2RE1A 1HR0F 2F4VJ 1B4SA 1RTIB 3W62A 4FKYA 3PTWA 4DL7A 4Q5VA 4EI2A 2QSFA 1VRTB 1S1UA 2XZTB 3W9JA 4YB7A 1U1OA 2RQKA 2CQ0A 3M8YA 1L5UA 1M5HA 3CIZA 4KV8B 3M32A 5IC6B 2BJDA 4DEZA 1HBOB 3VGTA 1IXKA 3C15B 2VB6A 1D09B 2VG5B 4OYAA 2HHXA 2JFDA 2RHSB 1TUWA 3HKWA 2RUGA 4F0HA 4CTAB 1FJEB 4U8VA 3SDEB 3S01A 3QSYB 2KN4A 5JUMA 2B9EA 4V1Ak 3FRYA 4M5IA 4M8LA 2RS8A 5LJ3Y 1Q8KA 1IVZA 3HP6A 3T19A 2FJDB 4HHUA 2KFNA 2J0XA 2PA8D 4UOGA 4YHHJ 1S4FA 3FMWA 1HNVB 4IOBA 3EVOA 2CZ9A 1D3WA 5J2NA 4MYTA 3O3LA 1T03B 4H4MA 5F0WA 4PPZA 3DXBA 4DSJA 3H42A 3FBBA 1MN7A 4DX7A 3HT0A 1SL0A 2D9PA 3DRPB 3EYZA 4ID8A 2KFZA 2VG6B 4RUBA 1TKXB 2DD8S 3DOKB 4CLUA 2G1DA 1VLOA 2IHR1 2ZHOA 1UEUA 5LMUJ 3H20A 2MKKA 2GVDB 4X66F 4DR5J 1O5JA 2EKYA 4OYBA 2VHGA 1IUJA 1DARA 1R8CA 3O5TB 3Q89A 3S7RA 2K1RA 1PC4A 2WZ1A 1FRKA 1PBUA 4PXBA 1PYSB 1RT5A 3B4DA 2DHXA 4AQYF 5A2QU 2XCAA 2GO8A 4N8OA 2HKEA 1FKAF 2NXCA 1MLAA 1Q8BA 4WF9Q 3NGKA 1N6QB 1R6VA 1C1CA 5AXMA 5HVFA 5L38A 2LQ8A 2BACA 1RP5A 1AXQA 4NCGB 2VFUA 4LRFA 4CNYA 2NXUA 4PG4A 2E5HA 2VA2A 3US5A 2OSQA 4RW8B 2AYEA 2UP1A 1LOUA 1QSSA 3LP0A 2AGQA 2QEXS 1FKPB 4PWDB 3PJ9A 4OI2A 3X1LB 4UT4A 2G9OA 2OPPB 3K58A 1ZM3A 3HCXA 2G0IA 3SQOP 2KL8A 3DI6A 1JK9B 3H4DA 3UD4P 3TNVA 2QA4G 3I32A 3BO4A 1HNIA 1IWGA 3MUMP 2Q1LA 2KH9A 5FIIA 2GJ2A 4EMDA 3PO5A 3D0HE 2DT9A 2OIHA 3HMJG 2QGFB 3CCQS 4JI3J 1VRUA 1G1XA 3CCRS 4Y2AA 4KGXB 1ZPWX 1T02A 3J7ZT 2HYIB 4JI0F 1UETA 2VZ9A 3EX7B 4ETXA 2D3ZA 1E6YB 1TMMA 3IBCB 2UU9J 3FQLA 4ED6A 1HL6A 2GW8A 2N82B 2FJAB 4DPOA 1K1SA 3MPUB 3SCIE 3DLEB 2UXBF 1CJKA 5A8WA 4ICLB 3DLKA 4I6YA 5KFLA 2BJ8A 2W1BA 4DSEA 4M5HA 1EHWA 1X5TA 3BSCA 1VQKS 3M8ZA 5J1NA 1J5OA 2J0QD 4MFBB 3AA9A 2OLWA 4ED8A 3JSRA 1EETB 1H38A 2ZZMA 5ETKA 1LWEB 2DIVA 1NHKL 1R8BA 3R3TA 3BBFA 2NREA 3PRDA 5D0HA 3QRQA 2ZDPA 4CO1A 2UVUA 1FE0A 3FNNA 3EZ5A 2LEAA 3W7BA 2ZH6A 2IPOB 2EEYA 1UL3A 2VPXB 4EFAC 4OLPA 1ZA2B 5HMWA 1VR6A 2KB2A 2BOAA 2KO1A 1W7WA 4C11B 2XCPA 4ZCIA 4GKJF 4HEA9 1K0VA 3NBPB 4C9DA 4TYBA 1TL7B 2V9WA 4DXLA 3IS9A 5A8KA 3CE8A 3EXCX 4DLEA 2UZAA 3GYNA 3MECB 3BQ1A 2QYGA 5KFUA 1FD8A 4CH0S 2R7TA 1U2CA 1L3TA 1S48A 3VGUA 3ZNUA 4KIAA 2JEJA 4I69A 4Q0BB 5B0FA 3PACA 5A6PA 2I1RA 4IFVA 3WIVA 2FD2A 3D2WA 2DKOB 4ECZA 4UOCA 3L9ZA 1UJ5A 5DO2A 5IV3A 1NUEA 2CNNB 1N5TA 3V4MA 3HVWA 2V4RA 3CTRA 1N34F 4OZ3A 1T05B 1U0SA 3FEYB 3A4TA 4KY3A 5HP1A 4LFCJ 4UW2A 1V3SA 5DDOC 2HMIA 2LP4A 3MM5A 3VZHA 3BN7A 3CD7A 4K4YA 1B7YB 4RX6A 2V8DA 4NXMJ 3MMAB 4QJVA 4FYWB 2LXFA 4ZKAA 4CI0B 5A6WA 5IT9Y 4IQMA 2KZZA 3M2UB 2V34A 2YWFA 2CVIA 4A8MP 4J9SA 4DR1F 2CJBA 1CJUB 3V81A 4ID5B 1JLGB 3BR9A 2LDIA 2PT0A 5DZ7A 3BZQA 1TV6B 1UWBA 3IR7B 1M1GA 1XEZA 2DRBA 1S99A 1M5SA 4JI8F 4OZ1A 4TU9A 5LMNJ 3EDRB 1HI8A 5F3TA 4DR4F 1HPZA 4OJ3A 3EVMA 3VWSA 1EB0A 5M2PA 1FXDA 5CQGA 3BREA 1S10A 4C8NA 3FFIA 2H65B 2HLUA 1M5PC 3FZ2A 3QIPA 1KSPA 1KOOA 3MMJA 5I3UA 2YWGA 1OSCA 2E7VA 1V3ZA 4JI2J 2OPQB 4RPFA 3BN4A 4ZLLA 2L08A 4JI4F 3PEJA 1VK8A 4FNIA 3D1OA 2LXIA 2AD9A 1MNEA 2R7SA 5GMEA 2CJKA 3GG0A 3U27A 2G0CA 4I7FB 4I64A 5F8JA 3H5UA 1SPBP 2CVEA 1X4GA 3Q23A 2JLEA 3TZXA 4NI2A 3QWPA 5F8LA 4LF5J 3OVSA 2AGPA 3I0RB 4J9LA 2V4JB 1XMOJ 3DRSB 3J80Y 1PIEA 4P2MA 1YJVA 2HFOA 3LA0A 1RABB 4NCAA 2B3TB 3HLUA 1NB2A 1MWYA 1RWUA 3IN5A 1VQYA 2YQ1A 1QVGR 2POKA 5H9FJ 1WKLA 4DUYF 2OELA 2X7IA 1RWKB 2X1FA 2LQ9A 4UOHA 5CA5A 1M1KT 1ZM2A 3DYAB 3NS5A 3ZC4A 2C28A 1UVIA 2QO3A 4I4BA 3R2CJ 3RW6A 1C0TB 4DN0A 1LV5A 2HVEA 1D0EA 1MMNA 4KQZA 1DTTA 4LIWA 3M8RA 5ETMA 2HHSA 1UPMB 2VH7A 3R8YA 5IZHA 3KTQA 3RB3A 4ZOSA 3BQ0A 4WE1A 5K8MA 1JLBB 4M5JA 4ZN3A 2HBQB 3CW2C 2RRAA 3VAIA 3TEHB 4JI5F 3ISNC 1VQ8S 2B4UA 1QJHA 4KO0B 3KJVB 2ZH1A 2W9AA 3NGTA 2WW4A 5AE1A 1F2HA 3DM2A 3MM7A 1YJ7A 1FDDA 2VPWB 3GJRB 2K7KA 1HNXF 1T9XA 3MHYA 2Y1JA 2IBKA 1SCJB 2ATCB 3I31A 4X4UA 3OD2A 1VK3A 3GFHA 4ED5A 4UQTA 4M5GA 3M9NB 1HW8A 4ED3A 4WWSA 2DHHA 4EO6A 4ZP6A 2HNZA 2IJRA 3D6MB 3NNHA 4IDKA 3VGSA 4H54A 1FKOB 1D1UA 1KQSR 3UO0A 4AL7A 4JV2A 3JAMU 2JOQA 4MYUA 4OZLA 1JLFB 1NJWA 2BVZA 3TYTA 3CCJS 1BQMA 3LPYA 3E8OA 2HNDA 2NXJA 3VAGA 1RAAB 2L3MA 2E1AA 2E9RX 2A6OA 5C7PA 1BY9A 3MM9A 2QZ8A 2R7WA 2C3OA 2OPRB 3CDAA 1YBTA 3PIOQ 1TTHB 5CZXA 2YWHA 1NDPA 1C2PA 6FD1A 2B6AB 2MHNA 3FRZA 5B0DA 1XWLA 1TAUA 2K2PA 2VD3A 4EU0A 2ZOMA 2EI5A 3R6GB 2EBEA 1RAJA 4W4MA 3MURP 1I3OB 1WC4A 3Q24A 3V6HA 4R5PA 1QY7A 2OPSA 3OTEA 1V5VA 1YRTA 4YDDB 3HK2A 2LFVA 1U4BA 3KLGB 2ZM6J 4WXWA 1X8DA 4CQ1A 2DNGA 1RU1A 2HQGA 3BYPA 4Q2LA 2Z0GA 1KNZA 3H98A 2MQMA 1S0VA 4LRDA 1NSAA 4ZLPA 2JDJA 2CG4A 3K5MA 2R3VA 1S6QB 3L3CA 4FS2A 2DNNA 4WKRA 1U8SA 2C2KB 4XK8C 3KFWX 2RUSA 1NK6A 2YTCA 4WFBQ 2J6UA 1S1WB 1ZPVA 3KLHA 3RTVA 2VJVA 5IM0B 5DDPC 3JSMA 1YJ9S 4XPEA 3I5AA 3SQGB 5LXRA 4JV1A 3W63A 5B0AA 2DPIA 2PFFB 3G82A 2AGOA 3OHBA 4B9SA 3GCWP 3QAEA 4DQPA 4LREA 2D69A 2ROPA 3PYEA 5BR8F 4R8UA 4I56A 3M2VA 5C25A 4WU2A 3DLJA 4ZITA 4DV6F 4TKTA 1OS5A 2BDPA 2U2FA 3FCVA 5EWFA 2G1HA 2QRRA 3C6UA 1SIWB 5DQGA 2CYYA 3U7JA 1EIYB 3RGIA 1PCAA 4QYRA 4FVMA 4UF4A 3A13A 1EARA 2N3OA 3MF5A 3GZ7A 4WBFA 4NLDA 3BDPA 2QLFB 3C14B 5DGAA 1IKWB 3PFEA 2KT2A 3MAHA 1NJYA 3T6BA 3AB4B 1CJTB 4DSLA 1XN9A 3N6LA 1MU2A 2WSEC 4USTA 4RUHA 4M63A 3DGPB 2RT3A 2KI2A 4P71A 3M8PA 3MR2A 2UUTA 4F02A 4X62F 3AOAA 2NLWA 4A8KA 4NA2A 5HATA 4B9TA 3RZAA 3CD5A 1UP1A 2DO4A 5DRKA 3WZ0A 3AHPA 4URSA 5GAGI 4ED0A 4DUZF 2E66A 3LWMA 3ZTSA 3UWTA 4DR3F 4X4TA 3M2RA 5I42A 4RW6A 1F0XA 2DY1A 1F9FA 3TAQA 4BS2A 3OSNA 5JMNA 2N7CA 1SJQA 5ADZA 5KG4A 5E41A 1BQNB 1SJRA 3IWXA 1GXUA 2W9BB 4DF4A 1RT4B 1JLAA 3PEHA 2GS8A 2DH9A 2L48A 1UVLA 2DNQA 2Z56B 4IKAA 4MT1A 1S1XA 2FIUA 4G1QB 4CP5A 3I82A 1Q16B 3E01A 4Q44A 3K17A 5GMDA 1J27A 3GSIA 4BBYA 1HYSA 1HQEA 7FDRA 4O4GB 2DGSA 5KFCA 2RHQB 3ONQA 1W26A 2JJ4D 3I5BA 2K3KA 3FGVA 3AJ2A 2GAGC 5KG7A 2GQQA 2QIFA 2A10A 3B78A 3N4WA 3NKYA 5LL6d 2HS0A 2F8HA 3TQEA 3CDUA 4MIWA 2V2VA 3BJYA 2YKAA 4OHZA 2V94A 3TAMA 1VQPS 1SUQA 4K4XA 1YJNS 2M52A 3DDKA 4PQUA 3BGRB 5B09A 3LQVA 4KT0C 3OUYA 4QWBA 1T94A 2DHGA 2KDOA 2IA6A 5J2QA 3K5LA 1WHYA 3F0NA 2BRKA 4LBHA 5J2MA 2J7KA 3FQKA 1RCOB 1DY3A 1GMWD 1RT2A 4P7VA 4J9VA 2YXLA 2NPFA 1CS4A 2PD1A 3CCMS 3PRVA 1RYSA 1ZAWA 4CYUB 1CBKA 2E9TA 1FJGF 4DV5J 2DCUB 1VRTA 2H3EB 1M90T 3R7BB 4Z7CA 2JC1A 2D9OA 4FXDA 4ZIVA 4IRKA 2MGZB 2HWTA 3UN2A 3R2DJ 2BE2B 3PIPQ 2VQEF 4CT9A 2LYVA 4GVBB 3MPYA 1IR0A 1RWXB 4WK1A 5KFGA 1U49A 1O0PA 5ETVA 5C24B 3NNCA 2J6TA 2B9WA 3EPIA 2XYGB 1S6OA 3J80U 3JQMA 1APSA 1YGYA 4PCQA 3SDEA 5HQLA 5E3AA 5F8HA 3VR1A 4K4ZA 3T5LA 1KQKA 5K8NA 4MK8A 2B51A 2BV3A 2B4VA 4DV2F 1BGXT 1HNVA 2RIJA 4CWBA 4J9NA 3GJSB 2MSTA 3DRRB 2CQGA 2NS1B 4OZJA 4DL6A 1YRUA 4Q8EA 3SMZA 1Q79A 2WB4A 1W25A 1LK5A 3TA2A 4M5NA 4WFZA 2JX2A 3BKUA 2IM3A 3DRPA 1D8ZA 3CD6S 3BV8A 3CJ4A 3BGFA 1RLCL 3SFGA 5LJ5Y 4ZHRB 4X4PA 2YKOA 1I94J 1UJ4A 4LF1A 5B0CA 3A1YG 1RT7B 3DLGB 4PG7A 1NKCA 4ZPTR 1RBLA 2ZOGA 3NGUA 1ZZNA 1FT8A 3R27A 1UFKA 1SI9A 3HKZD 1NSQA 1HHQA 2ZHAA 2A1BA 4ELUA 3H40A 1N6QA 2ILZA 4IRDA 4QWCA 1VLYA 3PR4A 4X4QA 2MTLA 1MWQA 4NCGA 1K9MT 3FK4A 4KGKA 4UY85 2HFVA 4RW8A 5EDWA 2HHVA 3OHAA 4C6AA 1FKPA 5HN0A 2GJFA 4K4SA 2CPJA 4KPYA 2GQ2A 5DG9A 2OPPA 4ZLNA 4PRFA 4I68A 1SJ3P 5I3QA 3NCRA 4WU3A 1T3NA 2BE7D 2M5YA 1HBNB 4CLZA 2W2PP 2CWKA 5C2GA 5E3PA 1RAIB 1H3DA 3FCWA 4BC7A 2KZMA 1KD1T 4YS2A 4I2QB 1WOPA 1FXLA 5H9FK 3QJPA 3AY0A 1Z4UA 3G6YA 3FVYA 4K5SA 4F2RA 1UAWA 4WFNQ 3QFWA 1U1QA 1HHTP 1VIXA 4JBCA 2YH0A 2D74B 1KKHA 2IIHA 4B9MA 2QL7B 4L73A 1E6VB 1E6YA 2PGCA 4YY3J 1Q7LB 1Q8LA 2CQIA 2HK3A 1WACA 1Y10A 2GNKA 4C3MA 3TA1A 3DLEA 3OFEA 4OZ5A 2I8EA 4ICLA 2B9XA 3IC1A 2J5AA 1VS3A 4LBPA 5HI7A 4IRCA 4X65F 3VGVA 1R0AB 2F4FA 4M1KA 4MKAA 4LF6F 2MSSA 4DUTA 3KJQB 2IBOA 2V69A 3KK3B 1QSYA 1EETA 4DR2F 3M8QB 1I5OB 4OYPA 3BEGB 1WHVA 1QSLA 2DR8A 1B99A 1OO0B 4HHHA 1OPZA 3WBZA 2V9KA 2KFYA 4R0EA 2V2QA 4LFBJ 1KP6A 1R6YA 1AB8A 4USUA 2BQRA 3GB0A 3GQCA 4F4YA 5E5NA 5IWAF 5IFMA 1W2IA 2ABYA 5GAEI 4DV0F 4TLQA 3UE2A 4KHPF 1WKJA 2EFVA 3BH6B 3UD3P 2X3GA 1NH8A 4ZLJA 4C11A 3T41A 4X4RA 1CSJA 1RA7A 3MWBA 4PYDA 4PKDB 3LP2B 1TL7A 1F2GA 2CIMA 2YVSA 5DJBA 3ILIA 1FRIA 1CQMA 5D0RA 2C42A 3O6QA 4GKKF 3M8WA 3C46A 3MECA 4JV5J 1XNRF 2F3JA 1RADB 5CYMB 4USMA 3BR8A 1WEXA 3PO4A 1B64A 2HBRB 1HARA 2OMLA 1N32F 2E5IA 2J8AA 4YOEA 2AQ4A 4Q0BA 1HWUA 2ZBIA 4YR3A 1KTQA 3D1QA 3CDEA 3CJ3A 3G2XA 2AJ1A 4FVCA 2GZOA 3R5AA 3HM9A 4WTYA 3W3SA 3UDLA 1P27B 2CQ3A 3ET6B 1PC5A 1ROFA 2KRRA 4J9PA 3LP0B 1T05A 1FRHA 4O4RA 3I4HX 1UVJA 3D6FB 1GX6A 2HQFA 5D4LA 2N7YA 5FD1A 2HZVA 2GCFA 1UZDA 3DLBA 5ETQA 4ILRA 4OV1A 4I0WA 1A7GE 4DG1B 1TKDA 4LF9J 5KT2A 3TUZC 1FA0A 1NPRA 4DV1J 3M2UA 2DPJA 1HNIB 4C2MA 3W8PA 1B0PA 1PKUA 4DL3A 4NASA 3TVZA 2A18A 1CJUA 1YSJA 1S72S 2JRSA 4EYHB 4ID5A 3MGJA 2DVIA 4MIAA 2HAIA 1TV6A 3R9LA 1PAUB 3N5FA 1X4BA 3LTOA 2XS7A 1UTAA 4C8YA 1RHUB 4F8RA 3VTIA 2JHEA 1WJ9A 1F9EB 1PJ5A 2M4MA 4URQU 5CYQB 3TVKA 2ALZA 2BJ3A 4DFKA 2QLWA 3GSDA 1SQGA 3PDNA 2BA9A 1OMSA 2QL9B 4K5RA 4U96A 1N5YB 1NK8A 3MR7A 4RBUA 3CDBA 4E0DA 1CJKB 2XQCA 3DNCA 3KHGA 1CJVA 3NOGA 2NZ4A 4BHQA 2VUGA 3NGDA 2CQCA 5F9LA 1NK7A 4JYAJ 1NK0A 3K7RA 2P9GA 5M2RA 1JWWA 2OPQA 1NBEB 2J9DE 2U1AA 4F26A 1ICEB 4I6AA 1X5SA 3Q0AA 4NLRA 3CMAS 1FCAA 3AD8C 5J2PB 2Q79A 4I7FA 3A8KA 4PABA 3H2UB 3MCNA 5K14B 3ISZA 2UUBF 4NPOA 2OKQA 1FWLA 1WSVA 1UMJA 3PM9A 3ILOA 3I0RA 2V4JA 2RKIB 3DRSA 2EFGA 2M0GB 3M6VA 3FSXA 3C66A 1P6TA 1VISA 1WC1A 4NZ7A 3KWMA 2JVRA 1EQMA 3IR5B 4PG6A 8RUCA 1DQAA 3KK1A 1LXNA 1Q81T 1URNA 5DQIA 2QL5B 3C16B 1WF2A 3LGHA 2CPHA 1FXRA 4Q7AA 5LOQA 3QGIA 4DU7A 2CJXB 2Z4PA 1UJ6A 1I51B 4P9SA 2G13A 2IA0A 5DM6Q 1M1HA 2DGTA 2DJWA 1UZHA 1C0TA 2UUAJ 3H8YA 4NLPA 2AT1B 1O8BA 4BWJA 3VV2B 2XSJB 3QO9B 1KVJA 3IGVA 5A76A 2W9CB 1U1LA 4TXSA 4CO0A 5B7WA 1RT6B 1BWVA 3I0SA 2Z57B 1YZ6A 2DGOA 3GTYX 1EX8A 4U8YA 4DR5F 2C2RA 1JLBA 3E2EA 2VASA 2NQPA 4F0KA 1NCLA 4OX7A 3MFHA 2E1CA 4ELTA 2ZUAA 4KO0A 4LR7A 2NUUG 3KJVA 3MPVA 2X1GA 3GR1A 1GMVA 5KFBA 1BE4A 1REVB 4OYMA 2BYCA 1U09A 2UXDJ 1VQMS 2KJWA 3MCOA 4J9UE 4CH7A 3DLHA 4ZP8A 3K5PA 2QTWA 2RSQA 4DL4A 3C6TB 4ZVPB 1K8AT 1LQ9A 2JSXA 5HVGA 3T5KA 3BGOP 4K4UA 1TKZA 1SIZA 1FKOA 2AIRB 4LRBA 3EWGA 2E5GA 3LGMA 4KSEB 2DNKA 1JLFA 4FYVB 2ZE2A 2WVFA 1WG1A 5IXUA 3H25A 1FNXH 5AXLA 2H4YB 3P8BB 2HFNA 4R0JA 4HACA 4JI3F 3M6WA 4DV7F 3H0PA 5L1JA 4ETZA 2YNFB 2AF6A 3C8YA 2M9KA 1CG2A 1JMTA 2W4DA 4DPWA 2VBXA 4BWMA 