1MN9A

Ndp kinase mutant (h122g) complex with rtp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Activation of Ribavirin Analogs by NDP Kinase: Comparison with Other Ribavirin Targets
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords NDP kinase
total genus 47
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2002-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1mn9A00
3GP9A 2DYAA 3ZTSA 3B54A 5C7PA 1S5ZA 3ZTOA 1S59A 1PKUA 4WBFA 3FC9A 2B8QA 1NB2A 3BBBA 4UOHA 1WKLA 5CAAA 3VVUA 3NGTA 1EHWA 4C6AA 2AZ1A 2HURA 3BBFA 1NDCA 3Q83A 3MPDA 3FBFA 1NSPA 1BE4A 2HVEA 1PAEX 1LEOA 1NPKA 3JS9A 2HVDA 1NSKL 1WKKA 2NCKL 1KDNA 2ZUAA 3EE3A 4DZ6A 4ANCA 1XQIA 1BHNA 2AZ3A 1VYAA 1B99A 2DY9A 1NSQA 3NGRA 4F36A 1K44A 1F3FA 4ANEA 3EM1A 3G2XA 3VGSA 3Q8UA 3Q8YA 3DDIA 3EVWA 4FKXA 2BX6A 1B4SA 3ELHA 3NGUA 3NGSA 3VGTA 4ENOA 3GPAA 4KPCA 1HIYA 4S0MA 2VU5A 3BBCA 3WX8A 1XIQA 5BXIA 1NDLA 1HHQA 1F6TA 2CWKA 3ETMA 4EK2A 4W98A 2B8PA 1UCNA 3ENAA 1NUEA 1NCLA 4FKYA 3VVTA 3EVMA 1U8WA 2BEFA 3Q8VA 1ZS6A 4DI6A 3FKBA 1NDPA 3PJ9A 1MN9A 4DUTA 3Q89A 3Q86A 3ZTPA 1W7WA 2DXEA 3DKDA 3VGVA 3EMTA 3ZTRA 4O0NA 4CP5A 3BH6B 3FBBA 4UOFA 4ANDA 5IOLA 3FCVA 3R9LA 1MN7A 4HR2A 3B6BA 5CABA 3VGUA 1LWXA 1HLWA 3EICA 1JXVA 1BUXA 3L7UA 4F4AA 3BH7B 3EVOA 1S57A 4UOGA 1NDKA 3ZTQA 3FCWA 3FBEA 1NHKL 2DXFA 2DXDA 1WKJA 1NLKL 3EJMA 3PRVA 3FBCA
chains in the Genus database with same CATH superfamily
1S4FA 1RA7A 3UQSA 1S0NA 2R8JA 4I2QA 1VJQA 1N5VA 1I6JA 3GZ7A 4X64F 2POKA 3CDAA 2W01A 3OVSA 1J5EF 2DR8A 2A2DA 2KM8B 4F67A 4DPYA 2E5LJ 1Q16B 2KJVA 3B8HA 1S7HA 5HN0A 2ZJRQ 1QAJA 5T41A 3A3PB 2MDAA 3ILLA 1URNA 3V6JA 3OR1B 4TXSA 3EX7B 3ET6A 3CMQA 3SDEA 3PX0A 3MOJB 4U7UD 2MPUA 2RDIA 4NI2B 5CYMA 3LGNA 5F3TA 3Q83A 2HHHJ 1GXLA 4WYWA 2HRTA 3H2LA 4OX8A 4PQUA 2CNLB 3DLEB 2QV6A 3MPYA 3NP5A 5CCLA 5CCMA 2ADCA 2HVHA 3DLEA 2ZHBA 3IN5A 1TKZA 2JFKA 1IWAA 3OFEA 4N8NA 2FJVA 4JYAF 1HNIB 2BANB 2C1EB 2VKZG 3I31A 3QT7A 1Q81T 1S4EA 2MKSA 4DV6F 3E2EA 2C3MA 3BREA 2LLZA 4BWJA 3AOCA 3GCXP 3RBXA 2D69A 5B08A 1CJUB 1S9EA 4KC5A 3OTOJ 3CUNA 1NJYA 1N33J 2IA6A 2ZHAA 1S6UA 1ZM3A 4Q43A 2WVEA 1WHYA 1RKJA 1X4AA 2L3MA 4UW2A 2B43A 2W9BA 3D1OA 1O0PA 2DT9A 3H42A 5CA5A 2D9PA 3PTWA 3K8WA 2FDNA 3CIZA 4CNZA 1J5OB 3TZYA 2ZM6J 4JI1J 3N9UC 1PJ6A 3KHHA 3S8SA 1NK8A 5I42B 4JYAJ 3ZZUA 3K5NA 2DGTA 1VRQC 2VPZB 1SQGA 3EWGA 3W1YC 1NJWA 3EXYA 3E3XA 2RNEA 3DLKA 1WHVA 1SV5A 4DCOB 1VHIA 5GAEI 1QVGR 5ETLA 2E5GA 3HSJA 5DRKA 5HSPA 1Q78A 4AE5A 3T3FA 4LIRA 2MQOA 3W63A 1LK7A 3BDPA 3CO9A 1OYDA 4DL3A 5E3PA 1S9FA 4BC7A 2XY6A 4QU6A 3ILOA 1XWLA 3KXDA 1DAXA 5HVHA 2YWHA 4WCEQ 1XNRF 1WF1A 5B0CA 5FLXY 4DLGA 2IFXA 4AT1B 1RLDA 1RUSA 3L4BC 1HBMA 5D8HB 1MN9A 2QZ8A 4FYWB 4B9NA 1T8EA 2GQCA 4DPTA 2GIQA 2RDJA 3GJQB 2OD6A 3KHRA 2XB2D 3IG1A 3D4JA 3PXGa 2HLUA 4LSNB 5F8NA 3C6UB 3KLIA 3BH6B 4PXDA 3CCWA 2HGLA 1RAAB 4B3MF 3BQ0A 1T0TV 4KFBB 4H4MA 3FCVA 4PG6A 4YB6A 3R9LA 5HMYA 4K4TA 4DV3J 3G71S 1FEEA 3UD4P 1VQ8S 1HLWA 3W2VB 3Q2TC 2FJBB 2GHPA 2H48B 1FRXA 3PJWA 2C2DA 1FKPA 1WUUA 1H7XA 1T9YA 2B0GA 5LXRA 1RYRA 2PN6A 3AODA 3LOUA 2GJIA 1YBUA 1TL7A 2DNGA 1YJNS 3LP1A 2BR0A 4EUVA 1NB7A 2GVZA 1VQ6S 5AXMA 5D0HA 1NH7A 4C9DA 4L74A 1Q7YT 2R2UA 1FFWB 3CC7S 1TUVA 2WTFA 3JSRA 2MKJA 5MAOA 3CCSS 1S9GB 3PV8A 1N48A 3QSYB 3W64A 4R5PB 1X9SA 4ERDA 4DX7A 3MAHA 4J9KA 1X4EA 2EBEA 4ECVA 4CCHA 1N6QB 1FE0A 1U26A 1KC8T 3D6FB 4JI3J 1CULA 3DOLB 2WHOA 1JLAB 2OPPB 3BJYA 4Q0BB 2XMWA 3RR7A 4M95A 1UVNA 4JV5F 2HRUA 4EU0A 5IZHA 2R4FA 3IP0A 3P3DA 3H0PA 3LA0A 4ZK7M 1HQEB 1ZTWA 3OSNA 4ILMA 5KFIA 4ZVPB 4XK8C 1UPMB 4KTQA 1R8BA 2CZ4A 4DQIA 1CJKA 4OFZA 4FNIA 2MGZB 4QYZK 2IVYA 3IWLA 2KFZA 3UVJA 4OHYA 4I6WA 1TR0A 1NDCA 3CCZA 3TWZA 2KB2A 3BSCA 3FBFA 3NRBA 3GQCA 2QTWA 3HULA 1T9TA 3A8KA 2YQ0A 3RJMB 5KG7A 2IMOA 1N5YA 2CQCA 3QFHA 4ECUA 5EWFA 2C22A 1C1CA 2HGNA 4ZVFA 4WF9Q 2FY1A 4I0WA 1X8DA 4FXWA 4OMFG 4HL9A 5L39A 2KFYA 3I5CA 4H4OA 1NKEA 1RAGB 2J0SD 1SC3B 1HNVA 3KK2B 2QSFA 1HWJA 2YKAA 4C3MA 1R0AA 2KRRA 2QEXS 3IRXA 2ZD1B 4ECRA 5AJ3J 1U4BA 3KHLA 4RW9B 1B3TA 2VFRA 2VB6A 3GU0A 4UZCA 1YIJS 3BSNA 2MQMA 2DHAA 1CJTB 2BACA 2GO8A 2W25A 3LW5C 3A4TA 3MMBB 4HT7A 5C25A 3W9IA 1ZPVA 4CLZA 4ENOA 4UQGA 2XO6A 2R7QA 3RBEA 1R6YA 1YJ7A 4GKJF 4DG1A 1SQFA 4OI4A 4Y28C 4Y00A 4Z7CA 1NSAA 3RW7A 2C3UA 4CNYA 1C0TA 2N7YA 2C2EA 3BBCA 2RE1A 1XC9A 1XIQA 5CYMB 5CZVA 1HWUA 3DU5A 4B3RJ 3I9ZA 3HI9A 3T1HF 1YTYA 1S6QA 4WJBA 5KFQA 5KFCA 3C66A 4CLTA 1WF0A 4QBUA 3MMAA 2DH8A 4YHHF 2H5JB 2HHPA 3W3SA 1HNIA 1WF2A 1RDRA 1GFWB 3D9BA 3V81A 1TKDA 4K50A 1VC0A 1UEUA 2CNOB 4C97A 1EKSA 2FVSA 3OUYA 1F2HA 2VHGA 3LUYA 3MM5B 2NPIA 1C1CB 2VQEJ 1IUJA 3CD0A 3GV7B 2KRBA 1RK8A 4USKA 4DLEA 3CB4A 3DCAA 1Q0NA 4WZQA 2VH7A 1BLUA 1WI6A 2KU7A 3UFCX 5E41A 3PDNA 8RUCA 2F1FA 3KOAA 1APSA 1HBNB 5E2QA 4LUBA 2HAIA 5KFDA 1VLYA 3M4XA 2C28A 2KO1A 4JI3F 4ANDA 1VFJA 2CYYA 4B02A 5KT2A 1KRPA 1XMOJ 3JSBA 2ZBQA 1WC5A 2DPIA 2ATLA 2QIFA 2MQPA 2DCUB 2CZ9A 3A8EA 2BJ1A 4DUZJ 2YKPA 2DKOB 1Y00A 3MAQA 3E01A 2ZKTA 4YR0A 2JVOA 3OL6A 4DX8H 1RQ0A 3CIMA 4JI6J 1VQLS 3S1TA 2F9JA 3M30A 3W65A 1V6HA 2MQNA 2RHQB 1IWGA 2ZITA 7AT1B 2ZH2A 1VQOS 3AOBA 3MEDB 1U02A 1JIHA 5KFMA 3U1LA 3K17A 5KFLA 4ZLNA 2UXBF 1NJIT 1JKHA 3BEGB 1GK8A 5K20B 5GAEU 1RT3B 2ZOFA 1RLCL 2K7KA 2VONA 4A46A 3MR3A 1YVFA 2QC3A 1S79A 4N56A 2WZ1A 2HQCA 4MKBA 1FRLA 1RAHB 4AQYJ 1RWPB 2MYFA 2NR0A 4J5OA 4ECWA 1UFKA 3C15B 4ES2A 3HFKA 1HNXF 3C6TA 1DJ0A 1Q8LA 3IFEA 1RYSA 4C2MA 4KGKA 3HM9A 2HQGA 3TAMB 3CJ8A 2XLJA 4WPAA 1KHWA 1TMJA 1U1OA 2XULA 2WVCA 3JQMA 4RW4A 2QA1A 1U45A 2N3OA 1XR5A 4RW6B 3RTVA 1YITS 1VQ4S 1M5PC 1XNRJ 5GAHI 3K0JA 2OH2A 2YWWA 1TUGB 2GIRA 2WVFA 2ZUGA 4A8SA 1KNZA 2AZ1A 1TL7B 2QSWA 4F0KA 2E9RX 3GB0A 3UDVA 3KNGA 3MPDA 4NZ7A 3QT5A 1X9MA 2JH3A 3H8YA 1HBOB 2L9NA 3UW1A 2OPQB 3VQTA 2HBQB 1S10A 4RWXA 3TVZA 2LYVA 3DRRA 2HVIA 1FHTA 3ZFVA 2V8DA 1FK9A 5HP1B 2HVDA 2OP5A 4MIAA 4EO8A 3KTQA 1OS5A 1PYTA 3AQPA 1FXRA 1VI7A 2C2KB 1HMVA 2I1RA 2UUCF 3QIPA 4DS4A 2YKQA 4A8FA 2DITA 2R3VA 2YWFA 1XR6A 3HJVA 3T1YJ 2UXBJ 5IC6B 1ZAXA 4ID5B 1CG2A 3UDCA 3KLGB 1HNWJ 4I6AA 1RISA 3GIMA 5HROA 2MZRA 5A8KB 3OL8A 3CCUS 2R9LA 2ZDOA 4WXOA 2FHOB 4JI6F 4LFBF 4F7VA 5ADZA 4AL6A 3R5CA 3KKFA 2BQRA 2DTJA 5GAGI 1UEVA 3GWCA 1K0VA 4A8OA 2HHXA 4TY8A 3DXBA 3DN9A 3ETMA 1XMOF 1BQMA 3GJTB 4JI0J 1UCNA 2YXLA 5EX3A 2RRNA 3P5BP 1HWIA 2L9DA 1HI8A 2IM3A 2MB0B 2C42A 2AJFE 5GAHU 2BUNA 1QAIA 1REVA 1FO1A 4RZRA 1IBKJ 2MLXA 1REVB 2KKHA 3L7OA 3N5FA 3W66A 2XY7A 1O5JA 2ZZNA 2YNHB 1RTHA 2QL7B 3MM8B 1SVDA 3I9V9 2MKHA 1RTJA 3QMQA 3R27A 3SSSA 1H73A 1NMEB 3VAKA 4ED6A 4DR3J 3HCXA 5JMNA 1KHVA 2F4FA 2BABA 3S01A 1T9XA 5LJ3Y 2Z57B 2G2YA 3U1MA 4OZ0A 2CVEA 2H54B 3Q86A 4ZP6A 3VGVA 2OFGX 4EEYA 3EMTA 3FSXA 4M94A 1E6VB 2R7XA 2XYPB 3NNHA 1HNXJ 3AXMA 2OAUA 4NYOA 1TFWA 1BD6A 2DNLA 2WB4A 5K8NA 4ES3A 4GC6A 2FZCB 4KR0B 2V69A 4FBUA 1U1RA 2ZNYA 3M8QA 1SIZA 4RW7A 4A4JA 4A8KA 3NLCA 5A8KA 3C46A 1IBLF 3M9NB 4I68A 3QWPA 2DNOA 2N4DA 2OPQA 1C4CA 1K9MT 4P7VA 4OV1A 1ZOTA 4DJBA 4NWBA 2VL1A 5IT9Y 4UTGA 4GKJJ 1XEZA 2HS0A 4LSZB 2D3ZA 3THVA 1VR6A 1WG5A 4WFXA 2JRSA 4F2RA 4PYDA 2GIFA 2LEAA 3QIDA 2Z4PA 4B08A 1UZDA 3CPWR 3RB6A 2IRXA 3IXQA 5D4NA 2V0NA 5DQHA 3FCWA 2W8KA 2WONA 4P2FA 1VQ9S 2KZMA 1TAUA 3R5AA 3SCIE 3I82A 1MWZA 3M2UB 3M2RB 1KEKA 3CC4S 2ASYA 4F26A 4MJKA 5D78A 4K5SA 1XN9A 1Y7PA 4X2BA 2DCLA 1PG5B 1MSWD 1RTDA 4HDGA 4ZVOB 3GP9A 2MEWA 1TL1A 4IFYA 4R5PA 1FRMA 3P96A 3ZTSA 1HHSA 1UWBB 3OW2R 5J1EA 4F2SA 1S5ZA 3DMJB 1XMQJ 3TVKA 2DPJA 1U24A 1AW0A 3H2UB 5T7LA 4WP8A 4F4XA 5L9XA 1T9UA 4K4ZA 1DTQB 3A3NB 3MOZA 3WC0A 5T14A 3QJJA 1DTQA 4OIXA 5ETPA 3T6BA 2H5IB 3OQ2A 1EHWA 1RWOB 2JWNA 4HHHA 2OPRB 2BW2A 2OEMA 2ZKUA 2RRAA 5U47A 2Z2LA 2P5VA 1UMJA 5A0YB 2V34A 1Z4UA 3B78A 5DG9A 4U6PA 2PFDA 5IQQA 3DLGA 4PKDB 3I32A 3MDFA 5H1SV 2HMIB 4N41A 3AD9C 4X4RA 2ZD1A 2R7RA 2PMHA 5KTQA 1J2VA 2DH9A 1HBUA 2AW0A 5KT6A 2LECA 1PO6A 3RGIA 4U9RA 2DRBA 3MPUB 3K5OA 5CD4H 3IR5B 1CS4B 2VPWB 2CPIA 2Y0BB 3HVAA 4KGZB 1VC6A 1L3VA 4KHMA 3W61A 2WK4A 3MZIA 2GGPA 2UVVA 2AWZA 3G6ES 1IKWA 4XPEA 1JLCB 4R8UA 4DR7J 5JUMA 1L3KA 2DBBA 3HDSA 4ECZA 1TVRA 4USWA 1YG0A 1U1NA 1TL4A 2HQFA 3MUTP 4FZVA 1E6YB 3H7HB 4LR8A 3QQCD 1C0UA 3TX0A 1UP1A 4Y6IA 3EVWA 4X4SA 2HHTA 4IG0A 1NHVA 3M6VA 3UI3A 1GMWA 3MFHA 3DDNA 2ZE2A 3KLEB 2J8AA 2YNFB 3FRZA 4FN5A 4ID8A 4I2PA 3EZ5A 1S99A 3PYGA 2MSTA 4D3GA 4NLGA 1S1WA 1RP5A 2Q43A 3IR7B 5A8RA 4C4WA 1U1MA 3NWRA 4NA3A 2YX1A 3DRSB 1N36F 4LF7J 1VQSA 3DDKA 4A8YA 4A48A 3DXSX 2B8PA 1V3RA 1UVLA 2CJQA 2E1PA 2OEJA 2ZFHA 5DM6Q 2HFZA 2KG1A 1LWEA 3GJRB 4LBHA 1RAOA 1T11A 4DCJB 3GV5B 1Q8IA 1XTZA 2W2OP 4YP3A 1D9FA 3TUPA 1U8WA 4K4VA 3CCJS 1WC1A 2N7CA 5KT7A 2UVWA 1M1GA 2BEFA 4DV1F 4J9NA 4DFJA 1VQ5S 4DI6A 1X4CA 2RUSA 3I0RB 4ILRA 4LREA 1Q4RA 5BYSA 7FD1A 3G8QA 2HS3A 3LGMA 1PBUA 1RGVA 3QATA 4FVMA 4M1KA 4YEAA 4YR3A 3I56S 2HFNA 2W4DA 3FQKA 3M7VA 2NPFA 1JJ4A 5AE3A 3BGRA 1M5VC 2BBEA 4PR6A 4YR2A 1IKXB 3J7YU 3MD3A 4WU2A 1U6FA 4NOHA 3LAKA 1YJRA 5IXUA 2ZZTA 1VBZA 5D4LA 5KFRA 1WC4A 3VAHA 2QLJB 1KWMA 3KYLA 4ECYA 2BOPA 1H7WA 1VRTA 4CIOA 3Q8PB 1I3OB 2XMVA 4UUWA 2R8GA 3CJ4A 1HWKA 4O3OA 5LM7E 4I4BA 4JV1A 1EJ7L 2RSQA 2XGQA 1T05B 3Q0AA 3KJVB 4IR9A 1ROFA 3DFEA 4W4MA 1Y10A 3DM2B 4IO9Q 3M8SA 3G4SS 1TV6A 1B70B 2EPIA 4P6QA 5F41A 2RQMA 4JI1F 1C4AA 4C8YA 4Y2MA 2WSCC 1ZBTA 1DARA 1KVKA 2PEHA 2V68A 1WACA 3N5BA 1FNMA 2VA3A 3QBCA 1S1UB 1U2RA 4G1PA 3VQSA 2VJVA 3O8WA 2IBOA 4LF4J 2DXDA 3AD8C 4DZDA 2DNYA 4DFPA 1N33F 4CO3A 2Y1JA 4PXEA 4EMDA 1DQ8A 1OYEA 2HNZA 1IKVB 3QYYA 3HZGA 4OHVA 2AGQA 1C0TB 4NZ6A 4LQ9A 2YPZA 4TLQA 5CH7B 1S1XA 3OTEA 5D77A 4RU2A 4F4YA 2Y1IA 1H2TZ 3GONA 3CEDA 3FVYA 3POTA 4J9LA 3CO0P 4LRAA 3RU0A 1X0FA 1VQYA 2ZH7A 1U47A 2V4JB 2OKQA 3I0SA 3SSRA 1WKLA 2R7OA 2HHHF 3ISND 4V1Ak 2OUGA 1ICEB 2XNQA 4CM2A 1U6ZA 3MD1A 3NGTA 2VKRA 5F0WA 2KH9A 4ZN3A 4DV5J 4J9PA 1FK9B 2FC8A 3OJSA 3M2VA 5HP1A 3NMAA 3ZZPA 1NJXA 1O8BA 3CCTA 1FWLA 3V6DA 4OJ3A 1VOMA 2X3GA 3MM7A 4I7FA 2BMBA 2XHCA 4X66J 1XK8A 2AQ4A 1H74A 1VBKA 5HAOA 3OTCA 4U7CA 4DL7A 4MFBA 3I4HX 2B9YA 4NYPA 4U8VA 3J7ZT 2OSQA 3Q8RB 1G1XA 1N88A 2EFQA 1VQNS 2DJWA 2GMJA 2XGPA 1GX6A 1KDNA 4G65A 1RHRB 1XJWB 2CQ4A 3RB0A 2P8IA 4PPZA 2W7OA 2LU1A 3IG1B 4JI8J 5THWA 2YKMA 1QTNB 1LW2A 2DY9A 2UUWA 3HVTA 3W7BA 4Z2XA 4DR2J 1RU1A 3KJQB 4H4KC 1CJVA 2B5JA 1SI9A 2DEJA 2PGCA 3HSDA 4N47A 4ANEA 1FNXH 2KVQE 3EM1A 4NRUA 3OVBA 3U02A 4PXCA 2DGXA 3V2UC 3MMBA 1IKVA 1NH8A 2HK2A 2HNZB 5GVQA 2XMUA 1W2IA 2MQ8A 3WBZA 4DSIA 2VOOA 2IA0A 1SQEA 4S0MA 4JI7F 3X1LB 3KK1B 2CUYA 4HLBA 2ZHOA 2MKIA 5A0YA 4GVBA 1N56A 2V9WA 3R2CJ 2W7PA 3DI6B 1S6OA 5A6PA 4F3OA 3CTRA 4YY3F 1K1QA 4DV5F 3V5RA 1HBNA 1JLGB 2FD2A 