1TKTB 2X1AA 3CJ5A 1M5OC 4OYXA 1X4DA 2W2MP 3CJ8A 5CH7B 3CCVS 4DV4J 3TUJC 4I2PB 8AT1B 3DXSX 3QWUA 1VCTA 4EBEA 5T7LB 3HSZA 1RDRA 2VKRA 1FVQA 3KLGA 2VIHA 3SV4A 1O51A 3P6YC 1DQ9A 3TJ9A 2XNRA 3EXYA 4X66J 5HROB 1RWNB 2V4QA 1S6QA 4XDDA 4UY8T 5MAOA 3HHLC 2Z8QA 5KFYA 2OGUA 4MJKA 3CJRA 3OJSA 1TFWA 3R97A 4ZP7A 1S76D 3BSAA 1WDTA 4K4WA 4UQGA 1N54B 1S1WA 2WSFC 2ZBQA 4KH0B 5G0RB 4EBDA 1R8PA 4ZPAA 2CXEA 4W92B 5IM0A 2HQ3A 1S49A 4B9UA 1VI7A 2Z2YB 4G65A 1P1TA 4OIXA 4WPAA 1DTTB 3A12A 1HD0A 4TY9A 3AODA 4NRTA 2OFHX 3POTB 1LXJA 5DDQC 2HZAA 4WE1B 1GT8A 4NOHA 3KLFB 3FJ2A 2PDAA 3W9IA 4ED7A 4FPIA 4PXDA 2VBWA 2LA6A 2VFVA 3HHDA 3W5YA 2C3MA 2GC8A 3ZZOA 4WFAQ 4O0IA 2BZ2A 2XNQA 4ZPVR 1SKSA 5KOWA 4IO9Q 3Q86A 1S9GB 3GFZA 3C14A 5F8NA 5KG1A 4OI3A 3QT7A 4UOFA 1QAJA 1CJTA 4JI0J 2J9CA 3JTNA 1L3SA 2HHHJ 3DGPA 3M05A 5BYSA 2LXUA 4NXMF 4QWEA 2DHAA 4S0MA 4B3SJ 3CCES 3BF4A 4ZVTB 2W2QP 3I96A 3MD1A 5L1LA 3C3LA 2PO4A 2RDJA 1JJCB 1GMUA 4YR0A 1HBUB 2H54B 1DJ0A 1CPZA 4X4SA 3OV7A 4RW9B 1X0PA 4KFBB 1JLEB 3CJ0A 4DFPA 3P5TL 1TK8A 4ANDA 2PIIA 1L3KA 2XEXA 3MM9B 1TL5A 1VQLS 3I55S 4P73A 2AYGA 1Q53A 5GADU 3MPWA 4J9KA 5LMNF 5I3PA 1YJWS 2DGWA 2OEJA 2FVSA 3K5NA 2V8PA 2AV5A 3TX0A 1BQNA 3UVJB 1HI1A 3P3DA 1YIJS 1RT4A 1U02A 2HK2A 1XIQA 2HVZA 4ES3A 3BKFA 3DOLB 4J37A 1N8RT 1EKRA 2OPSB 3DRYA 1VQ7S 4G1QA 2RAQA 3ITHB 1N33J 3OVBA 4GKJJ 4ZVUB 2RVJA 5HK4A 3DC2A 3M6UA 3TVYA 4JI2F 4RUCA 1X5OA 3FSIA 3K8VA 3QMQA 4X64F 4O4GA 1ZBTA 3PKYA 4ATNA 2G4BA 3EJMA 1KHWA 1YQHA 1T7PA 4K50A 1ZAVA 2B7BB 4IG3B 1FESA 1WELA 2H1YA 2KM8C 1OQ6A 3MEGB 3HSDA 3QNWB 2N4CA 1AW0A 1BC6A 1UPPA 2J9EA 3BGRA 2ZJPQ 1RACB 4LF5F 4KH1B 2L41A 2E7WA 3SCJE 2UXCJ 3KG1A 4FBTA 2UUWA 4DPUA 4HI2A 4C98A 2OAUA 1N48A 2IRYA 3J81U 1N34J 1FD2A 2YH1A 2OJ3A 1SV5A 2C2OB 2AEMA 3WQPA 2DB1A 3ZO7A 2VFTA 4KE5A 5KFFA 3CIMA 1SVDA 4CYUA 3G96A 2ZHBA 1QLNA 1FNMA 4NA1A 4Y2MA 1WOOA 3AFGA 2XMTA 3CJKB 4QQBA 4B02A 3D67A 4Q2MA 4DSKA 2BKPA 2MGZA 1YTYA 4DR1J 4BC9A 1RT1A 3OLBA 4GVBA 2UVRA 4CH1A 4OHWA 3GLJA 1J5EF 5C24A 2LLZA 2R7VA 1P9YA 4ZVSB 4ILLA 3OL6A 1EZZB 2YQ0A 3OL7A 4JI8J 2XC9A 1NKBA 1U2RA 3EVWA 1VBKA 1N4LA 2W7OA 5KFMA 3SV3A 3UN5A 2WVEA 3G8TA 1MU2B 1YJUA 2J6SA 2E1MC 2NUHA 4GC6A 4Y65A 2ILYA 5HMYA 4PG5A 1W2BR 2CZ4A 3QGGA 3MCMA 4IYQA 3FBFA 3UCZP 3OSPA 4WIQA 3ICLA 3HHKA 1L3UA 2KXHA 1FFSB 5B08A 1RUSA 1SBRA 2HS4A 5ETOA 4AYBD 5KT4A 4CIOA 2R7RA 2FVPA 3HD2A 1KLNA 4TNOA 4F3MA 1FK9A 1T11A 5D0EA 4JI4J 2QJ3A 4ZPWR 4CLYA 2E9ZA 2XB2D 3BBCA 1VHFA 3M2RB 2MQ8A 2YKMB 4ZPDA 1AYEA 2VA3A 3HVAA 5KFSA 4ZVFA 1YKWA 4MKVA 1RT7A 3DLGA 3DGVA 1AUSL 4UUWA 2KXFA 3HHLA 3BO2A 2FJWA 3RU0A 2WTFA 3N01A 3CF5Q 4ZA1A 1YDLA 1NLKL 3B8HA 2ROGA 4Y2KA 1T9TA 2VKZG 2LU1A 4KHMA 3P45B 2DXDA 1WC5A 5M2UA 1FRMA 2HHTA 1MWZA 3QT6A 3VZIA 1HYSB 3IAM9 1ZYQA 3OTBA 3BO3A 3W1YC 1TP7A 4DUYJ 2KTQA 3KG4A 2HIYA 2C2NA 1EJ7L 3A3PB 1ZETA 3MDFA 3N28A 2BQ3A 2FVQA 3NS7B 2RNEA 2FY8A 1FDNA 1EKSA 4HVZA 3TANA 4GVLA 4XO0A 3LW5C 3E3XA 3FMBA 3L09A 1D9AA 1S6UA 3Q8SB 5K9FA 1TUGB 1HBNA 3R5CA 1HD1A 4EUVA 3OJUA 4L3KA 4ECVA 1NSPA 1D9DA 5J2MB 1JJ2R 3NCPA 3AB2B 1TZ0A 2XM3A 4JI6J 4OV6A 1RT2B 2O66A 2RH3A 3T3FA 2QA1A 5HAOA 1HA1A 5ITHA 4Q45A 3NGSA 4ECRA 1CS4B 4JI7J 1AFIA 1GTEA 2XZWA 4ECWA 3DCAA 1FTRA 3T1AA 3KHRA 1HNXJ 2RF2B 2CQ4A 1FEHA 1E6VA 3K59A 2K06A 2BJ9A 2MPUA 3NS6A 2R8GA 1RTJB 4ZCMA 1NMEB 4J5OA 1O6XA 4C0BA 1RU2A 2QLBB 4N5SA 1K73T 3BS9A 4HYKA 4LJMA 3PYFA 3B4MA 1R0AA 2MQPA 1JX4A 2F63A 5HLFB 1CQNA 2VL1A 4QPXA 3GMGA 2VF3A 4KGMA 5L39A 5U47A 1FI4A 3AOBA 3KK3A 4USHA 3CSKA 1F1BB 3M8QA 3N6NA 1G3OA 1T9WA 1F5AA 2F65A 4IH7A 3JQKA 3TQ1A 2IC3B 4OI4A 2VG7A 1X9SA 1PILA 3KXDA 5HQMA 1U1RA 4Z37A 1BMQB 5KTQA 3PZPA 4K59A 2IVMA 3CC7S 5CZVA 2V50A 4R25A 4WP9A 3JSYA 4HTJA 4JOUA 4IH5A 3Q83A 1VC0A 3NL0A 1Y0HA 1Q78A 1JJ4A 3KJNB 4LFAF 3SCKE 4B3RF 4H4OA 2MQQA 3LP2A 1RISA 2K3IA 1UA1A 3CEDA 2A3JA 1TL1B 1WI6A 2WAQD 3DLLQ 2ZITA 4LR8A 2ZC3A 1S79A 3P5BP 2H51B 1ITPA 5CYMA 4C8MA 1GXTA 4A8WA 3JAMY 2NPIA 2R8KA 1S77D 5KFXA 2Y0BB 3WDOA 2DY9A 5CCLA 2KT3A 3NY0A 4A8FA 3O2IA 3MMCA 1HQ2A 1HWJA 1JLCB 1RWMB 3A3NB 2PN6A 3MOJB 3IXQA 4H4KC 1F9HA 3V6DB 1F5CA 1N36F 1YJTA 3OTCA 5BYRA 3PJXA 3ET6A 5E2QA 1IQTA 3HVTB 4WK3A 4PPDA 2VV5A 1FDAA 4LIRA 3NMRA 1SQFA 3HT3A 4A8OA 3RRHA 3HXMA 1LFWA 3KNGA 4QZVB 4DG1A 2XWXA 3CJ2A 2M8HA 3M8SA 3SYZA 3K2YA 4USWA 1PYOB 1U24A 5KFKA 2RDIA 3TR5A 4FF1A 3DKDA 3EGVA 1LWCB 2B56A 4OX9J 3QYYA 3LAKA 1H98A 3OTOF 3NEKA 1HIYA 4K0KF 5EHHA 1X7VA 1YZ7A 3UR3C 4DV6J 2MKCA 2RD5C 3TAPA 2OO4A 1M5KC 1K1QA 3AD7C 3FUYA 3I9V9 3G9CA 5CYQA 4N76A 5KG2A 2IY5B 4NLXA 4MKBA 4RWXA 3OR2B 1OSDA 3ZZRA 4EO8A 5THWA 3LH2S 1IBMJ 1N5YA 2F9JA 6AT1B 2IJFA 4C48A 3HO1A 3OW2R 1OQ3A 5KG5A 4KKOB 3AXKA 3NNAA 2E7XA 1WHXA 3GCXP 3MR6A 4X62J 3D68A 2VQFJ 1BHNA 5LSOA 2J7WA 3RW7A 3HDSA 1SC1B 5J2PA 2B8PA 5KG6A 4OX8A 2ADBA 1FFWB 3SSQA 5K14A 2CPIA 2FZGB 4DUZJ 2BUNA 1FJ7A 4ZIWA 3VAJA 2WONA 4OFZA 1FVSA 3FC9A 4DR3J 3HHNB 2RKIA 4O3OA 1T9UA 4DJBA 1N5VA 5D4NA 4WCEQ 2P8IA 3GILA 5F41A 4RNOA 4FF2A 2V8HA 3BSOA 1GXLA 2QC3A 3DMJA 5HQ8A 3C16A 3ILJA 4HH0A 1N52B 2DRDA 4OHVA 3K5OA 4IH6A 3IR6B 1EAYC 2XMJA 2EFQA 5E0OA 4C3KA 4N41A 3RRKA 3UPFA 4HL9A 2JH3A 3D0GE 1V5IB 2DXFA 2XSJA 3QO9A 4Y00A 3ZZPA 3EM1A 4QPTA 2XSFA 2W9CA 4FZVA 1RT6A 2OFGX 2XGPA 4Y6IA 4OJHA 4M5DB 1JXVA 3WX4A 3LUYA 2X1BA 2CAJA 4QIEA 5KFJA 3Q8YA 3RUBL 2CPDA 2V5HG 2A0FB 2ZJQQ 2XYPB 1REVA 5F0UA 1TL3B 4RNNA 3R7SB 4B9NA 2F8EX 4LF4J 2P6SA 5L9XA 4B3TF 1BXNA 2V2ZA 5KT7A 3BGLA 1WOSA 5IOLA 1HBMB 4P2SA 1KBRA 3SXLA 3C6TA 5EGYA 2HNYB 5CHCB 5DZ6A 4N47A 4M5KA 2G0JA 1NDKA 2L9NA 2JEGA 4DX5A 2VQEJ 4O0NA 2BR0A 2HRYA 2ZH2A 5LSLA 5D4OA 4XIUA 4TU7A 1LW2B 1KHVA 1RT3B 4X4NA 2KHDA 4DX8H 1WF0A 1Y5IB 3Q2TC 3WX8A 4TY8B 2CQHA 3VAMA 1SH2A 1NKEA 1CJVB 4ZN1A 2I5JA 3CCTA 1QD1A 3PY8A 3QRRA 1IKYA 2DNHA 1T3OA 3F41A 2QLJB 2AJ4A 2YNFA 5GADI 4E8UA 4YB1P 1X31C 4ZS6A 3ENVA 1TKTA 2XMWA 3TEGA 2DYAA 1DFDA 3OLAA 2FHMA 3QSIA 3GONA 1D9FA 3FZBA 3UD5A 4M94A 3SIPB 2VFRA 4B3MJ 2JLFA 2GHVC 2PI5A 4KGZB 3I4PA 4KC5A 4I2PA 4Q8FA 1LKZA 3JSBA 2FJVA 5T7LA 1SKUB 4RU9A 4YR2A 2D3OR 3V2UC 4AXIA 4TVAB 4B3OB 5J1EB 1G6BA 3QJLA 1BLUA 3SZ2A 2LDYA 2KU7A 2HHUA 1NJXA 3LO3A 4RNFA 5HROA 2KVQE 2KG1A 2YNIB 2R9LA 2FHJA 3KK1B 2ZD1B 4HDHA 4RW4B 1SH0A 2VDIA 1IBKF 2YNGB 2W2NP 1U8WA 1RTZA 5L1IA 4USIA 5G0RA 1VQSA 4ECYA 2CNLB 1I1GA 3GIRA 3IWLA 2WOMB 3HF5A 2MY7A 3HFKA 3PKMA 1NPKA 5DS7A 1SJFA 4J9QA 3NOCA 5J1PA 4CLSA 3M9MB 4CO2A 1IJFB 2CWXA 3POTA 1HMVB 4QWDA 3LPEA 5CABA 3NXZA 3I0SB 4ECQA 2R4FA 4NXNJ 3KLFA 4M5LA 2OMOA 1FERA 3I6PA 4JV5F 3KLVA 3GP9A 2R7OA 4A8YA 3JS9A 3G6VA 5CCMA 1SC3B 3PW7A 5BXIA 4O44B 4F4ZA 2DGXA 2UV8A 3VCDA 4NEZA 3AA8A 2M3DA 1RHJB 3KMQA 2W8LA 3P4UB 2OHDA 3UDVA 5L9NA 2KYZA 1S9GA 3QPIA 3L95X 2FLLA 4DR7F 3W65A 4DQQA 1NNDA 2LMIA 5I4MA 2GMHA 1RI7A 4D3GA 3HD1A 3TRGA 4FXVA 5KT6A 2VODA 3T6JA 4C4WA 3RB0A 1SJ1A 2PA3A 1NK5A 2KXNB 1UEKA 5JJBA 2QLXA 1TKZB 2HHPA 1FDBA 3T1HJ 5ETSA 5HBMB 3QIDA 4RW7B 4LF9F 4WFYA 4LSNA 4X65J 4DV1F 2Q6BA 1WKKA 1GQEA 3ENWA 1HBUA 2ZE2B 4ECUA 2HHQA 1NHVA 1IKVA 3CT9A 4RW9A 4KFBA 1JLEA 5BJRA 4PR6A 2EG1A 5CYJA 4JI1J 1UEVA 2CRLA 4HACB 1SL2A 1S4EA 3ILLA 4RZRA 3RG6A 3PYDA 1U26A 5IT0A 2DR6A 4RBTA 1EP4A 3KNAA 3UVJA 4ANEA 1RA6A 4NRUA 2PMZD 3NP5A 3PX0A 3DOLA 2YX1A 3CNQP 3GIIA 3GR0A 3ITHA 2EFPA 5G4DA 1SL1A 2OTJS 1QUPA 3F73A 4DCPB 4LT6A 5GAHI 2IM2A 3RB6A 1XMQF 2E1RA 5F8MA 4GKKJ 1XNRJ 1RBAA 3IMQJ 2ZNZA 2MLXA 3IG1B 4IG3A 1ZOTA 2RQCA 3VF0B 3GV8B 4L72B 3ZZ0A 3VALA 1N32J 3MEGA 3CD0A 3R6LB 2MZJA 1KS2A 2YWKA 3W2WB 5AXNA 3MI7X 1RYRA 4M95A 2C3UA 1S1VB 1X60A 2FTRA 3I56S 2BOPA 2GHWA 2IJNA 3H59A 1U1KA 1V3RA 3HHEA 1S97A 3AJDA 1XR5A 4ALZA 4AL5A 3IA0A 1UCNA 1LW0B 3ZXWA 4IQXA 1PO6A 2PMWA 3J7YU 5E3QA 2GMJA 4F4KA 4NZ6A 4DF8A 1KR4A 2MQNA 2YNHA 4U67Q 4OYOA 2C22A 3OL8A 3D6TB 1DURA 4HT5A 3CJKA 5MLCV 2UUAF 1T8EA 4F04B 2XI3A 2MZTA 3KYLA 1X9MA 3KLIB 2WVDA 4ZVGA 2WVBA 2ADCA 2V2KA 1DRZA 4HKQA 3G8SA 3CDWA 3QGHA 2BJ7A 1Y9OA 4BCAA 2AYMA 4ZK7M 2GVZB 5FDLB 2B9YA 2LU2A 4L6V3 2R2TA 4DZ6A 1NU4A 4QOTA 3MM8B 2WRMA 3CCZA 5B0GA 3PHEA 4HDGA 3KUHA 4ED2A 2A2CA 1S57A 2AKWB 1ZM4A 2FGCA 3CPWR 3IRXB 4RU2A 2DR9A 2C2ZB 2I9SA 4U6PA 2OTLS 4AUKA 4HI1A 3H7HB 4CLKA 1JLQB 4CO3A 3KDNA 2Y8YA 2P6TA 4WP3A 2XMMA 3RR7A 1S12A 1QE1B 3LP1B 2MZRA 3M6XA 3CMES 3IO1A 2YKMA 2E29A 2QSWA 3T1YJ 1MROB 4K8RA 2UUBJ 4O3NA 5KFVA 2J0WA 2M70A 1UVMA 1KRPA 1WHWA 4AL6A 3PX4A 4F25A 1MN9A 4KBIA 3MR5A 3AT1B 2W7PA 1QM9A 2FJBB 2V0NA 3FKBA 2QFJA 1AROP 3MAAB 2NYIA 3MMBB 4OZ2A 2BKOA 3PVXA 1KDNA 2AX1A 3PV8A 4Y34A 4HR2A 4KJIA 2G2ZA 3D0IE 3U1MA 2HZCA 5IQ6A 1F3FA 5GAGU 4GO7X 4DV4F 2JC0A 4PWWA 2KT5A 3OFHA 4LQ3A 2WVCA 3ZTOA 2VBZA 3LOUA 3AXMA 4TN2A 1RHRB 2FZKB 2E5JA 5FJ4A 3NLCA 3BBBA 4D3HA 2J0SD 1U1MA 1XNQF 3N5BA 4RUAA 4EZ9A 3PX6A 1SB6A 2GJIA 1U47A 4IG0B 1IBLF 1SV5B 2XY7A 2NYHA 2HLTA 3A8JA 4QCLA 2W25A 2V68A 4O3QA 4F67A 3BPDA 2OP5A 3HPOA 1TVRB 5T14A 2H4WB 2ZVIA 4Z2XA 4O3PA 3MXHP 2RF2A 3MEDA 4CM0A 1JXLA 2DNRA 4LF8F 1RTJA 5H1SV 4L75A 1KFDA 3THTA 3HHLD 2C2MB 1RT1B 3JXOA 1X4CA 1VFJA 3Q22A 2F5GA 2A6MA 2MMYA 5HVHA 4DV3J 5HLFA 4AD6A 1R7IA 5L1KA 2GHPA 4CO4A 3SFUA 4RNMA 5EN1A 3CWJA 1JB0C 4O3RA 1NXIA 1YHQS 2DR7A 2JWNA 2GGPB 1SJ4P 4P72A 3JYTB 2IC3A 1TK0A 5KFEA 4A8QA 4FPRA 2YPZA 3N0VA 1CVJA 1BQXA 3B54A 2P9CA 4HT7A 2GX8A 1CC7A 5KG3A 1YG0A 4CLTA 2V63A 3RBDA 4WFXA 4DV7J 1P9QC 4P2XA 2FDNA 2C3YA 2DR5A 1N88A 4ES2A 4QIFA 2C2EA 1IR1A 1FK9B 4CLPA 5K5MA 5KFPA 1XR7A 2EKNA 3V4IB 4DBQA 2HHHF 1VDHA 4G6VB 4HLBA 4NLTA 3DU6A 1TL1A 4X4VA 1ZAXA 4B3SF 5D8HB 4WJBA 2UVVA 2ZEJA 3MTKA 3PHTA 3HHLB 2PE8A 3GFXA 3GE9A 4EYIB 1RGVA 3BGUA 2N4DA 1HI0P 2I0XA 1S59A 3MCSA 5F9NA 4K2XA 4WZQA 1JLCA 4LSZB 4CNZA 4CCHA 2BABA 4CM2A 2EC2A 1RWOB 3V6DA 2ZFHA 1WG4A 4XTTA 2MKJA 1GAOA 4NL5A 1I6JA 2PMHA 3HVTA 4OX6A 2MYFA 2XHWA 4W90B 1HLWA 4EWTA 5KFAA 7FD1A 3VAFA 2UUCJ 4TLRA 4NLQA 3CC4S 1RHMB 4NE9C 1N33F 1NH7A 5H9EK 2DITA 1MG7A 4YB5A 2YX4A 3L7PA 4MTPA 4NLYA 2XHCA 1LWCA 5KFQA 1JIHA 3NG8A 3DU5A 1GX5A 2D7SA 4MK7A 4DLGA 3OPKA 3HJFA 4Y2CA 3GYGA 1HNWF 1ULRA 2VC0A 1R8AA 1VC6A 3H5SA 5D0GA 3QZ7A 1JJHA 3E51A 1QUVA 3VHQA 4QR2A 1WTFA 3GIKA 2L9DA 4TQSA 1WUUA 4IO1A 2UXCF 2FY1A 2I2YA 1RQ0A 2FLNA 3OR2A 4X4OA 2Q6CA 3RYLA 3PW4A 3QBCA 4NMXA 4EK2A 1R31A 1ZTTA 2HGLA 4RJVA 2HQIA 5C42B 2K8GA 4F50A 4KHRA 3Q8PB 4KKOA 1PG5B 1NZ8A 1KQFB 1K47A 5DLFA 3MUTP 3NWGA 4OHYA 2VPYB 3LALA 2FVCA 3RJMB 2EBGA 2M7SA 1DBDA 1FJCA 1XQIA 2Y0SD 4FF4A 1SQEA 2IMOA 3CJSA 2VG7B 4ELVA 2DEIA 1F6TA 4QIGA 1RXOB 2B4OA 3NCQA 2XULA 1NEEA 4N77A 1VBXA 3TZZA 1P1LA 4XAKA 4O3SA 4OJGA 1M0SA 4LVNP 5EWEA 4YP3A 1HNZJ 2NXEA 1U6BA 1OJ4A 4QU7A 2R7QA 1PJ7A 4H4OB 1T0TV 4TYAA 2EXUA 3HZGA 3IAS9 1Z2LA 1WWHA 4MIBA 3W66A 3WIUA 3DOMA 4WP8A 1QAIA 5DLGA 2EVZA 4DS5A 3CCWA 4URGA 4HH1A 4NYOA 2KM8B 5D3GB 2CQPA 3R1LA 4LF7F 4X64J 1TL4A 3MMCB 3T9NA 5HO4A 1RK8A 2XY5A 1Q5VA 2F1FA 1J2VA 1YK9A 4PAAA 1RHQB 4NCBA 2ALYB 4RLEA 4M5DA 3DN9A 2HWHA 3W2VB 2ZZNA 2L9WA 1SC4B 1U45A 2IVFB 4CT8A 3EMTA 4F4WA 1LFPA 5GAEU 3T9ZA 1SKRA 1G2EA 2Y9HA 1JNZB 4X84A 5DQHA 1X4HA 3D7SB 1TL3A 3CVKA 4CLWA 1DTQA 2QYCA 3PJWA 3QZ8A 2QMXA 1HBMA 1N5SA 1PAEX 3TI0A 4C97A 1UWAA 2HNYA 2IRXA 2MKYA 5HL7Q 2E5LF 1MMLA 1FRLA 3ZZYA 1ZA1B 2IVYA 3QATA 1OY6A 3GYXB 3V6KA 2B4PA 3D66A 2BMBA 5AT1B 1VYAA 2JZ5A 5F8IA 2A2DA 3CJQA 1HWKA 1J5EJ 2GQCA 2E44A 3KLEB 2VDHA 1LW2A 4DR6J 3PW0A 3CMQA 1RT3A 4B9LA 2HSEB 2IM0A 4TY8A 4ZP9A 2XO7A 4JI6F 3J81Y 2QE5A 4PQAA 2B7CB 3JTOA 3HULA 2P5VA 2F4VF 3GWCA 4NLGA 1HHSA 4CRJA 4P74A 4JI7F 3WC0A 1FF2A 3RB4A 1Z1ZA 4A8SA 2HAFA 4GC7A 2OD6A 3MEEB 5SZTA 3D6HB 4XDCA 2R7XA 5RUBA 3HI9A 1XBWA 3LWLA 2W24A 3QT8A 1IKXB 4W98A 1RKIA 2D3O1 4OZ0A 3G6ES 1Q0NA 4ER8A 4P10A 3UCUP 3ADAC 2X3DA 2ZZTA 5D78A 3DHXA 2WONB 3CJTA 2GO9A 2MJUA 1RAEB 2BX6A 4Y3CA 4F3QA 4B3OA 5J1EA 1X4FA 2IYGA 4NA3A 3CGIA 4UUXA 1KLMB 2WCXA 1H2VZ 1RWWB 2LA4A 4C8KA 4ERDA 4YDXA 3UN3A 2CKWA 2M2BA 2YNIA 1H72C 1IQZA 4ITSA 1B0TA 2WBMA 4FF3A 4DFMA 2ZD1A 3DMJB 1IWAA 1YJRA 4RW4A 2LQJA 4YHHF 2YNGA 5L46A 2AJ0A 3KUGA 5ETLA 1NZAA 1ZM9A 2NZCA 2XWYA 2MXYA 1QAXA 2HVHA 3QLHA 1C1BB 4OI1A 4QR0A 4DX6A 2VFSA 3TZWA 3D1HA 2WOMA 5EUHA 2CJYB 1WG5A 4UTGA 3PCOB 5AE3A 4ECSA 5IQQA 3GV5B 3VAHA 4DZDA 5AJ3J 4DCOB 3J7YI 2B43A 1D8YA 1X9WA 1HMVA 5LMUF 2XLIA 3RR8A 5AXKA 1IM4A 1RAFB 2KJVA 1UFWA 2J76E 4OJ1A 2IAJA 1S9EB 3TX8A 2EPIA 4O44A 1CULA 3M30B 1WORA 3Q8VA 2DGUA 2DTJA 3GIJA 1WF1A 3FDSA 2Z2ZA 6FDRA 1N0VC 3EGWB 1L3VA 1X0FA 2G2OA 2DHSA 4ILMA 5ETTA 2ZJRQ 2W7AA 2BW2A 1HR0J 2FLOA 2O1PA 3BB5A 3O1LA 3U02A 1H2UX 2YKNB 2Z2LA 1S0NA 2FHOB 1XTZA 2RILA 4ZVEA 1LWFB 1Y7PA 3PR5B 3J7A1 1H73A 1XMBA 3H5XA 1WC0A 1NPPA 1RHKB 4WZMA 1YI2S 3DHWC 4NZ0A 2COLA 1RAGB 3FBCA 2FHJD 4A48A 5HBMA 2R8HA 5F3ZA 2WHOA 1RJJA 4RW7A 1U0HA 4TQRA 2MB0B 4QYZJ 4F2SA 1U1NA 2BANB 4EBCA 2CNKB 3OFFA 5KFDA 4UZCA 4WXOA 3WHIA 3BM7A 4OX9F 4Y2IA 2CNOB 4P2FA 4WTOB 1NRKA 1KQGB 2I5JB 3CO9A 2FHKA 1IKYB 3AH6A 2RDDA 1R0CB 3G87A 4FS1A 2XGQA 2WW8A 2ASLA 4LSLB 4LRAA 4DS4A 1H2TZ 2ZH5A 3OFGA 3CO0P 1NM2A 1RE1B 2ATLA 2DISA 2UU9F 2E1PA 4C0OC 2WK4A 4DPXA 1IBMF 2F7VA 1Q82T 1QAYA 2XBPA 3M1VB 1C4AA 1RTDB 2NSBA 1VQ6S 1U7LA 1RB0A 4LFAJ 3UQSA 4ZMMA 1K44A 3MEKA 4B3RJ 2O3DA 1HQUB 3R7NB 3N6MA 2CADA 1JKHB 4DI6A 1C0UB 3D5MA 3MAQA 5CXTA 2VQFF 1YWXA 1UW4A 3IM8A 1RCXB 4MKYA 1NB7A 2MHEA 2D41A 2GIQA 3IG1A 1WD6A 5GMKa 4AQYJ 1HFEL 4USJC 2BE9B 1KVIA 2XO6A 4F7VA 2RS2A 2MKHA 3W2WA 1IJEB 4J9RA 2RU3A 3IRWP 2QT7A 1S1VA 4FP9A 2CA9A 4P7TA 1DAXA 4PWUA 1GH8A 4ED4A 1N36J 3N79A 4EZ6A 1VGYA 3KHLA 2PEHA 3GFYA 4OHXA 3FSYA 1LW0A 3NRBA 3KKFA 3S1TA 3QJJA 1QVFR 3ZZZA 2JNJA 5HMZA 4N7TA 3KJFB 3OR1B 1R0BG 4PG8A 2F8MA 2SXLA 4NLUA 1RSCA 4OL8A 1Y5LB 3PW2A 1X4EA 2VOOA 1NAQA 5IT9U 2WSCC 2JEFA 1AFJA 2MKSA 3M7VA 5DG7A 3W64A 4MH8A 2HWIA 3IBWA 4NLOA 2XG8A 2BRLA 2NCKL 2DNLA 3OTOJ 3KK2B 4F0MA 4NX9A 4K0KJ 3G8QA 3TO8A 3KUEA 3KLIA 1DLOB 2ZWPA 1S6PB 4O23A 2IYIA 2O5DA 3G4SS 2VPZB 3AAWB 1AZSB 3D9BA 4FKXA 2HQCA 1RTHA 3J81j 2H5IB 2GVZA 2H5EA 4LFCF 5FDLA 2V67A 4V19X 3MM8A 2ZH8A 3BPSP 2MY8A 1V6HA 5A0YB 3SCLE 2GA7A 3W61A 3UFCX 2UXBJ 4DSFA 3H4BA 4JB8B 1S1TB 2CJ9A 4LSNB 3EUNA 4LF4F 4IR1A 3TARA 1RTIA 1KTVA 3IRXA 1N5QA 1H0HB 2AP6A 4UZBA 1IKVB 2RJZA 4ZCKA 1JLQA 3EDQB 5T41A 1Y00A 5B0EA 1QE1A 3LP1A 4B17A 5ETNA 5KFIA 4FXWA 1N0UA 1QTNB 1WDDA 5CD4A 2ZBPA 4KV8A 1MROA 1Q7YT 3CC2S 1T9VA 2DK2A 3W8GA 2EFNA 1HBOA 2H9ZA 2C2DA 3IP0A 3C15A 2VG5A 1JXEA 1EP4B 3Q8RB 5A8RB 4F3OA 1RKJA 2YWWA 3HJVA 2D3UA 1A0OB 1A9NB 4CTAA 3AQOA 3T5JA 2MKIA 5B0BA 2BW7A 4DFJA 2B8QA 4C8LA 4L74A 4FN5A 4PEOA 2HURA 1M5VC 2ZUGA 2W4CA 4YMEA 1P8GA 2BJ1A 2J9DA 2HQDA 2AZ3A 1NO8A 3MAAA 2XI2A 1VMBA 3MMBA 2JLGA 1S0OA 1JNRB 3MM6B 3OXFA 3VVUA 3H90A 2IDLA 4FDFA 4ECTA 2ZBCA 4DL5A 1T03A 4I1TA 4J7CA 3ZZTA 4B3MF 1NK9A 4WIIA 1ELOA 4K2JA 2JL9A 3KMSA 3M9OB 2VG6A 2QA2A 2KKHA 1TKXA 1GFWB 3DOKA 3HFZB 3VAKA 2Z2MA 2R42A 2ZOFA 1XMOF 1VQOS 3A8IA 4LMZA 2YY3A 1PYTA 4B9VA 1XR6A 4RWWA 3P49B 2GVDA 1BUXA 3CXCR 1AT1B 2DNZA 3Q8UA 4A46A 2YKPA 1NJZA 1Y5NB 4IG0A 3GJQB 2CPEA 1VBZA 4C0HA 1KWMA 4DMZA 3ELHA 4PUOB 2D1CA 3OXLA 1Q86T 2NR0A 3JQJA 2YNHB 1CC8A 1TVRA 2W2OP 2B5JB 2ZH7A 5K8OA 5FLXY 2FB0A 5KFTA 2DNPA 2XTJP 2EG2A 2DH8A 4DCJB 4B3TJ 2OI2A 5ETPA 1K0TA 2KHCA 7AT1B 4KRWA 1YBUA 1IR2A 2ACMA 4KPCA 1WTBA 3THPA 4IFYB 1FRJA 1FX4A 2XYHB 5E7OB 4PWDA 2YKQA 2CG8A 2LQ5A 3CUNA 4NYPA 3VQSA 4PZVA 3I87A 4NXNF 1Z2ZA 1NDCA 2HG4A 1B0VA 4DR4J 4P52A 2Q43A 3QT5A 1LEOA 3TJAA 2M8DB 2CJAA 2GGPA 2ZBRA 3JYTA 5LT5A 2MQOA 5E3RA 3B6BA 2AJFE 2YQ3A 2VU5A 5KOXA 3VQTA 3RAMA 4GO5X 1NK4A 3BKTA 1QTMA 3GPAA 2MZ1A 1X4AA 2CQ2A 1ZH5A 5JVGQ 2UVWA 4E98A 3ISND 4GMKA 1WC3A 3C19A 1Y4ZB 1S1UB 1UA0A 2CUYA 3V4IA 3SEOA 2QV6A 1Q8IA 4LUBA 3W60A 3M32B 3SSSA 3T1HF 1VQ5S 1KEKA 3T5HA 1F60B 2JVOA 2RRBA 3THVA 5LM7E 2W01A 2DRAA 2CFXA 3AQPA 4ZVQB 3W5XA 3KG0A 3PXGa 4AT1B 4MFBA 2I6WA 2PFDA 5DETA 4RL1A 4JI1F 1LWEA 2K7JA 3Q2SC 4ZVHA 1Y3KA 5KT3A 1RWPB 3BYRA 4OMFG 4LBIA 1B3TA 3J7AN 4OYWA 2WB1D 3I9ZA 4RO0A 3SSRA 1IBKJ 3EPGA 5IS2A 2XMUA 2Z58B 2BM0A 3BH7B 2MLZA 2CJQA 5J2NB 5F8GA 2ACYA 1FO1A 3ENAA 9RUBA 2EWHA 2DIUA 4H4MB 2DBBA 3FEXB 4QBUA 2Z30B 4ECXA 1T95A 5IC4B 2AJ2A 4Z7YA 4JUZA 2EFOA 2FPHX 5KFOA 3R5DA 2IMWP 4G1IA 3NBPA 5C2CA 4IUFA 1FFGB 2ZM6F 3HSJA 3CCUS 1KOHA 2QFIA 1WSRA 3B82A 4ZJLA 3PG9A 2GV1A 1H74A 2H48B 2DO0A 2K1RB 1VQ4S 4JI5J 2HFSA 1RT5B 2OSRA 2ZH9A 4ZPCA 1XERA 2LEBA 4MAKA 3Q8QB 4NLVA 4A8XA 1C4CA 1C1CB 2BKNA 2BJEA 2CZVC 3RBXA 1HKAA 2HBZB 2W4PA 3MEDB 1WEYA 4I6WA 3V6JA 2ZC4A 1NHUA 4DR7J 1U1PA 5C42A 2CPZA 2XLKA 3TP2A 1AA1B 1H7XA 2O01C 1MMDA 3NWRA 2WBRA 3MMAA 3TUIC 4DPYA 3DDNA 2AMCB 2PI4A 4NLSA 2ZH3A 2AEJA 2HPUA 4YEAA 2CQ1A 1TAQA 3DI6B 2B0GA 4QU6A 3DFEA 1HWLA 3WC2A 1VRQC 4OLOA 1JQGA 5KFWA 3UW1A 2QN6B 2RQ4A 5DM7Q 2H5JB 1JLGA 3QAUA 2LECA 2LKZA 3MD3A 3U1LA 1LK7A 4A47A 1S7IA 2HVIA 1Q95G 2APOA 2QMUB 3LANA 2GIRA 1TUVA 2AZ1A 3HZEA 1VRUB 1TELA 2MEWA 2XMKA 3OTDA 3PRBA 3ETOA 1T9YA 4J91A 3H2LA 4OYIA 5K20B 3IBFB 3UI3A 3OQ2A 3QQCD 3D3CJ 1Y11A 2PEBA 4QYZK 4DHVA 5E3CA 5A8WB 4J9MA 3DLKB 4ZCLA 4A4JA 2F9DA 1XJWB 3AJ1A 3MR3A 1U25A 3ULHA 1GTHA 5D15A 4C8OA 5D3GA 5HANA 2EK6A 2VOPA 2IFXA 1VBYA 1J5OB 5KFRA 1XMQJ 4B08A 2QX0A 2AEFA 3HX9A 5EX0A 5JVHQ 2EW9A 1TU0B 2QA4S 2P2CB 2OEMA 1G7CB 3D3BJ 3T1YF 3EE3A 3KHHA 2AX0A 4HHJA 3W2VA 1VC5A 4KGVB 3LF0A 1FX2A 2BEFA 5KAKA 2OH2A 1FWPA 4U9RA 4OZNA 2HW3A 2ZDOA 2CQBA 2CPXA 3UR0A 1TFYA 1YBAA 3MTJA 2F40A 2BM1A 1S0MA 1YVFA 4DU8A 2FGOA 2AHOB 2HEKA 2VC1A 1G4CA 1RAOA 3NAHA 5KT5A 2ASDA 2YX7A 5DGBA 3UDEA 2RRNA 3PNIA 3IS9B 5A8KB 3ZNJ1 5BR8J 3RAQA 1PBAA 2RB7A 4G3IA 2MDAA 3DYAA 3BSNA 2FJEB 4HTIA 3R5JB 2R8JA 1UVNA 2W8KA 5KFNA 4RR5A 4IFVB 1URRA 2MJNA 3L7UA 3S6EA 1UKUA 4ES1A 1IBCB 1OPIA 3KLEA 4MMOA 3AOCA 4LF2A 4X2BA 4F36A 5E33A 4KTQA 4WKYA 3LGNA 1YITS 1OIAA 4DDFA 4DQSA 4I67A 3D28A 4IOCQ 5JXSA 1QDUB 2ZH4A 2AU0A 5HP1B 1FNOA 4NYZA 2HFUA 2HMIB 2R2RA 3L4BC 3MM5B 2XS2A 4YB6A 5ETRA 1SKWA 4WYWA 4DV5F 1IN0A 1VHIA 3R1HA 2R8IA 1VQNS 3HSGA 4AFFA 4K7QA 1R43A 3MEEA 1FWKA 1SC6A 4USVA 2GFFA 2CDRB 2VICA 3U1NA 2XMVA 1RWVB 1IKXA 3CB4A 3ENQA 2ASYA 5CD4H 2C3PA 3V81B 1ZZFA 2FJXA 2PSZA 4NEYA 4DN9A 1UWBB 2LEPA 4CLFA 4DV3F 3NAIA 4LRCA 2P9EA 5IT4A 2UV8G 4U7UD 3QRPA 1HPZB 1IM6A 3RRGA 1KLMA 4ENOA 2MLYA 2KG0A 1TQLA 1VJWA 4C8ZA 2HS3A 3FFIB 4GRSA 3QIPB 5D6GA 1Y3JA 3RBEA 2XY6A 3HVRA 2AW0A 1R89A 3DOMB 3CCSS 1GEHA 5FLXU 3FEZA 2FUG9 4Y0FA 2OD4A 4OQJA 2HGMA 5I3UB 2RMLA 3TWZA 1C1BA 4M5MA 4EGLA 2XS5A 2OPRA 5CAAA 3EGZA 3EZUA 3P96A 1TR0A 5GVQA 3ZTRA 3K89A 5C5JA 1DQ8A 2B6AA 3N9UC 3W5ZA 2ZNYA 1CEZA 4ZVOB 1S7HA 2KYXA 4QR1A 1I94F 2JFKA 2IM1A 1UVKA 3IGNA 4RBVA 2Q3PA 9ATCB 4JV0A 3VVTA 4NI2B 3PFOA 1F3VA 1S9EA 1ACMB 1WEZA 3M30A 3I5CA 2Y8WA 3TJ8A 2VBYA 4QIWD 1B70B 4CO5A 1XNQJ 2ASJA 1DTQB 2IRUA 3GG1A 3C2PA 1IBLJ 3F56A 1H7WA 2YKNA 3FCHA 1YLXA 1XK8A 1VJQA 1FJGJ 5KFZA 1LWFA 1R8HA 2BXJA 3GJTB 3MOZA 1Q1KA 3NGRA 2YWEA 2FLPA 4LF8J 2UUCF 3A3OB 3SQGA 2QG9B 4C7QA 3H5YA 4OI6A 3TA0A 4CDIA 1TMJA 4RNHA 3O8WA 2FC9A 4FYYB 2NXNA 1U2FA 2BANA 4DL0C 4L76A 2LVWA 3ZZUA 1Q5YA 2HVDA 2DCLA 8ATCB 5D77A 4P75A 4E2FB 4Y28C 1NJIT 4USKA 2ZVSA 2AJQA 3G6XA 1OYDA 1RLDA 4N56A 1KN6A 3IFEA 3G71S 5SUHA 2V8GA 1BWEA 4KB7A 5A2QY 4LSLA 3DDIA 3ETMA 1RAHB 4DV2J 3DM2B 3M4XA 3MM7B 3BQ2A 2DH7A 1XC9A 3G86A 2DGVA 4K4VA 2RU9A 4FNHA 4YY3F 1VIOA 4KR0B 3TOQA 3UDCA 1IKWA 3TZYA 3M1VA 1RTDA 2AYBA 1DZ5A 1UW9A 2R2UA 1N56A 2HNZB 3J7Z5 1LWXA 1HW9A 1HQUA 3NMAA 4OI0A 3MFIA 1VQ9S 2XZDB 4IDKB 5H9EJ 1JKHA 1C0UA 2DNMA 3MPDA 3MZIA 2HHWA 1MSWD 2GAHC 2DNYA 2CQDA 1FE4A 4H4KA 3DRXA 4F4XA 1BQMB 4QIVA 1Q4RA 2HNDB 2BBEA 4LFBF 4L3NA 3FBEA 2YPYA 3QLHB 1FHTA 1OY9A 4LQ9A 3K57A 2JEIA 5EWGA 1HNZF 4J9OA 2EK1A 3D4JA 3TW0A 4TU8A 4AXJA 2LCWA 3JTPA 4PYAA 3IM9A 4Q43A 3EZOA 1OYEA 1ZTWA 2YBVA 2FC8A 2W9BA 3OR1A 5HMXA 2HFZA 3V5RA 2XLJA 4U95A 1FTCA 4IOAQ 4R5PB 1KC8T 2OUGA 1UFLA 3BDEA 1V9OA 2G2YA 2LQBA 2ZKTA 4ED1A 4FYXB 2IAJB 4ZVRB 2MZQA 1CULB 4ANCA 3TUPA 1YRXA 3OL9A 2J7UA 4DQRA 1DHMA 5HJXA 3RAXA 2CPYA 4BLGA 2Y3YA 2OEKA 1R3NA 4U7CA 1LNQA 1HWIA 3KK2A 1U6FA 2XMAA 1DLOA 2CDQA 2KVIA 1S6PA 1SXLA 5DDRC 1HNWJ 3R5GA 3KOAA 1AZSA 1RBOB 2Y1RI 4PXEA 3ZTPA 4KAIA 2VJUA 5AE2A 3KLHB
chains in the Genus database with same CATH topology