3ILJA 2GNKA 4ZLJA 4LFAF 1RTJB 2KM8C 2PI4A 4M5DB 4KRWA 3TZXA 3ENVA 1R8HA 1K1SA 3PJXA 5D0EA 1AXQA 3OSPA 3NCPA 5FIIA 4YMEA 3DLJA 2EWHA 3MI7X 4L72B 2W4CA 2A6OA 4JI5J 2XO7A 3W2WA 1H0HB 4USVA 2FLPA 2CXEA 2RF2B 2JDJA 1WWHA 3M6XA 1RCOB 2P9EA 2XBPA 4E8UA 1U1PA 1DLOA 3CJ0A 3LO3A 3US5A 4KB7A 3I96A 2OPSA 1R0BG 2B9XA 2FIUA 1R31A 3M8PB 3Q89A 4MK9A 2XZDB 4MTPA 5KT5A 3GILA 3PO5A 1RT4B 4OI0A 2E5LF 2P6SA 3G9CA 3DGPB 3ISZA 4OZ1A 2HK3A 4CRJA 4CYUA 3KK3A 4L6V3 4B9UA 2EFNA 3KG0A 2BXJA 2HG4A 3UN2A 3FJ2A 3M6UA 3A13A 5F8LA 1FKOB 1S1WB 4LIWA 4DV0J 3RG6A 2W7AA 1RJJA 2RU9A 4ECTA 3DHXA 1I94J 3D0IE 2ZOGA 3AOAA 1MROA 1QE1B 3TJ9A 3TNVA 1D3WA 2FJAB 4USIA 3TUZC 1G3OA 1EIYB 4AXIA 4C8KA 3OHBA 3N6NA 5DM7Q 2EBGA 3QFWA 4ELTA 3THPA 2CJ9A 5J1NA 4RU9A 1S1TB 1UVKA 1HMVB 2ZBPA 3TUJC 2MTLA 5M2UA 3QGHA 4DV2F 4QWEA 3DLHA 1RWXB 1S1VB 1SBRA 3W62A 2ZVSA 4IFYB 4YS2A 4X4PA 4DF8A 2OIHA 3Q2SC 1YJUA 2AJ1A 1DFDA 3AB2B 5KOWA 1DZ5A 2YNFA 4ED3A 1ZZNA 1G7CB 3BPSP 2R7VA 1GXTA 4ZIVA 3QAEA 2VJUA 3UPFA 1VIOA 3HHEA 5L1KA 2J0XA 5I4MA 3CJRA 2GMLA 3ET6B 2AYGA 1LWCB 3QZ8A 4IRCA 2R7WA 3R7BB 3LP2A 4NE9C 3W8PA 2FJDB 2XSFA 4CO2A 4K2JA 2BE2B 5J2MA 1NK5A 1K73T 1Y5IB 2XS7A 1KQKA 2B4OA 4PUOA 4AL5A 1JLGA 4EZ6A 2UZAA 4KGVB 5IWAJ 2MJUA 3HHLA 4PYAA 4K4XA 3RBDA 2HURA 3OR2B 2KHCA 1RT6A 4E0DA 2HWIA 3RRHA 2FVRA 1SKRA 5LMUF 1FRJA 4CTAB 4OI2A 2DHGA 2WCXA 5ETQA 1HQ2A 1Y3JA 4ECXA 4DR1F 1WOSA 3J7AN 1TKXB 1UKUA 2WW8A 3CJTA 3O1LA 2R2TA 2IBKA 1H6KX 1QDUB 3HP6A 2F4VJ 4LVOP 1WKKA 2VDHA 1MMLA 3HVWA 5IM0B 1X4FA 3CE8A 2SXLA 3CWJA 4MMOA 4NLRA 5D6GA 4ZCKA 4MH8A 1B0VA 1XQIA 2D3O1 3OTBA 1IJEB 4M5KA 2AHOB 2AZ3A 2XS5A 2M88A 1SL1A 3TX8A 1D09B 1B64A 1SB6A 4LBPA 3MUMP 3GG0A 1RHQB 1VQMS 2F65A 4KY3A 2WAQD 1EX8A 3TQEA 2RH3A 3IS9B 3QO9B 4WFYA 2LQ9A 2ZH9A 1RAIB 2BX6A 5CYQA 3CMAS 2BQ3A 2F8EX 3BPDA 4A8WA 2HAFA 1Y5LB 3EGNA 3SFGA 3C6TB 3FNNA 4USHA 5HLFA 3FFIB 4PG4A 2QLBB 2WVBA 1TL3B 3CD5A 4GC7A 1S9GA 2A2CA 3D1QA 5C42B 1SH0A 4V19J 1KOOA 4JUZA 2DNPA 4OI1A 3ZNJ1 5IWAF 1GNKA 5K8MA 1NKBA 1KP6A 3ENAA 1NUEA 4RBTA 1HQUA 1FJEB 2NSBA 4MYTA 5D4OA 2BDPA 4IKAA 5D0RA 2G2OA 3BDEA 1YKWA 1FWKA 1HBMB 3MHYA 2QMWA 3C14A 4N76A 3OUYB 1S6PB 2M7SA 3K59A 3EDQB 3Q8VA 1GAOA 2EFGA 3Q23A 1CLFA 2DGOA 2HHWA 3PJ9A 1N36J 1UVIA 1NO8A 4KHRA 5DQGA 1WC3A 3MR5A 3GFXA 2V9KA 4M5NA 3BGUA 3ZTPA 4HH0A 2QL9B 3WZ0A 2J9EA 4O0NA 5DS7A 2FGOA 4LSLB 4OYBA 5CQGA 3ZZZA 2NSCA 2LQJA 2XMTA 3TI0A 1CPZA 4UY85 1RWMB 1UW9A 2J6SA 1MN7A 2LQBA 3DLKB 4YN3B 2G0CA 4CT9A 3Q8SB 3VGUA 1SJ3P 4X4VA 1N0UA 4RNHA 3ENWA 3EZOA 5SZTA 4ZVEA 1W26A 2OELA 3EICA 4CTAA 2XS2A 1NZ8A 3ETOA 3RW6A 3T5LA 3AY0A 3VF0B 2XYHB 3N0VA 2JLFA 3P5TL 5ETKA 3SSQA 2ZM6F 5K8PA 3KG4A 4DV2J 3LH2S 4CI0B 1QSLA 3OXLA 5LOQA 4OLPA 1TP7A 4DMZA 1S57A 4QPXA 1BQMB 3AJDA 4WK3A 2F8HA 4ZPBA 5IV4A 2L41A 1R7IA 1V3SA 1NK4A 2QA4G 4KQZA 3ZTQA 4IQXA 3LPYA 1NHKL 2AYMA 5LMNJ 3BV8A 1IKYA 4U7UK 2KFNA 4C0BA 2ZWPA 1N0VC 4Q8FA 2XSJB 3MXHP 3W8GA 4DR3F 1RT1A 2DHHA 3PRVA 5HROB 2FJXA 3T5JA 4WZMA 1I1GA 1FDNA 1PYOB 4LR9A 2FZKB 4XDCA 4L3NA 4O44B 4DV0F 4C98A 1KLMA 4C3LA 2F3JA 1TELA 4GMKA 3SFUA 5A2QU 3NL0A 1NAQA 3OFGA 2CG4A 4K0KJ 5F8MA 4WFNQ 4Q8EA 3AA8A 1XMQF 1CJUA 1S9EB 3M1VA 3WX4A 3R1HA 1T02A 3HT0A 4RW4B 3WIVA 3NCQA 4CLFA 1RBLA 3TAMA 2AV5A 1JJ2R 1EB0A 4LFCF 1M90T 1K47A 4RUAA 2BE9B 3AA9A 5D15A 4ZVHA 2E1AA 5JJBA 3NOGA 1YZ7A 1VIXA 3C14B 4PABA 3R8YA 4C7QA 1HBOA 4WFAQ 3KLHA 2YKMB 3QLHB 1DTTA 1RTIA 4IYQA 4NMLA 4DSFA 3AB4B 3P8BB 4FDFA 2ZBRA 1HL6A 5JXSA 3KG1A 3UNGC 3ZZOA 4ED2A 3G6YA 2XHWA 1WOPA 4KT0C 4ED0A 1VISA 2JFDA 4WYLA 1G2EA 1F60B 3MEGB 4GRSA 1VYAA 4MFBB 4BHQA 2I38A 1RWKB 1UJ6A 2M4MA 4ZITA 1Z2LA 4KHPJ 3MEEA 1XR7A 1NK0A 1ZYQA 2CQDA 3OFHA 3M8QB 4RW7B 2CIMA 5L1IA 3GV8B 3CW2C 1UFLA 4G6VB 4GVLA 3VGTA 3I87A 1G4CA 2YNGA 3NS7B 2HNYB 1WEZA 1KFSA 2F5GA 5JVHQ 2R2RA 2IM0A 1H72C 5CXTA 1K0TA 2ASDA 2FHMA 5C2CA 1RT3A 2YX4A 2IVFB 1N52B 2YH0A 1D0EA 3IBFB 2DGQA 3MMCA 1HHQA 2LFVA 2VD3A 1KKHA 4PQAA 4UOCA 1JXLA 3UCUP 2UUAF 1SC6A 2CDQA 2QO3A 4K2XA 2IJRA 4JI2F 3H25A 1YK9A 2MLZA 2NXEA 3HMJG 4ITSA 1FJ7A 4NLWA 3CJKA 3HKZD 5A8WA 3JSMB 1BGXT 1UA0A 5DDOC 2MXYA 4ZA1A 2IC3B 2LP4A 2IHR1 5KFHA 1FESA 1RWVB 5FDLA 2ASJA 4XIUA 3H5UA 2LU2A 2XI3A 2M52A 3IGVA 4NLXA 4PEOA 3FKBA 4JV2A 1HARA 2DHXA 2V2VA 1YRXA 2B7BB 2W8LA 3PYEA 4NLTA 4RWWA 3T41A 1F5AA 1OY9A 2A6MA 2DIVA 3GE9A 4F25A 1TU0B 2ZWOA 5BJRA 1FVSA 2F40A 2Y0SD 2FJWA 2VOPA 4LRFA 4OQJA 4QWCA 4G3IA 3UDEA 5AE2A 1JJCB 3T6JA 5ETOA 2JOQA 2GJ2A 2M5YA 1GX5A 1CC7A 2CJKA 3MR6A 4JV0A 1VRTB 3H20A 3CMES 4OHXA 4OZNA 1RT7A 4LF4F 1YQHA 1JXVA 5HL7Q 4NCBA 3LQVA 2ILZA 4QIGA 4QZVB 4QR2A 1QD1A 2FYXA 5IT4A 3BO4A 3V81B 4FF1A 4E2FB 3IMQJ 2K3IA 4C8MA 1NDKA 3IRXB 1SKUB 1RACB 2GQQA 3R6GB 4LSNA 4E98A 2JEFA 1JLFB 4TKTA 2O3DA 3AJ2A 1FXLA 1AFIA 2MY8A 2E1MC 2VF3A 1LFWA 2G1HA 1Q95G 2XYGB 4GO5X 2R8KA 2E44A 2UVRA 1LNQA 2O1PA 4FVCA 2V2QA 4N5SA 1ZTTA 4DBQA 1C0UB 2RKIB 3H40A 4RW8B 3KUHA 4IDKA 3RAMA 4KIAA 1LWFA 2E7WA 2FB0A 3AXKA 1KQGB 3ZTOA 3HHDA 3M6WA 3GCWP 1SH3A 2R7SA 4KGMA 3TARA 1NB2A 4ZLLA 1AB8A 3LTOA 2DH7A 4NRTA 3C2PA 1X5OA 3PHTA 3WDOA 4YHHJ 4L3KA 3BB5A 1GEHA 4TQSA 1S77D 2HWHA 1QJHA 3IM8A 3CJ3A 3OJUA 2DR7A 5DZ6A 2AEMA 2I8EA 3BBFA 4X65F 2KYZA 4KFBA 5J2MB 2UXCJ 2IRYA 2RF2A 1MW7A 6FD1A 1OO0B 1PAEX 2RQKA 5I42A 1GMUA 3TUIC 1RE1B 4CM0A 4PQUB 4KKOB 1TKZB 1FI4A 1H2UX 2DD8S 4ZVSB 4ZMMA 3M8RA 2QMUB 5KFYA 3JAMU 2P9CA 2J6UA 2V4RA 4TU7A 1U49A 1NJZA 4DZ6A 1WJ9A 2KJWA 2CAJA 5EHHA 3HX9A 4DUYJ 3EGZA 1JLFA 1KTQA 5HVGA 3B4DA 2X1FA 3MMAB 1EQ0A 1F9EB 1SUQA 2EFVA 1M5SA 2UUTA 2NLWA 8AT1B 4ATNA 2AJQA 4DUZF 3SXLA 2KI2A 1L3UA 3VAGA 2OLWA 4NXMF 3VGSA 3N6MA 2V50A 3Q8YA 4ZDNA 3L95X 2PO4A 3NGSA 3W9HA 3PKYA 1HNWF 1RT7B 2N4CA 3PNIA 2ACMA 4HDHA 4P73A 5LJ5Y 5I3UB 4DR6F 4XTTA 4X4NA 5AE1A 2CQBA 2M0GB 3D3BJ 3OLBA 3KLFA 4LT6A 1NDLA 2GA7A 2W9CA 1LW0A 1Q5YA 1NRKA 3ILIA 4FS2A 1GXUA 2XSJA 1B0TA 2H51B 2PA8D 1JLQA 2VQEF 2NREA 2F7VA 4LF1A 3UNYA 4XPCA 4IG3B 4FXDA 4Y65A 1NCLA 4PWUA 1MU2B 3JQKA 4NPOA 2RB7A 1TL3A 1YBAA 3QAUA 4DU8A 3DLLQ 4DQQA 4M8LA 2KG0A 3PRBA 2VV5A 3Q8QB 3JTPA 1FF2A 2G9OA 1HFEL 2MKYA 5J1PA 1HNZJ 1RCXB 3D6TB 3MCOA 5G0RB 3V4IA 2LXIA 5BYQA 1NZAA 2LXUA 1OSDA 3CD6S 4MKVA 2WB1D 3VHQA 3CULA 3OXFA 3I0SB 3FCHA 2FHJA 3R6LB 2MGZA 4QWBA 1X31C 2RD5C 5EWEA 2C2MB 2G1DA 4ZOSA 2W4PA 2RIJA 3OL9A 1IR0A 4AXJA 2VC1A 1U0HA 3UN3A 3VR1A 4UT4A 2JEGA 5CABA 2YVSA 2CWXA 2AGPA 3KUEA 2IAJA 5HMWA 3NGDA 3MPWA 2UV8G 2XI2A 4DX6A 1WEXA 1Q86T 2E66A 2CPDA 5A76A 4J9VA 2H5EA 3L7UA 3DOKB 5E0OA 4X62F 2HVZA 3KLVA 4I69A 2V63A 4NEZA 4URSA 2MZ1A 4USTA 1WTFA 3R97A 5I3QA 3OT9A 2CQIA 2W2QP 4USUA 2EW9A 4CLLA 1FJCA 2LDIA 1Y5NB 2Z30B 4O44A 3SZ2A 4B9SA 4IH6A 1ACMB 2V2ZA 1RHKB 3DM2A 1VQ7S 5GADU 3FBEA 1GMVA 5C24B 3T5HA 4JI8F 1KSPA 1URRA 4NEYA 3BQ1A 5I3PA 2NXUA 4K4SA 2RRBA 1RSCA 1AROP 1REGX 2AX0A 3NKYA 4C11B 2Y1LB 2BOAA 1R8PA 2RQ4A 1SL2A 2CZVC 4AUKA 5DETA 4OYOA 5F0UA 1ZAVA 4ZP9A 3R5BA 5LSLA 4MAKA 3IBCB 1LWEB 5KFVA 4HHUA 4ZCMA 2CPYA 2B8QA 3FC9A 4TN2A 5D4PA 2MQQA 3K5LA 2BRLA 4UOHA 1GTEA 1R89A 4I56A 5K14B 5CAAA 2FZGB 3MURP 5KFTA 1WELA 5IV3A 1VBXA 1U2CA 1JLQB 2F8MA 5M2PA 2WOMA 3FGVA 3I0RA 5M2RA 5E33A 2HFVA 2QA4S 2IPOB 3VAFA 4ZP7A 1OIAA 1IM6A 1VMBA 3AJ1A 3W5ZA 3JTOA 1HI0P 1IN0A 2PC6A 5F3ZA 2IMWP 2DK2A 3B4MA 1RZMA 4NI2A 4ZN1A 1NPKA 5E3CA 1ZH5A 4DL0C 4P75A 1NKCA 2ZUAA 4NCGA 4DL5A 1SL0A 1NNDA 5H9FJ 2KTQA 4RR5A 2E7XA 3MCMA 4HH1A 1ZM4A 3HF5A 5LSRA 1KOHA 1PCAA 4J9QA 3TEHB 3H90A 5KFGA 3LWMA 2BJ7A 4DR6J 2ZE2B 2JEIA 1AZSA 2RS8A 3FZBA 4NL5A 2DO0A 4DV6J 4LRCA 1FFSB 2B4PA 2KDOA 2L48A 1YJ9S 5FLXU 4DV3F 4F4KA 1SKWA 4C11A 1WSRA 3Q8UA 4X4UA 2PT0A 2Q6CA 4U95A 4X4QA 4KYZA 4DN9A 4KPCA 5J2QB 4F3QA 3ZZTA 4O3RA 2B3TB 4OZLA 2VUGA 2DR6A 2A1BA 4WE1A 4TU8A 2LCWA 2UUCJ 4NX9A 5AXLA 3S6EA 2CWKA 4F4WA 3G82A 2AD9A 3PYDA 2JJ4D 4ZP8A 1FD8A 4AYBD 5B0FA 2UUBJ 4OZ2A 5LT5A 3OLAA 1U25A 5KG4A 1FJGF 5DZ7A 1T94A 2C2RA 2YWGA 2RU3A 1RKIA 3SCLE 3G96A 1P9YA 2EEYA 1HPZA 4EZ9A 3UVJB 4B3RF 4HHJA 3OFFA 2OPRA 2LDYA 5B0AA 1JWWA 1JXEA 5F8GA 1N5TA 2M2BA 2IY5B 5KG5A 3E8OA 4P10A 3ZTRA 5DDQC 3M32A 5B0EA 2ALZA 4F8RA 4FP9A 4OYZA 2QJ3A 3SV4A 3NS5A 5IOLA 1NPRA 4KBIA 4NA2A 1WG4A 4A8QA 3BN7A 4LF7F 3DGPA 2PI5A 1WNEA 1N32F 1VQKS 2CNNB 3BM7A 3GR1A 3KLHB 3MR7A 4KHPF 1Z1ZA 2B6AA 3DU6A 2FLNA 1P1LA 4ZCLA 1FRIA 3O44A 3PIOQ 2ZJPQ 4OHWA 5D3GA 3IWXA 3HVTB 1J27A 1MU2A 1F3VA 2NYIA 4RNFA 1S97A 4B9LA 1W2BR 4W92B 2E1CA 2QT7A 4OI3A 3IR6B 4K59A 4IDKB 5D0GA 1FX2A 1V3ZA 5GMEA 4LMZA 4QQBA 1KBRA 2MKKA 2MZSA 4LF9J 1EKRA 4J9SA 5EUHA 2CJBA 2IIHA 1L5UA 3POTB 4LVNP 1YBTA 2J0WA 3MEDA 2BZ2A 5KFUA 5KFEA 5L8RC 3NBPA 4OHZA 3ZZYA 2GVDA 3DI6A 4BWMA 1AUDA 2DNHA 1RT1B 2X3DA 5CYQB 3PW0A 3NAHA 2ZH4A 1Y3KA 3TA2A 2YH1A 2WOMB 4IOCQ 3R1LA 2AEJA 3NG8A 5C7PA 1FX4A 5AXNA 1PC4A 4RW9A 2HNDA 4X84A 1Q1KA 1YJVA 3MECB 2QLWA 3L3CA 1ULRA 3C8YA 4M63A 4CO4A 2CDRB 3H5XA 3SQOP 1Q8BA 2XLIA 4X64J 2XZTB 1X60A 2MZQA 1PYSB 1UFWA 4PUOB 4Y2CA 3NNCA 3T1HJ 2PA3A 3MCSA 3ZC4A 1RU2A 4J91A 3K7RA 4HEA9 4LR7A 4EO6A 1BE4A 3HHKA 2B4UA 2LXFA 2PMZD 2HNYA 4CO1A 4CYUB 1TL1B 1KONA 4DWIA 1R0AB 2JL9A 1SJRA 1RT6B 1DTTB 2X7IA 3QGIA 4H54A 2QRRA 2I6WA 5J2PB 1HHTP 5B7WA 3TZWA 1L3SA 1RT2B 4XO0A 1JNZB 2CVIA 3PZPA 3Q22A 3D3CJ 2NXCA 2JZ5A 1JNRB 4TLRA 5B09A 4X62J 2Q66A 2MKCA 3L9ZA 5AJ3F 1JK9B 2OMOA 2CQ2A 1OY6A 3HHLD 3MCNA 4ZVRB 2ROPA 4WIIA 2AP6A 2QX0A 2PDAA 4F36A 4QW8A 5HBMB 4I1TA 4QR1A 4ELVA 2CQHA 1S1TA 1HWLA 1LW0B 1RABB 4DR4J 2BM0A 2V4JA 3PFOA 2OJ3A 2IM2A 3FK4A 3ELHA 4OZ3A 4RO0A 4DFMA 2I5JA 4DV4F 2GMHA 4J9RA 1U7LA 1KLMB 3MM9B 3R3TA 4Q7AA 4J9MA 3JYTB 1L3TA 5JVGQ 3QT6A 2EK1A 4ZPVR 4KAIA 3CDWA 2UP1A 2GV1A 2QG9B 1ZPWX 5DO2A 1U1LA 3GLJA 1SKSA 1BY9A 4DXLA 3BGRB 2ABYA 2XMMA 4BLGA 2DIUA 5AT1B 2RQCA 8ATCB 5HVFA 3W9JA 3VAJA 2B9WA 2VDIA 3TANA 3CDUA 3D5MA 3EUNA 1RHMB 4DS5A 2FQQB 3JQJA 1U8SA 2EC2A 2LQ5A 5HK4A 2GHWA 3M8PA 4ZJOA 4FPRA 2R7TA 1VGYA 3VVTA 1MG7A 2O5DA 1DLOB 3BGFA 2A18A 4J9OA 3K57A 4I6YA 1PIEA 2OPSB 4Y2IA 4F3MA 3KHGA 1Q8KA 3UR0A 1GMWD 1U0SA 3H5SA 4KH1B 3J81Y 4OZJA 4YFUA 1RB0A 1YI2S 1NHUA 2XMJA 1FKOA 1I51B 2L9WA 2I9SA 3KFWX 5DGAA 4XAKA 3TOQA 2I0XA 1VRUB 9RUBA 2MZTA 4DSLA 1JLEB 1RT5A 3R5GA 3F41A 1KVIA 3DRSA 1U2FA 2WBMA 2CPFA 2KT5A 2GGPB 1WDDA 2YQ3A 3VAMA 2O67A 3C15A 3FFIA 3NEKA 1TTHB 2YNIA 4LSLA 3HSGA 4PPDA 2N3LA 2VZ9A 4LFAJ 5SUHA 4IO1A 4R25A 3TP2A 3V6DB 2JHEA 4NYZA 4QIFA 5RUBA 2A0FB 2ZH6A 1UAWA 1TKTA 4GKKF 2XZWA 3GR0A 3DRPA 3LP0B 4PG8A 2Z2YB 4ED1A 5CYJA 2H3EB 2YKNB 3U1NA 1LWFB 2B4VA 4ZJLA 3X3UA 3ZXWA 4K4WA 1JKHB 3BH7B 4QOTA 1CJVB 3A8JA 3GFYA 2Z56B 2RMLA 3NBPB 2M8HA 3U7JA 2VQFF 3ZZ0A 2AKWB 1OPZA 1TUWA 2CJYB 4CLYA 4B9MA 2JC0A 3IBWA 4OYWA 2VG6A 1LW2B 2CADA 2H4WB 