2AZ3A 3VGUA 3L7UA 4ANEA 1XIQA 5C7PA 1S57A 1KDNA 4CP5A 1NDLA 4ENOA 1JXVA 3DDIA 1HIYA 1NCLA 3ETMA 3WX8A 1F6TA 4DUTA 1U8WA 3VVUA 4HR2A 4UOFA 2ZUAA 3EVMA 4KPCA 3NGTA 4F36A 3FC9A 3EE3A 1NB2A 4F4AA 1F3FA 1S5ZA 3Q8YA 1NDPA 3EMTA 3ZTQA 3G2XA 2DY9A 1NUEA 2CWKA 1BE4A 3VGTA 3BBCA 1NHKL 3ZTOA 2BEFA 2DXEA 1S59A 3FCWA 3BBFA 1B99A 1K44A 3Q89A 4S0MA 1WKLA 1NDCA 2AZ1A 1NSPA 1NPKA 3EJMA 5CAAA 3FBCA 3NGRA 4UOHA 1LEOA 3BBBA 1LWXA 2DYAA 3NGUA 4DI6A 3ZTRA 4ANCA 3ZTSA 1NSQA 1HHQA 5IOLA 1WKKA 5CABA 3B54A 3EVWA 3R9LA 2NCKL 1WKJA 4W98A 4EK2A 1W7WA 3B6BA 3BH6B 1BUXA 2HVEA 3NGSA 3FCVA 3MPDA 3Q8UA 3VGSA 1PAEX 1NLKL 4UOGA 3Q83A 2VU5A 4ANDA 3BH7B 3GP9A 2HVDA 3ENAA 3ELHA 1HLWA 3EICA 3JS9A 3EVOA 3GPAA 5BXIA 1MN9A 2DXDA 1NDKA 1ZS6A 2BX6A 1NSKL 2B8QA 4DZ6A 3VVTA 4FKXA 1BHNA 2DXFA 1B4SA 2HURA 4O0NA 4WBFA 1PKUA 3FKBA 3Q8VA 1VYAA 3PJ9A 3EM1A 3FBFA 3FBEA 4C6AA 4FKYA 3DKDA 3Q86A 1UCNA 3ZTPA 3VGVA 2B8PA 1EHWA 3FBBA 1MN7A 1XQIA 3PRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZ3 A;  3VGU A;  3L7U A;  4ANE A;  1XIQ A;  5C7P A;  1S57 A;  1KDN A;  4CP5 A;  1NDL A;  4ENO A;  1JXV A;  3DDI A;  1HIY A;  1NCL A;  3ETM A;  3WX8 A;  1F6T A;  4DUT A;  1U8W A;  3VVU A;  4HR2 A;  4UOF A;  2ZUA A;  3EVM A;  4KPC A;  3NGT A;  4F36 A;  3FC9 A;  3EE3 A;  1NB2 A;  4F4A A;  1F3F A;  1S5Z A;  3Q8Y A;  1NDP A;  3EMT A;  3ZTQ A;  3G2X A;  2DY9 A;  1NUE A;  2CWK A;  1BE4 A;  3VGT A;  3BBC A;  1NHK L;  3ZTO A;  2BEF A;  2DXE A;  1S59 A;  3FCW A;  3BBF A;  1B99 A;  1K44 A;  3Q89 A;  4S0M A;  1WKL A;  1NDC A;  2AZ1 A;  1NSP A;  1NPK A;  3EJM A;  5CAA A;  3FBC A;  3NGR A;  4UOH A;  1LEO A;  3BBB A;  1LWX A;  2DYA A;  3NGU A;  4DI6 A;  3ZTR A;  4ANC A;  3ZTS A;  1NSQ A;  1HHQ A;  5IOL A;  1WKK A;  5CAB A;  3B54 A;  3EVW A;  3R9L A;  2NCK L;  1WKJ A;  4W98 A;  4EK2 A;  1W7W A;  3B6B A;  3BH6 B;  1BUX A;  2HVE A;  3NGS A;  3FCV A;  3MPD A;  3Q8U A;  3VGS A;  1PAE X;  1NLK L;  4UOG A;  3Q83 A;  2VU5 A;  4AND A;  3BH7 B;  3GP9 A;  2HVD A;  3ENA A;  3ELH A;  1HLW A;  3EIC A;  3JS9 A;  3EVO A;  3GPA A;  5BXI A;  1MN9 A;  2DXD A;  1NDK A;  1ZS6 A;  2BX6 A;  1NSK L;  2B8Q A;  4DZ6 A;  3VVT A;  4FKX A;  1BHN A;  2DXF A;  1B4S A;  2HUR A;  4O0N A;  4WBF A;  1PKU A;  3FKB A;  3Q8V A;  1VYA A;  3PJ9 A;  3EM1 A;  3FBF A;  3FBE A;  4C6A A;  4FKY A;  3DKD A;  3Q86 A;  1UCN A;  3ZTP A;  3VGV A;  2B8P A;  1EHW A;  3FBB A;  1MN7 A;  1XQI A;  3PRV A; 
#chains in the Genus database with same CATH topology
 4DWI A;  1CLF A;  3MUV P;  3JSM B;  3OVA A;  1MW7 A;  5A0Y A;  1AUD A;  3G82 B;  4F4A A;  3K8W A;  1S5Z A;  4OYZ A;  4ZJO A;  1U0H B;  2DEJ A;  1S1T A;  2V6A A;  5IV4 A;  4LVO P;  5KG0 A;  3D54 A;  1GNK A;  3PYG A;  4YQW A;  2M88 A;  4LF6 J;  2DNO A;  3GU0 A;  2ERR A;  5K8P A;  4R8U B;  2X51 A;  4AE5 A;  4V19 J;  3M2V B;  1PSD A;  2PC6 A;  4EEY A;  4CZC A;  2HRU A;  1VOM A;  4PXC A;  4IR9 A;  5C25 B;  4DR2 J;  4J90 A;  2AWZ A;  4C3L A;  4LR9 A;  1FEE A;  1U6Z A;  3O44 A;  3OT9 A;  4P6Q A;  2Y1L B;  2BE2 A;  3C6U B;  2GML A;  4YUD A;  3K0J A;  4FBU A;  4DQI A;  2MZS A;  4WYL A;  4KYZ A;  3X3U A;  3EIC A;  1YX2 A;  5A8R A;  5D4P A;  4DR6 F;  4YN3 B;  2RQM A;  5IWA J;  1S9F A;  1U48 A;  1OWX A;  4DV0 J;  4G1P A;  2ZKU A;  4RKU C;  4KHP J;  1PGZ A;  5BYQ A;  5LSR A;  3F44 A;  2FVR A;  4NML A;  3GV7 B;  4DPT A;  2NSC A;  2ROE A;  2Y1I A;  1KFS A;  3OXG A;  2HGN A;  2J8S A;  4JYA F;  1NDL A;  4YFU A;  3HFV A;  1OY8 A;  3M8P B;  3CCL S;  2MQL A;  3UNY A;  3L7O A;  4U7U K;  3MM6 A;  1TK5 A;  2N3L A;  1SH3 A;  3DRR A;  2FQQ B;  5HSP A;  1WI8 A;  2DXE A;  2R2S A;  3S8S A;  1FRX A;  4N8N A;  1KVK A;  1F5B A;  1GMW A;  4JP8 A;  1WC6 A;  4ZDN A;  1B7F A;  4LF7 J;  3R5B A;  2I38 A;  4BDP A;  2ZWO A;  2HIQ A;  4ZHR A;  2O67 A;  2KRB A;  3SBM A;  5I42 B;  1EQ0 A;  4RW6 B;  1GK8 A;  2FYX A;  1X5P A;  3SI8 A;  3QGP A;  3RBZ A;  5DG8 A;  3CUL A;  2GIF A;  5KFH A;  5LXY A;  4DL2 A;  3OBI A;  1NSK L;  2IDE A;  4PUO A;  3A8E A;  1JLA B;  2DGQ A;  1A6L A;  1R27 B;  3UNG C;  1H6K X;  3IWN C;  2EC0 A;  3H2V E;  1S1X B;  2B5J A;  3KDO A;  3UCG A;  3QFH A;  4CLL A;  5L8R C;  3E01 B;  3EGN A;  5GAH U;  3ZFV A;  4MK9 A;  3JB9 k;  1HQE B;  2R7U A;  1KON A;  2Q66 A;  2VON A;  5HJY A;  3ZTQ A;  4ZJQ A;  4IFY A;  1REG X;  5AJ3 F;  3PW5 A;  2C1E B;  2QMW A;  2E5L J;  2CPF A;  2V8V A;  3AD9 C;  5EX3 A;  3LAM A;  4QWA A;  1RZM A;  3TAM B;  4FYD A;  1WNE A;  1SUQ B;  4QW8 A;  4K4T A;  3GIM A;  4NWB A;  4QW9 A;  4PQU B;  4NLW A;  1RTH B;  3OUY B;  2HBY B;  4DSI A;  4DOZ A;  5J2Q B;  4XPC A;  1PJ6 A;  2HRT A;  4I2Q A;  1BD6 A;  2BQU A;  2UXD F;  2FZC B;  3W9H A;  1ZS6 A;  4ZPB A;  2RE1 A;  1HR0 F;  2F4V J;  1B4S A;  1RTI B;  3W62 A;  4FKY A;  3PTW A;  4DL7 A;  4Q5V A;  4EI2 A;  2QSF A;  1VRT B;  1S1U A;  2XZT B;  3W9J A;  4YB7 A;  1U1O A;  2RQK A;  2CQ0 A;  3M8Y A;  1L5U A;  1M5H A;  3CIZ A;  4KV8 B;  3M32 A;  5IC6 B;  2BJD A;  4DEZ A;  1HBO B;  3VGT A;  1IXK A;  3C15 B;  2VB6 A;  1D09 B;  2VG5 B;  4OYA A;  2HHX A;  2JFD A;  2RHS B;  1TUW A;  3HKW A;  2RUG A;  4F0H A;  4CTA B;  1FJE B;  4U8V A;  3SDE B;  3S01 A;  3QSY B;  2KN4 A;  5JUM A;  2B9E A;  4V1A k;  3FRY A;  4M5I A;  4M8L A;  2RS8 A;  5LJ3 Y;  1Q8K A;  1IVZ A;  3HP6 A;  3T19 A;  2FJD B;  4HHU A;  2KFN A;  2J0X A;  2PA8 D;  4UOG A;  4YHH J;  1S4F A;  3FMW A;  1HNV B;  4IOB A;  3EVO A;  2CZ9 A;  1D3W A;  5J2N A;  4MYT A;  3O3L A;  1T03 B;  4H4M A;  5F0W A;  4PPZ A;  3DXB A;  4DSJ A;  3H42 A;  3FBB A;  1MN7 A;  4DX7 A;  3HT0 A;  1SL0 A;  2D9P A;  3DRP B;  3EYZ A;  4ID8 A;  2KFZ A;  2VG6 B;  4RUB A;  1TKX B;  2DD8 S;  3DOK B;  4CLU A;  2G1D A;  1VLO A;  2IHR 1;  2ZHO A;  1UEU A;  5LMU J;  3H20 A;  2MKK A;  2GVD B;  4X66 F;  4DR5 J;  1O5J A;  2EKY A;  4OYB A;  2VHG A;  1IUJ A;  1DAR A;  1R8C A;  3O5T B;  3Q89 A;  3S7R A;  2K1R A;  1PC4 A;  2WZ1 A;  1FRK A;  1PBU A;  4PXB A;  1PYS B;  1RT5 A;  3B4D A;  2DHX A;  4AQY F;  5A2Q U;  2XCA A;  2GO8 A;  4N8O A;  2HKE A;  1FKA F;  2NXC A;  1MLA A;  1Q8B A;  4WF9 Q;  3NGK A;  1N6Q B;  1R6V A;  1C1C A;  5AXM A;  5HVF A;  5L38 A;  2LQ8 A;  2BAC A;  1RP5 A;  1AXQ A;  4NCG B;  2VFU A;  4LRF A;  4CNY A;  2NXU A;  4PG4 A;  2E5H A;  2VA2 A;  3US5 A;  2OSQ A;  4RW8 B;  2AYE A;  2UP1 A;  1LOU A;  1QSS A;  3LP0 A;  2AGQ A;  2QEX S;  1FKP B;  4PWD B;  3PJ9 A;  4OI2 A;  3X1L B;  4UT4 A;  2G9O A;  2OPP B;  3K58 A;  1ZM3 A;  3HCX A;  2G0I A;  3SQO P;  2KL8 A;  3DI6 A;  1JK9 B;  3H4D A;  3UD4 P;  3TNV A;  2QA4 G;  3I32 A;  3BO4 A;  1HNI A;  1IWG A;  3MUM P;  2Q1L A;  2KH9 A;  5FII A;  2GJ2 A;  4EMD A;  3PO5 A;  3D0H E;  2DT9 A;  2OIH A;  3HMJ G;  2QGF B;  3CCQ S;  4JI3 J;  1VRU A;  1G1X A;  3CCR S;  4Y2A A;  4KGX B;  1ZPW X;  1T02 A;  3J7Z T;  2HYI B;  4JI0 F;  1UET A;  2VZ9 A;  3EX7 B;  4ETX A;  2D3Z A;  1E6Y B;  1TMM A;  3IBC B;  2UU9 J;  3FQL A;  4ED6 A;  1HL6 A;  2GW8 A;  2N82 B;  2FJA B;  4DPO A;  1K1S A;  3MPU B;  3SCI E;  3DLE B;  2UXB F;  1CJK A;  5A8W A;  4ICL B;  3DLK A;  4I6Y A;  5KFL A;  2BJ8 A;  2W1B A;  4DSE A;  4M5H A;  1EHW A;  1X5T A;  3BSC A;  1VQK S;  3M8Z A;  5J1N A;  1J5O A;  2J0Q D;  4MFB B;  3AA9 A;  2OLW A;  4ED8 A;  3JSR A;  1EET B;  1H38 A;  2ZZM A;  5ETK A;  1LWE B;  2DIV A;  1NHK L;  1R8B A;  3R3T A;  3BBF A;  2NRE A;  3PRD A;  5D0H A;  3QRQ A;  2ZDP A;  4CO1 A;  2UVU A;  1FE0 A;  3FNN A;  3EZ5 A;  2LEA A;  3W7B A;  2ZH6 A;  2IPO B;  2EEY A;  1UL3 A;  2VPX B;  4EFA C;  4OLP A;  1ZA2 B;  5HMW A;  1VR6 A;  2KB2 A;  2BOA A;  2KO1 A;  1W7W A;  4C11 B;  2XCP A;  4ZCI A;  4GKJ F;  4HEA 9;  1K0V A;  3NBP B;  4C9D A;  4TYB A;  1TL7 B;  2V9W A;  4DXL A;  3IS9 A;  5A8K A;  3CE8 A;  3EXC X;  4DLE A;  2UZA A;  3GYN A;  3MEC B;  3BQ1 A;  2QYG A;  5KFU A;  1FD8 A;  4CH0 S;  2R7T A;  1U2C A;  1L3T A;  1S48 A;  3VGU A;  3ZNU A;  4KIA A;  2JEJ A;  4I69 A;  4Q0B B;  5B0F A;  3PAC A;  5A6P A;  2I1R A;  4IFV A;  3WIV A;  2FD2 A;  3D2W A;  2DKO B;  4ECZ A;  4UOC A;  3L9Z A;  1UJ5 A;  5DO2 A;  5IV3 A;  1NUE A;  2CNN B;  1N5T A;  3V4M A;  3HVW A;  2V4R A;  3CTR A;  1N34 F;  4OZ3 A;  1T05 B;  1U0S A;  3FEY B;  3A4T A;  4KY3 A;  5HP1 A;  4LFC J;  4UW2 A;  1V3S A;  5DDO C;  2HMI A;  2LP4 A;  3MM5 A;  3VZH A;  3BN7 A;  3CD7 A;  4K4Y A;  1B7Y B;  4RX6 A;  2V8D A;  4NXM J;  3MMA B;  4QJV A;  4FYW B;  2LXF A;  4ZKA A;  4CI0 B;  5A6W A;  5IT9 Y;  4IQM A;  2KZZ A;  3M2U B;  2V34 A;  2YWF A;  2CVI A;  4A8M P;  4J9S A;  4DR1 F;  2CJB A;  1CJU B;  3V81 A;  4ID5 B;  1JLG B;  3BR9 A;  2LDI A;  2PT0 A;  5DZ7 A;  3BZQ A;  1TV6 B;  1UWB A;  3IR7 B;  1M1G A;  1XEZ A;  2DRB A;  1S99 A;  1M5S A;  4JI8 F;  4OZ1 A;  4TU9 A;  5LMN J;  3EDR B;  1HI8 A;  5F3T A;  4DR4 F;  1HPZ A;  4OJ3 A;  3EVM A;  3VWS A;  1EB0 A;  5M2P A;  1FXD A;  5CQG A;  3BRE A;  1S10 A;  4C8N A;  3FFI A;  2H65 B;  2HLU A;  1M5P C;  3FZ2 A;  3QIP A;  1KSP A;  1KOO A;  3MMJ A;  5I3U A;  2YWG A;  1OSC A;  2E7V A;  1V3Z A;  4JI2 J;  2OPQ B;  4RPF A;  3BN4 A;  4ZLL A;  2L08 A;  4JI4 F;  3PEJ A;  1VK8 A;  4FNI A;  3D1O A;  2LXI A;  2AD9 A;  1MNE A;  2R7S A;  5GME A;  2CJK A;  3GG0 A;  3U27 A;  2G0C A;  4I7F B;  4I64 A;  5F8J A;  3H5U A;  1SPB P;  2CVE A;  1X4G A;  3Q23 A;  2JLE A;  3TZX A;  4NI2 A;  3QWP A;  5F8L A;  4LF5 J;  3OVS A;  2AGP A;  3I0R B;  4J9L A;  2V4J B;  1XMO J;  3DRS B;  3J80 Y;  1PIE A;  4P2M A;  1YJV A;  2HFO A;  3LA0 A;  1RAB B;  4NCA A;  2B3T B;  3HLU A;  1NB2 A;  1MWY A;  1RWU A;  3IN5 A;  1VQY A;  2YQ1 A;  1QVG R;  2POK A;  5H9F J;  1WKL A;  4DUY F;  2OEL A;  2X7I A;  1RWK B;  2X1F A;  2LQ9 A;  4UOH A;  5CA5 A;  1M1K T;  1ZM2 A;  3DYA B;  3NS5 A;  3ZC4 A;  2C28 A;  1UVI A;  2QO3 A;  4I4B A;  3R2C J;  3RW6 A;  1C0T B;  4DN0 A;  1LV5 A;  2HVE A;  1D0E A;  1MMN A;  4KQZ A;  1DTT A;  4LIW A;  3M8R A;  5ETM A;  2HHS A;  1UPM B;  2VH7 A;  3R8Y A;  5IZH A;  3KTQ A;  3RB3 A;  4ZOS A;  3BQ0 A;  4WE1 A;  5K8M A;  1JLB B;  4M5J A;  4ZN3 A;  2HBQ B;  3CW2 C;  2RRA A;  3VAI A;  3TEH B;  4JI5 F;  3ISN C;  1VQ8 S;  2B4U A;  1QJH A;  4KO0 B;  3KJV B;  2ZH1 A;  2W9A A;  3NGT A;  2WW4 A;  5AE1 A;  1F2H A;  3DM2 A;  3MM7 A;  1YJ7 A;  1FDD A;  2VPW B;  3GJR B;  2K7K A;  1HNX F;  1T9X A;  3MHY A;  2Y1J A;  2IBK A;  1SCJ B;  2ATC B;  3I31 A;  4X4U A;  3OD2 A;  1VK3 A;  3GFH A;  4ED5 A;  4UQT A;  4M5G A;  3M9N B;  1HW8 A;  4ED3 A;  4WWS A;  2DHH A;  4EO6 A;  4ZP6 A;  2HNZ A;  2IJR A;  3D6M B;  3NNH A;  4IDK A;  3VGS A;  4H54 A;  1FKO B;  1D1U A;  1KQS R;  3UO0 A;  4AL7 A;  4JV2 A;  3JAM U;  2JOQ A;  4MYU A;  4OZL A;  1JLF B;  1NJW A;  2BVZ A;  3TYT A;  3CCJ S;  1BQM A;  3LPY A;  3E8O A;  2HND A;  2NXJ A;  3VAG A;  1RAA B;  2L3M A;  2E1A A;  2E9R X;  2A6O A;  5C7P A;  1BY9 A;  3MM9 A;  2QZ8 A;  2R7W A;  2C3O A;  2OPR B;  3CDA A;  1YBT A;  3PIO Q;  1TTH B;  5CZX A;  2YWH A;  1NDP A;  1C2P A;  6FD1 A;  2B6A B;  2MHN A;  3FRZ A;  5B0D A;  1XWL A;  1TAU A;  2K2P A;  2VD3 A;  4EU0 A;  2ZOM A;  2EI5 A;  3R6G B;  2EBE A;  1RAJ A;  4W4M A;  3MUR P;  1I3O B;  1WC4 A;  3Q24 A;  3V6H A;  4R5P A;  1QY7 A;  2OPS A;  3OTE A;  1V5V A;  1YRT A;  4YDD B;  3HK2 A;  2LFV A;  1U4B A;  3KLG B;  2ZM6 J;  4WXW A;  1X8D A;  4CQ1 A;  2DNG A;  1RU1 A;  2HQG A;  3BYP A;  4Q2L A;  2Z0G A;  1KNZ A;  3H98 A;  2MQM A;  1S0V A;  4LRD A;  1NSA A;  4ZLP A;  2JDJ A;  2CG4 A;  3K5M A;  2R3V A;  1S6Q B;  3L3C A;  4FS2 A;  2DNN A;  4WKR A;  1U8S A;  2C2K B;  4XK8 C;  3KFW X;  2RUS A;  1NK6 A;  2YTC A;  4WFB Q;  2J6U A;  1S1W B;  1ZPV A;  3KLH A;  3RTV A;  2VJV A;  5IM0 B;  5DDP C;  3JSM A;  1YJ9 S;  4XPE A;  3I5A A;  3SQG B;  5LXR A;  4JV1 A;  3W63 A;  5B0A A;  2DPI A;  2PFF B;  3G82 A;  2AGO A;  3OHB A;  4B9S A;  3GCW P;  3QAE A;  4DQP A;  4LRE A;  2D69 A;  2ROP A;  3PYE A;  5BR8 F;  4R8U A;  4I56 A;  3M2V A;  5C25 A;  4WU2 A;  3DLJ A;  4ZIT A;  4DV6 F;  4TKT A;  1OS5 A;  2BDP A;  2U2F A;  3FCV A;  5EWF A;  2G1H A;  2QRR A;  3C6U A;  1SIW B;  5DQG A;  2CYY A;  3U7J A;  1EIY B;  3RGI A;  1PCA A;  4QYR A;  4FVM A;  4UF4 A;  3A13 A;  1EAR A;  2N3O A;  3MF5 A;  3GZ7 A;  4WBF A;  4NLD A;  3BDP A;  2QLF B;  3C14 B;  5DGA A;  1IKW B;  3PFE A;  2KT2 A;  3MAH A;  1NJY A;  3T6B A;  3AB4 B;  1CJT B;  4DSL A;  1XN9 A;  3N6L A;  1MU2 A;  2WSE C;  4UST A;  4RUH A;  4M63 A;  3DGP B;  2RT3 A;  2KI2 A;  4P71 A;  3M8P A;  3MR2 A;  2UUT A;  4F02 A;  4X62 F;  3AOA A;  2NLW A;  4A8K A;  4NA2 A;  5HAT A;  4B9T A;  3RZA A;  3CD5 A;  1UP1 A;  2DO4 A;  5DRK A;  3WZ0 A;  3AHP A;  4URS A;  5GAG I;  4ED0 A;  4DUZ F;  2E66 A;  3LWM A;  3ZTS A;  3UWT A;  4DR3 F;  4X4T A;  3M2R A;  5I42 A;  4RW6 A;  1F0X A;  2DY1 A;  1F9F A;  3TAQ A;  4BS2 A;  3OSN A;  5JMN A;  2N7C A;  1SJQ A;  5ADZ A;  5KG4 A;  5E41 A;  1BQN B;  1SJR A;  3IWX A;  1GXU A;  2W9B B;  4DF4 A;  1RT4 B;  1JLA A;  3PEH A;  2GS8 A;  2DH9 A;  2L48 A;  1UVL A;  2DNQ A;  2Z56 B;  4IKA A;  4MT1 A;  1S1X A;  2FIU A;  4G1Q B;  4CP5 A;  3I82 A;  1Q16 B;  3E01 A;  4Q44 A;  3K17 A;  5GMD A;  1J27 A;  3GSI A;  4BBY A;  1HYS A;  1HQE A;  7FDR A;  4O4G B;  2DGS A;  5KFC A;  2RHQ B;  3ONQ A;  1W26 A;  2JJ4 D;  3I5B A;  2K3K A;  3FGV A;  3AJ2 A;  2GAG C;  5KG7 A;  2GQQ A;  2QIF A;  2A10 A;  3B78 A;  3N4W A;  3NKY A;  5LL6 d;  2HS0 A;  2F8H A;  3TQE A;  3CDU A;  4MIW A;  2V2V A;  3BJY A;  2YKA A;  4OHZ A;  2V94 A;  3TAM A;  1VQP S;  1SUQ A;  4K4X A;  1YJN S;  2M52 A;  3DDK A;  4PQU A;  3BGR B;  5B09 A;  3LQV A;  4KT0 C;  3OUY A;  4QWB A;  1T94 A;  2DHG A;  2KDO A;  2IA6 A;  5J2Q A;  3K5L A;  1WHY A;  3F0N A;  2BRK A;  4LBH A;  5J2M A;  2J7K A;  3FQK A;  1RCO B;  1DY3 A;  1GMW D;  1RT2 A;  4P7V A;  4J9V A;  2YXL A;  2NPF A;  1CS4 A;  2PD1 A;  3CCM S;  3PRV A;  1RYS A;  1ZAW A;  4CYU B;  1CBK A;  2E9T A;  1FJG F;  4DV5 J;  2DCU B;  1VRT A;  2H3E B;  1M90 T;  3R7B B;  4Z7C A;  2JC1 A;  2D9O A;  4FXD A;  4ZIV A;  4IRK A;  2MGZ B;  2HWT A;  3UN2 A;  3R2D J;  2BE2 B;  3PIP Q;  2VQE F;  4CT9 A;  2LYV A;  4GVB B;  3MPY A;  1IR0 A;  1RWX B;  4WK1 A;  5KFG A;  1U49 A;  1O0P A;  5ETV A;  5C24 B;  3NNC A;  2J6T A;  2B9W A;  3EPI A;  2XYG B;  1S6O A;  3J80 U;  3JQM A;  1APS A;  1YGY A;  4PCQ A;  3SDE A;  5HQL A;  5E3A A;  5F8H A;  3VR1 A;  4K4Z A;  3T5L A;  1KQK A;  5K8N A;  4MK8 A;  2B51 A;  2BV3 A;  2B4V A;  4DV2 F;  1BGX T;  1HNV A;  2RIJ A;  4CWB A;  4J9N A;  3GJS B;  2MST A;  3DRR B;  2CQG A;  2NS1 B;  4OZJ A;  4DL6 A;  1YRU A;  4Q8E A;  3SMZ A;  1Q79 A;  2WB4 A;  1W25 A;  1LK5 A;  3TA2 A;  4M5N A;  4WFZ A;  2JX2 A;  3BKU A;  2IM3 A;  3DRP A;  1D8Z A;  3CD6 S;  3BV8 A;  3CJ4 A;  3BGF A;  1RLC L;  3SFG A;  5LJ5 Y;  4ZHR B;  4X4P A;  2YKO A;  1I94 J;  1UJ4 A;  4LF1 A;  5B0C A;  3A1Y G;  1RT7 B;  3DLG B;  4PG7 A;  1NKC A;  4ZPT R;  1RBL A;  2ZOG A;  3NGU A;  1ZZN A;  1FT8 A;  3R27 A;  1UFK A;  1SI9 A;  3HKZ D;  1NSQ A;  1HHQ A;  2ZHA A;  2A1B A;  4ELU A;  3H40 A;  1N6Q A;  2ILZ A;  4IRD A;  4QWC A;  1VLY A;  3PR4 A;  4X4Q A;  2MTL A;  1MWQ A;  4NCG A;  1K9M T;  3FK4 A;  4KGK A;  4UY8 5;  2HFV A;  4RW8 A;  5EDW A;  2HHV A;  3OHA A;  4C6A A;  1FKP A;  5HN0 A;  2GJF A;  4K4S A;  2CPJ A;  4KPY A;  2GQ2 A;  5DG9 A;  2OPP A;  4ZLN A;  4PRF A;  4I68 A;  1SJ3 P;  5I3Q A;  3NCR A;  4WU3 A;  1T3N A;  2BE7 D;  2M5Y A;  1HBN B;  4CLZ A;  2W2P P;  2CWK A;  5C2G A;  5E3P A;  1RAI B;  1H3D A;  3FCW A;  4BC7 A;  2KZM A;  1KD1 T;  4YS2 A;  4I2Q B;  1WOP A;  1FXL A;  5H9F K;  3QJP A;  3AY0 A;  1Z4U A;  3G6Y A;  3FVY A;  4K5S A;  4F2R A;  1UAW A;  4WFN Q;  3QFW A;  1U1Q A;  1HHT P;  1VIX A;  4JBC A;  2YH0 A;  2D74 B;  1KKH A;  2IIH A;  4B9M A;  2QL7 B;  4L73 A;  1E6V B;  1E6Y A;  2PGC A;  4YY3 J;  1Q7L B;  1Q8L A;  2CQI A;  2HK3 A;  1WAC A;  1Y10 A;  2GNK A;  4C3M A;  3TA1 A;  3DLE A;  3OFE A;  4OZ5 A;  2I8E A;  4ICL A;  2B9X A;  3IC1 A;  2J5A A;  1VS3 A;  4LBP A;  5HI7 A;  4IRC A;  4X65 F;  3VGV A;  1R0A B;  2F4F A;  4M1K A;  4MKA A;  4LF6 F;  2MSS A;  4DUT A;  3KJQ B;  2IBO A;  2V69 A;  3KK3 B;  1QSY A;  1EET A;  4DR2 F;  3M8Q B;  1I5O B;  4OYP A;  3BEG B;  1WHV A;  1QSL A;  2DR8 A;  1B99 A;  1OO0 B;  4HHH A;  1OPZ A;  3WBZ A;  2V9K A;  2KFY A;  4R0E A;  2V2Q A;  4LFB J;  1KP6 A;  1R6Y A;  1AB8 A;  4USU A;  2BQR A;  3GB0 A;  3GQC A;  4F4Y A;  5E5N A;  5IWA F;  5IFM A;  1W2I A;  2ABY A;  5GAE I;  4DV0 F;  4TLQ A;  3UE2 A;  4KHP F;  1WKJ A;  2EFV A;  3BH6 B;  3UD3 P;  2X3G A;  1NH8 A;  4ZLJ A;  4C11 A;  3T41 A;  4X4R A;  1CSJ A;  1RA7 A;  3MWB A;  4PYD A;  4PKD B;  3LP2 B;  1TL7 A;  1F2G A;  2CIM A;  2YVS A;  5DJB A;  3ILI A;  1FRI A;  1CQM A;  5D0R A;  2C42 A;  3O6Q A;  4GKK F;  3M8W A;  3C46 A;  3MEC A;  4JV5 J;  1XNR F;  2F3J A;  1RAD B;  5CYM B;  4USM A;  3BR8 A;  1WEX A;  3PO4 A;  1B64 A;  2HBR B;  1HAR A;  2OML A;  1N32 F;  2E5I A;  2J8A A;  4YOE A;  2AQ4 A;  4Q0B A;  1HWU A;  2ZBI A;  4YR3 A;  1KTQ A;  3D1Q A;  3CDE A;  3CJ3 A;  3G2X A;  2AJ1 A;  4FVC A;  2GZO A;  3R5A A;  3HM9 A;  4WTY A;  3W3S A;  3UDL A;  1P27 B;  2CQ3 A;  3ET6 B;  1PC5 A;  1ROF A;  2KRR A;  4J9P A;  3LP0 B;  1T05 A;  1FRH A;  4O4R A;  3I4H X;  1UVJ A;  3D6F B;  1GX6 A;  2HQF A;  5D4L A;  2N7Y A;  5FD1 A;  2HZV A;  2GCF A;  1UZD A;  3DLB A;  5ETQ A;  4ILR A;  4OV1 A;  4I0W A;  1A7G E;  4DG1 B;  1TKD A;  4LF9 J;  5KT2 A;  3TUZ C;  1FA0 A;  1NPR A;  4DV1 J;  3M2U A;  2DPJ A;  1HNI B;  4C2M A;  3W8P A;  1B0P A;  1PKU A;  4DL3 A;  4NAS A;  3TVZ A;  2A18 A;  1CJU A;  1YSJ A;  1S72 S;  2JRS A;  4EYH B;  4ID5 A;  3MGJ A;  2DVI A;  4MIA A;  2HAI A;  1TV6 A;  3R9L A;  1PAU B;  3N5F A;  1X4B A;  3LTO A;  2XS7 A;  1UTA A;  4C8Y A;  1RHU B;  4F8R A;  3VTI A;  2JHE A;  1WJ9 A;  1F9E B;  1PJ5 A;  2M4M A;  4URQ U;  5CYQ B;  3TVK A;  2ALZ A;  2BJ3 A;  4DFK A;  2QLW A;  3GSD A;  1SQG A;  3PDN A;  2BA9 A;  1OMS A;  2QL9 B;  4K5R A;  4U96 A;  1N5Y B;  1NK8 A;  3MR7 A;  4RBU A;  3CDB A;  4E0D A;  1CJK B;  2XQC A;  3DNC A;  3KHG A;  1CJV A;  3NOG A;  2NZ4 A;  4BHQ A;  2VUG A;  3NGD A;  2CQC A;  5F9L A;  1NK7 A;  4JYA J;  1NK0 A;  3K7R A;  2P9G A;  5M2R A;  1JWW A;  2OPQ A;  1NBE B;  2J9D E;  2U1A A;  4F26 A;  1ICE B;  4I6A A;  1X5S A;  3Q0A A;  4NLR A;  3CMA S;  1FCA A;  3AD8 C;  5J2P B;  2Q79 A;  4I7F A;  3A8K A;  4PAB A;  3H2U B;  3MCN A;  5K14 B;  3ISZ A;  2UUB F;  4NPO A;  2OKQ A;  1FWL A;  1WSV A;  1UMJ A;  3PM9 A;  3ILO A;  3I0R A;  2V4J A;  2RKI B;  3DRS A;  2EFG A;  2M0G B;  3M6V A;  3FSX A;  3C66 A;  1P6T A;  1VIS A;  1WC1 A;  4NZ7 A;  3KWM A;  2JVR A;  1EQM A;  3IR5 B;  4PG6 A;  8RUC A;  1DQA A;  3KK1 A;  1LXN A;  1Q81 T;  1URN A;  5DQI A;  2QL5 B;  3C16 B;  1WF2 A;  3LGH A;  2CPH A;  1FXR A;  4Q7A A;  5LOQ A;  3QGI A;  4DU7 A;  2CJX B;  2Z4P A;  1UJ6 A;  1I51 B;  4P9S A;  2G13 A;  2IA0 A;  5DM6 Q;  1M1H A;  2DGT A;  2DJW A;  1UZH A;  1C0T A;  2UUA J;  3H8Y A;  4NLP A;  2AT1 B;  1O8B A;  4BWJ A;  3VV2 B;  2XSJ B;  3QO9 B;  1KVJ A;  3IGV A;  5A76 A;  2W9C B;  1U1L A;  4TXS A;  4CO0 A;  5B7W A;  1RT6 B;  1BWV A;  3I0S A;  2Z57 B;  1YZ6 A;  2DGO A;  3GTY X;  1EX8 A;  4U8Y A;  4DR5 F;  2C2R A;  1JLB A;  3E2E A;  2VAS A;  2NQP A;  4F0K A;  1NCL A;  4OX7 A;  3MFH A;  2E1C A;  4ELT A;  2ZUA A;  4KO0 A;  4LR7 A;  2NUU G;  3KJV A;  3MPV A;  2X1G A;  3GR1 A;  1GMV A;  5KFB A;  1BE4 A;  1REV B;  4OYM A;  2BYC A;  1U09 A;  2UXD J;  1VQM S;  2KJW A;  3MCO A;  4J9U E;  4CH7 A;  3DLH A;  4ZP8 A;  3K5P A;  2QTW A;  2RSQ A;  4DL4 A;  3C6T B;  4ZVP B;  1K8A T;  1LQ9 A;  2JSX A;  5HVG A;  3T5K A;  3BGO P;  4K4U A;  1TKZ A;  1SIZ A;  1FKO A;  2AIR B;  4LRB A;  3EWG A;  2E5G A;  3LGM A;  4KSE B;  2DNK A;  1JLF A;  4FYV B;  2ZE2 A;  2WVF A;  1WG1 A;  5IXU A;  3H25 A;  1FNX H;  5AXL A;  2H4Y B;  3P8B B;  2HFN A;  4R0J A;  4HAC A;  4JI3 F;  3M6W A;  4DV7 F;  3H0P A;  5L1J A;  4ETZ A;  2YNF B;  2AF6 A;  3C8Y A;  2M9K A;  1CG2 A;  1JMT A;  2W4D A;  4DPW A;  2VBX A;  4BWM A;  1TKT B;  2X1A A;  3CJ5 A;  1M5O C;  4OYX A;  1X4D A;  2W2M P;  3CJ8 A;  5CH7 B;  3CCV S;  4DV4 J;  3TUJ C;  4I2P B;  8AT1 B;  3DXS X;  3QWU A;  1VCT A;  4EBE A;  5T7L B;  3HSZ A;  1RDR A;  2VKR A;  1FVQ A;  3KLG A;  2VIH A;  3SV4 A;  1O51 A;  3P6Y C;  1DQ9 A;  3TJ9 A;  2XNR A;  3EXY A;  4X66 J;  5HRO B;  1RWN B;  2V4Q A;  1S6Q A;  4XDD A;  4UY8 T;  5MAO A;  3HHL C;  2Z8Q A;  5KFY A;  2OGU A;  4MJK A;  3CJR A;  3OJS A;  1TFW A;  3R97 A;  4ZP7 A;  1S76 D;  3BSA A;  1WDT A;  4K4W A;  4UQG A;  1N54 B;  1S1W A;  2WSF C;  2ZBQ A;  4KH0 B;  5G0R B;  4EBD A;  1R8P A;  4ZPA A;  2CXE A;  4W92 B;  5IM0 A;  2HQ3 A;  1S49 A;  4B9U A;  1VI7 A;  2Z2Y B;  4G65 A;  1P1T A;  4OIX A;  4WPA A;  1DTT B;  3A12 A;  1HD0 A;  4TY9 A;  3AOD A;  4NRT A;  2OFH X;  3POT B;  1LXJ A;  