3TVYA 3JAMY 3J7A1 1IR1A 4ZKAA 3A3OB 1YDLA 4HI2A 1HR0F 3DOKA 2AX1A 4CQ1A 1TMMA 2V2KA 2BYCA 1IBLJ 1VC5A 1QAYA 4HACB 2KXHA 2K3KA 2B56A 4XDDA 2O01C 5DDPC 1XERA 2ZZMA 3GYNA 4F04B 5E3QA 1Z2ZA 3TRGA 1FKPB 4DQRA 3P45B 2XCAA 4CO5A 1FEHA 1UWAA 3GJSB 4QYRA 3SBMA 3RBZA 5J2NB 4A8XA 1M0SA 5F9LA 3V6HA 4PRFA 3K8VA 2HQIA 5KG0A 2QL5B 4O3PA 1MNEA 1X4DA 4OYIA 2KXFA 2UUAJ 2CQ3A 1YSJA 3HZEA 2W9BB 2HHSA 2LMIA 2BW7A 1KLNA 2RDDA 2HZVA 4M5GA 3BGOP 2CQ1A 4HVZA 3IWNC 2ZC4A 4ED4A 5KFSA 1MWQA 4JI0F 2NXNA 1N8RT 1VBYA 2NCKL 3GIRA 4U96A 2JLEA 3TJ8A 3BYRA 3KK3B 2X1BA 5KOXA 4O4RA 2XWYA 2VBWA 3C6UA 3KLIB 4O4GB 1BC6A 2C2OB 2HIQA 3AFGA 2ASLA 1HR0J 2PMWA 3D6HB 2K8GA 3I4PA 1TZ0A 2FPHX 2IM1A 3VALA 4LFBJ 4DG1B 2D74B 2H1YA 1T95A 1CQNA 2Y1RI 3GFZA 3UWTA 1I94F 2XEXA 2G13A 1ZM2A 3BF4A 1MROB 1QE1A 3M30B 1PGZA 2BJ3A 1E6YA 4PCQA 1TK8A 2Q79A 3D68A 2EKYA 1UEKA 3P49B 1QY7A 3CGIA 1TVRB 3H4DA 4KV8B 1S0MA 1EARA 1IQTA 2ILYA 4TYAA 4FXVA 3NXZA 3WX8A 2DB1A 3UCZP 1IBCB 2VC0A 1IVZA 2UU9J 4JP8A 4LFCJ 4WKRA 2GC8A 4L75A 1F6TA 1HD0A 3BKFA 2KN4A 1QUVA 2NXJA 4EK2A 3AQOA 2RILA 3M8ZA 5KT4A 1B7FA 2IDLA 3VCDA 2QMXA 1S7IA 1V9OA 2FHJD 3F44A 4YUDA 2XCPA 4TVAB 4Y0FA 1ZETA 1EZZB 2GAHC 2HNDB 2D1CA 4FF2A 4OYMA 2ATCB 2J0QD 2CQ0A 2IC3A 3N28A 5MLCV 3LF0A 1SCJB 4F0HA 5H9FK 2L08A 4L73A 3CJKB 3OTDA 3SMZA 1EETA 1ZS6A 2H4YB 4NCAA 3MTKA 3TW0A 3PCOB 4USMA 1B0PA 4ZVGA 1VK3A 2R7UA 3KLGA 2J7WA 3SQGB 1HQEA 4NLQA 1EP4B 5KG6A 2H65B 3V4MA 2E5IA 2V94A 1J5EJ 4CP5A 4FF4A 1FFGB 2GS8A 5K9FA 2QLFB 4UOFA 1UWBA 3MGJA 1O6XA 1H3DA 4WXWA 3RB3A 3QRPA 2J8SA 3CDBA 1BQNB 1FDAA 4HR2A 1U0HB 2PFFB 2MQLA 1SJ1A 1XMBA 3ZO7A 1N6QA 2DRDA 2J7KA 4DR2F 1FDDA 1X4GA 4F4ZA 2IJFA 3SEOA 4ES1A 2J9DE 2M70A 3F56A 4YDXA 3N79A 1PAUB 1Q53A 2DGWA 3N6LA 4KGXB 5KT3A 3N01A 2CPEA 5BR8F 2AJ4A 5L1JA 3QJLA 4DR4F 3D0HE 1HA1A 3EVOA 3H98A 2VQFJ 1QVFR 2VPXB 5GMKa 5HQLA 2YQ1A 4OYAA 3SCKE 1M5KC 3CJ2A 1Q82T 2WW4A 2DXFA 5HLFB 2HFSA 2W24A 3QGGA 4ZHRB 2F9DA 2Q3PA 2IJNA 3DGVA 4HTIA 2HBZB 4GKKJ 3EJMA 4ZHRA 3UR3C 2EG2A 6AT1B 2OTJS 2FTRA 4I7FB 3PX6A 1DRZA 1HNZF 1OMSA 4QWDA 3PX4A 2VA2A 3J81j 3TQ1A 3GIJA 2KT3A 2AGOA 2VFUA 3KK1A 2ZBCA 2D41A 4KE5A 2ZH3A 4KV8A 5J2PA 2K2PA 4MKAA 3OV7A 1S59A 3BQ2A 4WBFA 1KQFB 3L09A 5HQ8A 1SH2A 4B3TF 4YB7A 1TFYA 1DQ9A 3UN5A 2EG1A 5DQIA 4QWAA 1UPPA 1GT8A 2XQCA 1X5PA 1S1XB 3FEXB 4PG7A 4O0IA 3CNQP 4DU7A 2J9CA 2ZH1A 4OX9J 2I2YA 3QSIA 2FVQA 1KFDA 5KFNA 2DGVA 1RADB 2BJ9A 1P8GA 2IRUA 4ETZA 4RBUA 4ZVQB 5B0BA 3PR5B 2G0IA 3AHPA 4M5MA 1FDBA 2PE8A 4WKYA 4P9SA 1HW9A 4YB1P 3RR8A 4EBEA 4C8LA 5IT9U 3FRYA 1QTMA 1V5IB 2BKNA 2LKZA 1CULB 2A3JA 2HLTA 3DRRB 4HTJA 1BXNA 1RHJB 3LANA 3NS6A 1RWNB 5E5NA 2EKNA 3D66A 4GO7X 3VZIA 3ADAC 1NSKL 2HHVA 4OYXA 2BM1A 2K1RB 4KO0B 3MAAA 4IR1A 2IYGA 4ANCA 1BHNA 1FWPA 3QJPA 3DOMA 1BWEA 2DO4A 3T9NA 3OBIA 2OO4A 1S1VA 1JX4A 2HHUA 1DHMA 2FUG9 3BSAA 3NGKA 1RAJA 3NGRA 3JTNA 1OQ3A 3D2WA 1F3FA 2BANA 2HFUA 3EPGA 2JX2A 4F02A 3G2XA 1Y4ZB 2J7UA 4ICLB 4NXMJ 4DV7J 2E5JA 2Q6BA 1VCTA 4RBVA 3PEJA 1H98A 1FTCA 1HIYA 2XM3A 4G1QB 3E51A 3OL7A 2APOA 4DFKA 3RYLA 1N5SA 4DOZA 4QYZJ 4ZPWR 1WC6A 1T9VA 4WTYA 5HMXA 3HT3A 1A9NB 3NOCA 3L7PA 2RAQA 1U48A 4HACA 2HQDA 3H59A 3F0NA 4W98A 2XNRA 5L46A 1JLAA 1R6VA 3M32B 1M1KT 4DV1J 2DR9A 2CNKB 2FY8A 2XTJP 3HO1A 2YKOA 2DNRA 2DHSA 2WVDA 4FKYA 3SQGA 2GAGC 3THTA 4DDFA 4ID5A 3PW7A 3KNAA 3AD7C 1LFPA 3FEZA 1U6BA 4DSEA 1RTHB 4A47A 4CWBA 1FA0A 2LA6A 3MTJA 4K7QA 4B3OB 7FDRA 1VQPS 3OPKA 1RBAA 3A12A 3GFHA 1U1QA 2JSXA 4O23A 5F8IA 3FSYA 4C48A 3GYXB 4DUTA 4Q44A 3OHAA 1RI7A 3EGVA 2VBYA 2EI5A 3IM9A 3M1VB 4C8OA 3DKDA 5A6WA 4O3SA 1B7YB 5A2QY 1PC5A 3HHLB 1HNVB 3KLEA 1LKZA 3KMSA 2X1AA 4I2QB 1AA1B 4MIBA 1JMTA 2ROGA 4NLVA 1TV6B 4MKYA 1OY8A 1XNQJ 2GJFA 1JLEA 1RT5B 1YGYA 1F2GA 3KUGA 4KSEB 3PVXA 5IC4B 4CT8A 4ECSA 3FMWA 3MEKA 4LF9F 1RHUB 1JLCA 4R8UB 2ZBIA 3CJ5A 4CLKA 3K5MA 1S0VA 4RLEA 1X0PA 2ZDPA 3QRRA 2XY5A 4DQSA 2DEIA 1VS3A 2EC0A 4Y34A 3GYGA 2K1RA 4KO0A 5IS2A 2DNZA 4TY8B 4KH0B 4U8YA 5DJBA 3T1YF 1IXKA 3BYPA 1D9AA 1GTHA 3EDRB 3MMJA 4BC9A 4HKQA 2AIRB 1M5OC 4AD6A 3D0GE 2LEBA 4WP9A 2R8IA 2J6TA 1RTZA 3FEYB 3FSIA 3MPVA 3R7NB 3CCVS 4DF4A 3C16B 1R3NA 4P74A 2QYCA 1RTDB 3TJAA 3FBCA 2PIIA 3U27A 3G6XA 4LF8J 3TA0A 4CZCA 2VG6B 4FYVB 3BR9A 4B3MJ 1X5TA 3J80U 4FPIA 4TU9A 2HYIB 4G1QA 1OJ4A 5D3GB 1A6LA 1ELOA 3MMCB 1PKUA 5T7LB 2VFVA 4WU3A 2RUGA 3IAM9 2DY1A 5C25B 1ZZFA 3FUYA 3NCRA 4OLOA 5HQMA 1MMNA 3OR1A 3KJVA 4B9VA 3K89A 2JEJA 3HXMA 3SCJE 2H9ZA 4OZ5A 1TAQA 5HJXA 3T1AA 5DGBA 5ETTA 4F0MA 2FC9A 3JB9k 4N77A 1RT4A 3EXCX 1GQEA 3MAAB 2AYEA 3NWGA 5LSOA 1ZM9A 2B6AB 1NXIA 1CQMA 4FF3A 3FDSA 1LEOA 3OVAA 1IKXA 4EWTA 3HLUA 2MY7A 1KN6A 4H4MB 2P2CB 3M8YA 3MF5A 1S12A 1R8CA 4QIEA 3KDNA 3CDEA 3UD5A 3O3LA 3T5KA 4JI2J 3DNCA 4IRKA 3UO0A 4OI6A 2M9KA 1UJ5A 2QYGA 9ATCB 5FD1A 2HWTA 4IRDA 4QR0A 4I67A 1PBAA 1X7VA 2AJ2A 1B99A 3GTYX 2AF6A 1PJ7A 2VFTA 1N4LA 5IM0A 4EBDA 1N34J 2X51A 1KD1T 2OTLS 1AUSL 5F8HA 4GVBB 2BKOA 3DDIA 3NGUA 3IS9A 3GIKA 1F9FA 2KL8A 3GPAA 3TEGA 1OQ6A 3CD7A 2D3UA 2VU5A 3OXGA 2HFOA 4Z7YA 5C2GA 4UF4A 4UZBA 2C3YA 2J5AA 2BJDA 3C19A 1S72S 1M1HA 4CLUA 2Z2MA 4PAAA 3O2IA 2E9ZA 2YWEA 1DBDA 4IQMA 4K4YA 3QNWB 2G4BA 1YJTA 2W2MP 3H2VE 5H9EK 2ZNZA 1IBKF 1RWWB 2ACYA 2MHNA 4EYHB 2BE2A 1BMQB 1YZ6A 2KYXA 1DQAA 2W2NP 2QLXA 4QJVA 5KFZA 4EBCA 2BQUA 4BDPA 5G0RA 1KS2A 3JSYA 3CC2S 3IGNA 3DRPB 2EXUA 2QGFB 3VZHA 4CLSA 5KFOA 3EYZA 4O3NA 4ZLPA 4AL7A 4PWDA 3NAIA 3TAPA 1NDPA 1AZSB 1UVMA 2FVCA 3PKMA 4DL4A 1RT2A 2MJNA 3QWUA 1RAFB 4RJVA 5HO4A 2FJEB 3M9OB 2V8GA 4DR5J 2R8HA 2K7JA 4K0KF 1OSCA 4B3SF 3JXOA 4JI7J 1UA1A 4PWWA 1N5YB 4TYBA 1Y0HA 1FE4A 2C2ZB 2V8HA 2V67A 2CQGA 2Y3YA 3FBBA 3H5YA 2OPPA 4DX5A 4Q0BA 2EVZA 2OD4A 3VV2B 4TY9A 3PW5A 3B6BA 1J5OA 1N34F 1EP4A 1WHXA 2RKIA 3QLHA 4K5RA 1QAXA 2E9TA 3VTIA 2ZVIA 5EWGA 3WC2A 1RA6A 2E1RA 1T03A 4OX6A 2YY3A 2FHKA 3HVRA 4NXNF 4M5IA 1SJQA 4DV4J 2U2FA 1T3OA 3PO4A 1F1BB 1RAEB 2MSSA 4MYUA 4F4AA 2GO9A 2V5HG 1Q79A 4RNNA 1RXOB 4UOGA 3RRGA 2V4QA 4RUHA 2ZEJA 1E6VA 1S1UA 1IQZA 4RL1A 5KG2A 1AYEA 2G2ZA 2ZOMA 2J9DA 4BCAA 2DNQA 1AFJA 2ALYB 2B9EA 4LJMA 4H4OB 2D3OR 3LALA 4FYXB 4IG0B 2CFXA 3HJFA 1FT8A 2XG8A 2V6AA 3VWSA 4AFFA 3R5JB 4DCPB 3BN4A 5FDLB 4Q45A 4PWDB 4N8OA 2DYAA 1X5SA 2PSZA 2GZOA 3B54A 4NASA 5ETRA 1X9WA 2CA9A 2VODA 2UXDJ 2AEFA 3ICLA 4Y2AA 5DG8A 1D1UA 1PSDA 2UVUA 1JLBA 2LEPA 3G87A 2AYBA 2HW3A 3DLBA 4Z37A 1YX2A 3CT9A 4CLPA 4YDDB 5EGYA 4DL2A 4X65J 1YLXA 3PY8A 2B7CB 4J9UE 2HPUA 2XC9A 5GAGU 1F9HA 1C1BA 5KG3A 1HPZB 1LXNA 2O66A 4NLPA 5KFFA 3CCLS 2MZJA 2FLOA 4USJC 5KFKA 1VK8A 4WK1A 4NLOA 3HFZB 1NSPA 3T19A 3CJQA 3LP0A 1IR2A 4CH1A 4DSJA 2NQPA 5L1LA 5HANA 5KFXA 4ELUA 4WFZA 3O5TB 4LF5J 5C24A 3PYFA 3PM9A 2Y9HA 2C3PA 5B0GA 3JS9A 4Q2LA 4M5HA 2NYHA 5GADI 1ZA2B 2B5JB 2B51A 3LAMA 3EE3A 4YOEA 4IOBA 4ED8A 2DNMA 4PZVA 2GX8A 3G8TA 2Y8WA 2GHVC 3DRXA 4RNOA 1TKXA 4FNHA 1D9DA 4O4GA 1ITPA 1NK7A 2HQ3A 1DURA 1NSQA 3MECA 1MMDA 2P9GA 1AT1B 4MIWA 5K5MA 3J7YI 1F5CA 4UUXA 5K14A 3D28A 1N54B 4FKXA 2DNKA 4QPTA 2W9AA 2X1GA 4HI1A 4RX6A 1C2PA 1V5VA 1H38A 3EZUA 3G82B 2PEBA 4WIQA 2VG5B 4FBTA 4EI2A 5G4DA 4URGA 2CPJA 5LMUJ 4DUYF 4I64A 3QO9A 1HQUB 3W5XA 4DEZA 1F5BA 3P4UB 3F73A 1S6QB 2VASA 3A1YG 4MT1A 3PIPQ 2F4VF 3J7Z5 3PFEA 3IRWP 3IAS9 3UCGA 3R5DA 3BKTA 5HMZA 4X4TA 4LF5F 4QIWD 2HRYA 3FZ2A 2E5HA 3HFVA 1FXDA 4DR1J 5C42A 3ITHA 5GMDA 1TK0A 1P1TA 3HHLC 1CEZA 1TL5A 2D9OA 4KPYA 4IFVA 3EVMA 2MHEA 3BO2A 3ULHA 4P72A 1NU4A 4CDIA 4ZVTB 1CSJA 1ZAWA 2W2PP 3CSKA 3D54A 1IBMF 5AXKA 1Q5VA 1T3NA 4MK7A 1IKYB 4NLUA 1P6TA 2KVIA 3HD2A 2GFFA 3DLGB 5E7OB 4EYIB 4KJIA 2GCFA 1EQMA 5ETMA 2NS1B 2CQPA 3KK2A 1WTBA 1SJFA 1QUPA 3R2DJ 4DQPA 2W1BA 3MM9A 1LXJA 1M5HA 3TO8A 4RUBA 2UXDF 3JYTA 2R42A 4DV7F 4U67Q 1ZA1B 4P2XA 5F8JA 4DL6A 2DNNA 2KHDA 2CG8A 4DPOA 4DN0A 1H2VZ 3GSIA 3WIUA 1YRUA 1BWVA 3ZZRA 4ALZA 5B0DA 3W2WB 2DRAA 1FERA 4NXNJ 3PHEA 5HJYA 3C3LA 3EGWB 4YB5A 4UQTA 3GIIA 1S0OA 2GQ2A 4NLSA 1BUXA 3HSZA 4ZPDA 2HEKA 3ONQA 4C8NA 3I5AA 3MWBA 3TYTA 4IUFA 1A0OB 5CD4A 2CPXA 4NLYA 2HS4A 3ENQA 1YWXA 3AAWB 4L76A 4RPFA 2XMKA 2CJXB 2UU9F 2K06A 3NNAA 3KWMA 2P6TA 4MK8A 3T9ZA 4J90A 5CZXA 2VBZA 3GMGA 3RAQA 3TR5A 1JLBB 4DR5F 1HD1A 1SC1B 3V6KA 2QN6B 1LWCA 2QFIA 2OGUA 2RHSB 1NPPA 1UJ4A 1WEYA 4OX9F 5KFPA 4P2SA 3I55S 3HD1A 5DLFA 5DG7A 1QM9A 2E29A 1SPBP 1UTAA 1UZHA 4OJGA 3O6QA 4C0OC 5L38A 3W5YA 2DVIA 2HBRB 5ETNA 3RB4A 3MM6A 3BBBA 1TQLA 4QW9A 2FLLA 4LBIA 3KMQA 4RW6A 1MLAA 2HKEA 3CJSA 3DHWC 4OJ1A 5J1EB 1JB0C 5KAKA 5DLGA 3CCES 2RS2A 1D8ZA 1SXLA 2YWKA 2ZC3A 4C6AA 2MLYA 4YY3J 4FS1A 5CHCB 4YQWA 3B82A 2J76E 2U1AA 2JLGA 2NUUG 4QU7A 4JOUA 4JI5F 4IFVB 2HSEB 4OJHA 4RKUC 4EGLA 1KTVA 3KJFB 5H9EJ 1EETB 2M3DA 3G8SA 3IO1A 1MWYA 3J81U 1X4BA 1UVJA 1LOUA 1DY3A 3BS9A 3SDEB 4PG5A 1F0XA 4WP3A 3I6PA 5HBMA 5KFBA 3LP1B 2V8PA 1RTIB 4G1IA 5LMNF 3DOMB 3LGHA 2KXNB 2VG5A 3RAXA 2VBXA 3NMRA 1CJKB 4JBCA 1CS4A 1VJWA 1X4HA 4ZPAA 3CF5Q 1K44A 2OI2A 2HGMA 4H4KA 3AH6A 4P71A 2MMYA 5LL6d 1CBKA 3WQPA 1N32J 2Z0GA 1UL3A 4J37A 1BQNA 3R7SB 3G86A 4R0JA 2Z8QA 3J80Y 5K8OA 1B4SA 4LF2A 1WHWA 2HBYB 2N82B 4WFBQ 4TQRA 3E01B 3ISNC 1S48A 2RJZA 5J2NA 1YJWS 3RUBL 5KFAA 1FKAF 4DPXA 1T7PA 3DOLA 3K5PA 4WWSA 5A8WB 4C0HA 1FNOA 1P27B 2XWXA 3MM6B 1WD6A 3PR4A 1RWUA 3KLFB 3JSMA 1K8AT 3QZ7A 5EX0A 1NM2A 2RT3A 1FRKA 4FYYB 3MUVP 3HKWA 4CH7A 3K2YA 2VG7B 5EDWA 3G6VA 4OX7A 2YNHA 3MM8A 5LXYA 1SIWB 3I5BA 3CXCR 3C16A 4X66F 2XMAA 4WTOB 3CCQS 3CCMS 1WOOA 2Q1LA 4CH0S 3HPOA 1FCAA 2UUBF 1FJGJ 2G0JA 2IAJB 2OMLA 2HZCA 4ZCIA 4DPUA 1C1BB 4W90B 3MEEB 3M05A 4J7CA 1QSYA 4ETXA 2YNIB 2YBVA 3M2UA 3MM7B 4JI4F 1PJ5A 3W2VA 3MFIA 2C2NA 1SC4B 1WC0A 2FGCA 2OEKA 4NCGB 1WSVA 4D3HA 5L9NA 2KZZA 1WDTA 1YRTA 5IQ6A 3V4IB 3DMJA 2LA4A 3DYAB 2VIHA 4LF8F 3RRKA 1HYSA 3W60A 2YX7A 2XLKA 3CCRS 3PRDA 1CVJA 4DPWA 1LWXA 1Y11A 1NBEB 2BJ8A 2ZH5A 3BSOA 3MM5A 2A10A 3QGPA 4BBYA 2HIYA 4CO0A 2NZ4A 2WSFC 2BJEA 4B9TA 2CPZA 3OTOF 2WSEC 1T9WA 4LRDA 2ZH8A 1R27B 1XNQF 4P7TA 3NY0A 4B17A 3GG1A 5KG1A 2WRMA 1HKAA 4CLWA 4IH5A 3TAQA 4FYDA 4ED5A 1FVQA 4RW8A 3BZQA 1U09A 4ED7A 4OL8A 2Z58B 3LPEA 1BQXA 4ILLA 1VHFA 5HATA 3TZZA 2ERRA 1D8YA 1NLKL 2OHDA 4HT5A 2WBRA 2I5JB 3QPIA 2IVMA 4EFAC 1S76D 1FTRA 1UETA 1Y9OA 2EFPA 4UY8T 1WI8A 3QT8A 4NLDA 3UE2A 5KFWA 1QLNA 2DGUA 2UXCF 4F50A 4NA1A 2PD1A 4ZIWA 3M9MB 2ROEA 4P52A 3VVUA 3FQLA 4HYKA 4LF6J 5EN1A 2ZJQQ 1IBMJ 4AQYF 3D6MB 4ECQA 2AU0A 5IFMA 4A8MP 1HBUB 1O51A 4QIVA 4KKOA 2QFJA 4DSKA 1I5OB 1R43A 3AT1B 3A8IA 1VRUA 1S49A 2C3OA 2GW8A 5E3RA 3Q24A 2HVEA 1FRHA 5HI7A 3SIPB 3ZNUA 3K58A 2BRKA 4X4OA 2V8VA 1IKWB 4B3OA 3BGLA 4M5DA 1KVJA 2BA9A 2ADBA 2D7SA 2CKWA 1TK5A 1NEEA 2OFHX 2IDEA 1HI1A 3SI8A 4LRBA 4ZPTR 6FDRA 4V19X 3PEHA 2YKNA 4OV6A 1LK5A 4URQU 5BYRA 3WHIA 3D7SB 3PW2A 1TKTB 4DHVA 2JVRA 2E7VA 2CPHA 3D1HA 4PXBA 5A8RB 1S6PA 3FMBA 4M5JA 2VG7A 1T03B 2GVDB 1LQ9A 2AMCB 4I2PB 4Q2MA 2AT1B 1NK9A 2OSRA 1NK6A 4DR7F 4O3QA 3ITHB 5DDRC 1LV5A 2DR5A 3KDOA 3KJNB 5C5JA 4R0EA 1HW8A 3BR8A 3GSDA 4ICLA 4ZVUB 5BXIA 3VAIA 5FJ4A 4LQ3A 3LP2B 1CJTA 1SJ4P 1PILA 3QIPB 5IT0A 1R8AA 5J2QA 2KT2A 2EK6A 3DC2A 5ETVA 2Z2ZA 4NZ0A 2FVPA 2R2SA 4P2MA 4ZJQA 2LQ8A 5KFJA 4Q5VA 4B3SJ 2LVWA 3M2RA 4Y2KA 5E3AA 4JB8B 1OWXA 3H4BA 1U1KA 2CJAA 4JI4J 2BE7D 1VDHA 3PW4A 4JV5J 2VFSA 2VPYB 4IG3A 2RVJA 3OD2A 4RNMA 3M2VB 3IA0A 2HZAA 3DYAA 1W25A 3PACA 1JQGA 1HYSB 2YPYA 3HK2A 1EAYC 3BO3A 2NZCA 4C8ZA 2YTCA 3TA1A 2DISA 4B3TJ 1W7WA 2DXEA 3D67A 1IJFB 4QCLA 3CVKA 4ZS6A 1WORA 2BV3A 2COLA 5ETSA 4ER8A 5I3UA 2QA2A 2UV8A 4M5LA 3P6YC 2BVZA 3UD3P 2NUHA 5F9NA 1P9QC 2DGSA 5BR8J 2HHQA 3SV3A 3S7RA 2Y8YA 1OPIA 3IC1A 1UW4A 3PG9A 3RZAA 1XBWA 2JNJA 3UDLA 1RBOB 1QSSA 2HMIA 3QRQA 1KQSR 1JJHA 1IM4A 2QE5A 4TNOA 1YHQS 1SUQB 3HHNB 1GH8A 2EFOA 1WG1A 1A7GE 3OR2A 3MR2A 1R0CB 4N7TA 3LWLA 1SV5B 4C3KA 2F63A 4RUCA 2M8DB 3MEGA 1CC8A 4Y3CA 4IOAQ 4K8RA 1G6BA 2IYIA 2WONB 1VLOA 1Q7LB 2VICA 1KR4A 3DRYA 4NMXA 4WE1B 4IH7A 1T05A 1WKJA 3SYZA 2AJ0A 1FD2A 2CRLA 5ITHA 3EPIA 3M8WA 2GVZB 3N4WA 4ZPCA 2JC1A 1N5QA 2YNGB 3BKUA 2W9CB 4BS2A 2BKPA 4K4UA 4OYPA 4LF6F