5DDQ C;  2HZA A;  4WE1 B;  1GT8 A;  4NOH A;  3KLF B;  3FJ2 A;  2PDA A;  3W9I A;  4ED7 A;  4FPI A;  4PXD A;  2VBW A;  2LA6 A;  2VFV A;  3HHD A;  3W5Y A;  2C3M A;  2GC8 A;  3ZZO A;  4WFA Q;  4O0I A;  2BZ2 A;  2XNQ A;  4ZPV R;  1SKS A;  5KOW A;  4IO9 Q;  3Q86 A;  1S9G B;  3GFZ A;  3C14 A;  5F8N A;  5KG1 A;  4OI3 A;  3QT7 A;  4UOF A;  1QAJ A;  1CJT A;  4JI0 J;  2J9C A;  3JTN A;  1L3S A;  2HHH J;  3DGP A;  3M05 A;  5BYS A;  2LXU A;  4NXM F;  4QWE A;  2DHA A;  4S0M A;  4B3S J;  3CCE S;  3BF4 A;  4ZVT B;  2W2Q P;  3I96 A;  3MD1 A;  5L1L A;  3C3L A;  2PO4 A;  2RDJ A;  1JJC B;  1GMU A;  4YR0 A;  1HBU B;  2H54 B;  1DJ0 A;  1CPZ A;  4X4S A;  3OV7 A;  4RW9 B;  1X0P A;  4KFB B;  1JLE B;  3CJ0 A;  4DFP A;  3P5T L;  1TK8 A;  4AND A;  2PII A;  1L3K A;  2XEX A;  3MM9 B;  1TL5 A;  1VQL S;  3I55 S;  4P73 A;  2AYG A;  1Q53 A;  5GAD U;  3MPW A;  4J9K A;  5LMN F;  5I3P A;  1YJW S;  2DGW A;  2OEJ A;  2FVS A;  3K5N A;  2V8P A;  2AV5 A;  3TX0 A;  1BQN A;  3UVJ B;  1HI1 A;  3P3D A;  1YIJ S;  1RT4 A;  1U02 A;  2HK2 A;  1XIQ A;  2HVZ A;  4ES3 A;  3BKF A;  3DOL B;  4J37 A;  1N8R T;  1EKR A;  2OPS B;  3DRY A;  1VQ7 S;  4G1Q A;  2RAQ A;  3ITH B;  1N33 J;  3OVB A;  4GKJ J;  4ZVU B;  2RVJ A;  5HK4 A;  3DC2 A;  3M6U A;  3TVY A;  4JI2 F;  4RUC A;  1X5O A;  3FSI A;  3K8V A;  3QMQ A;  4X64 F;  4O4G A;  1ZBT A;  3PKY A;  4ATN A;  2G4B A;  3EJM A;  1KHW A;  1YQH A;  1T7P A;  4K50 A;  1ZAV A;  2B7B B;  4IG3 B;  1FES A;  1WEL A;  2H1Y A;  2KM8 C;  1OQ6 A;  3MEG B;  3HSD A;  3QNW B;  2N4C A;  1AW0 A;  1BC6 A;  1UPP A;  2J9E A;  3BGR A;  2ZJP Q;  1RAC B;  4LF5 F;  4KH1 B;  2L41 A;  2E7W A;  3SCJ E;  2UXC J;  3KG1 A;  4FBT A;  2UUW A;  4DPU A;  4HI2 A;  4C98 A;  2OAU A;  1N48 A;  2IRY A;  3J81 U;  1N34 J;  1FD2 A;  2YH1 A;  2OJ3 A;  1SV5 A;  2C2O B;  2AEM A;  3WQP A;  2DB1 A;  3ZO7 A;  2VFT A;  4KE5 A;  5KFF A;  3CIM A;  1SVD A;  4CYU A;  3G96 A;  2ZHB A;  1QLN A;  1FNM A;  4NA1 A;  4Y2M A;  1WOO A;  3AFG A;  2XMT A;  3CJK B;  4QQB A;  4B02 A;  3D67 A;  4Q2M A;  4DSK A;  2BKP A;  2MGZ A;  1YTY A;  4DR1 J;  4BC9 A;  1RT1 A;  3OLB A;  4GVB A;  2UVR A;  4CH1 A;  4OHW A;  3GLJ A;  1J5E F;  5C24 A;  2LLZ A;  2R7V A;  1P9Y A;  4ZVS B;  4ILL A;  3OL6 A;  1EZZ B;  2YQ0 A;  3OL7 A;  4JI8 J;  2XC9 A;  1NKB A;  1U2R A;  3EVW A;  1VBK A;  1N4L A;  2W7O A;  5KFM A;  3SV3 A;  3UN5 A;  2WVE A;  3G8T A;  1MU2 B;  1YJU A;  2J6S A;  2E1M C;  2NUH A;  4GC6 A;  4Y65 A;  2ILY A;  5HMY A;  4PG5 A;  1W2B R;  2CZ4 A;  3QGG A;  3MCM A;  4IYQ A;  3FBF A;  3UCZ P;  3OSP A;  4WIQ A;  3ICL A;  3HHK A;  1L3U A;  2KXH A;  1FFS B;  5B08 A;  1RUS A;  1SBR A;  2HS4 A;  5ETO A;  4AYB D;  5KT4 A;  4CIO A;  2R7R A;  2FVP A;  3HD2 A;  1KLN A;  4TNO A;  4F3M A;  1FK9 A;  1T11 A;  5D0E A;  4JI4 J;  2QJ3 A;  4ZPW R;  4CLY A;  2E9Z A;  2XB2 D;  3BBC A;  1VHF A;  3M2R B;  2MQ8 A;  2YKM B;  4ZPD A;  1AYE A;  2VA3 A;  3HVA A;  5KFS A;  4ZVF A;  1YKW A;  4MKV A;  1RT7 A;  3DLG A;  3DGV A;  1AUS L;  4UUW A;  2KXF A;  3HHL A;  3BO2 A;  2FJW A;  3RU0 A;  2WTF A;  3N01 A;  3CF5 Q;  4ZA1 A;  1YDL A;  1NLK L;  3B8H A;  2ROG A;  4Y2K A;  1T9T A;  2VKZ G;  2LU1 A;  4KHM A;  3P45 B;  2DXD A;  1WC5 A;  5M2U A;  1FRM A;  2HHT A;  1MWZ A;  3QT6 A;  3VZI A;  1HYS B;  3IAM 9;  1ZYQ A;  3OTB A;  3BO3 A;  3W1Y C;  1TP7 A;  4DUY J;  2KTQ A;  3KG4 A;  2HIY A;  2C2N A;  1EJ7 L;  3A3P B;  1ZET A;  3MDF A;  3N28 A;  2BQ3 A;  2FVQ A;  3NS7 B;  2RNE A;  2FY8 A;  1FDN A;  1EKS A;  4HVZ A;  3TAN A;  4GVL A;  4XO0 A;  3LW5 C;  3E3X A;  3FMB A;  3L09 A;  1D9A A;  1S6U A;  3Q8S B;  5K9F A;  1TUG B;  1HBN A;  3R5C A;  1HD1 A;  4EUV A;  3OJU A;  4L3K A;  4ECV A;  1NSP A;  1D9D A;  5J2M B;  1JJ2 R;  3NCP A;  3AB2 B;  1TZ0 A;  2XM3 A;  4JI6 J;  4OV6 A;  1RT2 B;  2O66 A;  2RH3 A;  3T3F A;  2QA1 A;  5HAO A;  1HA1 A;  5ITH A;  4Q45 A;  3NGS A;  4ECR A;  1CS4 B;  4JI7 J;  1AFI A;  1GTE A;  2XZW A;  4ECW A;  3DCA A;  1FTR A;  3T1A A;  3KHR A;  1HNX J;  2RF2 B;  2CQ4 A;  1FEH A;  1E6V A;  3K59 A;  2K06 A;  2BJ9 A;  2MPU A;  3NS6 A;  2R8G A;  1RTJ B;  4ZCM A;  1NME B;  4J5O A;  1O6X A;  4C0B A;  1RU2 A;  2QLB B;  4N5S A;  1K73 T;  3BS9 A;  4HYK A;  4LJM A;  3PYF A;  3B4M A;  1R0A A;  2MQP A;  1JX4 A;  2F63 A;  5HLF B;  1CQN A;  2VL1 A;  4QPX A;  3GMG A;  2VF3 A;  4KGM A;  5L39 A;  5U47 A;  1FI4 A;  3AOB A;  3KK3 A;  4USH A;  3CSK A;  1F1B B;  3M8Q A;  3N6N A;  1G3O A;  1T9W A;  1F5A A;  2F65 A;  4IH7 A;  3JQK A;  3TQ1 A;  2IC3 B;  4OI4 A;  2VG7 A;  1X9S A;  1PIL A;  3KXD A;  5HQM A;  1U1R A;  4Z37 A;  1BMQ B;  5KTQ A;  3PZP A;  4K59 A;  2IVM A;  3CC7 S;  5CZV A;  2V50 A;  4R25 A;  4WP9 A;  3JSY A;  4HTJ A;  4JOU A;  4IH5 A;  3Q83 A;  1VC0 A;  3NL0 A;  1Y0H A;  1Q78 A;  1JJ4 A;  3KJN B;  4LFA F;  3SCK E;  4B3R F;  4H4O A;  2MQQ A;  3LP2 A;  1RIS A;  2K3I A;  1UA1 A;  3CED A;  2A3J A;  1TL1 B;  1WI6 A;  2WAQ D;  3DLL Q;  2ZIT A;  4LR8 A;  2ZC3 A;  1S79 A;  3P5B P;  2H51 B;  1ITP A;  5CYM A;  4C8M A;  1GXT A;  4A8W A;  3JAM Y;  2NPI A;  2R8K A;  1S77 D;  5KFX A;  2Y0B B;  3WDO A;  2DY9 A;  5CCL A;  2KT3 A;  3NY0 A;  4A8F A;  3O2I A;  3MMC A;  1HQ2 A;  1HWJ A;  1JLC B;  1RWM B;  3A3N B;  2PN6 A;  3MOJ B;  3IXQ A;  4H4K C;  1F9H A;  3V6D B;  1F5C A;  1N36 F;  1YJT A;  3OTC A;  5BYR A;  3PJX A;  3ET6 A;  5E2Q A;  1IQT A;  3HVT B;  4WK3 A;  4PPD A;  2VV5 A;  1FDA A;  4LIR A;  3NMR A;  1SQF A;  3HT3 A;  4A8O A;  3RRH A;  3HXM A;  1LFW A;  3KNG A;  4QZV B;  4DG1 A;  2XWX A;  3CJ2 A;  2M8H A;  3M8S A;  3SYZ A;  3K2Y A;  4USW A;  1PYO B;  1U24 A;  5KFK A;  2RDI A;  3TR5 A;  4FF1 A;  3DKD A;  3EGV A;  1LWC B;  2B56 A;  4OX9 J;  3QYY A;  3LAK A;  1H98 A;  3OTO F;  3NEK A;  1HIY A;  4K0K F;  5EHH A;  1X7V A;  1YZ7 A;  3UR3 C;  4DV6 J;  2MKC A;  2RD5 C;  3TAP A;  2OO4 A;  1M5K C;  1K1Q A;  3AD7 C;  3FUY A;  3I9V 9;  3G9C A;  5CYQ A;  4N76 A;  5KG2 A;  2IY5 B;  4NLX A;  4MKB A;  4RWX A;  3OR2 B;  1OSD A;  3ZZR A;  4EO8 A;  5THW A;  3LH2 S;  1IBM J;  1N5Y A;  2F9J A;  6AT1 B;  2IJF A;  4C48 A;  3HO1 A;  3OW2 R;  1OQ3 A;  5KG5 A;  4KKO B;  3AXK A;  3NNA A;  2E7X A;  1WHX A;  3GCX P;  3MR6 A;  4X62 J;  3D68 A;  2VQF J;  1BHN A;  5LSO A;  2J7W A;  3RW7 A;  3HDS A;  1SC1 B;  5J2P A;  2B8P A;  5KG6 A;  4OX8 A;  2ADB A;  1FFW B;  3SSQ A;  5K14 A;  2CPI A;  2FZG B;  4DUZ J;  2BUN A;  1FJ7 A;  4ZIW A;  3VAJ A;  2WON A;  4OFZ A;  1FVS A;  3FC9 A;  4DR3 J;  3HHN B;  2RKI A;  4O3O A;  1T9U A;  4DJB A;  1N5V A;  5D4N A;  4WCE Q;  2P8I A;  3GIL A;  5F41 A;  4RNO A;  4FF2 A;  2V8H A;  3BSO A;  1GXL A;  2QC3 A;  3DMJ A;  5HQ8 A;  3C16 A;  3ILJ A;  4HH0 A;  1N52 B;  2DRD A;  4OHV A;  3K5O A;  4IH6 A;  3IR6 B;  1EAY C;  2XMJ A;  2EFQ A;  5E0O A;  4C3K A;  4N41 A;  3RRK A;  3UPF A;  4HL9 A;  2JH3 A;  3D0G E;  1V5I B;  2DXF A;  2XSJ A;  3QO9 A;  4Y00 A;  3ZZP A;  3EM1 A;  4QPT A;  2XSF A;  2W9C A;  4FZV A;  1RT6 A;  2OFG X;  2XGP A;  4Y6I A;  4OJH A;  4M5D B;  1JXV A;  3WX4 A;  3LUY A;  2X1B A;  2CAJ A;  4QIE A;  5KFJ A;  3Q8Y A;  3RUB L;  2CPD A;  2V5H G;  2A0F B;  2ZJQ Q;  2XYP B;  1REV A;  5F0U A;  1TL3 B;  4RNN A;  3R7S B;  4B9N A;  2F8E X;  4LF4 J;  2P6S A;  5L9X A;  4B3T F;  1BXN A;  2V2Z A;  5KT7 A;  3BGL A;  1WOS A;  5IOL A;  1HBM B;  4P2S A;  1KBR A;  3SXL A;  3C6T A;  5EGY A;  2HNY B;  5CHC B;  5DZ6 A;  4N47 A;  4M5K A;  2G0J A;  1NDK A;  2L9N A;  2JEG A;  4DX5 A;  2VQE J;  4O0N A;  2BR0 A;  2HRY A;  2ZH2 A;  5LSL A;  5D4O A;  4XIU A;  4TU7 A;  1LW2 B;  1KHV A;  1RT3 B;  4X4N A;  2KHD A;  4DX8 H;  1WF0 A;  1Y5I B;  3Q2T C;  3WX8 A;  4TY8 B;  2CQH A;  3VAM A;  1SH2 A;  1NKE A;  1CJV B;  4ZN1 A;  2I5J A;  3CCT A;  1QD1 A;  3PY8 A;  3QRR A;  1IKY A;  2DNH A;  1T3O A;  3F41 A;  2QLJ B;  2AJ4 A;  2YNF A;  5GAD I;  4E8U A;  4YB1 P;  1X31 C;  4ZS6 A;  3ENV A;  1TKT A;  2XMW A;  3TEG A;  2DYA A;  1DFD A;  3OLA A;  2FHM A;  3QSI A;  3GON A;  1D9F A;  3FZB A;  3UD5 A;  4M94 A;  3SIP B;  2VFR A;  4B3M J;  2JLF A;  2GHV C;  2PI5 A;  4KGZ B;  3I4P A;  4KC5 A;  4I2P A;  4Q8F A;  1LKZ A;  3JSB A;  2FJV A;  5T7L A;  1SKU B;  4RU9 A;  4YR2 A;  2D3O R;  3V2U C;  4AXI A;  4TVA B;  4B3O B;  5J1E B;  1G6B A;  3QJL A;  1BLU A;  3SZ2 A;  2LDY A;  2KU7 A;  2HHU A;  1NJX A;  3LO3 A;  4RNF A;  5HRO A;  2KVQ E;  2KG1 A;  2YNI B;  2R9L A;  2FHJ A;  3KK1 B;  2ZD1 B;  4HDH A;  4RW4 B;  1SH0 A;  2VDI A;  1IBK F;  2YNG B;  2W2N P;  1U8W A;  1RTZ A;  5L1I A;  4USI A;  5G0R A;  1VQS A;  4ECY A;  2CNL B;  1I1G A;  3GIR A;  3IWL A;  2WOM B;  3HF5 A;  2MY7 A;  3HFK A;  3PKM A;  1NPK A;  5DS7 A;  1SJF A;  4J9Q A;  3NOC A;  5J1P A;  4CLS A;  3M9M B;  4CO2 A;  1IJF B;  2CWX A;  3POT A;  1HMV B;  4QWD A;  3LPE A;  5CAB A;  3NXZ A;  3I0S B;  4ECQ A;  2R4F A;  4NXN J;  3KLF A;  4M5L A;  2OMO A;  1FER A;  3I6P A;  4JV5 F;  3KLV A;  3GP9 A;  2R7O A;  4A8Y A;  3JS9 A;  3G6V A;  5CCM A;  1SC3 B;  3PW7 A;  5BXI A;  4O44 B;  4F4Z A;  2DGX A;  2UV8 A;  3VCD A;  4NEZ A;  3AA8 A;  2M3D A;  1RHJ B;  3KMQ A;  2W8L A;  3P4U B;  2OHD A;  3UDV A;  5L9N A;  2KYZ A;  1S9G A;  3QPI A;  3L95 X;  2FLL A;  4DR7 F;  3W65 A;  4DQQ A;  1NND A;  2LMI A;  5I4M A;  2GMH A;  1RI7 A;  4D3G A;  3HD1 A;  3TRG A;  4FXV A;  5KT6 A;  2VOD A;  3T6J A;  4C4W A;  3RB0 A;  1SJ1 A;  2PA3 A;  1NK5 A;  2KXN B;  1UEK A;  5JJB A;  2QLX A;  1TKZ B;  2HHP A;  1FDB A;  3T1H J;  5ETS A;  5HBM B;  3QID A;  4RW7 B;  4LF9 F;  4WFY A;  4LSN A;  4X65 J;  4DV1 F;  2Q6B A;  1WKK A;  1GQE A;  3ENW A;  1HBU A;  2ZE2 B;  4ECU A;  2HHQ A;  1NHV A;  1IKV A;  3CT9 A;  4RW9 A;  4KFB A;  1JLE A;  5BJR A;  4PR6 A;  2EG1 A;  5CYJ A;  4JI1 J;  1UEV A;  2CRL A;  4HAC B;  1SL2 A;  1S4E A;  3ILL A;  4RZR A;  3RG6 A;  3PYD A;  1U26 A;  5IT0 A;  2DR6 A;  4RBT A;  1EP4 A;  3KNA A;  3UVJ A;  4ANE A;  1RA6 A;  4NRU A;  2PMZ D;  3NP5 A;  3PX0 A;  3DOL A;  2YX1 A;  3CNQ P;  3GII A;  3GR0 A;  3ITH A;  2EFP A;  5G4D A;  1SL1 A;  2OTJ S;  1QUP A;  3F73 A;  4DCP B;  4LT6 A;  5GAH I;  2IM2 A;  3RB6 A;  1XMQ F;  2E1R A;  5F8M A;  4GKK J;  1XNR J;  1RBA A;  3IMQ J;  2ZNZ A;  2MLX