chains in the Genus database with same CATH topology
3GP9A 2DYAA 3ZTSA 3B54A 5C7PA 1S5ZA 3ZTOA 1S59A 1PKUA 4WBFA 3FC9A 2B8QA 1NB2A 3BBBA 4UOHA 1WKLA 5CAAA 3VVUA 3NGTA 1EHWA 4C6AA 2AZ1A 2HURA 3BBFA 1NDCA 3Q83A 3MPDA 3FBFA 1NSPA 1BE4A 2HVEA 1PAEX 1LEOA 1NPKA 3JS9A 2HVDA 1NSKL 1WKKA 2NCKL 1KDNA 2ZUAA 3EE3A 4DZ6A 4ANCA 1XQIA 1BHNA 2AZ3A 1VYAA 1B99A 2DY9A 1NSQA 3NGRA 4F36A 1K44A 1F3FA 4ANEA 3EM1A 3G2XA 3VGSA 3Q8UA 3Q8YA 3DDIA 3EVWA 4FKXA 2BX6A 1B4SA 3ELHA 3NGUA 3NGSA 3VGTA 4ENOA 3GPAA 4KPCA 1HIYA 4S0MA 2VU5A 3BBCA 3WX8A 1XIQA 5BXIA 1NDLA 1HHQA 1F6TA 2CWKA 3ETMA 4EK2A 4W98A 2B8PA 1UCNA 3ENAA 1NUEA 1NCLA 4FKYA 3VVTA 3EVMA 1U8WA 2BEFA 3Q8VA 1ZS6A 4DI6A 3FKBA 1NDPA 3PJ9A 1MN9A 4DUTA 3Q89A 3Q86A 3ZTPA 1W7WA 2DXEA 3DKDA 3VGVA 3EMTA 3ZTRA 4O0NA 4CP5A 3BH6B 3FBBA 4UOFA 4ANDA 5IOLA 3FCVA 3R9LA 1MN7A 4HR2A 3B6BA 5CABA 3VGUA 1LWXA 1HLWA 3EICA 1JXVA 1BUXA 3L7UA 4F4AA 3BH7B 3EVOA 1S57A 4UOGA 1NDKA 3ZTQA 3FCWA 3FBEA 1NHKL 2DXFA 2DXDA 1WKJA 1NLKL 3EJMA 3PRVA 3FBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP9 A;  2DYA A;  3ZTS A;  3B54 A;  5C7P A;  1S5Z A;  3ZTO A;  1S59 A;  1PKU A;  4WBF A;  3FC9 A;  2B8Q A;  1NB2 A;  3BBB A;  4UOH A;  1WKL A;  5CAA A;  3VVU A;  3NGT A;  1EHW A;  4C6A A;  2AZ1 A;  2HUR A;  3BBF A;  1NDC A;  3Q83 A;  3MPD A;  3FBF A;  1NSP A;  1BE4 A;  2HVE A;  1PAE X;  1LEO A;  1NPK A;  3JS9 A;  2HVD A;  1NSK L;  1WKK A;  2NCK L;  1KDN A;  2ZUA A;  3EE3 A;  4DZ6 A;  4ANC A;  1XQI A;  1BHN A;  2AZ3 A;  1VYA A;  1B99 A;  2DY9 A;  1NSQ A;  3NGR A;  4F36 A;  1K44 A;  1F3F A;  4ANE A;  3EM1 A;  3G2X A;  3VGS A;  3Q8U A;  3Q8Y A;  3DDI A;  3EVW A;  4FKX A;  2BX6 A;  1B4S A;  3ELH A;  3NGU A;  3NGS A;  3VGT A;  4ENO A;  3GPA A;  4KPC A;  1HIY A;  4S0M A;  2VU5 A;  3BBC A;  3WX8 A;  1XIQ A;  5BXI A;  1NDL A;  1HHQ A;  1F6T A;  2CWK A;  3ETM A;  4EK2 A;  4W98 A;  2B8P A;  1UCN A;  3ENA A;  1NUE A;  1NCL A;  4FKY A;  3VVT A;  3EVM A;  1U8W A;  2BEF A;  3Q8V A;  1ZS6 A;  4DI6 A;  3FKB A;  1NDP A;  3PJ9 A;  1MN9 A;  4DUT A;  3Q89 A;  3Q86 A;  3ZTP A;  1W7W A;  2DXE A;  3DKD A;  3VGV A;  3EMT A;  3ZTR A;  4O0N A;  4CP5 A;  3BH6 B;  3FBB A;  4UOF A;  4AND A;  5IOL A;  3FCV A;  3R9L A;  1MN7 A;  4HR2 A;  3B6B A;  5CAB A;  3VGU A;  1LWX A;  1HLW A;  3EIC A;  1JXV A;  1BUX A;  3L7U A;  4F4A A;  3BH7 B;  3EVO A;  1S57 A;  4UOG A;  1NDK A;  3ZTQ A;  3FCW A;  3FBE A;  1NHK L;  2DXF A;  2DXD A;  1WKJ A;  1NLK L;  3EJM A;  3PRV A;  3FBC A; 
#chains in the Genus database with same CATH topology
 1S4F A;  1RA7 A;  3UQS A;  1S0N A;  2R8J A;  4I2Q A;  1VJQ A;  1N5V A;  1I6J A;  3GZ7 A;  4X64 F;  2POK A;  3CDA A;  2W01 A;  3OVS A;  1J5E F;  2DR8 A;  2A2D A;  2KM8 B;  4F67 A;  4DPY A;  2E5L J;  1Q16 B;  2KJV A;  3B8H A;  1S7H A;  5HN0 A;  2ZJR Q;  1QAJ A;  5T41 A;  3A3P B;  2MDA A;  3ILL A;  1URN A;  3V6J A;  3OR1 B;  4TXS A;  3EX7 B;  3ET6 A;  3CMQ A;  3SDE A;  3PX0 A;  3MOJ B;  4U7U D;  2MPU A;  2RDI A;  4NI2 B;  5CYM A;  3LGN A;  5F3T A;  3Q83 A;  2HHH J;  1GXL A;  4WYW A;  2HRT A;  3H2L A;  4OX8 A;  4PQU A;  2CNL B;  3DLE B;  2QV6 A;  3MPY A;  3NP5 A;  5CCL A;  5CCM A;  2ADC A;  2HVH A;  3DLE A;  2ZHB A;  3IN5 A;  1TKZ A;  2JFK A;  1IWA A;  3OFE A;  4N8N A;  2FJV A;  4JYA F;  1HNI B;  2BAN B;  2C1E B;  2VKZ G;  3I31 A;  3QT7 A;  1Q81 T;  1S4E A;  2MKS A;  4DV6 F;  3E2E A;  2C3M A;  3BRE A;  2LLZ A;  4BWJ A;  3AOC A;  3GCX P;  3RBX A;  2D69 A;  5B08 A;  1CJU B;  1S9E A;  4KC5 A;  3OTO J;  3CUN A;  1NJY A;  1N33 J;  2IA6 A;  2ZHA A;  1S6U A;  1ZM3 A;  4Q43 A;  2WVE A;  1WHY A;  1RKJ A;  1X4A A;  2L3M A;  4UW2 A;  2B43 A;  2W9B A;  3D1O A;  1O0P A;  2DT9 A;  3H42 A;  5CA5 A;  2D9P A;  3PTW A;  3K8W A;  2FDN A;  3CIZ A;  4CNZ A;  1J5O B;  3TZY A;  2ZM6 J;  4JI1 J;  3N9U C;  1PJ6 A;  3KHH A;  3S8S A;  1NK8 A;  5I42 B;  4JYA J;  3ZZU A;  3K5N A;  2DGT A;  1VRQ C;  2VPZ B;  1SQG A;  3EWG A;  3W1Y C;  1NJW A;  3EXY A;  3E3X A;  2RNE A;  3DLK A;  1WHV A;  1SV5 A;  4DCO B;  1VHI A;  5GAE I;  1QVG R;  5ETL A;  2E5G A;  3HSJ A;  5DRK A;  5HSP A;  1Q78 A;  4AE5 A;  3T3F A;  4LIR A;  2MQO A;  3W63 A;  1LK7 A;  3BDP A;  3CO9 A;  1OYD A;  4DL3 A;  5E3P A;  1S9F A;  4BC7 A;  2XY6 A;  4QU6 A;  3ILO A;  1XWL A;  3KXD A;  1DAX A;  5HVH A;  2YWH A;  4WCE Q;  1XNR F;  1WF1 A;  5B0C A;  5FLX Y;  4DLG A;  2IFX A;  4AT1 B;  1RLD A;  1RUS A;  3L4B C;  1HBM A;  5D8H B;  1MN9 A;  2QZ8 A;  4FYW B;  4B9N A;  1T8E A;  2GQC A;  4DPT A;  2GIQ A;  2RDJ A;  3GJQ B;  2OD6 A;  3KHR A;  2XB2 D;  3IG1 A;  3D4J A;  3PXG a;  2HLU A;  4LSN B;  5F8N A;  3C6U B;  3KLI A;  3BH6 B;  4PXD A;  3CCW A;  2HGL A;  1RAA B;  4B3M F;  3BQ0 A;  1T0T V;  4KFB B;  4H4M A;  3FCV A;  4PG6 A;  4YB6 A;  3R9L A;  5HMY A;  4K4T A;  4DV3 J;  3G71 S;  1FEE A;  3UD4 P;  1VQ8 S;  1HLW A;  3W2V B;  3Q2T C;  2FJB B;  2GHP A;  2H48 B;  1FRX A;  3PJW A;  2C2D A;  1FKP A;  1WUU A;  1H7X A;  1T9Y A;  2B0G A;  5LXR A;  1RYR A;  2PN6 A;  3AOD A;  3LOU A;  2GJI A;  1YBU A;  1TL7 A;  2DNG A;  1YJN S;  3LP1 A;  2BR0 A;  4EUV A;  1NB7 A;  2GVZ A;  1VQ6 S;  5AXM A;  5D0H A;  1NH7 A;  4C9D A;  4L74 A;  1Q7Y T;  2R2U A;  1FFW B;  3CC7 S;  1TUV A;  2WTF A;  3JSR A;  2MKJ A;  5MAO A;  3CCS S;  1S9G B;  3PV8 A;  1N48 A;  3QSY B;  3W64 A;  4R5P B;  1X9S A;  4ERD A;  4DX7 A;  3MAH A;  4J9K A;  1X4E A;  2EBE A;  4ECV A;  4CCH A;  1N6Q B;  1FE0 A;  1U26 A;  1KC8 T;  3D6F B;  4JI3 J;  1CUL A;  3DOL B;  2WHO A;  1JLA B;  2OPP B;  3BJY A;  4Q0B B;  2XMW A;  3RR7 A;  4M95 A;  1UVN A;  4JV5 F;  2HRU A;  4EU0 A;  5IZH A;  2R4F A;  3IP0 A;  3P3D A;  3H0P A;  3LA0 A;  4ZK7 M;  1HQE B;  1ZTW A;  3OSN A;  4ILM A;  5KFI A;  4ZVP B;  4XK8 C;  1UPM B;  4KTQ A;  1R8B A;  2CZ4 A;  4DQI A;  1CJK A;  4OFZ A;  4FNI A;  2MGZ B;  4QYZ K;  2IVY A;  3IWL A;  2KFZ A;  3UVJ A;  4OHY A;  4I6W A;  1TR0 A;  1NDC A;  3CCZ A;  3TWZ A;  2KB2 A;  3BSC A;  3FBF A;  3NRB A;  3GQC A;  2QTW A;  3HUL A;  1T9T A;  3A8K A;  2YQ0 A;  3RJM B;  5KG7 A;  2IMO A;  1N5Y A;  2CQC A;  3QFH A;  4ECU A;  5EWF A;  2C22 A;  1C1C A;  2HGN A;  4ZVF A;  4WF9 Q;  2FY1 A;  4I0W A;  1X8D A;  4FXW A;  4OMF G;  4HL9 A;  5L39 A;  2KFY A;  3I5C A;  4H4O A;  1NKE A;  1RAG B;  2J0S D;  1SC3 B;  1HNV A;  3KK2 B;  2QSF A;  1HWJ A;  2YKA A;  4C3M A;  1R0A A;  2KRR A;  2QEX S;  3IRX A;  2ZD1 B;  4ECR A;  5AJ3 J;  1U4B A;  3KHL A;  4RW9 B;  1B3T A;  2VFR A;  2VB6 A;  3GU0 A;  4UZC A;  1YIJ S;  3BSN A;  2MQM A;  2DHA A;  1CJT B;  2BAC A;  2GO8 A;  2W25 A;  3LW5 C;  3A4T A;  3MMB B;  4HT7 A;  5C25 A;  3W9I A;  1ZPV A;  4CLZ A;  4ENO A;  4UQG A;  2XO6 A;  2R7Q A;  3RBE A;  1R6Y A;  1YJ7 A;  4GKJ F;  4DG1 A;  1SQF A;  4OI4 A;  4Y28 C;  4Y00 A;  4Z7C A;  1NSA A;  3RW7 A;  2C3U A;  4CNY A;  1C0T A;  2N7Y A;  2C2E A;  3BBC A;  2RE1 A;  1XC9 A;  1XIQ A;  5CYM B;  5CZV A;  1HWU A;  3DU5 A;  4B3R J;  3I9Z A;  3HI9 A;  3T1H F;  1YTY A;  1S6Q A;  4WJB A;  5KFQ A;  5KFC A;  3C66 A;  4CLT A;  1WF0 A;  4QBU A;  3MMA A;  2DH8 A;  4YHH F;  2H5J B;  2HHP A;  3W3S A;  1HNI A;  1WF2 A;  1RDR A;  1GFW B;  3D9B A;  3V81 A;  1TKD A;  4K50 A;  1VC0 A;  1UEU A;  2CNO B;  4C97 A;  1EKS A;  2FVS A;  3OUY A;  1F2H A;  2VHG A;  3LUY A;  3MM5 B;  2NPI A;  1C1C B;  2VQE J;  1IUJ A;  3CD0 A;  3GV7 B;  2KRB A;  1RK8 A;  4USK A;  4DLE A;  3CB4 A;  3DCA A;  1Q0N A;  4WZQ A;  2VH7 A;  1BLU A;  1WI6 A;  2KU7 A;  3UFC X;  5E41 A;  3PDN A;  8RUC A;  2F1F A;  3KOA A;  1APS A;  1HBN B;  5E2Q A;  4LUB A;  2HAI A;  5KFD A;  1VLY A;  3M4X A;  2C28 A;  2KO1 A;  4JI3 F;  4AND A;  1VFJ A;  2CYY A;  4B02 A;  5KT2 A;  1KRP A;  1XMO J;  3JSB A;  2ZBQ A;  1WC5 A;  2DPI A;  2ATL A;  2QIF A;  2MQP A;  2DCU B;  2CZ9 A;  3A8E A;  2BJ1 A;  4DUZ J;  2YKP A;  2DKO B;  1Y00 A;  3MAQ A;  3E01 A;  2ZKT A;  4YR0 A;  2JVO A;  3OL6 A;  4DX8 H;  1RQ0 A;  3CIM A;  4JI6 J;  1VQL S;  3S1T A;  2F9J A;  3M30 A;  3W65 A;  1V6H A;  2MQN A;  2RHQ B;  1IWG A;  2ZIT A;  7AT1 B;  2ZH2 A;  1VQO S;  3AOB A;  3MED B;  1U02 A;  1JIH A;  5KFM A;  3U1L A;  3K17 A;  5KFL A;  4ZLN A;  2UXB F;  1NJI T;  1JKH A;  3BEG B;  1GK8 A;  5K20 B;  5GAE U;  1RT3 B;  2ZOF A;  1RLC L;  2K7K A;  2VON A;  4A46 A;  3MR3 A;  1YVF A;  2QC3 A;  1S79 A;  4N56 A;  2WZ1 A;  2HQC A;  4MKB A;  1FRL A;  1RAH B;  4AQY J;  1RWP B;  2MYF A;  2NR0 A;  4J5O A;  4ECW A;  1UFK A;  3C15 B;  4ES2 A;  3HFK A;  1HNX F;  3C6T A;  1DJ0 A;  1Q8L A;  3IFE A;  1RYS A;  4C2M A;  4KGK A;  3HM9 A;  2HQG A;  3TAM B;  3CJ8 A;  2XLJ A;  4WPA A;  1KHW A;  1TMJ A;  1U1O A;  2XUL A;  2WVC A;  3JQM A;  4RW4 A;  2QA1 A;  1U45 A;  2N3O A;  1XR5 A;  4RW6 B;  3RTV A;  1YIT S;  1VQ4 S;  1M5P C;  1XNR J;  5GAH I;  3K0J A;  2OH2 A;  2YWW A;  1TUG B;  2GIR A;  2WVF A;  2ZUG A;  4A8S A;  1KNZ A;  2AZ1 A;  1TL7 B;  2QSW A;  4F0K A;  2E9R X;  3GB0 A;  3UDV A;  3KNG A;  3MPD A;  4NZ7 A;  3QT5 A;  1X9M A;  2JH3 A;  3H8Y A;  1HBO B;  2L9N A;  3UW1 A;  2OPQ B;  3VQT A;  2HBQ B;  1S10 A;  4RWX A;  3TVZ A;  2LYV A;  3DRR A;  2HVI A;  1FHT A;  3ZFV A;  2V8D A;  1FK9 A;  5HP1 B;  2HVD A;  2OP5 A;  4MIA A;  4EO8 A;  3KTQ A;  1OS5 A;  1PYT A;  3AQP A;  1FXR A;  1VI7 A;  2C2K B;  1HMV A;  2I1R A;  2UUC F;  3QIP A;  4DS4 A;  2YKQ A;  4A8F A;  2DIT A;  2R3V A;  2YWF A;  1XR6 A;  3HJV A;  3T1Y J;  2UXB J;  5IC6 B;  1ZAX A;  4ID5 B;  1CG2 A;  3UDC A;  3KLG B;  1HNW J;  4I6A A;  1RIS A;  3GIM A;  5HRO A;  2MZR A;  5A8K B;  3OL8 A;  3CCU S;  2R9L A;  2ZDO A;  4WXO A;  2FHO B;  4JI6 F;  4LFB F;  4F7V A;  5ADZ A;  4AL6 A;  3R5C A;  3KKF A;  2BQR A;  2DTJ A;  5GAG I;  1UEV A;  3GWC A;  1K0V A;  4A8O A;  2HHX A;  4TY8 A;  3DXB A;  3DN9 A;  3ETM A;  1XMO F;  1BQM A;  3GJT B;  4JI0 J;  1UCN A;  2YXL A;  5EX3 A;  2RRN A;  3P5B P;  1HWI A;  2L9D A;  1HI8 A;  2IM3 A;  2MB0 B;  2C42 A;  2AJF E;  5GAH U;  2BUN A;  1QAI A;  1REV A;  1FO1 A;  4RZR A;  1IBK J;  2MLX A;  1REV B;  2KKH A;  3L7O A;  3N5F A;  3W66 A;  2XY7 A;  1O5J A;  2ZZN A;  2YNH B;  1RTH A;  2QL7 B;  3MM8 B;  1SVD A;  3I9V 9;  2MKH A;  1RTJ A;  3QMQ A;  3R27 A;  3SSS A;  1H73 A;  1NME B;  3VAK A;  4ED6 A;  4DR3 J;  3HCX A;  5JMN A;  1KHV A;  2F4F A;  2BAB A;  3S01 A;  1T9X A;  5LJ3 Y;  2Z57 B;  2G2Y A;  3U1M A;  4OZ0 A;  2CVE A;  2H54 B;  3Q86 A;  4ZP6 A;  3VGV A;  2OFG X;  4EEY A;  3EMT A;  3FSX A;  4M94 A;  1E6V B;  2R7X A;  2XYP B;  3NNH A;  1HNX J;  3AXM A;  2OAU A;  4NYO A;  1TFW A;  1BD6 A;  2DNL A;  2WB4 A;  5K8N A;  4ES3 A;  4GC6 A;  2FZC B;  4KR0 B;  2V69 A;  4FBU A;  1U1R A;  2ZNY A;  3M8Q A;  1SIZ A;  4RW7 A;  4A4J A;  4A8K A;  3NLC A;  5A8K A;  3C46 A;  1IBL F;  3M9N B;  4I68 A;  3QWP A;  2DNO A;  2N4D A;  2OPQ A;  1C4C A;  1K9M T;  4P7V A;  4OV1 A;  1ZOT A;  4DJB A;  4NWB A;  2VL1 A;  5IT9 Y;  4UTG A;  4GKJ J;  1XEZ A;  2HS0 A;  4LSZ B;  2D3Z A;  3THV A;  1VR6 A;  1WG5 A;  4WFX A;  2JRS A;  4F2R A;  4PYD A;  2GIF A;  2LEA A;  3QID A;  2Z4P A;  4B08 A;  1UZD A;  3CPW R;  3RB6 A;  2IRX A;  3IXQ A;  5D4N A;  2V0N A;  5DQH A;  3FCW A;  2W8K A;  2WON A;  4P2F A;  1VQ9 S;  2KZM A;  1TAU A;  3R5A A;  3SCI E;  3I82 A;  1MWZ A;  3M2U B;  3M2R B;  1KEK A;  3CC4 S;  2ASY A;  4F26 A;  4MJK A;  5D78 A;  4K5S A;  1XN9 A;  1Y7P A;  4X2B A;  2DCL A;  1PG5 B;  1MSW D;  1RTD A;  4HDG A;  4ZVO B;  3GP9 A;  2MEW A;  1TL1 A;  4IFY A;  4R5P A;  1FRM A;  3P96 A;  3ZTS A;  1HHS A;  1UWB B;  3OW2 R;  5J1E A;  4F2S A;  1S5Z A;  3DMJ B;  1XMQ J;  3TVK A;  2DPJ A;  1U24 A;  1AW0 A;  3H2U B;  5T7L A;  4WP8 A;  4F4X A;  5L9X A;  1T9U A;  4K4Z A;  1DTQ B;  3A3N B;  3MOZ A;  3WC0 A;  5T14 A;  3QJJ A;  1DTQ A;  4OIX A;  5ETP A;  3T6B A;  2H5I B;  3OQ2 A;  1EHW A;  1RWO B;  2JWN A;  4HHH A;  2OPR B;  2BW2 A;  2OEM A;  2ZKU A;  2RRA A;  5U47 A;  2Z2L A;  2P5V A;  1UMJ A;  5A0Y B;  2V34 A;  1Z4U A;  3B78 A;  5DG9 A;  4U6P A;  2PFD A;  5IQQ A;  3DLG A;  4PKD B;  3I32 A;  3MDF A;  5H1S V;  2HMI B;  4N41 A;  3AD9 C;  4X4R A;  2ZD1 A;  2R7R A;  2PMH A;  5KTQ A;  1J2V A;  2DH9 A;  1HBU A;  2AW0 A;  5KT6 A;  2LEC A;  1PO6 A;  3RGI A;  4U9R A;  2DRB A;  3MPU B;  3K5O A;  5CD4 H;  3IR5 B;  1CS4 B;  2VPW B;  2CPI A;  2Y0B B;  3HVA A;  4KGZ B;  1VC6 A;  1L3V A;  4KHM A;  3W61 A;  2WK4 A;  3MZI A;  2GGP A;  2UVV A;  2AWZ A;  3G6E S;  1IKW A;  4XPE A;  1JLC B;  4R8U A;  4DR7 J;  5JUM A;  1L3K A;  2DBB A;  3HDS A;  4ECZ A;  1TVR A;  4USW A;  1YG0 A;  1U1N A;  1TL4 A;  2HQF A;  3MUT P;  4FZV A;  1E6Y B;  3H7H B;  4LR8 A;  3QQC D;  1C0U A;  3TX0 A;  1UP1 A;  4Y6I A;  3EVW A;  4X4S A;  2HHT A;  4IG0 A;  1NHV A;  3M6V A;  3UI3 A;  1GMW A;  3MFH A;  3DDN A;  2ZE2 A;  3KLE B;  2J8A A;  2YNF B;  3FRZ A;  4FN5 A;  4ID8 A;  4I2P A;  3EZ5 A;  1S99 A;  3PYG A;  2MST A;  4D3G A;  4NLG A;  1S1W A;  1RP5 A;  2Q43 A;  3IR7 B;  5A8R A;  4C4W A;  1U1M A;  3NWR A;  4NA3 A;  2YX1 A;  3DRS B;  1N36 F;  4LF7 J;  1VQS A;  3DDK A;  4A8Y A;  4A48 A;  3DXS X;  2B8P A;  1V3R A;  1UVL A;  2CJQ A;  2E1P A;  2OEJ A;  2ZFH A;  5DM6 Q;  2HFZ A;  2KG1 A;  1LWE A;  3GJR B;  4LBH A;  1RAO A;  1T11 A;  4DCJ B;  3GV5 B;  1Q8I A;  1XTZ A;  2W2O P;  4YP3 A;  1D9F A;  3TUP A;  1U8W A;  4K4V A;  3CCJ S;  1WC1 A;  2N7C A;  5KT7 A;  2UVW A;  1M1G A;  2BEF A;  4DV1 F;  4J9N A;  4DFJ A;  1VQ5 S;  4DI6 A;  1X4C A;  2RUS A;  3I0R B;  4ILR A;  4LRE A;  1Q4R A;  5BYS A;  7FD1 A;  3G8Q A;  2HS3 A;  3LGM A;  1PBU A;  1RGV A;  3QAT A;  4FVM A;  4M1K A;  4YEA A;  4YR3 A;  3I56 S;  2HFN A;  2W4D A;  3FQK A;  3M7V A;  2NPF A;  1JJ4 A;  5AE3 A;  3BGR A;  1M5V C;  2BBE A;  4PR6 A;  4YR2 A;  1IKX B;  3J7Y U;  3MD3 A;  4WU2 A;  1U6F A;  4NOH A;  3LAK A;  1YJR A;  5IXU A;  2ZZT A;  1VBZ A;  5D4L A;  5KFR A;  1WC4 A;  3VAH A;  2QLJ B;  1KWM A;  3KYL A;  4ECY A;  2BOP A;  1H7W A;  1VRT A;  4CIO A;  3Q8P B;  1I3O B;  2XMV A;  4UUW A;  2R8G A;  3CJ4 A;  1HWK A;  4O3O A;  5LM7 E;  4I4B A;  4JV1 A;  1EJ7 L;  2RSQ A;  2XGQ A;  1T05 B;  3Q0A A;  3KJV B;  4IR9 A;  1ROF A;  3DFE A;  4W4M A;  1Y10 A;  3DM2 B;  4IO9 Q;  3M8S A;  3G4S S;  1TV6 A;  1B70 B;  2EPI A;  4P6Q A;  5F41 A;  2RQM A;  4JI1 F;  1C4A A;  4C8Y A;  4Y2M A;  2WSC C;  1ZBT A;  1DAR A;  1KVK A;  2PEH A;  2V68 A;  1WAC A;  3N5B A;  1FNM A;  2VA3 A;  3QBC A;  1S1U B;  1U2R A;  4G1P A;  3VQS A;  2VJV A;  3O8W A;  2IBO A;  4LF4 J;  2DXD A;  3AD8 C;  4DZD A;  2DNY A;  4DFP A;  1N33 F;  4CO3 A;  2Y1J A;  4PXE A;  4EMD A;  1DQ8 A;  1OYE A;  2HNZ A;  1IKV B;  3QYY A;  3HZG A;  4OHV A;  2AGQ A;  1C0T B;  4NZ6 A;  4LQ9 A;  2YPZ A;  4TLQ A;  5CH7 B;  1S1X A;  3OTE A;  5D77 A;  4RU2 A;  4F4Y A;  2Y1I A;  1H2T Z;  3GON A;  3CED A;  3FVY A;  3POT A;  4J9L A;  3CO0 P;  4LRA A;  3RU0 A;  1X0F A;  1VQY A;  2ZH7 A;  1U47 A;  2V4J B;  2OKQ A;  3I0S A;  3SSR A;  1WKL A;  2R7O A;  2HHH F;  3ISN D;  4V1A k;  2OUG A;  1ICE B;  2XNQ A;  4CM2 A;  1U6Z A;  3MD1 A;  3NGT A;  2VKR A;  5F0W A;  2KH9 A;  4ZN3 A;  4DV5 J;  4J9P A;  1FK9 B;  2FC8 A;  3OJS A;  3M2V A;  5HP1 A;  3NMA A;  3ZZP A;  1NJX A;  1O8B A;  3CCT A;  1FWL A;  3V6D A;  4OJ3 A;  1VOM A;  2X3G A;  3MM7 A;  4I7F A;  2BMB A;  2XHC A;  4X66 J;  1XK8 A;  2AQ4 A;  1H74 A;  1VBK A;  5HAO A;  3OTC A;  4U7C A;  4DL7 A;  4MFB A;  3I4H X;  2B9Y A;  4NYP A;  4U8V A;  3J7Z T;  2OSQ A;  3Q8R B;  1G1X A;  1N88 A;  2EFQ A;  1VQN S;  2DJW A;  2GMJ A;  2XGP A;  1GX6 A;  1KDN A;  4G65 A;  1RHR B;  1XJW B;  2CQ4 A;  3RB0 A;  2P8I A;  4PPZ A;  2W7O A;  2LU1 A;  3IG1 B;  4JI8 J;  5THW A;  2YKM A;  1QTN B;  1LW2 A;  2DY9 A;  2UUW A;  3HVT A;  3W7B A;  4Z2X A;  4DR2 J;  1RU1 A;  3KJQ B;  4H4K C;  1CJV A;  2B5J A;  1SI9 A;  2DEJ A;  2PGC A;  3HSD A;  4N47 A;  4ANE A;  1FNX H;  2KVQ E;  3EM1 A;  4NRU A;  3OVB A;  3U02 A;  4PXC A;  2DGX A;  3V2U C;  3MMB A;  1IKV A;  1NH8 A;  2HK2 A;  2HNZ B;  5GVQ A;  2XMU A;  1W2I A;  2MQ8 A;  3WBZ A;  4DSI A;  2VOO A;  2IA0 A;  1SQE A;  4S0M A;  4JI7 F;  3X1L B;  3KK1 B;  2CUY A;  4HLB A;  2ZHO A;  2MKI A;  5A0Y A;  4GVB A;  1N56 A;  2V9W A;  3R2C J;  2W7P A;  3DI6 B;  1S6O A;  5A6P A;  4F3O A;  3CTR A;  4YY3 F;  1K1Q A;  4DV5 F;  3V5R A;  1HBN A;  1JLG B;  2FD2 A;  3ILJ A;  2GNK A;  4ZLJ A;  4LFA F;  1RTJ B;  2KM8 C;  2PI4 A;  4M5D B;  4KRW A;  3TZX A;  3ENV A;  1R8H A;  1K1S A;  3PJX A;  5D0E A;  1AXQ A;  3OSP A;  3NCP A;  5FII A;  4YME A;  3DLJ A;  2EWH A;  3MI7 X;  4L72 B;  2W4C A;  2A6O A;  4JI5 J;  2XO7 A;  3W2W A;  1H0H B;  4USV A;  2FLP A;  2CXE A;  2RF2 B;  2JDJ A;  1WWH A;  3M6X A;  1RCO B;  2P9E A;  2XBP A;  4E8U A;  1U1P A;  1DLO A;  3CJ0 A;  3LO3 A;  3US5 A;  4KB7 A;  3I96 A;  2OPS A;  1R0B G;  2B9X A;  2FIU A;  1R31 A;  3M8P B;  3Q89 A;  4MK9 A;  2XZD B;  4MTP A;  5KT5 A;  3GIL A;  3PO5 A;  1RT4 B;  4OI0 A;  2E5L F;  2P6S A;  3G9C A;  3DGP B;  3ISZ A;  4OZ1 A;  2HK3 A;  4CRJ A;  4CYU A;  3KK3 A;  4L6V 3;  4B9U A;  2EFN A;  3KG0 A;  2BXJ A;  2HG4 A;  3UN2 A;  3FJ2 A;  3M6U A;  3A13 A;  5F8L A;  1FKO B;  1S1W B;  4LIW A;  4DV0 J;  3RG6 A;  2W7A A;  1RJJ A;  2RU9 A;  4ECT A;  3DHX A;  1I94 J;  3D0I E;  2ZOG A;  3AOA A;  1MRO A;  1QE1 B;  3TJ9 A;  3TNV A;  1D3W A;  2FJA B;  4USI A;  3TUZ C;  1G3O A;  1EIY B;  4AXI A;  4C8K A;  3OHB A;  3N6N A;  5DM7 Q;  2EBG A;  3QFW A;  4ELT A;  3THP A;  2CJ9 A;  5J1N A;  4RU9 A;  1S1T B;  1UVK A;  1HMV B;  2ZBP A;  3TUJ C;  2MTL A;  5M2U A;  3QGH A;  4DV2 F;  4QWE A;  3DLH A;  1RWX B;  1S1V B;  1SBR A;  3W62 A;  2ZVS A;  4IFY B;  4YS2 A;  4X4P A;  4DF8 A;  2OIH A;  3Q2S C;  1YJU A;  2AJ1 A;  1DFD A;  3AB2 B;  5KOW A;  1DZ5 A;  2YNF A;  4ED3 A;  1ZZN A;  1G7C B;  3BPS P;  2R7V A;  1GXT A;  4ZIV A;  3QAE A;  2VJU A;  3UPF A;  1VIO A;  3HHE A;  5L1K A;  2J0X A;  5I4M A;  3CJR A;  2GML A;  3ET6 B;  2AYG A;  1LWC B;  3QZ8 A;  4IRC A;  2R7W A;  3R7B B;  3LP2 A;  4NE9 C;  3W8P A;  2FJD B;  2XSF A;  4CO2 A;  4K2J A;  2BE2 B;  5J2M A;  1NK5 A;  1K73 T;  1Y5I B;  2XS7 A;  1KQK A;  2B4O A;  4PUO A;  4AL5 A;  1JLG A;  4EZ6 A;  2UZA A;  4KGV B;  5IWA J;  2MJU A;  3HHL A;  4PYA A;  4K4X A;  3RBD A;  2HUR A;  3OR2 B;  2KHC A;  1RT6 A;  4E0D A;  2HWI A;  3RRH A;  2FVR A;  1SKR A;  5LMU F;  1FRJ A;  4CTA B;  4OI2 A;  2DHG A;  2WCX A;  5ETQ A;  1HQ2 A;  1Y3J A;  4ECX A;  4DR1 F;  1WOS A;  3J7A N;  1TKX B;  1UKU A;  2WW8 A;  3CJT A;  3O1L A;  2R2T A;  2IBK A;  1H6K X;  1QDU B;  3HP6 A;  2F4V J;  4LVO P;  1WKK A;  2VDH A;  1MML A;  3HVW A;  5IM0 B;  1X4F A;  3CE8 A;  2SXL A;  3CWJ A;  4MMO A;  4NLR A;  5D6G A;  4ZCK A;  4MH8 A;  1B0V A;  1XQI A;  2D3O 1;  3OTB A;  1IJE B;  4M5K A;  2AHO B;  2AZ3 A;  2XS5 A;  2M88 A;  1SL1 A;  3TX8 A;  1D09 B;  1B64 A;  1SB6 A;  4LBP A;  3MUM P;  3GG0 A;  1RHQ B;  1VQM S;  2F65 A;  4KY3 A;  2WAQ D;  1EX8 A;  3TQE A;  2RH3 A;  3IS9 B;  3QO9 B;  4WFY A;  2LQ9 A;  2ZH9 A;  1RAI B;  2BX6 A;  5CYQ A;  3CMA S;  2BQ3 A;  2F8E X;  3BPD A;  4A8W A;  2HAF A;  1Y5L B;  3EGN A;  3SFG A;  3C6T B;  3FNN A;  4USH A;  5HLF A;  3FFI B;  4PG4 A;  2QLB B;  2WVB A;  1TL3 B;  3CD5 A;  4GC7 A;  1S9G A;  2A2C A;  3D1Q A;  5C42 B;  1SH0 A;  4V19 J;  1KOO A;  4JUZ A;  2DNP A;  4OI1 A;  3ZNJ 1;  5IWA F;  1GNK A;  5K8M A;  1NKB A;  1KP6 A;  3ENA A;  1NUE A;  4RBT A;  1HQU A;  1FJE B;  2NSB A;  4MYT A;  5D4O A;  2BDP A;  4IKA A;  5D0R A;  2G2O A;  3BDE A;  1YKW A;  1FWK A;  1HBM B;  3MHY A;  2QMW A;  3C14 A;  4N76 A;  3OUY B;  1S6P B;  2M7S A;  3K59 A;  3EDQ B;  3Q8V A;  1GAO A;  2EFG A;  3Q23 A;  1CLF A;  2DGO A;  2HHW A;  3PJ9 A;  1N36 J;  1UVI A;  1NO8 A;  4KHR A;  5DQG A;  1WC3 A;  3MR5 A;  3GFX A;  2V9K A;  4M5N A;  3BGU A;  3ZTP A;  4HH0 A;  2QL9 B;  3WZ0 A;  2J9E A;  4O0N A;  5DS7 A;  2FGO A;  4LSL