A;  3IG1 B;  4IG3 A;  1ZOT A;  2RQC A;  3VF0 B;  3GV8 B;  4L72 B;  3ZZ0 A;  3VAL A;  1N32 J;  3MEG A;  3CD0 A;  3R6L B;  2MZJ A;  1KS2 A;  2YWK A;  3W2W B;  5AXN A;  3MI7 X;  1RYR A;  4M95 A;  2C3U A;  1S1V B;  1X60 A;  2FTR A;  3I56 S;  2BOP A;  2GHW A;  2IJN A;  3H59 A;  1U1K A;  1V3R A;  3HHE A;  1S97 A;  3AJD A;  1XR5 A;  4ALZ A;  4AL5 A;  3IA0 A;  1UCN A;  1LW0 B;  3ZXW A;  4IQX A;  1PO6 A;  2PMW A;  3J7Y U;  5E3Q A;  2GMJ A;  4F4K A;  4NZ6 A;  4DF8 A;  1KR4 A;  2MQN A;  2YNH A;  4U67 Q;  4OYO A;  2C22 A;  3OL8 A;  3D6T B;  1DUR A;  4HT5 A;  3CJK A;  5MLC V;  2UUA F;  1T8E A;  4F04 B;  2XI3 A;  2MZT A;  3KYL A;  1X9M A;  3KLI B;  2WVD A;  4ZVG A;  2WVB A;  2ADC A;  2V2K A;  1DRZ A;  4HKQ A;  3G8S A;  3CDW A;  3QGH A;  2BJ7 A;  1Y9O A;  4BCA A;  2AYM A;  4ZK7 M;  2GVZ B;  5FDL B;  2B9Y A;  2LU2 A;  4L6V 3;  2R2T A;  4DZ6 A;  1NU4 A;  4QOT A;  3MM8 B;  2WRM A;  3CCZ A;  5B0G A;  3PHE A;  4HDG A;  3KUH A;  4ED2 A;  2A2C A;  1S57 A;  2AKW B;  1ZM4 A;  2FGC A;  3CPW R;  3IRX B;  4RU2 A;  2DR9 A;  2C2Z B;  2I9S A;  4U6P A;  2OTL S;  4AUK A;  4HI1 A;  3H7H B;  4CLK A;  1JLQ B;  4CO3 A;  3KDN A;  2Y8Y A;  2P6T A;  4WP3 A;  2XMM A;  3RR7 A;  1S12 A;  1QE1 B;  3LP1 B;  2MZR A;  3M6X A;  3CME S;  3IO1 A;  2YKM A;  2E29 A;  2QSW A;  3T1Y J;  1MRO B;  4K8R A;  2UUB J;  4O3N A;  5KFV A;  2J0W A;  2M70 A;  1UVM A;  1KRP A;  1WHW A;  4AL6 A;  3PX4 A;  4F25 A;  1MN9 A;  4KBI A;  3MR5 A;  3AT1 B;  2W7P A;  1QM9 A;  2FJB B;  2V0N A;  3FKB A;  2QFJ A;  1ARO P;  3MAA B;  2NYI A;  3MMB B;  4OZ2 A;  2BKO A;  3PVX A;  1KDN A;  2AX1 A;  3PV8 A;  4Y34 A;  4HR2 A;  4KJI A;  2G2Z A;  3D0I E;  3U1M A;  2HZC A;  5IQ6 A;  1F3F A;  5GAG U;  4GO7 X;  4DV4 F;  2JC0 A;  4PWW A;  2KT5 A;  3OFH A;  4LQ3 A;  2WVC A;  3ZTO A;  2VBZ A;  3LOU A;  3AXM A;  4TN2 A;  1RHR B;  2FZK B;  2E5J A;  5FJ4 A;  3NLC A;  3BBB A;  4D3H A;  2J0S D;  1U1M A;  1XNQ F;  3N5B A;  4RUA A;  4EZ9 A;  3PX6 A;  1SB6 A;  2GJI A;  1U47 A;  4IG0 B;  1IBL F;  1SV5 B;  2XY7 A;  2NYH A;  2HLT A;  3A8J A;  4QCL A;  2W25 A;  2V68 A;  4O3Q A;  4F67 A;  3BPD A;  2OP5 A;  3HPO A;  1TVR B;  5T14 A;  2H4W B;  2ZVI A;  4Z2X A;  4O3P A;  3MXH P;  2RF2 A;  3MED A;  4CM0 A;  1JXL A;  2DNR A;  4LF8 F;  1RTJ A;  5H1S V;  4L75 A;  1KFD A;  3THT A;  3HHL D;  2C2M B;  1RT1 B;  3JXO A;  1X4C A;  1VFJ A;  3Q22 A;  2F5G A;  2A6M A;  2MMY A;  5HVH A;  4DV3 J;  5HLF A;  4AD6 A;  1R7I A;  5L1K A;  2GHP A;  4CO4 A;  3SFU A;  4RNM A;  5EN1 A;  3CWJ A;  1JB0 C;  4O3R A;  1NXI A;  1YHQ S;  2DR7 A;  2JWN A;  2GGP B;  1SJ4 P;  4P72 A;  3JYT B;  2IC3 A;  1TK0 A;  5KFE A;  4A8Q A;  4FPR A;  2YPZ A;  3N0V A;  1CVJ A;  1BQX A;  3B54 A;  2P9C A;  4HT7 A;  2GX8 A;  1CC7 A;  5KG3 A;  1YG0 A;  4CLT A;  2V63 A;  3RBD A;  4WFX A;  4DV7 J;  1P9Q C;  4P2X A;  2FDN A;  2C3Y A;  2DR5 A;  1N88 A;  4ES2 A;  4QIF A;  2C2E A;  1IR1 A;  1FK9 B;  4CLP A;  5K5M A;  5KFP A;  1XR7 A;  2EKN A;  3V4I B;  4DBQ A;  2HHH F;  1VDH A;  4G6V B;  4HLB A;  4NLT A;  3DU6 A;  1TL1 A;  4X4V A;  1ZAX A;  4B3S F;  5D8H B;  4WJB A;  2UVV A;  2ZEJ A;  3MTK A;  3PHT A;  3HHL B;  2PE8 A;  3GFX A;  3GE9 A;  4EYI B;  1RGV A;  3BGU A;  2N4D A;  1HI0 P;  2I0X A;  1S59 A;  3MCS A;  5F9N A;  4K2X A;  4WZQ A;  1JLC A;  4LSZ B;  4CNZ A;  4CCH A;  2BAB A;  4CM2 A;  2EC2 A;  1RWO B;  3V6D A;  2ZFH A;  1WG4 A;  4XTT A;  2MKJ A;  1GAO A;  4NL5 A;  1I6J A;  2PMH A;  3HVT A;  4OX6 A;  2MYF A;  2XHW A;  4W90 B;  1HLW A;  4EWT A;  5KFA A;  7FD1 A;  3VAF A;  2UUC J;  4TLR A;  4NLQ A;  3CC4 S;  1RHM B;  4NE9 C;  1N33 F;  1NH7 A;  5H9E K;  2DIT A;  1MG7 A;  4YB5 A;  2YX4 A;  3L7P A;  4MTP A;  4NLY A;  2XHC A;  1LWC A;  5KFQ A;  1JIH A;  3NG8 A;  3DU5 A;  1GX5 A;  2D7S A;  4MK7 A;  4DLG A;  3OPK A;  3HJF A;  4Y2C A;  3GYG A;  1HNW F;  1ULR A;  2VC0 A;  1R8A A;  1VC6 A;  3H5S A;  5D0G A;  3QZ7 A;  1JJH A;  3E51 A;  1QUV A;  3VHQ A;  4QR2 A;  1WTF A;  3GIK A;  2L9D A;  4TQS A;  1WUU A;  4IO1 A;  2UXC F;  2FY1 A;  2I2Y A;  1RQ0 A;  2FLN A;  3OR2 A;  4X4O A;  2Q6C A;  3RYL A;  3PW4 A;  3QBC A;  4NMX A;  4EK2 A;  1R31 A;  1ZTT A;  2HGL A;  4RJV A;  2HQI A;  5C42 B;  2K8G A;  4F50 A;  4KHR A;  3Q8P B;  4KKO A;  1PG5 B;  1NZ8 A;  1KQF B;  1K47 A;  5DLF A;  3MUT P;  3NWG A;  4OHY A;  2VPY B;  3LAL A;  2FVC A;  3RJM B;  2EBG A;  2M7S A;  1DBD A;  1FJC A;  1XQI A;  2Y0S D;  4FF4 A;  1SQE A;  2IMO A;  3CJS A;  2VG7 B;  4ELV A;  2DEI A;  1F6T A;  4QIG A;  1RXO B;  2B4O A;  3NCQ A;  2XUL A;  1NEE A;  4N77 A;  1VBX A;  3TZZ A;  1P1L A;  4XAK A;  4O3S A;  4OJG A;  1M0S A;  4LVN P;  5EWE A;  4YP3 A;  1HNZ J;  2NXE A;  1U6B A;  1OJ4 A;  4QU7 A;  2R7Q A;  1PJ7 A;  4H4O B;  1T0T V;  4TYA A;  2EXU A;  3HZG A;  3IAS 9;  1Z2L A;  1WWH A;  4MIB A;  3W66 A;  3WIU A;  3DOM A;  4WP8 A;  1QAI A;  5DLG A;  2EVZ A;  4DS5 A;  3CCW A;  4URG A;  4HH1 A;  4NYO A;  2KM8 B;  5D3G B;  2CQP A;  3R1L A;  4LF7 F;  4X64 J;  1TL4 A;  3MMC B;  3T9N A;  5HO4 A;  1RK8 A;  2XY5 A;  1Q5V A;  2F1F A;  1J2V A;  1YK9 A;  4PAA A;  1RHQ B;  4NCB A;  2ALY B;  4RLE A;  4M5D A;  3DN9 A;  2HWH A;  3W2V B;  2ZZN A;  2L9W A;  1SC4 B;  1U45 A;  2IVF B;  4CT8 A;  3EMT A;  4F4W A;  1LFP A;  5GAE U;  3T9Z A;  1SKR A;  1G2E A;  2Y9H A;  1JNZ B;  4X84 A;  5DQH A;  1X4H A;  3D7S B;  1TL3 A;  3CVK A;  4CLW A;  1DTQ A;  2QYC A;  3PJW A;  3QZ8 A;  2QMX A;  1HBM A;  1N5S A;  1PAE X;  3TI0 A;  4C97 A;  1UWA A;  2HNY A;  2IRX A;  2MKY A;  5HL7 Q;  2E5L F;  1MML A;  1FRL A;  3ZZY A;  1ZA1 B;  2IVY A;  3QAT A;  1OY6 A;  3GYX B;  3V6K A;  2B4P A;  3D66 A;  2BMB A;  5AT1 B;  1VYA A;  2JZ5 A;  5F8I A;  2A2D A;  3CJQ A;  1HWK A;  1J5E J;  2GQC A;  2E44 A;  3KLE B;  2VDH A;  1LW2 A;  4DR6 J;  3PW0 A;  3CMQ A;  1RT3 A;  4B9L A;  2HSE B;  2IM0 A;  4TY8 A;  4ZP9 A;  2XO7 A;  4JI6 F;  3J81 Y;  2QE5 A;  4PQA A;  2B7C B;  3JTO A;  3HUL A;  2P5V A;  2F4V F;  3GWC A;  4NLG A;  1HHS A;  4CRJ A;  4P74 A;  4JI7 F;  3WC0 A;  1FF2 A;  3RB4 A;  1Z1Z A;  4A8S A;  2HAF A;  4GC7 A;  2OD6 A;  3MEE B;  5SZT A;  3D6H B;  4XDC A;  2R7X A;  5RUB A;  3HI9 A;  1XBW A;  3LWL A;  2W24 A;  3QT8 A;  1IKX B;  4W98 A;  1RKI A;  2D3O 1;  4OZ0 A;  3G6E S;  1Q0N A;  4ER8 A;  4P10 A;  3UCU P;  3ADA C;  2X3D A;  2ZZT A;  5D78 A;  3DHX A;  2WON B;  3CJT A;  2GO9 A;  2MJU A;  1RAE B;  2BX6 A;  4Y3C A;  4F3Q A;  4B3O A;  5J1E A;  1X4F A;  2IYG A;  4NA3 A;  3CGI A;  4UUX A;  1KLM B;  2WCX A;  1H2V Z;  1RWW B;  2LA4 A;  4C8K A;  4ERD A;  4YDX A;  3UN3 A;  2CKW A;  2M2B A;  2YNI A;  1H72 C;  1IQZ A;  4ITS A;  1B0T A;  2WBM A;  4FF3 A;  4DFM A;  2ZD1 A;  3DMJ B;  1IWA A;  1YJR A;  4RW4 A;  2LQJ A;  4YHH F;  2YNG A;  5L46 A;  2AJ0 A;  3KUG A;  5ETL A;  1NZA A;  1ZM9 A;  2NZC A;  2XWY A;  2MXY A;  1QAX A;  2HVH A;  3QLH A;  1C1B B;  4OI1 A;  4QR0 A;  4DX6 A;  2VFS A;  3TZW A;  3D1H A;  2WOM A;  5EUH A;  2CJY B;  1WG5 A;  4UTG A;  3PCO B;  5AE3 A;  4ECS A;  5IQQ A;  3GV5 B;  3VAH A;  4DZD A;  5AJ3 J;  4DCO B;  3J7Y I;  2B43 A;  1D8Y A;  1X9W A;  1HMV A;  5LMU F;  2XLI A;  3RR8 A;  5AXK A;  1IM4 A;  1RAF B;  2KJV A;  1UFW A;  2J76 E;  4OJ1 A;  2IAJ A;  1S9E B;  3TX8 A;  2EPI A;  4O44 A;  1CUL A;  3M30 B;  1WOR A;  3Q8V A;  2DGU A;  2DTJ A;  3GIJ A;  1WF1 A;  3FDS A;  2Z2Z A;  6FDR A;  1N0V C;  3EGW B;  1L3V A;  1X0F A;  2G2O A;  2DHS A;  4ILM A;  5ETT A;  2ZJR Q;  2W7A A;  2BW2 A;  1HR0 J;  2FLO A;  2O1P A;  3BB5 A;  3O1L A;  3U02 A;  1H2U X;  2YKN B;  2Z2L A;  1S0N A;  2FHO B;  1XTZ A;  2RIL A;  4ZVE A;  1LWF B;  1Y7P A;  3PR5 B;  3J7A 1;  1H73 A;  1XMB A;  3H5X A;  1WC0 A;  1NPP A;  1RHK B;  4WZM A;  1YI2 S;  3DHW C;  4NZ0 A;  2COL A;  1RAG B;  3FBC A;  2FHJ D;  4A48 A;  5HBM A;  2R8H A;  5F3Z A;  2WHO A;  1RJJ A;  4RW7 A;  1U0H A;  4TQR A;  2MB0 B;  4QYZ J;  4F2S A;  1U1N A;  2BAN B;  4EBC A;  2CNK B;  3OFF A;  5KFD A;  4UZC A;  4WXO A;  3WHI A;  3BM7 A;  4OX9 F;  4Y2I A;  2CNO B;  4P2F A;  4WTO B;  1NRK A;  1KQG B;  2I5J B;  3CO9 A;  2FHK A;  1IKY B;  3AH6 A;  2RDD A;  1R0C B;  3G87 A;  4FS1 A;  2XGQ A;  2WW8 A;  2ASL A;  4LSL B;  4LRA A;  4DS4 A;  1H2T Z;  2ZH5 A;  3OFG A;  3CO0 P;  1NM2 A;  1RE1 B;  2ATL A;  2DIS A;  2UU9 F;  2E1P A;  4C0O C;  2WK4 A;  4DPX A;  1IBM F;  2F7V A;  1Q82 T;  1QAY A;  2XBP A;  3M1V B;  1C4A A;  1RTD B;  2NSB A;  1VQ6 S;  1U7L A;  1RB0 A;  4LFA J;  3UQS A;  4ZMM A;  1K44 A;  3MEK A;  4B3R J;  2O3D A;  1HQU B;  3R7N B;  3N6M A;  2CAD A;  1JKH B;  4DI6 A;  1C0U B;  3D5M A;  3MAQ A;  5CXT A;  2VQF F;  1YWX A;  1UW4 A;  3IM8 A;  1RCX B;  4MKY A;  1NB7 A;  2MHE A;  2D41 A;  2GIQ A;  3IG1 A;  1WD6 A;  5GMK a;  4AQY J;  1HFE L;  4USJ C;  2BE9 B;  1KVI A;  2XO6 A;  4F7V A;  2RS2 A;  2MKH A;  3W2W A;  1IJE B;  4J9R A;  2RU3 A;  3IRW P;  2QT7 A;  1S1V A;  4FP9 A;  2CA9 A;  4P7T A;  1DAX A;  4PWU A;  1GH8 A;  4ED4 A;  1N36 J;  3N79 A;  4EZ6 A;  1VGY A;  3KHL A;  2PEH A;  3GFY A;  4OHX A;  3FSY A;  1LW0 A;  3NRB A;  3KKF A;  3S1T A;  3QJJ A;  1QVF R;  3ZZZ A;  2JNJ A;  5HMZ A;  4N7T A;  3KJF B;  3OR1 B;  1R0B G;  4PG8 A;  2F8M A;  2SXL A;  4NLU A;  1RSC A;  4OL8 A;  1Y5L B;  3PW2 A;  1X4E A;  2VOO A;  1NAQ A;  5IT9 U;  2WSC C;  2JEF A;  1AFJ A;  2MKS A;  3M7V A;  5DG7 A;  3W64 A;  4MH8 A;  2HWI A;  3IBW A;  4NLO A;  2XG8 A;  2BRL A;  2NCK L;  2DNL A;  3OTO J;  3KK2 B;  4F0M A;  4NX9 A;  4K0K J;  3G8Q A;  3TO8 A;  3KUE A;  3KLI A;  1DLO B;  2ZWP A;  1S6P B;  4O23 A;  2IYI A;  2O5D A;  3G4S S;  2VPZ B;  3AAW B;  1AZS B;  3D9B A;  4FKX A;  2HQC A;  1RTH A;  3J81 j;  2H5I B;  2GVZ A;  2H5E A;  4LFC F;  5FDL A;  2V67 A;  4V19 X;  3MM8 A;  2ZH8 A;  3BPS P;  2MY8 A;  1V6H A;  5A0Y B;  3SCL E;  2GA7 A;  3W61 A;  3UFC X;  2UXB J;  4DSF A;  3H4B A;  4JB8 B;  1S1T B;  2CJ9 A;  4LSN B;  3EUN A;  4LF4 F;  4IR1 A;  3TAR A;  1RTI A;  1KTV A;  3IRX A;  1N5Q A;  1H0H B;  2AP6 A;  4UZB A;  1IKV B;  2RJZ A;  4ZCK A;  1JLQ A;  3EDQ B;  5T41 A;  1Y00 A;  5B0E A;  1QE1 A;  3LP1 A;  4B17 A;  5ETN A;  5KFI A;  4FXW A;  1N0U A;  1QTN B;  1WDD A;  5CD4 A;  2ZBP A;  4KV8 A;  1MRO A;  1Q7Y