B;  4OYB A;  5CQG A;  3ZZZ A;  2NSC A;  2LQJ A;  2XMT A;  3TI0 A;  1CPZ A;  4UY8 5;  1RWM B;  1UW9 A;  2J6S A;  1MN7 A;  2LQB A;  3DLK B;  4YN3 B;  2G0C A;  4CT9 A;  3Q8S B;  3VGU A;  1SJ3 P;  4X4V A;  1N0U A;  4RNH A;  3ENW A;  3EZO A;  5SZT A;  4ZVE A;  1W26 A;  2OEL A;  3EIC A;  4CTA A;  2XS2 A;  1NZ8 A;  3ETO A;  3RW6 A;  3T5L A;  3AY0 A;  3VF0 B;  2XYH B;  3N0V A;  2JLF A;  3P5T L;  5ETK A;  3SSQ A;  2ZM6 F;  5K8P A;  3KG4 A;  4DV2 J;  3LH2 S;  4CI0 B;  1QSL A;  3OXL A;  5LOQ A;  4OLP A;  1TP7 A;  4DMZ A;  1S57 A;  4QPX A;  1BQM B;  3AJD A;  4WK3 A;  2F8H A;  4ZPB A;  5IV4 A;  2L41 A;  1R7I A;  1V3S A;  1NK4 A;  2QA4 G;  4KQZ A;  3ZTQ A;  4IQX A;  3LPY A;  1NHK L;  2AYM A;  5LMN J;  3BV8 A;  1IKY A;  4U7U K;  2KFN A;  4C0B A;  2ZWP A;  1N0V C;  4Q8F A;  2XSJ B;  3MXH P;  3W8G A;  4DR3 F;  1RT1 A;  2DHH A;  3PRV A;  5HRO B;  2FJX A;  3T5J A;  4WZM A;  1I1G A;  1FDN A;  1PYO B;  4LR9 A;  2FZK B;  4XDC A;  4L3N A;  4O44 B;  4DV0 F;  4C98 A;  1KLM A;  4C3L A;  2F3J A;  1TEL A;  4GMK A;  3SFU A;  5A2Q U;  3NL0 A;  1NAQ A;  3OFG A;  2CG4 A;  4K0K J;  5F8M A;  4WFN Q;  4Q8E A;  3AA8 A;  1XMQ F;  1CJU A;  1S9E B;  3M1V A;  3WX4 A;  3R1H A;  1T02 A;  3HT0 A;  4RW4 B;  3WIV A;  3NCQ A;  4CLF A;  1RBL A;  3TAM A;  2AV5 A;  1JJ2 R;  1EB0 A;  4LFC F;  1M90 T;  1K47 A;  4RUA A;  2BE9 B;  3AA9 A;  5D15 A;  4ZVH A;  2E1A A;  5JJB A;  3NOG A;  1YZ7 A;  1VIX A;  3C14 B;  4PAB A;  3R8Y A;  4C7Q A;  1HBO A;  4WFA Q;  3KLH A;  2YKM B;  3QLH B;  1DTT A;  1RTI A;  4IYQ A;  4NML A;  4DSF A;  3AB4 B;  3P8B B;  4FDF A;  2ZBR A;  1HL6 A;  5JXS A;  3KG1 A;  3UNG C;  3ZZO A;  4ED2 A;  3G6Y A;  2XHW A;  1WOP A;  4KT0 C;  4ED0 A;  1VIS A;  2JFD A;  4WYL A;  1G2E A;  1F60 B;  3MEG B;  4GRS A;  1VYA A;  4MFB B;  4BHQ A;  2I38 A;  1RWK B;  1UJ6 A;  2M4M A;  4ZIT A;  1Z2L A;  4KHP J;  3MEE A;  1XR7 A;  1NK0 A;  1ZYQ A;  2CQD A;  3OFH A;  3M8Q B;  4RW7 B;  2CIM A;  5L1I A;  3GV8 B;  3CW2 C;  1UFL A;  4G6V B;  4GVL A;  3VGT A;  3I87 A;  1G4C A;  2YNG A;  3NS7 B;  2HNY B;  1WEZ A;  1KFS A;  2F5G A;  5JVH Q;  2R2R A;  2IM0 A;  1H72 C;  5CXT A;  1K0T A;  2ASD A;  2FHM A;  5C2C A;  1RT3 A;  2YX4 A;  2IVF B;  1N52 B;  2YH0 A;  1D0E A;  3IBF B;  2DGQ A;  3MMC A;  1HHQ A;  2LFV A;  2VD3 A;  1KKH A;  4PQA A;  4UOC A;  1JXL A;  3UCU P;  2UUA F;  1SC6 A;  2CDQ A;  2QO3 A;  4K2X A;  2IJR A;  4JI2 F;  3H25 A;  1YK9 A;  2MLZ A;  2NXE A;  3HMJ G;  4ITS A;  1FJ7 A;  4NLW A;  3CJK A;  3HKZ D;  5A8W A;  3JSM B;  1BGX T;  1UA0 A;  5DDO C;  2MXY A;  4ZA1 A;  2IC3 B;  2LP4 A;  2IHR 1;  5KFH A;  1FES A;  1RWV B;  5FDL A;  2ASJ A;  4XIU A;  3H5U A;  2LU2 A;  2XI3 A;  2M52 A;  3IGV A;  4NLX A;  4PEO A;  3FKB A;  4JV2 A;  1HAR A;  2DHX A;  2V2V A;  1YRX A;  2B7B B;  2W8L A;  3PYE A;  4NLT A;  4RWW A;  3T41 A;  1F5A A;  1OY9 A;  2A6M A;  2DIV A;  3GE9 A;  4F25 A;  1TU0 B;  2ZWO A;  5BJR A;  1FVS A;  2F40 A;  2Y0S D;  2FJW A;  2VOP A;  4LRF A;  4OQJ A;  4QWC A;  4G3I A;  3UDE A;  5AE2 A;  1JJC B;  3T6J A;  5ETO A;  2JOQ A;  2GJ2 A;  2M5Y A;  1GX5 A;  1CC7 A;  2CJK A;  3MR6 A;  4JV0 A;  1VRT B;  3H20 A;  3CME S;  4OHX A;  4OZN A;  1RT7 A;  4LF4 F;  1YQH A;  1JXV A;  5HL7 Q;  4NCB A;  3LQV A;  2ILZ A;  4QIG A;  4QZV B;  4QR2 A;  1QD1 A;  2FYX A;  5IT4 A;  3BO4 A;  3V81 B;  4FF1 A;  4E2F B;  3IMQ J;  2K3I A;  4C8M A;  1NDK A;  3IRX B;  1SKU B;  1RAC B;  2GQQ A;  3R6G B;  4LSN A;  4E98 A;  2JEF A;  1JLF B;  4TKT A;  2O3D A;  3AJ2 A;  1FXL A;  1AFI A;  2MY8 A;  2E1M C;  2VF3 A;  1LFW A;  2G1H A;  1Q95 G;  2XYG B;  4GO5 X;  2R8K A;  2E44 A;  2UVR A;  1LNQ A;  2O1P A;  4FVC A;  2V2Q A;  4N5S A;  1ZTT A;  4DBQ A;  1C0U B;  2RKI B;  3H40 A;  4RW8 B;  3KUH A;  4IDK A;  3RAM A;  4KIA A;  1LWF A;  2E7W A;  2FB0 A;  3AXK A;  1KQG B;  3ZTO A;  3HHD A;  3M6W A;  3GCW P;  1SH3 A;  2R7S A;  4KGM A;  3TAR A;  1NB2 A;  4ZLL A;  1AB8 A;  3LTO A;  2DH7 A;  4NRT A;  3C2P A;  1X5O A;  3PHT A;  3WDO A;  4YHH J;  4L3K A;  3BB5 A;  1GEH A;  4TQS A;  1S77 D;  2HWH A;  1QJH A;  3IM8 A;  3CJ3 A;  3OJU A;  2DR7 A;  5DZ6 A;  2AEM A;  2I8E A;  3BBF A;  4X65 F;  2KYZ A;  4KFB A;  5J2M B;  2UXC J;  2IRY A;  2RF2 A;  1MW7 A;  6FD1 A;  1OO0 B;  1PAE X;  2RQK A;  5I42 A;  1GMU A;  3TUI C;  1RE1 B;  4CM0 A;  4PQU B;  4KKO B;  1TKZ B;  1FI4 A;  1H2U X;  2DD8 S;  4ZVS B;  4ZMM A;  3M8R A;  2QMU B;  5KFY A;  3JAM U;  2P9C A;  2J6U A;  2V4R A;  4TU7 A;  1U49 A;  1NJZ A;  4DZ6 A;  1WJ9 A;  2KJW A;  2CAJ A;  5EHH A;  3HX9 A;  4DUY J;  3EGZ A;  1JLF A;  1KTQ A;  5HVG A;  3B4D A;  2X1F A;  3MMA B;  1EQ0 A;  1F9E B;  1SUQ A;  2EFV A;  1M5S A;  2UUT A;  2NLW A;  8AT1 B;  4ATN A;  2AJQ A;  4DUZ F;  3SXL A;  2KI2 A;  1L3U A;  3VAG A;  2OLW A;  4NXM F;  3VGS A;  3N6M A;  2V50 A;  3Q8Y A;  4ZDN A;  3L95 X;  2PO4 A;  3NGS A;  3W9H A;  3PKY A;  1HNW F;  1RT7 B;  2N4C A;  3PNI A;  2ACM A;  4HDH A;  4P73 A;  5LJ5 Y;  5I3U B;  4DR6 F;  4XTT A;  4X4N A;  5AE1 A;  2CQB A;  2M0G B;  3D3B J;  3OLB A;  3KLF A;  4LT6 A;  1NDL A;  2GA7 A;  2W9C A;  1LW0 A;  1Q5Y A;  1NRK A;  3ILI A;  4FS2 A;  1GXU A;  2XSJ A;  1B0T A;  2H51 B;  2PA8 D;  1JLQ A;  2VQE F;  2NRE A;  2F7V A;  4LF1 A;  3UNY A;  4XPC A;  4IG3 B;  4FXD A;  4Y65 A;  1NCL A;  4PWU A;  1MU2 B;  3JQK A;  4NPO A;  2RB7 A;  1TL3 A;  1YBA A;  3QAU A;  4DU8 A;  3DLL Q;  4DQQ A;  4M8L A;  2KG0 A;  3PRB A;  2VV5 A;  3Q8Q B;  3JTP A;  1FF2 A;  2G9O A;  1HFE L;  2MKY A;  5J1P A;  1HNZ J;  1RCX B;  3D6T B;  3MCO A;  5G0R B;  3V4I A;  2LXI A;  5BYQ A;  1NZA A;  2LXU A;  1OSD A;  3CD6 S;  4MKV A;  2WB1 D;  3VHQ A;  3CUL A;  3OXF A;  3I0S B;  3FCH A;  2FHJ A;  3R6L B;  2MGZ A;  4QWB A;  1X31 C;  2RD5 C;  5EWE A;  2C2M B;  2G1D A;  4ZOS A;  2W4P A;  2RIJ A;  3OL9 A;  1IR0 A;  4AXJ A;  2VC1 A;  1U0H A;  3UN3 A;  3VR1 A;  4UT4 A;  2JEG A;  5CAB A;  2YVS A;  2CWX A;  2AGP A;  3KUE A;  2IAJ A;  5HMW A;  3NGD A;  3MPW A;  2UV8 G;  2XI2 A;  4DX6 A;  1WEX A;  1Q86 T;  2E66 A;  2CPD A;  5A76 A;  4J9V A;  2H5E A;  3L7U A;  3DOK B;  5E0O A;  4X62 F;  2HVZ A;  3KLV A;  4I69 A;  2V63 A;  4NEZ A;  4URS A;  2MZ1 A;  4UST A;  1WTF A;  3R97 A;  5I3Q A;  3OT9 A;  2CQI A;  2W2Q P;  4USU A;  2EW9 A;  4CLL A;  1FJC A;  2LDI A;  1Y5N B;  2Z30 B;  4O44 A;  3SZ2 A;  4B9S A;  4IH6 A;  1ACM B;  2V2Z A;  1RHK B;  3DM2 A;  1VQ7 S;  5GAD U;  3FBE A;  1GMV A;  5C24 B;  3T5H A;  4JI8 F;  1KSP A;  1URR A;  4NEY A;  3BQ1 A;  5I3P A;  2NXU A;  4K4S A;  2RRB A;  1RSC A;  1ARO P;  1REG X;  2AX0 A;  3NKY A;  4C11 B;  2Y1L B;  2BOA A;  1R8P A;  2RQ4 A;  1SL2 A;  2CZV C;  4AUK A;  5DET A;  4OYO A;  5F0U A;  1ZAV A;  4ZP9 A;  3R5B A;  5LSL A;  4MAK A;  3IBC B;  1LWE B;  5KFV A;  4HHU A;  4ZCM A;  2CPY A;  2B8Q A;  3FC9 A;  4TN2 A;  5D4P A;  2MQQ A;  3K5L A;  2BRL A;  4UOH A;  1GTE A;  1R89 A;  4I56 A;  5K14 B;  5CAA A;  2FZG B;  3MUR P;  5KFT A;  1WEL A;  5IV3 A;  1VBX A;  1U2C A;  1JLQ B;  2F8M A;  5M2P A;  2WOM A;  3FGV A;  3I0R A;  5M2R A;  5E33 A;  2HFV A;  2QA4 S;  2IPO B;  3VAF A;  4ZP7 A;  1OIA A;  1IM6 A;  1VMB A;  3AJ1 A;  3W5Z A;  3JTO A;  1HI0 P;  1IN0 A;  2PC6 A;  5F3Z A;  2IMW P;  2DK2 A;  3B4M A;  1RZM A;  4NI2 A;  4ZN1 A;  1NPK A;  5E3C A;  1ZH5 A;  4DL0 C;  4P75 A;  1NKC A;  2ZUA A;  4NCG A;  4DL5 A;  1SL0 A;  1NND A;  5H9F J;  2KTQ A;  4RR5 A;  2E7X A;  3MCM A;  4HH1 A;  1ZM4 A;  3HF5 A;  5LSR A;  1KOH A;  1PCA A;  4J9Q A;  3TEH B;  3H90 A;  5KFG A;  3LWM A;  2BJ7 A;  4DR6 J;  2ZE2 B;  2JEI A;  1AZS A;  2RS8 A;  3FZB A;  4NL5 A;  2DO0 A;  4DV6 J;  4LRC A;  1FFS B;  2B4P A;  2KDO A;  2L48 A;  1YJ9 S;  5FLX U;  4DV3 F;  4F4K A;  1SKW A;  4C11 A;  1WSR A;  3Q8U A;  4X4U A;  2PT0 A;  2Q6C A;  4U95 A;  4X4Q A;  4KYZ A;  4DN9 A;  4KPC A;  5J2Q B;  4F3Q A;  3ZZT A;  4O3R A;  2B3T B;  4OZL A;  2VUG A;  2DR6 A;  2A1B A;  4WE1 A;  4TU8 A;  2LCW A;  2UUC J;  4NX9 A;  5AXL A;  3S6E A;  2CWK A;  4F4W A;  3G82 A;  2AD9 A;  3PYD A;  2JJ4 D;  4ZP8 A;  1FD8 A;  4AYB D;  5B0F A;  2UUB J;  4OZ2 A;  5LT5 A;  3OLA A;  1U25 A;  5KG4 A;  1FJG F;  5DZ7 A;  1T94 A;  2C2R A;  2YWG A;  2RU3 A;  1RKI A;  3SCL E;  3G96 A;  1P9Y A;  2EEY A;  1HPZ A;  4EZ9 A;  3UVJ B;  4B3R F;  4HHJ A;  3OFF A;  2OPR A;  2LDY A;  5B0A A;  1JWW A;  1JXE A;  5F8G A;  1N5T A;  2M2B A;  2IY5 B;  5KG5 A;  3E8O A;  4P10 A;  3ZTR A;  5DDQ C;  3M32 A;  5B0E A;  2ALZ A;  4F8R A;  4FP9 A;  4OYZ A;  2QJ3 A;  3SV4 A;  3NS5 A;  5IOL A;  1NPR A;  4KBI A;  4NA2 A;  1WG4 A;  4A8Q A;  3BN7 A;  4LF7 F;  3DGP A;  2PI5 A;  1WNE A;  1N32 F;  1VQK S;  2CNN B;  3BM7 A;  3GR1 A;  3KLH B;  3MR7 A;  4KHP F;  1Z1Z A;  2B6A A;  3DU6 A;  2FLN A;  1P1L A;  4ZCL A;  1FRI A;  3O44 A;  3PIO Q;  2ZJP Q;  4OHW A;  5D3G A;  3IWX A;  3HVT B;  1J27 A;  1MU2 A;  1F3V A;  2NYI A;  4RNF A;  1S97 A;  4B9L A;  1W2B R;  4W92 B;  2E1C A;  2QT7 A;  4OI3 A;  3IR6 B;  4K59 A;  4IDK B;  5D0G A;  1FX2 A;  1V3Z A;  5GME A;  4LMZ A;  4QQB A;  1KBR A;  2MKK A;  2MZS A;  4LF9 J;  1EKR A;  4J9S A;  5EUH A;  2CJB A;  2IIH A;  1L5U A;  3POT B;  4LVN P;  1YBT A;  2J0W A;  3MED A;  2BZ2 A;  5KFU A;  5KFE A;  5L8R C;  3NBP A;  4OHZ A;  3ZZY A;  2GVD A;  3DI6 A;  4BWM A;  1AUD A;  2DNH A;  1RT1 B;  2X3D A;  5CYQ B;  3PW0 A;  3NAH A;  2ZH4 A;  1Y3K A;  3TA2 A;  2YH1 A;  2WOM B;  4IOC Q;  3R1L A;  2AEJ A;  3NG8 A;  5C7P A;  1FX4 A;  5AXN A;  1PC4 A;  4RW9 A;  2HND A;  4X84 A;  1Q1K A;  1YJV A;  3MEC B;  2QLW A;  3L3C A;  1ULR A;  3C8Y A;  4M63 A;  4CO4 A;  2CDR B;  3H5X A;  3SQO P;  1Q8B A;  2XLI A;  4X64 J;  2XZT B;  1X60 A;  2MZQ A;  1PYS B;  1UFW A;  4PUO B;  4Y2C A;  3NNC A;  3T1H J;  2PA3 A;  3MCS A;  3ZC4 A;  1RU2 A;  4J91 A;  3K7R A;  4HEA 9;  4LR7 A;  4EO6 A;  1BE4 A;  3HHK A;  2B4U A;  2LXF A;  2PMZ D;  2HNY A;  4CO1 A;  4CYU B;  1TL1 B;  1KON A;  4DWI A;  1R0A B;  2JL9 A;  1SJR A;  1RT6 B;  1DTT B;  2X7I A;  3QGI A;  4H54 A;  2QRR A;  2I6W A;  5J2P B;  1HHT P;  5B7W A;  3TZW A;  1L3S A;  1RT2 B;  4XO0 A;  1JNZ B;  2CVI A;  3PZP A;  3Q22 A;  3D3C J;  2NXC A;  2JZ5 A;  1JNR B;  4TLR A;  5B09 A;  4X62 J;  2Q66 A;  2MKC A;  3L9Z A;  5AJ3 F;  1JK9 B;  2OMO A;  2CQ2 A;  1OY6 A;  3HHL D;  3MCN A;  4ZVR B;  2ROP A;  4WII A;  2AP6 A;  2QX0 A;  2PDA A;  4F36 A;  4QW8 A;  5HBM B;  4I1T A;  4QR1 A;  4ELV A;  2CQH A;  1S1T A;  1HWL A;  1LW0 B;  1RAB B;  4DR4 J;  2BM0 A;  2V4J A;  3PFO A;  2OJ3 A;  2IM2 A;  3FK4 A;  3ELH A;  4OZ3 A;  4RO0 A;  4DFM A;  2I5J A;  4DV4 F;  2GMH A;  4J9R A;  1U7L A;  1KLM B;  3MM9 B;  3R3T A;  4Q7A A;  4J9M A;  3JYT B;  1L3T A;  5JVG Q;  3QT6 A;  2EK1 A;  4ZPV R;  4KAI A;  3CDW A;  2UP1 A;  2GV1 A;  2QG9 B;  1ZPW X;  5DO2 A;  1U1L A;  3GLJ A;  1SKS A;  1BY9 A;  4DXL A;  3BGR B;  2ABY A;  2XMM A;  4BLG A;  2DIU A;  5AT1 B;  2RQC A;  8ATC B;  5HVF A;  3W9J A;  3VAJ A;  2B9W A;  2VDI A;  3TAN A;  3CDU A;  3D5M A;  3EUN A;  1RHM B;  4DS5 A;  2FQQ B;  3JQJ A;  1U8S A;  2EC2 A;  2LQ5 A;  5HK4 A;  2GHW A;  3M8P A;  4ZJO A;  4FPR A;  2R7T A;  1VGY A;  3VVT A;  1MG7 A;  2O5D A;  1DLO B;  3BGF A;  2A18 A;  4J9O A;  3K57 A;  4I6Y A;  1PIE A;  2OPS B;  4Y2I A;  4F3M A;  3KHG A;  1Q8K A;  3UR0 A;  1GMW D;  1U0S A;  3H5S A;  4KH1 B;  3J81 Y;  4OZJ A;  4YFU A;  1RB0 A;  1YI2 S;  1NHU A;  2XMJ A;  1FKO A;  1I51 B;  2L9W A;  2I9S A;  3KFW X;  5DGA A;  4XAK A;  3TOQ A;  2I0X A;  1VRU B;  9RUB A;  2MZT A;  4DSL A;  1JLE B;  1RT5 A;  3R5G A;  3F41 A;  1KVI A;  3DRS A;  1U2F A;  2WBM A;  2CPF A;  2KT5 A;  2GGP B;  1WDD A;  2YQ3 A;  3VAM A;  2O67 A;  3C15 A;  3FFI A;  3NEK A;  1TTH B;  2YNI A;  4LSL A;  3HSG A;  4PPD A;  2N3L A;  2VZ9 A;  4LFA J;  5SUH A;  4IO1 A;  4R25 A;  3TP2 A;  3V6D B;  2JHE A;  4NYZ A;  4QIF A;  5RUB A;  2A0F B;  2ZH6 A;  1UAW A;  1TKT A;  4GKK F;  2XZW A;  3GR0 A;  3DRP A;  3LP0 B;  4PG8 A;  2Z2Y B;  4ED1 A;  5CYJ A;  2H3E B;  2YKN B;  3U1N A;  1LWF B;  2B4V A;  4ZJL A;  3X3U A;  3ZXW A;  4K4W A;  1JKH B;  3BH7 B;  4QOT A;  1CJV B;  3A8J A;  3GFY A;  2Z56 B;  2RML A;  3NBP B;  2M8H A;  3U7J A;  2VQF F;  3ZZ0 A;  2AKW B;  1OPZ A;  1TUW A;  2CJY B;  4CLY A;  4B9M A;  2JC0 A;  3IBW A;  4OYW A;  2VG6 A;  1LW2 B;  2CAD A;  2H4W B;  3TVY A;  3JAM Y;  3J7A 1;  1IR1 A;  4ZKA A;  3A3O B;  1YDL A;  4HI2 A;  1HR0 F;  3DOK A;  2AX1 A;  4CQ1 A;  1TMM A;  2V2K A;  2BYC A;  1IBL J;  1VC5 A;  1QAY A;  4HAC B;  2KXH A;  2K3K A;  2B56 A;  4XDD A;  2O01 C;  5DDP C;  1XER A;  2ZZM A;  3GYN A;  4F04 B;  5E3Q A;  1Z2Z A;  3TRG A;  1FKP B;  4DQR A;  3P45 B;  2XCA A;  4CO5 A;  1FEH A;  1UWA A;  3GJS B;  4QYR A;  3SBM A;  3RBZ A;  5J2N B;  4A8X A;  1M0S A;  5F9L A;  3V6H A;  4PRF A;  3K8V A;  2HQI A;  5KG0 A;  2QL5 B;  4O3P A;  1MNE A;  1X4D A;  4OYI A;  2KXF A;  2UUA J;  2CQ3 A;  1YSJ A;  3HZE A;  2W9B B;  2HHS A;  2LMI A;  2BW7 A;  1KLN A;  2RDD A;  2HZV A;  4M5G A;  3BGO P;  2CQ1 A;  4HVZ A;  3IWN C;  2ZC4 A;  4ED4 A;  5KFS A;  1MWQ A;  4JI0 F;  2NXN A;  1N8R T;  1VBY A;  2NCK L;  3GIR A;  4U96 A;  2JLE A;  3TJ8 A;  3BYR A;  3KK3 B;  2X1B A;  5KOX A;  4O4R A;  2XWY A;  2VBW A;  3C6U A;  3KLI B;  4O4G B;  1BC6 A;  2C2O B;  2HIQ A;  3AFG A;  2ASL A;  1HR0 J;  2PMW A;  3D6H B;  2K8G A;  3I4P A;  1TZ0 A;  2FPH X;  2IM1 A;  3VAL A;  4LFB J;  4DG1 B;  2D74 B;  2H1Y A;  1T95 A;  1CQN A;  2Y1R I;  3GFZ A;  3UWT A;  1I94 F;  2XEX A;  2G13 A;  1ZM2 A;  3BF4 A;  1MRO B;  1QE1 A;  3M30 B;  1PGZ A;  2BJ3 A;  1E6Y A;  4PCQ A;  1TK8 A;  2Q79 A;  3D68 A;  2EKY A;  1UEK A;  3P49 B;  1QY7 A;  3CGI A;  1TVR B;  3H4D A;  4KV8 B;  1S0M A;  1EAR A;  1IQT A;  2ILY A;  4TYA A;  4FXV A;  3NXZ A;  3WX8 A;  2DB1 A;  3UCZ P;  1IBC B;  2VC0 A;  1IVZ A;  2UU9 J;  4JP8 A;  4LFC J;  4WKR A;  2GC8 A;  4L75 A;  1F6T A;  1HD0 A;  3BKF A;  2KN4 A;  1QUV A;  2NXJ A;  4EK2 A;  3AQO A;  2RIL A;  3M8Z A;  5KT4 A;  1B7F A;  2IDL A;  3VCD A;  2QMX A;  1S7I A;  1V9O A;  2FHJ D;  3F44 A;  4YUD A;  2XCP A;  4TVA B;  4Y0F A;  1ZET A;  1EZZ B;  2GAH C;  2HND B;  2D1C A;  4FF2 A;  4OYM A;  2ATC B;  2J0Q D;  2CQ0 A;  2IC3 A;  3N28 A;  5MLC V;  3LF0 A;  1SCJ B;  4F0H A;  5H9F K;  2L08 A;  4L73 A;  3CJK B;  3OTD A;  3SMZ A;  1EET A;  1ZS6 A;  2H4Y B;  4NCA A;  3MTK A;  3TW0 A;  3PCO B;  4USM A;  1B0P A;  4ZVG A;  1VK3 A;  2R7U A;  3KLG A;  2J7W A;  3SQG B;  1HQE A;  4NLQ A;  1EP4 B;  5KG6 A;  2H65 B;  3V4M A;  2E5I A;  2V94 A;  1J5E J;  4CP5 A;  4FF4 A;  1FFG B;  2GS8 A;  5K9F A;  2QLF B;  4UOF A;  1UWB A;  3MGJ A;  1O6X A;  1H3D A;  4WXW A;  3RB3 A;  3QRP A;  2J8S A;  3CDB A;  1BQN B;  1FDA A;  4HR2 A;  1U0H B;  2PFF B;  2MQL A;  1SJ1 A;  1XMB A;  3ZO7 A;  1N6Q A;  2DRD A;  2J7K A;  4DR2 F;  1FDD A;  1X4G A;  4F4Z A;  2IJF A;  3SEO A;  4ES1 A;  2J9D E;  2M70 A;  3F56 A;  4YDX A;  3N79 A;  1PAU B;  1Q53 A;  2DGW A;  3N6L A;  4KGX B;  5KT3 A;  3N01 A;  2CPE A;  5BR8 F;  2AJ4 A;  5L1J A;  3QJL A;  4DR4 F;  3D0H E;  1HA1 A;  3EVO A;  3H98 A;  2VQF J;  1QVF R;  2VPX B;  5GMK a;  5HQL A;  2YQ1 A;  4OYA A;  3SCK E;  1M5K C;  3CJ2 A;  1Q82 T;  2WW4 A;  2DXF A;  5HLF B;  2HFS A;  2W24 A;  3QGG A;  4ZHR B;  2F9D A;  2Q3P A;  2IJN A;  3DGV A;  4HTI A;  2HBZ B;  4GKK J;  3EJM A;  4ZHR A;  3UR3 C;  2EG2 A;  6AT1 B;  2OTJ S;  2FTR A;  4I7F B;  3PX6 A;  1DRZ A;  1HNZ F;  1OMS A;  4QWD A;  3PX4 A;  2VA2 A;  3J81 j;  3TQ1 A;  3GIJ A;  2KT3 A;  2AGO A;  2VFU A;  3KK1 A;  2ZBC A;  2D41 A;  4KE5 A;  2ZH3 A;  4KV8 A;  5J2P A;  2K2P A;  4MKA A;  3OV7 A;  1S59 A;  3BQ2 A;  4WBF A;  1KQF B;  3L09 A;  5HQ8 A;  1SH2 A;  4B3T F;  4YB7 A;  1TFY A;  1DQ9 A;  3UN5 A;  2EG1 A;  5DQI A;  4QWA A;  1UPP A;  1GT8 A;  2XQC A;  1X5P A;  1S1X B;  3FEX B;  4PG7 A;  4O0I A;  3CNQ P;  4DU7 A;  2J9C A;  2ZH1 A;  4OX9 J;  2I2Y A;  3QSI A;  2FVQ A;  1KFD A;  5KFN A;  2DGV A;  1RAD B;  2BJ9 A;  1P8G A;  2IRU A;  4ETZ A;  4RBU A;  4ZVQ B;  5B0B A;  3PR5 B;  2G0I A;  3AHP A;  4M5M A;  1FDB A;  2PE8 A;  4WKY A;  4P9S A;  1HW9 A;  4YB1 P;  3RR8 A;  4EBE A;  4C8L A;  5IT9 U;  3FRY A;  1QTM A;  1V5I B;  2BKN A;  2LKZ A;  1CUL B;  2A3J A;  2HLT A;  3DRR B;  4HTJ A;  1BXN A;  1RHJ B;  3LAN A;  3NS6 A;  1RWN B;  5E5N A;  2EKN A;  3D66 A;  4GO7 X;  3VZI A;  3ADA C;  1NSK L;  2HHV A;  4OYX A;  2BM1 A;  2K1R B;  4KO0 B;  3MAA A;  4IR1 A;  2IYG A;  4ANC A;  1BHN A;  1FWP A;  3QJP A;  3DOM A;  1BWE A;  2DO4 A;  3T9N A;  3OBI A;  2OO4 A;  1S1V A;  1JX4 A;  2HHU A;  1DHM A;  2FUG 9;  3BSA A;  3NGK A;  1RAJ A;  3NGR A;  3JTN A;  1OQ3 A;  3D2W A;  1F3F A;  2BAN A;  2HFU A;  3EPG A;  2JX2 A;  4F02 A;  3G2X A;  1Y4Z B;  2J7U A;  4ICL B;  4NXM J;  4DV7 J;  2E5J A;  2Q6B A;  1VCT A;  4RBV A;  3PEJ A;  1H98 A;  1FTC A;  1HIY A;  2XM3 A;  4G1Q B;  3E51 A;  3OL7 A;  2APO A;  4DFK A;  3RYL A;  1N5S A;  4DOZ A;  4QYZ J;  4ZPW R;  1WC6 A;  1T9V A;  4WTY A;  5HMX A;  3HT3 A;  1A9N B;  3NOC A;  3L7P A;  2RAQ A;  1U48 A;  4HAC A;  2HQD A;  3H59 A;  3F0N A;  4W98 A;  2XNR A;  5L46 A;  1JLA A;  1R6V A;  3M32 B;  1M1K T;  4DV1 J;  2DR9 A;  2CNK B;  2FY8 A;  2XTJ P;  3HO1 A;  2YKO A;  2DNR A;  2DHS A;  2WVD A;  4FKY A;  3SQG A;  2GAG C;  3THT A;  4DDF A;  4ID5 A;  3PW7 A;  3KNA A;  3AD7 C;  1LFP A;  3FEZ A;  1U6B A;  4DSE A;  1RTH B;  4A47 A;  4CWB A;  1FA0 A;  2LA6 A;  3MTJ A;  4K7Q A;  4B3O B;  7FDR A;  1VQP S;  3OPK A;  1RBA A;  3A12 A;  3GFH A;  1U1Q A;  2JSX A;  4O23 A;  5F8I A;  3FSY A;  4C48 A;  3GYX B;  4DUT A;  4Q44 A;  3OHA A;  1RI7 A;  3EGV A;  2VBY A;  2EI5 A;  3IM9 A;  3M1V B;  4C8O A;  3DKD A;  5A6W A;  4O3S A;  1B7Y B;  5A2Q Y;  1PC5 A;  3HHL B;  1HNV B;  3KLE A;  1LKZ A;  3KMS A;  2X1A A;  4I2Q B;  1AA1 B;  4MIB A;  1JMT A;  2ROG A;  4NLV A;  1TV6 B;  4MKY A;  1OY8 A;  1XNQ J;  2GJF A;  1JLE A;  1RT5 B;  1YGY A;  1F2G A;  3KUG A;  4KSE B;  3PVX A;  5IC4 B;  4CT8 A;  4ECS A;  3FMW A;  3MEK A;  4LF9 F;  1RHU B;  1JLC A;  4R8U B;  2ZBI A;  3CJ5 A;  4CLK A;  3K5M A;  1S0V A;  4RLE A;  1X0P A;  2ZDP A;  3QRR A;  2XY5 A;  4DQS A;  2DEI A;  1VS3 A;  2EC0 A;  4Y34 A;  3GYG A;  2K1R A;  4KO0 A;  5IS2 A;  2DNZ A;  4TY8 B;  4KH0 B;  4U8Y A;  5DJB A;  3T1Y F;  1IXK A;  3BYP A;  1D9A A;  1GTH A;  3EDR B;  3MMJ A;  4BC9 A;  4HKQ A;  2AIR B;  1M5O C;  4AD6 A;  3D0G E;  2LEB A;  4WP9 A;  2R8I A;  2J6T A;  1RTZ A;  3FEY B;  3FSI A;  3MPV A;  3R7N B;  3CCV S;  4DF4 A;  3C16 B;  1R3N A;  4P74 A;  2QYC A;  1RTD B;  3TJA A;  3FBC A;  2PII A;  3U27 A;  3G6X A;  4LF8 J;  3TA0 A;  4CZC A;  2VG6 B;  4FYV B;  3BR9 A;  4B3M J;  1X5T A;  3J80 U;  4FPI A;  4TU9 A;  2HYI B;  4G1Q A;  1OJ4 A;  5D3G B;  1A6L A;  1ELO A;  3MMC B;  1PKU A;  5T7L B;  2VFV A;  4WU3 A;  2RUG A;  3IAM 9;  2DY1 A;  5C25 B;  1ZZF A;  3FUY A;  3NCR A;  4OLO A;  5HQM A;  1MMN A;  3OR1 A;  3KJV A;  4B9V A;  3K89 A;  2JEJ A;  3HXM A;  3SCJ E;  2H9Z A;  4OZ5 A;  1TAQ A;  5HJX A;  3T1A A;  5DGB A;  5ETT A;  4F0M A;  2FC9 A;  3JB9 k;  4N77 A;  1RT4 A;  3EXC X;  1GQE A;  3MAA B;  2AYE A;  3NWG A;  5LSO A;  1ZM9 A;  2B6A B;  1NXI A;  1CQM A;  4FF3 A;  3FDS A;  1LEO A;  3OVA A;  1IKX A;  4EWT A;  3HLU A;  2MY7 A;  1KN6 A;  4H4M B;  2P2C B;  3M8Y A;  3MF5 A;  1S12 A;  1R8C A;  4QIE A;  3KDN A;  3CDE A;  3UD5 A;  3O3L A;  3T5K A;  4JI2 J;  3DNC A;  4IRK A;  3UO0 A;  4OI6 A;  2M9K A;  1UJ5 A;  2QYG A;  9ATC B;  5FD1 A;  2HWT A;  4IRD A;  4QR0 A;  4I67 A;  1PBA A;  1X7V A;  2AJ2 A;  1B99 A;  3GTY X;  2AF6 A;  1PJ7 A;  2VFT A;  1N4L A;  5IM0 A;  4EBD A;  1N34 J;  2X51 A;  1KD1 T;  2OTL S;  1AUS L;  5F8H A;  4GVB B;  2BKO A;  3DDI A;  3NGU A;  3IS9 A;  3GIK A;  1F9F A;  2KL8 A;  3GPA A;  3TEG A;  1OQ6 A;  3CD7 A;  2D3U A;  2VU5 A;  3OXG A;  2HFO A;  4Z7Y A;  5C2G A;  4UF4 A;  4UZB A;  2C3Y A;  2J5A A;  2BJD A;  3C19 A;  1S72 S;  1M1H A;  4CLU A;  2Z2M A;  4PAA A;  3O2I A;  2E9Z A;  2YWE A;  1DBD A;  4IQM A;  4K4Y A;  3QNW B;  2G4B A;  1YJT A;  2W2M P;  3H2V E;  5H9E K;  2ZNZ A;  1IBK F;  1RWW B;  2ACY A;  2MHN A;  4EYH B;  2BE2 A;  1BMQ B;  1YZ6 A;  2KYX A;  1DQA A;  2W2N P;  2QLX A;  4QJV A;  5KFZ A;  4EBC A;  2BQU A;  4BDP A;  5G0R A;  1KS2 A;  3JSY A;  3CC2 S;  3IGN A;  3DRP B;  2EXU A;  2QGF B;  3VZH A;  4CLS A;  5KFO A;  3EYZ A;  4O3N A;  4ZLP A;  4AL7 A;  4PWD A;  3NAI A;  3TAP A;  1NDP A;  1AZS B;  1UVM A;  2FVC A;  3PKM A;  4DL4 A;  1RT2 A;  2MJN A;  3QWU A;  1RAF B;  4RJV A;  5HO4 A;  2FJE B;  3M9O B;  2V8G A;  4DR5 J;  2R8H A;  2K7J A;  4K0K F;  1OSC A;  4B3S F;  3JXO A;  4JI7 J;  1UA1 A;  4PWW A;  1N5Y B;  4TYB A;  1Y0H A;  1FE4 A;  2C2Z B;  2V8H A;  2V67 A;  2CQG A;  2Y3Y A;  3FBB A;  3H5Y A;  2OPP A;  4DX5 A;  4Q0B A;  2EVZ A;  2OD4 A;  3VV2 B;  4TY9 A;  3PW5 A;  3B6B A;  1J5O A;  1N34 F;  1EP4 A;  1WHX A;  2RKI A;  3QLH A;  4K5R A;  1QAX A;  2E9T A;  3VTI A;  2ZVI A;  5EWG A;  3WC2 A;  1RA6 A;  2E1R A;  1T03 A;  4OX6 A;  2YY3 A;  2FHK A;  3HVR A;  4NXN F;  4M5I A;  1SJQ A;  4DV4 J;  2U2F A;  1T3O A;  3PO4 A;  1F1B B;  1RAE B;  2MSS A;  4MYU A;  4F4A A;  2GO9 