T;  3CC2 S;  1T9V A;  2DK2 A;  3W8G A;  2EFN A;  1HBO A;  2H9Z A;  2C2D A;  3IP0 A;  3C15 A;  2VG5 A;  1JXE A;  1EP4 B;  3Q8R B;  5A8R B;  4F3O A;  1RKJ A;  2YWW A;  3HJV A;  2D3U A;  1A0O B;  1A9N B;  4CTA A;  3AQO A;  3T5J A;  2MKI A;  5B0B A;  2BW7 A;  4DFJ A;  2B8Q A;  4C8L A;  4L74 A;  4FN5 A;  4PEO A;  2HUR A;  1M5V C;  2ZUG A;  2W4C A;  4YME A;  1P8G A;  2BJ1 A;  2J9D A;  2HQD A;  2AZ3 A;  1NO8 A;  3MAA A;  2XI2 A;  1VMB A;  3MMB A;  2JLG A;  1S0O A;  1JNR B;  3MM6 B;  3OXF A;  3VVU A;  3H90 A;  2IDL A;  4FDF A;  4ECT A;  2ZBC A;  4DL5 A;  1T03 A;  4I1T A;  4J7C A;  3ZZT A;  4B3M F;  1NK9 A;  4WII A;  1ELO A;  4K2J A;  2JL9 A;  3KMS A;  3M9O B;  2VG6 A;  2QA2 A;  2KKH A;  1TKX A;  1GFW B;  3DOK A;  3HFZ B;  3VAK A;  2Z2M A;  2R42 A;  2ZOF A;  1XMO F;  1VQO S;  3A8I A;  4LMZ A;  2YY3 A;  1PYT A;  4B9V A;  1XR6 A;  4RWW A;  3P49 B;  2GVD A;  1BUX A;  3CXC R;  1AT1 B;  2DNZ A;  3Q8U A;  4A46 A;  2YKP A;  1NJZ A;  1Y5N B;  4IG0 A;  3GJQ B;  2CPE A;  1VBZ A;  4C0H A;  1KWM A;  4DMZ A;  3ELH A;  4PUO B;  2D1C A;  3OXL A;  1Q86 T;  2NR0 A;  3JQJ A;  2YNH B;  1CC8 A;  1TVR A;  2W2O P;  2B5J B;  2ZH7 A;  5K8O A;  5FLX Y;  2FB0 A;  5KFT A;  2DNP A;  2XTJ P;  2EG2 A;  2DH8 A;  4DCJ B;  4B3T J;  2OI2 A;  5ETP A;  1K0T A;  2KHC A;  7AT1 B;  4KRW A;  1YBU A;  1IR2 A;  2ACM A;  4KPC A;  1WTB A;  3THP A;  4IFY B;  1FRJ A;  1FX4 A;  2XYH B;  5E7O B;  4PWD A;  2YKQ A;  2CG8 A;  2LQ5 A;  3CUN A;  4NYP A;  3VQS A;  4PZV A;  3I87 A;  4NXN F;  1Z2Z A;  1NDC A;  2HG4 A;  1B0V A;  4DR4 J;  4P52 A;  2Q43 A;  3QT5 A;  1LEO A;  3TJA A;  2M8D B;  2CJA A;  2GGP A;  2ZBR A;  3JYT A;  5LT5 A;  2MQO A;  5E3R A;  3B6B A;  2AJF E;  2YQ3 A;  2VU5 A;  5KOX A;  3VQT A;  3RAM A;  4GO5 X;  1NK4 A;  3BKT A;  1QTM A;  3GPA A;  2MZ1 A;  1X4A A;  2CQ2 A;  1ZH5 A;  5JVG Q;  2UVW A;  4E98 A;  3ISN D;  4GMK A;  1WC3 A;  3C19 A;  1Y4Z B;  1S1U B;  1UA0 A;  2CUY A;  3V4I A;  3SEO A;  2QV6 A;  1Q8I A;  4LUB A;  3W60 A;  3M32 B;  3SSS A;  3T1H F;  1VQ5 S;  1KEK A;  3T5H A;  1F60 B;  2JVO A;  2RRB A;  3THV A;  5LM7 E;  2W01 A;  2DRA A;  2CFX A;  3AQP A;  4ZVQ B;  3W5X A;  3KG0 A;  3PXG a;  4AT1 B;  4MFB A;  2I6W A;  2PFD A;  5DET A;  4RL1 A;  4JI1 F;  1LWE A;  2K7J A;  3Q2S C;  4ZVH A;  1Y3K A;  5KT3 A;  1RWP B;  3BYR A;  4OMF G;  4LBI A;  1B3T A;  3J7A N;  4OYW A;  2WB1 D;  3I9Z A;  4RO0 A;  3SSR A;  1IBK J;  3EPG A;  5IS2 A;  2XMU A;  2Z58 B;  2BM0 A;  3BH7 B;  2MLZ A;  2CJQ A;  5J2N B;  5F8G A;  2ACY A;  1FO1 A;  3ENA A;  9RUB A;  2EWH A;  2DIU A;  4H4M B;  2DBB A;  3FEX B;  4QBU A;  2Z30 B;  4ECX A;  1T95 A;  5IC4 B;  2AJ2 A;  4Z7Y A;  4JUZ A;  2EFO A;  2FPH X;  5KFO A;  3R5D A;  2IMW P;  4G1I A;  3NBP A;  5C2C A;  4IUF A;  1FFG B;  2ZM6 F;  3HSJ A;  3CCU S;  1KOH A;  2QFI A;  1WSR A;  3B82 A;  4ZJL A;  3PG9 A;  2GV1 A;  1H74 A;  2H48 B;  2DO0 A;  2K1R B;  1VQ4 S;  4JI5 J;  2HFS A;  1RT5 B;  2OSR A;  2ZH9 A;  4ZPC A;  1XER A;  2LEB A;  4MAK A;  3Q8Q B;  4NLV A;  4A8X A;  1C4C A;  1C1C B;  2BKN A;  2BJE A;  2CZV C;  3RBX A;  1HKA A;  2HBZ B;  2W4P A;  3MED B;  1WEY A;  4I6W A;  3V6J A;  2ZC4 A;  1NHU A;  4DR7 J;  1U1P A;  5C42 A;  2CPZ A;  2XLK A;  3TP2 A;  1AA1 B;  1H7X A;  2O01 C;  1MMD A;  3NWR A;  2WBR A;  3MMA A;  3TUI C;  4DPY A;  3DDN A;  2AMC B;  2PI4 A;  4NLS A;  2ZH3 A;  2AEJ A;  2HPU A;  4YEA A;  2CQ1 A;  1TAQ A;  3DI6 B;  2B0G A;  4QU6 A;  3DFE A;  1HWL A;  3WC2 A;  1VRQ C;  4OLO A;  1JQG A;  5KFW A;  3UW1 A;  2QN6 B;  2RQ4 A;  5DM7 Q;  2H5J B;  1JLG A;  3QAU A;  2LEC A;  2LKZ A;  3MD3 A;  3U1L A;  1LK7 A;  4A47 A;  1S7I A;  2HVI A;  1Q95 G;  2APO A;  2QMU B;  3LAN A;  2GIR A;  1TUV A;  2AZ1 A;  3HZE A;  1VRU B;  1TEL A;  2MEW A;  2XMK A;  3OTD A;  3PRB A;  3ETO A;  1T9Y A;  4J91 A;  3H2L A;  4OYI A;  5K20 B;  3IBF B;  3UI3 A;  3OQ2 A;  3QQC D;  3D3C J;  1Y11 A;  2PEB A;  4QYZ K;  4DHV A;  5E3C A;  5A8W B;  4J9M A;  3DLK B;  4ZCL A;  4A4J A;  2F9D A;  1XJW B;  3AJ1 A;  3MR3 A;  1U25 A;  3ULH A;  1GTH A;  5D15 A;  4C8O A;  5D3G A;  5HAN A;  2EK6 A;  2VOP A;  2IFX A;  1VBY A;  1J5O B;  5KFR A;  1XMQ J;  4B08 A;  2QX0 A;  2AEF A;  3HX9 A;  5EX0 A;  5JVH Q;  2EW9 A;  1TU0 B;  2QA4 S;  2P2C B;  2OEM A;  1G7C B;  3D3B J;  3T1Y F;  3EE3 A;  3KHH A;  2AX0 A;  4HHJ A;  3W2V A;  1VC5 A;  4KGV B;  3LF0 A;  1FX2 A;  2BEF A;  5KAK A;  2OH2 A;  1FWP A;  4U9R A;  4OZN A;  2HW3 A;  2ZDO A;  2CQB A;  2CPX A;  3UR0 A;  1TFY A;  1YBA A;  3MTJ A;  2F40 A;  2BM1 A;  1S0M A;  1YVF A;  4DU8 A;  2FGO A;  2AHO B;  2HEK A;  2VC1 A;  1G4C A;  1RAO A;  3NAH A;  5KT5 A;  2ASD A;  2YX7 A;  5DGB A;  3UDE A;  2RRN A;  3PNI A;  3IS9 B;  5A8K B;  3ZNJ 1;  5BR8 J;  3RAQ A;  1PBA A;  2RB7 A;  4G3I A;  2MDA A;  3DYA A;  3BSN A;  2FJE B;  4HTI A;  3R5J B;  2R8J A;  1UVN A;  2W8K A;  5KFN A;  4RR5 A;  4IFV B;  1URR A;  2MJN A;  3L7U A;  3S6E A;  1UKU A;  4ES1 A;  1IBC B;  1OPI A;  3KLE A;  4MMO A;  3AOC A;  4LF2 A;  4X2B A;  4F36 A;  5E33 A;  4KTQ A;  4WKY A;  3LGN A;  1YIT S;  1OIA A;  4DDF A;  4DQS A;  4I67 A;  3D28 A;  4IOC Q;  5JXS A;  1QDU B;  2ZH4 A;  2AU0 A;  5HP1 B;  1FNO A;  4NYZ A;  2HFU A;  2HMI B;  2R2R A;  3L4B C;  3MM5 B;  2XS2 A;  4YB6 A;  5ETR A;  1SKW A;  4WYW A;  4DV5 F;  1IN0 A;  1VHI A;  3R1H A;  2R8I A;  1VQN S;  3HSG A;  4AFF A;  4K7Q A;  1R43 A;  3MEE A;  1FWK A;  1SC6 A;  4USV A;  2GFF A;  2CDR B;  2VIC A;  3U1N A;  2XMV A;  1RWV B;  1IKX A;  3CB4 A;  3ENQ A;  2ASY A;  5CD4 H;  2C3P A;  3V81 B;  1ZZF A;  2FJX A;  2PSZ A;  4NEY A;  4DN9 A;  1UWB B;  2LEP A;  4CLF A;  4DV3 F;  3NAI A;  4LRC A;  2P9E A;  5IT4 A;  2UV8 G;  4U7U D;  3QRP A;  1HPZ B;  1IM6 A;  3RRG A;  1KLM A;  4ENO A;  2MLY A;  2KG0 A;  1TQL A;  1VJW A;  4C8Z A;  2HS3 A;  3FFI B;  4GRS A;  3QIP B;  5D6G A;  1Y3J A;  3RBE A;  2XY6 A;  3HVR A;  2AW0 A;  1R89 A;  3DOM B;  3CCS S;  1GEH A;  5FLX U;  3FEZ A;  2FUG 9;  4Y0F A;  2OD4 A;  4OQJ A;  2HGM A;  5I3U B;  2RML A;  3TWZ A;  1C1B A;  4M5M A;  4EGL A;  2XS5 A;  2OPR A;  5CAA A;  3EGZ A;  3EZU A;  3P96 A;  1TR0 A;  5GVQ A;  3ZTR A;  3K89 A;  5C5J A;  1DQ8 A;  2B6A A;  3N9U C;  3W5Z A;  2ZNY A;  1CEZ A;  4ZVO B;  1S7H A;  2KYX A;  4QR1 A;  1I94 F;  2JFK A;  2IM1 A;  1UVK A;  3IGN A;  4RBV A;  2Q3P A;  9ATC B;  4JV0 A;  3VVT A;  4NI2 B;  3PFO A;  1F3V A;  1S9E A;  1ACM B;  1WEZ A;  3M30 A;  3I5C A;  2Y8W A;  3TJ8 A;  2VBY A;  4QIW D;  1B70 B;  4CO5 A;  1XNQ J;  2ASJ A;  1DTQ B;  2IRU A;  3GG1 A;  3C2P A;  1IBL J;  3F56 A;  1H7W A;  2YKN A;  3FCH A;  1YLX A;  1XK8 A;  1VJQ A;  1FJG J;  5KFZ A;  1LWF A;  1R8H A;  2BXJ A;  3GJT B;  3MOZ A;  1Q1K A;  3NGR A;  2YWE A;  2FLP A;  4LF8 J;  2UUC F;  3A3O B;  3SQG A;  2QG9 B;  4C7Q A;  3H5Y A;  4OI6 A;  3TA0 A;  4CDI A;  1TMJ A;  4RNH A;  3O8W A;  2FC9 A;  4FYY B;  2NXN A;  1U2F A;  2BAN A;  4DL0 C;  4L76 A;  2LVW A;  3ZZU A;  1Q5Y A;  2HVD A;  2DCL A;  8ATC B;  5D77 A;  4P75 A;  4E2F B;  4Y28 C;  1NJI T;  4USK A;  2ZVS A;  2AJQ A;  3G6X A;  1OYD A;  1RLD A;  4N56 A;  1KN6 A;  3IFE A;  3G71 S;  5SUH A;  2V8G A;  1BWE A;  4KB7 A;  5A2Q Y;  4LSL A;  3DDI A;  3ETM A;  1RAH B;  4DV2 J;  3DM2 B;  3M4X A;  3MM7 B;  3BQ2 A;  2DH7 A;  1XC9 A;  3G86 A;  2DGV A;  4K4V A;  2RU9 A;  4FNH A;  4YY3 F;  1VIO A;  4KR0 B;  3TOQ A;  3UDC A;  1IKW A;  3TZY A;  3M1V A;  1RTD A;  2AYB A;  1DZ5 A;  1UW9 A;  2R2U A;  1N56 A;  2HNZ B;  3J7Z 5;  1LWX A;  1HW9 A;  1HQU A;  3NMA A;  4OI0 A;  3MFI A;  1VQ9 S;  2XZD B;  4IDK B;  5H9E J;  1JKH A;  1C0U A;  2DNM A;  3MPD A;  3MZI A;  2HHW A;  1MSW D;  2GAH C;  2DNY A;  2CQD A;  1FE4 A;  4H4K A;  3DRX A;  4F4X A;  1BQM B;  4QIV A;  1Q4R A;  2HND B;  2BBE A;  4LFB F;  4L3N A;  3FBE A;  2YPY A;  3QLH B;  1FHT A;  1OY9 A;  4LQ9 A;  3K57 A;  2JEI A;  5EWG A;  1HNZ F;  4J9O A;  2EK1 A;  3D4J A;  3TW0 A;  4TU8 A;  4AXJ A;  2LCW A;  3JTP A;  4PYA A;  3IM9 A;  4Q43 A;  3EZO A;  1OYE A;  1ZTW A;  2YBV A;  2FC8 A;  2W9B A;  3OR1 A;  5HMX A;  2HFZ A;  3V5R A;  2XLJ A;  4U95 A;  1FTC A;  4IOA Q;  4R5P B;  1KC8 T;  2OUG A;  1UFL A;  3BDE A;  1V9O A;  2G2Y A;  2LQB A;  2ZKT A;  4ED1 A;  4FYX B;  2IAJ B;  4ZVR B;  2MZQ A;  1CUL B;  4ANC A;  3TUP A;  1YRX A;  3OL9 A;  2J7U A;  4DQR A;  1DHM A;  5HJX A;  3RAX A;  2CPY A;  4BLG A;  2Y3Y A;  2OEK A;  1R3N A;  4U7C A;  1LNQ A;  1HWI A;  3KK2 A;  1U6F A;  2XMA A;  1DLO A;  2CDQ A;  2KVI A;  1S6P A;  1SXL A;  5DDR C;  1HNW J;  3R5G A;  3KOA A;  1AZS A;  1RBO B;  2Y1R I;  4PXE A;  3ZTP A;  4KAI A;  2VJU A;  5AE2 A;  3KLH B; 
#chains in the Genus database with same CATH homology
 2AZ3 A;  3VGU A;  3L7U A;  4ANE A;  1XIQ A;  5C7P A;  1S57 A;  1KDN A;  4CP5 A;  1NDL A;  4ENO A;  1JXV A;  3DDI A;  1HIY A;  1NCL A;  3ETM A;  3WX8 A;  1F6T A;  4DUT A;  1U8W A;  3VVU A;  4HR2 A;  4UOF A;  2ZUA A;  3EVM A;  4KPC A;  3NGT A;  4F36 A;  3FC9 A;  3EE3 A;  1NB2 A;  4F4A A;  1F3F A;  1S5Z A;  3Q8Y A;  1NDP A;  3EMT A;  3ZTQ A;  3G2X A;  2DY9 A;  1NUE A;  2CWK A;  1BE4 A;  3VGT A;  3BBC A;  1NHK L;  3ZTO A;  2BEF A;  2DXE A;  1S59 A;  3FCW A;  3BBF A;  1B99 A;  1K44 A;  3Q89 A;  4S0M A;  1WKL A;  1NDC A;  2AZ1 A;  1NSP A;  1NPK A;  3EJM A;  5CAA A;  3FBC A;  3NGR A;  4UOH A;  1LEO A;  3BBB A;  1LWX A;  2DYA A;  3NGU A;  4DI6 A;  3ZTR A;  4ANC A;  3ZTS A;  1NSQ A;  1HHQ A;  5IOL A;  1WKK A;  5CAB A;  3B54 A;  3EVW A;  3R9L A;  2NCK L;  1WKJ A;  4W98 A;  4EK2 A;  1W7W A;  3B6B A;  3BH6 B;  1BUX A;  2HVE A;  3NGS A;  3FCV A;  3MPD A;  3Q8U A;  3VGS A;  1PAE X;  1NLK L;  4UOG A;  3Q83 A;  2VU5 A;  4AND A;  3BH7 B;  3GP9 A;  2HVD A;  3ENA A;  3ELH A;  1HLW A;  3EIC A;  3JS9 A;  3EVO A;  3GPA A;  5BXI A;  1MN9 A;  2DXD A;  1NDK A;  1ZS6 A;  2BX6 A;  1NSK L;  2B8Q A;  4DZ6 A;  3VVT A;  4FKX A;  1BHN A;  2DXF A;  1B4S A;  2HUR A;  4O0N A;  4WBF A;  1PKU A;  3FKB A;  3Q8V A;  1VYA A;  3PJ9 A;  3EM1 A;  3FBF A;  3FBE A;  4C6A A;  4FKY A;  3DKD A;  3Q86 A;  1UCN A;  3ZTP A;  3VGV A;  2B8P A;  1EHW A;  3FBB A;  1MN7 A;  1XQI A;  3PRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...