A;  2V5H G;  1Q79 A;  4RNN A;  1RXO B;  4UOG A;  3RRG A;  2V4Q A;  4RUH A;  2ZEJ A;  1E6V A;  1S1U A;  1IQZ A;  4RL1 A;  5KG2 A;  1AYE A;  2G2Z A;  2ZOM A;  2J9D A;  4BCA A;  2DNQ A;  1AFJ A;  2ALY B;  2B9E A;  4LJM A;  4H4O B;  2D3O R;  3LAL A;  4FYX B;  4IG0 B;  2CFX A;  3HJF A;  1FT8 A;  2XG8 A;  2V6A A;  3VWS A;  4AFF A;  3R5J B;  4DCP B;  3BN4 A;  5FDL B;  4Q45 A;  4PWD B;  4N8O A;  2DYA A;  1X5S A;  2PSZ A;  2GZO A;  3B54 A;  4NAS A;  5ETR A;  1X9W A;  2CA9 A;  2VOD A;  2UXD J;  2AEF A;  3ICL A;  4Y2A A;  5DG8 A;  1D1U A;  1PSD A;  2UVU A;  1JLB A;  2LEP A;  3G87 A;  2AYB A;  2HW3 A;  3DLB A;  4Z37 A;  1YX2 A;  3CT9 A;  4CLP A;  4YDD B;  5EGY A;  4DL2 A;  4X65 J;  1YLX A;  3PY8 A;  2B7C B;  4J9U E;  2HPU A;  2XC9 A;  5GAG U;  1F9H A;  1C1B A;  5KG3 A;  1HPZ B;  1LXN A;  2O66 A;  4NLP A;  5KFF A;  3CCL S;  2MZJ A;  2FLO A;  4USJ C;  5KFK A;  1VK8 A;  4WK1 A;  4NLO A;  3HFZ B;  1NSP A;  3T19 A;  3CJQ A;  3LP0 A;  1IR2 A;  4CH1 A;  4DSJ A;  2NQP A;  5L1L A;  5HAN A;  5KFX A;  4ELU A;  4WFZ A;  3O5T B;  4LF5 J;  5C24 A;  3PYF A;  3PM9 A;  2Y9H A;  2C3P A;  5B0G A;  3JS9 A;  4Q2L A;  4M5H A;  2NYH A;  5GAD I;  1ZA2 B;  2B5J B;  2B51 A;  3LAM A;  3EE3 A;  4YOE A;  4IOB A;  4ED8 A;  2DNM A;  4PZV A;  2GX8 A;  3G8T A;  2Y8W A;  2GHV C;  3DRX A;  4RNO A;  1TKX A;  4FNH A;  1D9D A;  4O4G A;  1ITP A;  1NK7 A;  2HQ3 A;  1DUR A;  1NSQ A;  3MEC A;  1MMD A;  2P9G A;  1AT1 B;  4MIW A;  5K5M A;  3J7Y I;  1F5C A;  4UUX A;  5K14 A;  3D28 A;  1N54 B;  4FKX A;  2DNK A;  4QPT A;  2W9A A;  2X1G A;  4HI1 A;  4RX6 A;  1C2P A;  1V5V A;  1H38 A;  3EZU A;  3G82 B;  2PEB A;  4WIQ A;  2VG5 B;  4FBT A;  4EI2 A;  5G4D A;  4URG A;  2CPJ A;  5LMU J;  4DUY F;  4I64 A;  3QO9 A;  1HQU B;  3W5X A;  4DEZ A;  1F5B A;  3P4U B;  3F73 A;  1S6Q B;  2VAS A;  3A1Y G;  4MT1 A;  3PIP Q;  2F4V F;  3J7Z 5;  3PFE A;  3IRW P;  3IAS 9;  3UCG A;  3R5D A;  3BKT A;  5HMZ A;  4X4T A;  4LF5 F;  4QIW D;  2HRY A;  3FZ2 A;  2E5H A;  3HFV A;  1FXD A;  4DR1 J;  5C42 A;  3ITH A;  5GMD A;  1TK0 A;  1P1T A;  3HHL C;  1CEZ A;  1TL5 A;  2D9O A;  4KPY A;  4IFV A;  3EVM A;  2MHE A;  3BO2 A;  3ULH A;  4P72 A;  1NU4 A;  4CDI A;  4ZVT B;  1CSJ A;  1ZAW A;  2W2P P;  3CSK A;  3D54 A;  1IBM F;  5AXK A;  1Q5V A;  1T3N A;  4MK7 A;  1IKY B;  4NLU A;  1P6T A;  2KVI A;  3HD2 A;  2GFF A;  3DLG B;  5E7O B;  4EYI B;  4KJI A;  2GCF A;  1EQM A;  5ETM A;  2NS1 B;  2CQP A;  3KK2 A;  1WTB A;  1SJF A;  1QUP A;  3R2D J;  4DQP A;  2W1B A;  3MM9 A;  1LXJ A;  1M5H A;  3TO8 A;  4RUB A;  2UXD F;  3JYT A;  2R42 A;  4DV7 F;  4U67 Q;  1ZA1 B;  4P2X A;  5F8J A;  4DL6 A;  2DNN A;  2KHD A;  2CG8 A;  4DPO A;  4DN0 A;  1H2V Z;  3GSI A;  3WIU A;  1YRU A;  1BWV A;  3ZZR A;  4ALZ A;  5B0D A;  3W2W B;  2DRA A;  1FER A;  4NXN J;  3PHE A;  5HJY A;  3C3L A;  3EGW B;  4YB5 A;  4UQT A;  3GII A;  1S0O A;  2GQ2 A;  4NLS A;  1BUX A;  3HSZ A;  4ZPD A;  2HEK A;  3ONQ A;  4C8N A;  3I5A A;  3MWB A;  3TYT A;  4IUF A;  1A0O B;  5CD4 A;  2CPX A;  4NLY A;  2HS4 A;  3ENQ A;  1YWX A;  3AAW B;  4L76 A;  4RPF A;  2XMK A;  2CJX B;  2UU9 F;  2K06 A;  3NNA A;  3KWM A;  2P6T A;  4MK8 A;  3T9Z A;  4J90 A;  5CZX A;  2VBZ A;  3GMG A;  3RAQ A;  3TR5 A;  1JLB B;  4DR5 F;  1HD1 A;  1SC1 B;  3V6K A;  2QN6 B;  1LWC A;  2QFI A;  2OGU A;  2RHS B;  1NPP A;  1UJ4 A;  1WEY A;  4OX9 F;  5KFP A;  4P2S A;  3I55 S;  3HD1 A;  5DLF A;  5DG7 A;  1QM9 A;  2E29 A;  1SPB P;  1UTA A;  1UZH A;  4OJG A;  3O6Q A;  4C0O C;  5L38 A;  3W5Y A;  2DVI A;  2HBR B;  5ETN A;  3RB4 A;  3MM6 A;  3BBB A;  1TQL A;  4QW9 A;  2FLL A;  4LBI A;  3KMQ A;  4RW6 A;  1MLA A;  2HKE A;  3CJS A;  3DHW C;  4OJ1 A;  5J1E B;  1JB0 C;  5KAK A;  5DLG A;  3CCE S;  2RS2 A;  1D8Z A;  1SXL A;  2YWK A;  2ZC3 A;  4C6A A;  2MLY A;  4YY3 J;  4FS1 A;  5CHC B;  4YQW A;  3B82 A;  2J76 E;  2U1A A;  2JLG A;  2NUU G;  4QU7 A;  4JOU A;  4JI5 F;  4IFV B;  2HSE B;  4OJH A;  4RKU C;  4EGL A;  1KTV A;  3KJF B;  5H9E J;  1EET B;  2M3D A;  3G8S A;  3IO1 A;  1MWY A;  3J81 U;  1X4B A;  1UVJ A;  1LOU A;  1DY3 A;  3BS9 A;  3SDE B;  4PG5 A;  1F0X A;  4WP3 A;  3I6P A;  5HBM A;  5KFB A;  3LP1 B;  2V8P A;  1RTI B;  4G1I A;  5LMN F;  3DOM B;  3LGH A;  2KXN B;  2VG5 A;  3RAX A;  2VBX A;  3NMR A;  1CJK B;  4JBC A;  1CS4 A;  1VJW A;  1X4H A;  4ZPA A;  3CF5 Q;  1K44 A;  2OI2 A;  2HGM A;  4H4K A;  3AH6 A;  4P71 A;  2MMY A;  5LL6 d;  1CBK A;  3WQP A;  1N32 J;  2Z0G A;  1UL3 A;  4J37 A;  1BQN A;  3R7S B;  3G86 A;  4R0J A;  2Z8Q A;  3J80 Y;  5K8O A;  1B4S A;  4LF2 A;  1WHW A;  2HBY B;  2N82 B;  4WFB Q;  4TQR A;  3E01 B;  3ISN C;  1S48 A;  2RJZ A;  5J2N A;  1YJW S;  3RUB L;  5KFA A;  1FKA F;  4DPX A;  1T7P A;  3DOL A;  3K5P A;  4WWS A;  5A8W B;  4C0H A;  1FNO A;  1P27 B;  2XWX A;  3MM6 B;  1WD6 A;  3PR4 A;  1RWU A;  3KLF B;  3JSM A;  1K8A T;  3QZ7 A;  5EX0 A;  1NM2 A;  2RT3 A;  1FRK A;  4FYY B;  3MUV P;  3HKW A;  4CH7 A;  3K2Y A;  2VG7 B;  5EDW A;  3G6V A;  4OX7 A;  2YNH A;  3MM8 A;  5LXY A;  1SIW B;  3I5B A;  3CXC R;  3C16 A;  4X66 F;  2XMA A;  4WTO B;  3CCQ S;  3CCM S;  1WOO A;  2Q1L A;  4CH0 S;  3HPO A;  1FCA A;  2UUB F;  1FJG J;  2G0J A;  2IAJ B;  2OML A;  2HZC A;  4ZCI A;  4DPU A;  1C1B B;  4W90 B;  3MEE B;  3M05 A;  4J7C A;  1QSY A;  4ETX A;  2YNI B;  2YBV A;  3M2U A;  3MM7 B;  4JI4 F;  1PJ5 A;  3W2V A;  3MFI A;  2C2N A;  1SC4 B;  1WC0 A;  2FGC A;  2OEK A;  4NCG B;  1WSV A;  4D3H A;  5L9N A;  2KZZ A;  1WDT A;  1YRT A;  5IQ6 A;  3V4I B;  3DMJ A;  2LA4 A;  3DYA B;  2VIH A;  4LF8 F;  3RRK A;  1HYS A;  3W60 A;  2YX7 A;  2XLK A;  3CCR S;  3PRD A;  1CVJ A;  4DPW A;  1LWX A;  1Y11 A;  1NBE B;  2BJ8 A;  2ZH5 A;  3BSO A;  3MM5 A;  2A10 A;  3QGP A;  4BBY A;  2HIY A;  4CO0 A;  2NZ4 A;  2WSF C;  2BJE A;  4B9T A;  2CPZ A;  3OTO F;  2WSE C;  1T9W A;  4LRD A;  2ZH8 A;  1R27 B;  1XNQ F;  4P7T A;  3NY0 A;  4B17 A;  3GG1 A;  5KG1 A;  2WRM A;  1HKA A;  4CLW A;  4IH5 A;  3TAQ A;  4FYD A;  4ED5 A;  1FVQ A;  4RW8 A;  3BZQ A;  1U09 A;  4ED7 A;  4OL8 A;  2Z58 B;  3LPE A;  1BQX A;  4ILL A;  1VHF A;  5HAT A;  3TZZ A;  2ERR A;  1D8Y A;  1NLK L;  2OHD A;  4HT5 A;  2WBR A;  2I5J B;  3QPI A;  2IVM A;  4EFA C;  1S76 D;  1FTR A;  1UET A;  1Y9O A;  2EFP A;  4UY8 T;  1WI8 A;  3QT8 A;  4NLD A;  3UE2 A;  5KFW A;  1QLN A;  2DGU A;  2UXC F;  4F50 A;  4NA1 A;  2PD1 A;  4ZIW A;  3M9M B;  2ROE A;  4P52 A;  3VVU A;  3FQL A;  4HYK A;  4LF6 J;  5EN1 A;  2ZJQ Q;  1IBM J;  4AQY F;  3D6M B;  4ECQ A;  2AU0 A;  5IFM A;  4A8M P;  1HBU B;  1O51 A;  4QIV A;  4KKO A;  2QFJ A;  4DSK A;  1I5O B;  1R43 A;  3AT1 B;  3A8I A;  1VRU A;  1S49 A;  2C3O A;  2GW8 A;  5E3R A;  3Q24 A;  2HVE A;  1FRH A;  5HI7 A;  3SIP B;  3ZNU A;  3K58 A;  2BRK A;  4X4O A;  2V8V A;  1IKW B;  4B3O A;  3BGL A;  4M5D A;  1KVJ A;  2BA9 A;  2ADB A;  2D7S A;  2CKW A;  1TK5 A;  1NEE A;  2OFH X;  2IDE A;  1HI1 A;  3SI8 A;  4LRB A;  4ZPT R;  6FDR A;  4V19 X;  3PEH A;  2YKN A;  4OV6 A;  1LK5 A;  4URQ U;  5BYR A;  3WHI A;  3D7S B;  3PW2 A;  1TKT B;  4DHV A;  2JVR A;  2E7V A;  2CPH A;  3D1H A;  4PXB A;  5A8R B;  1S6P A;  3FMB A;  4M5J A;  2VG7 A;  1T03 B;  2GVD B;  1LQ9 A;  2AMC B;  4I2P B;  4Q2M A;  2AT1 B;  1NK9 A;  2OSR A;  1NK6 A;  4DR7 F;  4O3Q A;  3ITH B;  5DDR C;  1LV5 A;  2DR5 A;  3KDO A;  3KJN B;  5C5J A;  4R0E A;  1HW8 A;  3BR8 A;  3GSD A;  4ICL A;  4ZVU B;  5BXI A;  3VAI A;  5FJ4 A;  4LQ3 A;  3LP2 B;  1CJT A;  1SJ4 P;  1PIL A;  3QIP B;  5IT0 A;  1R8A A;  5J2Q A;  2KT2 A;  2EK6 A;  3DC2 A;  5ETV A;  2Z2Z A;  4NZ0 A;  2FVP A;  2R2S A;  4P2M A;  4ZJQ A;  2LQ8 A;  5KFJ A;  4Q5V A;  4B3S J;  2LVW A;  3M2R A;  4Y2K A;  5E3A A;  4JB8 B;  1OWX A;  3H4B A;  1U1K A;  2CJA A;  4JI4 J;  2BE7 D;  1VDH A;  3PW4 A;  4JV5 J;  2VFS A;  2VPY B;  4IG3 A;  2RVJ A;  3OD2 A;  4RNM A;  3M2V B;  3IA0 A;  2HZA A;  3DYA A;  1W25 A;  3PAC A;  1JQG A;  1HYS B;  2YPY A;  3HK2 A;  1EAY C;  3BO3 A;  2NZC A;  4C8Z A;  2YTC A;  3TA1 A;  2DIS A;  4B3T J;  1W7W A;  2DXE A;  3D67 A;  1IJF B;  4QCL A;  3CVK A;  4ZS6 A;  1WOR A;  2BV3 A;  2COL A;  5ETS A;  4ER8 A;  5I3U A;  2QA2 A;  2UV8 A;  4M5L A;  3P6Y C;  2BVZ A;  3UD3 P;  2NUH A;  5F9N A;  1P9Q C;  2DGS A;  5BR8 J;  2HHQ A;  3SV3 A;  3S7R A;  2Y8Y A;  1OPI A;  3IC1 A;  1UW4 A;  3PG9 A;  3RZA A;  1XBW A;  2JNJ A;  3UDL A;  1RBO B;  1QSS A;  2HMI A;  3QRQ A;  1KQS R;  1JJH A;  1IM4 A;  2QE5 A;  4TNO A;  1YHQ S;  1SUQ B;  3HHN B;  1GH8 A;  2EFO A;  1WG1 A;  1A7G E;  3OR2 A;  3MR2 A;  1R0C B;  4N7T A;  3LWL A;  1SV5 B;  4C3K A;  2F63 A;  4RUC A;  2M8D B;  3MEG A;  1CC8 A;  4Y3C A;  4IOA Q;  4K8R A;  1G6B A;  2IYI A;  2WON B;  1VLO A;  1Q7L B;  2VIC A;  1KR4 A;  3DRY A;  4NMX A;  4WE1 B;  4IH7 A;  1T05 A;  1WKJ A;  3SYZ A;  2AJ0 A;  1FD2 A;  2CRL A;  5ITH A;  3EPI A;  3M8W A;  2GVZ B;  3N4W A;  4ZPC A;  2JC1 A;  1N5Q A;  2YNG B;  3BKU A;  2W9C B;  4BS2 A;  2BKP A;  4K4U A;  4OYP A;  4LF6 F; 
#chains in the Genus database with same CATH homology
 3GP9 A;  2DYA A;  3ZTS A;  3B54 A;  5C7P A;  1S5Z A;  3ZTO A;  1S59 A;  1PKU A;  4WBF A;  3FC9 A;  2B8Q A;  1NB2 A;  3BBB A;  4UOH A;  1WKL A;  5CAA A;  3VVU A;  3NGT A;  1EHW A;  4C6A A;  2AZ1 A;  2HUR A;  3BBF A;  1NDC A;  3Q83 A;  3MPD A;  3FBF A;  1NSP A;  1BE4 A;  2HVE A;  1PAE X;  1LEO A;  1NPK A;  3JS9 A;  2HVD A;  1NSK L;  1WKK A;  2NCK L;  1KDN A;  2ZUA A;  3EE3 A;  4DZ6 A;  4ANC A;  1XQI A;  1BHN A;  2AZ3 A;  1VYA A;  1B99 A;  2DY9 A;  1NSQ A;  3NGR A;  4F36 A;  1K44 A;  1F3F A;  4ANE A;  3EM1 A;  3G2X A;  3VGS A;  3Q8U A;  3Q8Y A;  3DDI A;  3EVW A;  4FKX A;  2BX6 A;  1B4S A;  3ELH A;  3NGU A;  3NGS A;  3VGT A;  4ENO A;  3GPA A;  4KPC A;  1HIY A;  4S0M A;  2VU5 A;  3BBC A;  3WX8 A;  1XIQ A;  5BXI A;  1NDL A;  1HHQ A;  1F6T A;  2CWK A;  3ETM A;  4EK2 A;  4W98 A;  2B8P A;  1UCN A;  3ENA A;  1NUE A;  1NCL A;  4FKY A;  3VVT A;  3EVM A;  1U8W A;  2BEF A;  3Q8V A;  1ZS6 A;  4DI6 A;  3FKB A;  1NDP A;  3PJ9 A;  1MN9 A;  4DUT A;  3Q89 A;  3Q86 A;  3ZTP A;  1W7W A;  2DXE A;  3DKD A;  3VGV A;  3EMT A;  3ZTR A;  4O0N A;  4CP5 A;  3BH6 B;  3FBB A;  4UOF A;  4AND A;  5IOL A;  3FCV A;  3R9L A;  1MN7 A;  4HR2 A;  3B6B A;  5CAB A;  3VGU A;  1LWX A;  1HLW A;  3EIC A;  1JXV A;  1BUX A;  3L7U A;  4F4A A;  3BH7 B;  3EVO A;  1S57 A;  4UOG A;  1NDK A;  3ZTQ A;  3FCW A;  3FBE A;  1NHK L;  2DXF A;  2DXD A;  1WKJ A;  1NLK L;  3EJM A;  3PRV A;  3FBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...